F487684
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 229 | 1986 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10145490|Ga0157369_101454902 |
| Length | 154 |
| Sequence | LAASLNEVLPPQAIGFFVDQSSSMTNRRSRRSPVLLAAALELAGRTVPVKLRNLSEEGALVEGDDLPVEGSTTYFHRNELRLEGKVIWVQGRYAGVAFKERLAPEQVLRNVPKPKLRTATEFKRPGFACRPLTDYERRMVEQWMDLPPVASPRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 184 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 189 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 190 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 191 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 192 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 1.91 |
| Rhizosphere | 97.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10145490 | 3300013105 | Bacteria | 2506 |
| 2 | JGI24741J21665_1000867 | 3300001915 | Bacteria | 9119 |
| 3 | JGI24740J21852_10002444 | 3300001979 | Bacteria | 8426 |
| 4 | JGI24740J21852_10015262 | 3300001979 | Bacteria | 2809 |
| 5 | JGI24740J21852_10089584 | 3300001979 | Unclassified | 795 |
| 6 | JGI24740J21852_10107735 | 3300001979 | Unclassified | 705 |
| 7 | JGI24740J21852_10114888 | 3300001979 | Unclassified | 677 |
| 8 | JGI24739J22299_10003964 | 3300001989 | Bacteria | 5663 |
| 9 | JGI24739J22299_10009318 | 3300001989 | Bacteria | 3662 |
| 10 | JGI24737J22298_10002168 | 3300001990 | Bacteria | 6998 |
| 11 | JGI24737J22298_10005610 | 3300001990 | Bacteria | 4324 |
| 12 | JGI24737J22298_10074335 | 3300001990 | Bacteria | 1013 |
| 13 | JGI24743J22301_10061826 | 3300001991 | Bacteria | 772 |
| 14 | JGI24735J21928_10000970 | 3300002067 | Bacteria | 10261 |
| 15 | JGI24735J21928_10001752 | 3300002067 | Bacteria | 7650 |
| 16 | JGI24735J21928_10020585 | 3300002067 | Bacteria | 2019 |
| 17 | JGI24735J21928_10077951 | 3300002067 | Bacteria | 949 |
| 18 | JGI24735J21928_10133519 | 3300002067 | Bacteria | 716 |
| 19 | JGI24735J21928_10142113 | 3300002067 | Unclassified | 692 |
| 20 | JGI25406J46586_10260734 | 3300003203 | Unclassified | 510 |
| 21 | Ga0065715_10211467 | 3300005293 | Unclassified | 1312 |
| 22 | Ga0065715_10465005 | 3300005293 | Bacteria | 805 |
| 23 | Ga0070658_10016564 | 3300005327 | Bacteria | 5899 |
| 24 | Ga0070658_10018275 | 3300005327 | Bacteria | 5611 |
| 25 | Ga0070658_10089282 | 3300005327 | Bacteria | 2538 |
| 26 | Ga0070658_10190935 | 3300005327 | Bacteria | 1726 |
| 27 | Ga0070658_10445404 | 3300005327 | Bacteria | 1115 |
| 28 | Ga0070658_10758480 | 3300005327 | Bacteria | 843 |
| 29 | Ga0070658_10995793 | 3300005327 | Bacteria | 729 |
| 30 | Ga0070676_10009673 | 3300005328 | Bacteria | 5213 |
| 31 | Ga0070676_10184729 | 3300005328 | Bacteria | 1358 |
| 32 | Ga0070676_10349086 | 3300005328 | Bacteria | 1017 |
| 33 | Ga0070676_10497349 | 3300005328 | Unclassified | 865 |
| 34 | Ga0070676_10783907 | 3300005328 | Unclassified | 702 |
| 35 | Ga0070683_100001584 | 3300005329 | Bacteria | 17600 |
| 36 | Ga0070683_100006972 | 3300005329 | Bacteria | 9504 |
| 37 | Ga0070683_100012444 | 3300005329 | Bacteria | 7395 |
| 38 | Ga0070683_100046392 | 3300005329 | Bacteria | 4014 |
| 39 | Ga0070683_100142351 | 3300005329 | Bacteria | 2272 |
| 40 | Ga0070683_100517580 | 3300005329 | Bacteria | 1140 |
| 41 | Ga0070690_100806541 | 3300005330 | Bacteria | 728 |
| 42 | Ga0070690_101461423 | 3300005330 | Unclassified | 551 |
| 43 | Ga0070670_100022358 | 3300005331 | Bacteria | 5443 |
| 44 | Ga0070670_100032462 | 3300005331 | Bacteria | 4497 |
| 45 | Ga0070670_100042083 | 3300005331 | Bacteria | 3926 |
| 46 | Ga0070670_100128865 | 3300005331 | Bacteria | 2184 |
| 47 | Ga0070670_100253068 | 3300005331 | Bacteria | 1535 |
| 48 | Ga0070677_10017821 | 3300005333 | Unclassified | 2548 |
| 49 | Ga0070677_10039196 | 3300005333 | Bacteria | 1858 |
| 50 | Ga0070677_10195632 | 3300005333 | Bacteria | 972 |
| 51 | Ga0070677_10282147 | 3300005333 | Bacteria | 837 |
| 52 | Ga0068869_100007144 | 3300005334 | Bacteria | 7117 |
| 53 | Ga0068869_100569989 | 3300005334 | Bacteria | 953 |
| 54 | Ga0070666_10018749 | 3300005335 | Bacteria | 4455 |
| 55 | Ga0070666_10055794 | 3300005335 | Bacteria | 2667 |
| 56 | Ga0070666_10074253 | 3300005335 | Bacteria | 2317 |
| 57 | Ga0070666_10117152 | 3300005335 | Bacteria | 1845 |
| 58 | Ga0070666_10157780 | 3300005335 | Unclassified | 1585 |
| 59 | Ga0070666_10394078 | 3300005335 | Bacteria | 995 |
| 60 | Ga0070680_100002188 | 3300005336 | Bacteria | 14408 |
| 61 | Ga0070680_100011586 | 3300005336 | Bacteria | 6829 |
| 62 | Ga0070680_100048410 | 3300005336 | Bacteria | 3464 |
| 63 | Ga0070680_100277387 | 3300005336 | Bacteria | 1420 |
| 64 | Ga0070680_100280585 | 3300005336 | Bacteria | 1411 |
| 65 | Ga0070680_100299822 | 3300005336 | Bacteria | 1363 |
| 66 | Ga0070682_100003586 | 3300005337 | Bacteria | 8594 |
| 67 | Ga0070682_100038426 | 3300005337 | Bacteria | 2936 |
| 68 | Ga0070682_100085170 | 3300005337 | Bacteria | 2056 |
| 69 | Ga0070682_100202095 | 3300005337 | Bacteria | 1402 |
| 70 | Ga0070682_100839227 | 3300005337 | Unclassified | 750 |
| 71 | Ga0068868_100016525 | 3300005338 | Bacteria | 5483 |
| 72 | Ga0068868_100089857 | 3300005338 | Bacteria | 2473 |
| 73 | Ga0068868_100714200 | 3300005338 | Unclassified | 898 |
| 74 | Ga0070660_100003337 | 3300005339 | Bacteria | 11034 |
| 75 | Ga0070660_100030266 | 3300005339 | Bacteria | 4061 |
| 76 | Ga0070660_100038928 | 3300005339 | Bacteria | 3612 |
| 77 | Ga0070660_100092565 | 3300005339 | Bacteria | 2386 |
| 78 | Ga0070660_100132154 | 3300005339 | Bacteria | 1998 |
| 79 | Ga0070660_100135947 | 3300005339 | Bacteria | 1969 |
| 80 | Ga0070660_100152144 | 3300005339 | Unclassified | 1861 |
| 81 | Ga0070660_100156277 | 3300005339 | Bacteria | 1836 |
| 82 | Ga0070660_100226822 | 3300005339 | Bacteria | 1519 |
| 83 | Ga0070660_100246347 | 3300005339 | Bacteria | 1456 |
| 84 | Ga0070660_100259918 | 3300005339 | Bacteria | 1417 |
| 85 | Ga0070660_100305876 | 3300005339 | Bacteria | 1304 |
| 86 | Ga0070660_101876991 | 3300005339 | Unclassified | 511 |
| 87 | Ga0070689_100789512 | 3300005340 | Unclassified | 834 |
| 88 | Ga0070691_10032882 | 3300005341 | Bacteria | 2438 |
| 89 | Ga0070691_10074238 | 3300005341 | Bacteria | 1654 |
| 90 | Ga0070661_100004629 | 3300005344 | Bacteria | 9467 |
| 91 | Ga0070661_100016515 | 3300005344 | Bacteria | 5221 |
| 92 | Ga0070661_100026111 | 3300005344 | Unclassified | 4198 |
| 93 | Ga0070661_100030374 | 3300005344 | Bacteria | 3903 |
| 94 | Ga0070661_100031892 | 3300005344 | Bacteria | 3812 |
| 95 | Ga0070661_100082414 | 3300005344 | Unclassified | 2375 |
| 96 | Ga0070661_100107514 | 3300005344 | Unclassified | 2080 |
| 97 | Ga0070661_100113918 | 3300005344 | Bacteria | 2021 |
| 98 | Ga0070661_100194702 | 3300005344 | Unclassified | 1547 |
| 99 | Ga0070661_100384113 | 3300005344 | Bacteria | 1107 |
| 100 | Ga0070661_100422604 | 3300005344 | Bacteria | 1057 |
| 101 | Ga0070661_100477474 | 3300005344 | Bacteria | 995 |
| 102 | Ga0070692_10000457 | 3300005345 | Bacteria | 12459 |
| 103 | Ga0070692_10040506 | 3300005345 | Unclassified | 2383 |
| 104 | Ga0070692_10216645 | 3300005345 | Bacteria | 1129 |
| 105 | Ga0070692_10414175 | 3300005345 | Unclassified | 854 |
| 106 | Ga0070668_100003267 | 3300005347 | Bacteria | 11949 |
| 107 | Ga0070668_100009416 | 3300005347 | Bacteria | 7246 |
| 108 | Ga0070668_100051859 | 3300005347 | Bacteria | 3162 |
| 109 | Ga0070668_100409734 | 3300005347 | Bacteria | 1159 |
| 110 | Ga0070668_100477038 | 3300005347 | Unclassified | 1077 |
| 111 | Ga0070668_100815403 | 3300005347 | Bacteria | 830 |
| 112 | Ga0070668_101135636 | 3300005347 | Unclassified | 706 |
| 113 | Ga0070669_100020434 | 3300005353 | Bacteria | 4729 |
| 114 | Ga0070669_100032975 | 3300005353 | Bacteria | 3743 |
| 115 | Ga0070669_101309023 | 3300005353 | Unclassified | 627 |
| 116 | Ga0070675_100056143 | 3300005354 | Bacteria | 3244 |
| 117 | Ga0070675_100155099 | 3300005354 | Bacteria | 1966 |
| 118 | Ga0070675_100197553 | 3300005354 | Unclassified | 1745 |
| 119 | Ga0070675_100256298 | 3300005354 | Bacteria | 1532 |
| 120 | Ga0070671_100023728 | 3300005355 | Bacteria | 5020 |
| 121 | Ga0070671_100580857 | 3300005355 | Unclassified | 968 |
| 122 | Ga0070671_100607023 | 3300005355 | Unclassified | 946 |
| 123 | Ga0070671_101187810 | 3300005355 | Bacteria | 671 |
| 124 | Ga0070674_100183757 | 3300005356 | Bacteria | 1603 |
| 125 | Ga0070674_100277940 | 3300005356 | Bacteria | 1326 |
| 126 | Ga0070674_100344924 | 3300005356 | Bacteria | 1201 |
| 127 | Ga0070673_100002262 | 3300005364 | Bacteria | 11674 |
| 128 | Ga0070673_100003681 | 3300005364 | Bacteria | 9603 |
| 129 | Ga0070673_100012846 | 3300005364 | Bacteria | 5765 |
| 130 | Ga0070673_100026793 | 3300005364 | Unclassified | 4262 |
| 131 | Ga0070673_100262978 | 3300005364 | Bacteria | 1508 |
| 132 | Ga0070673_100325003 | 3300005364 | Bacteria | 1360 |
| 133 | Ga0070673_100451108 | 3300005364 | Bacteria | 1157 |
| 134 | Ga0070673_100537300 | 3300005364 | Unclassified | 1061 |
| 135 | Ga0070673_100776599 | 3300005364 | Unclassified | 883 |
| 136 | Ga0070673_101156145 | 3300005364 | Bacteria | 724 |
| 137 | Ga0070673_101240329 | 3300005364 | Bacteria | 699 |
| 138 | Ga0070659_100000952 | 3300005366 | Bacteria | 21291 |
| 139 | Ga0070659_100013633 | 3300005366 | Bacteria | 6055 |
| 140 | Ga0070659_100016873 | 3300005366 | Bacteria | 5488 |
| 141 | Ga0070659_100031512 | 3300005366 | Bacteria | 4107 |
| 142 | Ga0070659_100047040 | 3300005366 | Bacteria | 3383 |
| 143 | Ga0070659_100052634 | 3300005366 | Bacteria | 3203 |
| 144 | Ga0070659_100082356 | 3300005366 | Unclassified | 2570 |
| 145 | Ga0070659_100090118 | 3300005366 | Bacteria | 2457 |
| 146 | Ga0070659_100097739 | 3300005366 | Bacteria | 2360 |
| 147 | Ga0070659_100161273 | 3300005366 | Bacteria | 1833 |
| 148 | Ga0070659_100221554 | 3300005366 | Bacteria | 1561 |
| 149 | Ga0070659_100255697 | 3300005366 | Bacteria | 1452 |
| 150 | Ga0070659_100257565 | 3300005366 | Unclassified | 1447 |
| 151 | Ga0070659_100260211 | 3300005366 | Unclassified | 1439 |
| 152 | Ga0070659_100322658 | 3300005366 | Bacteria | 1291 |
| 153 | Ga0070659_100330999 | 3300005366 | Unclassified | 1275 |
| 154 | Ga0070659_100451931 | 3300005366 | Bacteria | 1090 |
| 155 | Ga0070659_100465858 | 3300005366 | Bacteria | 1074 |
| 156 | Ga0070659_100612614 | 3300005366 | Bacteria | 936 |
| 157 | Ga0070659_100719967 | 3300005366 | Bacteria | 864 |
| 158 | Ga0070667_100017309 | 3300005367 | Bacteria | 5972 |
| 159 | Ga0070667_100032746 | 3300005367 | Unclassified | 4337 |
| 160 | Ga0070667_100037562 | 3300005367 | Bacteria | 4060 |
| 161 | Ga0070667_100066053 | 3300005367 | Bacteria | 3073 |
| 162 | Ga0070667_100246800 | 3300005367 | Bacteria | 1595 |
| 163 | Ga0070667_100805577 | 3300005367 | Bacteria | 872 |
| 164 | Ga0070667_100882085 | 3300005367 | Bacteria | 832 |
| 165 | Ga0070714_100026304 | 3300005435 | Bacteria | 4808 |
| 166 | Ga0070714_100040484 | 3300005435 | Bacteria | 3928 |
| 167 | Ga0070714_100170508 | 3300005435 | Unclassified | 1975 |
| 168 | Ga0070714_100178880 | 3300005435 | Bacteria | 1929 |
| 169 | Ga0070700_100647404 | 3300005441 | Unclassified | 834 |
| 170 | Ga0070694_100011422 | 3300005444 | Bacteria | 5500 |
| 171 | Ga0070694_100221368 | 3300005444 | Unclassified | 1420 |
| 172 | Ga0070663_100007719 | 3300005455 | Bacteria | 6569 |
| 173 | Ga0070663_100039836 | 3300005455 | Bacteria | 3286 |
| 174 | Ga0070663_100102619 | 3300005455 | Bacteria | 2137 |
| 175 | Ga0070663_100117035 | 3300005455 | Unclassified | 2009 |
| 176 | Ga0070663_100206373 | 3300005455 | Unclassified | 1536 |
| 177 | Ga0070663_100265782 | 3300005455 | Bacteria | 1362 |
| 178 | Ga0070663_100592348 | 3300005455 | Unclassified | 931 |
| 179 | Ga0070663_100770821 | 3300005455 | Unclassified | 823 |
| 180 | Ga0070678_100084285 | 3300005456 | Bacteria | 2419 |
| 181 | Ga0070678_100371528 | 3300005456 | Unclassified | 1235 |
| 182 | Ga0070678_100551631 | 3300005456 | Unclassified | 1023 |
| 183 | Ga0070678_101270431 | 3300005456 | Bacteria | 684 |
| 184 | Ga0070662_100008823 | 3300005457 | Bacteria | 6572 |
| 185 | Ga0070662_100026697 | 3300005457 | Bacteria | 4002 |
| 186 | Ga0070662_100056154 | 3300005457 | Bacteria | 2858 |
| 187 | Ga0070662_100133449 | 3300005457 | Bacteria | 1917 |
| 188 | Ga0070662_100161718 | 3300005457 | Unclassified | 1752 |
| 189 | Ga0070662_100197031 | 3300005457 | Bacteria | 1596 |
| 190 | Ga0070662_100197718 | 3300005457 | Bacteria | 1593 |
| 191 | Ga0070662_100242475 | 3300005457 | Unclassified | 1446 |
| 192 | Ga0070662_100266233 | 3300005457 | Bacteria | 1382 |
| 193 | Ga0070662_100272839 | 3300005457 | Bacteria | 1366 |
| 194 | Ga0070681_10007382 | 3300005458 | Bacteria | 10745 |
| 195 | Ga0070681_10063354 | 3300005458 | Bacteria | 3669 |
| 196 | Ga0070681_10065670 | 3300005458 | Bacteria | 3597 |
| 197 | Ga0070681_10252056 | 3300005458 | Bacteria | 1678 |
| 198 | Ga0070681_10391969 | 3300005458 | Unclassified | 1300 |
| 199 | Ga0070681_10910707 | 3300005458 | Unclassified | 798 |
| 200 | Ga0068867_100007573 | 3300005459 | Bacteria | 7684 |
| 201 | Ga0068867_100135689 | 3300005459 | Bacteria | 1917 |
| 202 | Ga0068867_100157805 | 3300005459 | Unclassified | 1787 |
| 203 | Ga0068867_101318542 | 3300005459 | Viruses | 667 |
| 204 | Ga0068867_101640496 | 3300005459 | Bacteria | 602 |
| 205 | Ga0068867_102032465 | 3300005459 | Unclassified | 543 |
| 206 | Ga0070679_100012704 | 3300005530 | Bacteria | 8055 |
| 207 | Ga0070679_100031193 | 3300005530 | Bacteria | 5265 |
| 208 | Ga0070679_100136079 | 3300005530 | Unclassified | 2438 |
| 209 | Ga0070679_100138052 | 3300005530 | Bacteria | 2419 |
| 210 | Ga0070679_100454789 | 3300005530 | Bacteria | 1225 |
| 211 | Ga0070679_100680354 | 3300005530 | Unclassified | 971 |
| 212 | Ga0070679_100690219 | 3300005530 | Unclassified | 964 |
| 213 | Ga0070679_100752261 | 3300005530 | Bacteria | 917 |
| 214 | Ga0070679_100774990 | 3300005530 | Bacteria | 902 |
| 215 | Ga0070679_100961820 | 3300005530 | Bacteria | 798 |
| 216 | Ga0070684_100064378 | 3300005535 | Bacteria | 3216 |
| 217 | Ga0070684_100067819 | 3300005535 | Bacteria | 3135 |
| 218 | Ga0070684_100113622 | 3300005535 | Bacteria | 2430 |
| 219 | Ga0070684_100352556 | 3300005535 | Unclassified | 1354 |
| 220 | Ga0068853_100015024 | 3300005539 | Bacteria | 6361 |
| 221 | Ga0068853_100073208 | 3300005539 | Bacteria | 2986 |
| 222 | Ga0068853_100108935 | 3300005539 | Bacteria | 2458 |
| 223 | Ga0068853_100127936 | 3300005539 | Unclassified | 2271 |
| 224 | Ga0068853_100206773 | 3300005539 | Bacteria | 1788 |
| 225 | Ga0068853_100381987 | 3300005539 | Unclassified | 1315 |
| 226 | Ga0068853_100418516 | 3300005539 | Bacteria | 1256 |
| 227 | Ga0068853_100483414 | 3300005539 | Bacteria | 1167 |
| 228 | Ga0068853_100503150 | 3300005539 | Bacteria | 1144 |
| 229 | Ga0068853_100538784 | 3300005539 | Bacteria | 1105 |
| 230 | Ga0068853_102264796 | 3300005539 | Unclassified | 526 |
| 231 | Ga0070672_100006694 | 3300005543 | Bacteria | 7767 |
| 232 | Ga0070672_100053147 | 3300005543 | Bacteria | 3166 |
| 233 | Ga0070672_100158575 | 3300005543 | Bacteria | 1875 |
| 234 | Ga0070672_100507355 | 3300005543 | Viruses | 1044 |
| 235 | Ga0070672_100571992 | 3300005543 | Unclassified | 983 |
| 236 | Ga0070696_100142813 | 3300005546 | Unclassified | 1751 |
| 237 | Ga0070696_100158136 | 3300005546 | Bacteria | 1668 |
| 238 | Ga0070696_100287638 | 3300005546 | Bacteria | 1255 |
| 239 | Ga0070696_100788383 | 3300005546 | Unclassified | 781 |
| 240 | Ga0070693_100034766 | 3300005547 | Bacteria | 2790 |
| 241 | Ga0070693_100079256 | 3300005547 | Bacteria | 1954 |
| 242 | Ga0070693_100083179 | 3300005547 | Unclassified | 1912 |
| 243 | Ga0070693_100324832 | 3300005547 | Unclassified | 1045 |
| 244 | Ga0070693_100652817 | 3300005547 | Unclassified | 765 |
| 245 | Ga0070693_101002284 | 3300005547 | Bacteria | 632 |
| 246 | Ga0070665_100016938 | 3300005548 | Bacteria | 7307 |
| 247 | Ga0070665_100038981 | 3300005548 | Bacteria | 4777 |
| 248 | Ga0070665_100102479 | 3300005548 | Bacteria | 2866 |
| 249 | Ga0070665_100201534 | 3300005548 | Bacteria | 1991 |
| 250 | Ga0068855_100001622 | 3300005563 | Bacteria | 28214 |
| 251 | Ga0068855_100019513 | 3300005563 | Bacteria | 8147 |
| 252 | Ga0068855_100028425 | 3300005563 | Bacteria | 6689 |
| 253 | Ga0068855_100138516 | 3300005563 | Unclassified | 2775 |
| 254 | Ga0068855_100355939 | 3300005563 | Bacteria | 1612 |
| 255 | Ga0068855_100381148 | 3300005563 | Bacteria | 1548 |
| 256 | Ga0068855_100415076 | 3300005563 | Bacteria | 1473 |
| 257 | Ga0068855_100477501 | 3300005563 | Bacteria | 1357 |
| 258 | Ga0070664_100000066 | 3300005564 | Bacteria | 65204 |
| 259 | Ga0070664_100026936 | 3300005564 | Bacteria | 4774 |
| 260 | Ga0070664_100030149 | 3300005564 | Unclassified | 4525 |
| 261 | Ga0070664_100046327 | 3300005564 | Bacteria | 3672 |
| 262 | Ga0070664_100072355 | 3300005564 | Bacteria | 2956 |
| 263 | Ga0070664_100077575 | 3300005564 | Bacteria | 2856 |
| 264 | Ga0070664_100137483 | 3300005564 | Unclassified | 2149 |
| 265 | Ga0070664_100195994 | 3300005564 | Unclassified | 1801 |
| 266 | Ga0070664_100196256 | 3300005564 | Unclassified | 1799 |
| 267 | Ga0070664_100210254 | 3300005564 | Unclassified | 1738 |
| 268 | Ga0070664_100307603 | 3300005564 | Unclassified | 1433 |
| 269 | Ga0070664_100493552 | 3300005564 | Bacteria | 1128 |
| 270 | Ga0070664_100496690 | 3300005564 | Bacteria | 1124 |
| 271 | Ga0068857_100003820 | 3300005577 | Bacteria | 12676 |
| 272 | Ga0068857_100036247 | 3300005577 | Bacteria | 4371 |
| 273 | Ga0068857_100052081 | 3300005577 | Bacteria | 3632 |
| 274 | Ga0068857_100054790 | 3300005577 | Bacteria | 3539 |
| 275 | Ga0068857_100062010 | 3300005577 | Bacteria | 3323 |
| 276 | Ga0068857_100102224 | 3300005577 | Unclassified | 2572 |
| 277 | Ga0068857_100109609 | 3300005577 | Bacteria | 2481 |
| 278 | Ga0068857_100128369 | 3300005577 | Bacteria | 2285 |
| 279 | Ga0068857_100202522 | 3300005577 | Unclassified | 1809 |
| 280 | Ga0068857_100519850 | 3300005577 | Bacteria | 1119 |
| 281 | Ga0068854_100011462 | 3300005578 | Bacteria | 5776 |
| 282 | Ga0068854_100027419 | 3300005578 | Bacteria | 3926 |
| 283 | Ga0068854_100028677 | 3300005578 | Bacteria | 3848 |
| 284 | Ga0068854_100030513 | 3300005578 | Bacteria | 3739 |
| 285 | Ga0068854_100050449 | 3300005578 | Bacteria | 2977 |
| 286 | Ga0068854_100056060 | 3300005578 | Bacteria | 2839 |
| 287 | Ga0068854_100185323 | 3300005578 | Unclassified | 1628 |
| 288 | Ga0068854_100253841 | 3300005578 | Bacteria | 1405 |
| 289 | Ga0068854_100330098 | 3300005578 | Bacteria | 1242 |
| 290 | Ga0068856_100000213 | 3300005614 | Bacteria | 62582 |
| 291 | Ga0068856_100036106 | 3300005614 | Bacteria | 4846 |
| 292 | Ga0068856_100052623 | 3300005614 | Bacteria | 4016 |
| 293 | Ga0068856_100082243 | 3300005614 | Bacteria | 3196 |
| 294 | Ga0068856_100109309 | 3300005614 | Bacteria | 2761 |
| 295 | Ga0068856_100121053 | 3300005614 | Bacteria | 2618 |
| 296 | Ga0068856_100189095 | 3300005614 | Bacteria | 2073 |
| 297 | Ga0068856_100268011 | 3300005614 | Unclassified | 1723 |
| 298 | Ga0068856_100373244 | 3300005614 | Unclassified | 1445 |
| 299 | Ga0068856_100374064 | 3300005614 | Bacteria | 1443 |
| 300 | Ga0068856_100788395 | 3300005614 | Unclassified | 970 |
| 301 | Ga0068856_100847412 | 3300005614 | Bacteria | 933 |
| 302 | Ga0068852_100001507 | 3300005616 | Bacteria | 15764 |
| 303 | Ga0068852_100006300 | 3300005616 | Bacteria | 8565 |
| 304 | Ga0068852_100008088 | 3300005616 | Bacteria | 7717 |
| 305 | Ga0068852_100011209 | 3300005616 | Bacteria | 6736 |
| 306 | Ga0068852_100014400 | 3300005616 | Bacteria | 6088 |
| 307 | Ga0068852_100026871 | 3300005616 | Bacteria | 4684 |
| 308 | Ga0068852_100053153 | 3300005616 | Bacteria | 3485 |
| 309 | Ga0068852_100273733 | 3300005616 | Unclassified | 1626 |
| 310 | Ga0068852_100371446 | 3300005616 | Bacteria | 1401 |
| 311 | Ga0068852_100447655 | 3300005616 | Bacteria | 1278 |
| 312 | Ga0068852_100584025 | 3300005616 | Bacteria | 1120 |
| 313 | Ga0068852_100615292 | 3300005616 | Bacteria | 1091 |
| 314 | Ga0068859_100030114 | 3300005617 | Bacteria | 5445 |
| 315 | Ga0068859_100030683 | 3300005617 | Bacteria | 5394 |
| 316 | Ga0068859_100159890 | 3300005617 | Unclassified | 2332 |
| 317 | Ga0068859_100299524 | 3300005617 | Bacteria | 1701 |
| 318 | Ga0068859_100703892 | 3300005617 | Bacteria | 1101 |
| 319 | Ga0068864_100028236 | 3300005618 | Bacteria | 4740 |
| 320 | Ga0068864_100061038 | 3300005618 | Bacteria | 3265 |
| 321 | Ga0068864_100314088 | 3300005618 | Unclassified | 1470 |
| 322 | Ga0068864_100444532 | 3300005618 | Bacteria | 1239 |
| 323 | Ga0068864_101148054 | 3300005618 | Unclassified | 774 |
| 324 | Ga0068861_100583262 | 3300005719 | Bacteria | 1024 |
| 325 | Ga0068851_10016284 | 3300005834 | Bacteria | 3556 |
| 326 | Ga0068851_10020242 | 3300005834 | Bacteria | 3219 |
| 327 | Ga0068851_10080838 | 3300005834 | Bacteria | 1697 |
| 328 | Ga0068851_10153411 | 3300005834 | Unclassified | 1261 |
| 329 | Ga0068851_10227401 | 3300005834 | Bacteria | 1050 |
| 330 | Ga0068851_10501739 | 3300005834 | Bacteria | 728 |
| 331 | Ga0068870_10069758 | 3300005840 | Bacteria | 1913 |
| 332 | Ga0068870_11322177 | 3300005840 | Bacteria | 526 |
| 333 | Ga0068863_100005172 | 3300005841 | Bacteria | 12867 |
| 334 | Ga0068863_100014937 | 3300005841 | Bacteria | 7458 |
| 335 | Ga0068863_100036472 | 3300005841 | Bacteria | 4683 |
| 336 | Ga0068863_100138633 | 3300005841 | Bacteria | 2324 |
| 337 | Ga0068863_100287156 | 3300005841 | Unclassified | 1594 |
| 338 | Ga0068863_100291612 | 3300005841 | Bacteria | 1581 |
| 339 | Ga0068858_100023025 | 3300005842 | Bacteria | 5809 |
| 340 | Ga0068858_100027858 | 3300005842 | Bacteria | 5249 |
| 341 | Ga0068858_100111933 | 3300005842 | Bacteria | 2550 |
| 342 | Ga0068858_100116331 | 3300005842 | Bacteria | 2499 |
| 343 | Ga0068860_100005183 | 3300005843 | Bacteria | 13250 |
| 344 | Ga0068860_100008281 | 3300005843 | Bacteria | 10349 |
| 345 | Ga0068860_100219301 | 3300005843 | Bacteria | 1847 |
| 346 | Ga0068860_100224409 | 3300005843 | Bacteria | 1825 |
| 347 | Ga0068860_100461993 | 3300005843 | Bacteria | 1263 |
| 348 | Ga0068860_100463229 | 3300005843 | Unclassified | 1261 |
| 349 | Ga0068860_100593493 | 3300005843 | Unclassified | 1112 |
| 350 | Ga0068860_101030615 | 3300005843 | Unclassified | 841 |
| 351 | Ga0068862_100002736 | 3300005844 | Bacteria | 15475 |
| 352 | Ga0068862_100028673 | 3300005844 | Bacteria | 4689 |
| 353 | Ga0068862_100048154 | 3300005844 | Bacteria | 3639 |
| 354 | Ga0068862_100260236 | 3300005844 | Unclassified | 1584 |
| 355 | Ga0068862_100410996 | 3300005844 | Bacteria | 1268 |
| 356 | Ga0068862_100630013 | 3300005844 | Unclassified | 1032 |
| 357 | Ga0081539_10028927 | 3300005985 | Bacteria | 3476 |
| 358 | Ga0075366_10321775 | 3300006195 | Bacteria | 948 |
| 359 | Ga0097621_100004831 | 3300006237 | Bacteria | 9440 |
| 360 | Ga0097621_100030925 | 3300006237 | Bacteria | 4242 |
| 361 | Ga0097621_100057667 | 3300006237 | Unclassified | 3177 |
| 362 | Ga0097621_100321242 | 3300006237 | Bacteria | 1371 |
| 363 | Ga0068871_100007517 | 3300006358 | Bacteria | 7792 |
| 364 | Ga0068871_100173586 | 3300006358 | Bacteria | 1849 |
| 365 | Ga0068871_100818466 | 3300006358 | Bacteria | 859 |
| 366 | Ga0075431_101560271 | 3300006847 | Unclassified | 618 |
| 367 | Ga0075433_10096914 | 3300006852 | Unclassified | 2610 |
| 368 | Ga0075434_100077462 | 3300006871 | Bacteria | 3320 |
| 369 | Ga0068865_100030645 | 3300006881 | Bacteria | 3579 |
| 370 | Ga0068865_100448526 | 3300006881 | Bacteria | 1066 |
| 371 | Ga0068865_100494219 | 3300006881 | Bacteria | 1019 |
| 372 | Ga0097620_100030114 | 3300006931 | Bacteria | 5445 |
| 373 | Ga0097620_100030685 | 3300006931 | Bacteria | 5394 |
| 374 | Ga0097620_100159890 | 3300006931 | Unclassified | 2332 |
| 375 | Ga0097620_100299543 | 3300006931 | Bacteria | 1701 |
| 376 | Ga0097620_100703896 | 3300006931 | Bacteria | 1101 |
| 377 | Ga0075435_100114674 | 3300007076 | Bacteria | 2243 |
| 378 | Ga0105240_10009782 | 3300009093 | Bacteria | 13538 |
| 379 | Ga0105240_10037918 | 3300009093 | Bacteria | 6188 |
| 380 | Ga0105240_10204343 | 3300009093 | Bacteria | 2313 |
| 381 | Ga0111539_10228685 | 3300009094 | Unclassified | 2166 |
| 382 | Ga0105245_12089080 | 3300009098 | Unclassified | 620 |
| 383 | Ga0105247_10525326 | 3300009101 | Unclassified | 866 |
| 384 | Ga0114129_10471580 | 3300009147 | Bacteria | 1644 |
| 385 | Ga0105243_10035268 | 3300009148 | Bacteria | 3877 |
| 386 | Ga0105243_11407605 | 3300009148 | Unclassified | 718 |
| 387 | Ga0105243_11416958 | 3300009148 | Viruses | 716 |
| 388 | Ga0105241_10057130 | 3300009174 | Bacteria | 2993 |
| 389 | Ga0105241_10244469 | 3300009174 | Unclassified | 1518 |
| 390 | Ga0105241_10309138 | 3300009174 | Bacteria | 1359 |
| 391 | Ga0105241_10332714 | 3300009174 | Bacteria | 1313 |
| 392 | Ga0105241_11138797 | 3300009174 | Bacteria | 736 |
| 393 | Ga0105241_11732985 | 3300009174 | Unclassified | 608 |
| 394 | Ga0105242_10073172 | 3300009176 | Bacteria | 2848 |
| 395 | Ga0105248_10010355 | 3300009177 | Bacteria | 10266 |
| 396 | Ga0105248_10031916 | 3300009177 | Bacteria | 5885 |
| 397 | Ga0105248_10047959 | 3300009177 | Bacteria | 4790 |
| 398 | Ga0105248_10126192 | 3300009177 | Bacteria | 2887 |
| 399 | Ga0105248_12875060 | 3300009177 | Unclassified | 549 |
| 400 | Ga0105237_10010455 | 3300009545 | Bacteria | 9867 |
| 401 | Ga0105237_10612210 | 3300009545 | Bacteria | 1096 |
| 402 | Ga0105238_10002513 | 3300009551 | Bacteria | 18352 |
| 403 | Ga0105238_10008543 | 3300009551 | Bacteria | 10246 |
| 404 | Ga0105238_10017853 | 3300009551 | Bacteria | 7213 |
| 405 | Ga0105238_10092286 | 3300009551 | Unclassified | 3016 |
| 406 | Ga0105238_12304016 | 3300009551 | Unclassified | 574 |
| 407 | Ga0105249_10008517 | 3300009553 | Bacteria | 8942 |
| 408 | Ga0105249_10041715 | 3300009553 | Bacteria | 4172 |
| 409 | Ga0105249_10054591 | 3300009553 | Bacteria | 3654 |
| 410 | Ga0105249_11940707 | 3300009553 | Bacteria | 661 |
| 411 | Ga0105239_10151161 | 3300010375 | Bacteria | 2591 |
| 412 | Ga0105239_10186338 | 3300010375 | Bacteria | 2322 |
| 413 | Ga0105239_10680213 | 3300010375 | Unclassified | 1176 |
| 414 | Ga0105239_13367732 | 3300010375 | Unclassified | 520 |
| 415 | Ga0105246_10006278 | 3300011119 | Bacteria | 7255 |
| 416 | Ga0105246_10598571 | 3300011119 | Unclassified | 952 |
| 417 | Ga0157373_10001899 | 3300013100 | Bacteria | 15862 |
| 418 | Ga0157373_10014261 | 3300013100 | Bacteria | 5830 |
| 419 | Ga0157373_10018364 | 3300013100 | Bacteria | 5093 |
| 420 | Ga0157373_10028680 | 3300013100 | Bacteria | 4014 |
| 421 | Ga0157373_10225276 | 3300013100 | Bacteria | 1323 |
| 422 | Ga0157373_10244567 | 3300013100 | Unclassified | 1268 |
| 423 | Ga0157373_10637514 | 3300013100 | Unclassified | 777 |
| 424 | Ga0157373_10664608 | 3300013100 | Bacteria | 762 |
| 425 | Ga0157373_10711032 | 3300013100 | Bacteria | 737 |
| 426 | Ga0157371_10016811 | 3300013102 | Bacteria | 5448 |
| 427 | Ga0157371_10058821 | 3300013102 | Bacteria | 2726 |
| 428 | Ga0157371_10086721 | 3300013102 | Bacteria | 2217 |
| 429 | Ga0157371_10150516 | 3300013102 | Unclassified | 1659 |
| 430 | Ga0157371_10177241 | 3300013102 | Bacteria | 1524 |
| 431 | Ga0157371_10606201 | 3300013102 | Bacteria | 815 |
| 432 | Ga0157371_10617416 | 3300013102 | Unclassified | 807 |
| 433 | Ga0157371_10646989 | 3300013102 | Bacteria | 789 |
| 434 | Ga0157371_10840626 | 3300013102 | Unclassified | 694 |
| 435 | Ga0157371_10846090 | 3300013102 | Unclassified | 691 |
| 436 | Ga0157371_10924914 | 3300013102 | Unclassified | 662 |
| 437 | Ga0157371_11248668 | 3300013102 | Unclassified | 574 |
| 438 | Ga0157370_10015357 | 3300013104 | Bacteria | 7783 |
| 439 | Ga0157370_10030530 | 3300013104 | Bacteria | 5280 |
| 440 | Ga0157370_10043152 | 3300013104 | Bacteria | 4342 |
| 441 | Ga0157370_10049602 | 3300013104 | Bacteria | 4017 |
| 442 | Ga0157370_10087657 | 3300013104 | Bacteria | 2924 |
| 443 | Ga0157370_10165632 | 3300013104 | Bacteria | 2055 |
| 444 | Ga0157370_10266640 | 3300013104 | Bacteria | 1582 |
| 445 | Ga0157370_10267555 | 3300013104 | Bacteria | 1579 |
| 446 | Ga0157370_10529143 | 3300013104 | Bacteria | 1081 |
| 447 | Ga0157370_10997233 | 3300013104 | Unclassified | 758 |
| 448 | Ga0157369_10011269 | 3300013105 | Bacteria | 10158 |
| 449 | Ga0157369_10026544 | 3300013105 | Bacteria | 6424 |
| 450 | Ga0157369_10097016 | 3300013105 | Unclassified | 3144 |
| 451 | Ga0157369_10110514 | 3300013105 | Bacteria | 2922 |
| 452 | Ga0157369_10136161 | 3300013105 | Bacteria | 2600 |
| 453 | Ga0157369_10252179 | 3300013105 | Unclassified | 1841 |
| 454 | Ga0157369_10966875 | 3300013105 | Bacteria | 872 |
| 455 | Ga0157374_10158088 | 3300013296 | Bacteria | 2207 |
| 456 | Ga0157374_10451423 | 3300013296 | Unclassified | 1287 |
| 457 | Ga0157374_11150481 | 3300013296 | Bacteria | 797 |
| 458 | Ga0157378_11020559 | 3300013297 | Unclassified | 862 |
| 459 | Ga0163162_10021069 | 3300013306 | Bacteria | 6412 |
| 460 | Ga0163162_10115725 | 3300013306 | Bacteria | 2782 |
| 461 | Ga0163162_10743552 | 3300013306 | Unclassified | 1100 |
| 462 | Ga0163162_11602953 | 3300013306 | Unclassified | 742 |
| 463 | Ga0157372_10004040 | 3300013307 | Bacteria | 15730 |
| 464 | Ga0157372_10029471 | 3300013307 | Bacteria | 5993 |
| 465 | Ga0157372_10044454 | 3300013307 | Bacteria | 4922 |
| 466 | Ga0157372_10099009 | 3300013307 | Bacteria | 3326 |
| 467 | Ga0157372_10102994 | 3300013307 | Bacteria | 3261 |
| 468 | Ga0157372_10340606 | 3300013307 | Bacteria | 1746 |
| 469 | Ga0157372_10385244 | 3300013307 | Bacteria | 1633 |
| 470 | Ga0157372_10443753 | 3300013307 | Bacteria | 1512 |
| 471 | Ga0157372_10700979 | 3300013307 | Unclassified | 1178 |
| 472 | Ga0157372_10750785 | 3300013307 | Bacteria | 1134 |
| 473 | Ga0157372_11277799 | 3300013307 | Bacteria | 847 |
| 474 | Ga0157372_11319716 | 3300013307 | Unclassified | 832 |
| 475 | Ga0157375_10014100 | 3300013308 | Bacteria | 7126 |
| 476 | Ga0157375_10168279 | 3300013308 | Bacteria | 2338 |
| 477 | Ga0157375_10289995 | 3300013308 | Bacteria | 1799 |
| 478 | Ga0157375_10566424 | 3300013308 | Bacteria | 1297 |
| 479 | Ga0163163_10037594 | 3300014325 | Bacteria | 4711 |
| 480 | Ga0163163_10983305 | 3300014325 | Unclassified | 907 |
| 481 | Ga0157380_11459356 | 3300014326 | Bacteria | 736 |
| 482 | Ga0182008_10296950 | 3300014497 | Unclassified | 844 |
| 483 | Ga0182008_10461846 | 3300014497 | Bacteria | 692 |
| 484 | Ga0157377_10020706 | 3300014745 | Unclassified | 3450 |
| 485 | Ga0157379_10063298 | 3300014968 | Bacteria | 3308 |
| 486 | Ga0157376_12650254 | 3300014969 | Bacteria | 541 |
| 487 | Ga0163161_10257971 | 3300017792 | Unclassified | 1361 |
| 488 | Ga0163161_10456764 | 3300017792 | Unclassified | 1033 |
| 489 | Ga0206356_10965601 | 3300020070 | Unclassified | 891 |
| 490 | Ga0206353_11202403 | 3300020082 | Bacteria | 2324 |
| 491 | Ga0206353_11906044 | 3300020082 | Bacteria | 710 |
| 492 | Ga0207697_10024948 | 3300025315 | Bacteria | 2445 |
| 493 | Ga0207656_10033899 | 3300025321 | Bacteria | 2129 |
| 494 | Ga0207656_10055130 | 3300025321 | Unclassified | 1729 |
| 495 | Ga0207653_10057109 | 3300025885 | Unclassified | 1310 |
| 496 | Ga0207682_10043576 | 3300025893 | Bacteria | 1837 |
| 497 | Ga0207682_10051377 | 3300025893 | Bacteria | 1707 |
| 498 | Ga0207682_10093543 | 3300025893 | Bacteria | 1306 |
| 499 | Ga0207688_10045051 | 3300025901 | Bacteria | 2460 |
| 500 | Ga0207688_10051937 | 3300025901 | Bacteria | 2296 |
| 501 | Ga0207688_10197006 | 3300025901 | Viruses | 1207 |
| 502 | Ga0207680_10038947 | 3300025903 | Unclassified | 2754 |
| 503 | Ga0207680_10103553 | 3300025903 | Bacteria | 1833 |
| 504 | Ga0207680_10145850 | 3300025903 | Bacteria | 1573 |
| 505 | Ga0207680_10188038 | 3300025903 | Bacteria | 1400 |
| 506 | Ga0207680_10286196 | 3300025903 | Bacteria | 1146 |
| 507 | Ga0207647_10000721 | 3300025904 | Bacteria | 25921 |
| 508 | Ga0207647_10002263 | 3300025904 | Bacteria | 14665 |
| 509 | Ga0207647_10002940 | 3300025904 | Bacteria | 12822 |
| 510 | Ga0207647_10006442 | 3300025904 | Bacteria | 8531 |
| 511 | Ga0207647_10015955 | 3300025904 | Bacteria | 5135 |
| 512 | Ga0207647_10064843 | 3300025904 | Bacteria | 2219 |
| 513 | Ga0207647_10146109 | 3300025904 | Bacteria | 1384 |
| 514 | Ga0207647_10149786 | 3300025904 | Unclassified | 1364 |
| 515 | Ga0207647_10152481 | 3300025904 | Bacteria | 1350 |
| 516 | Ga0207647_10452625 | 3300025904 | Unclassified | 719 |
| 517 | Ga0207645_10013495 | 3300025907 | Bacteria | 5503 |
| 518 | Ga0207645_10030977 | 3300025907 | Bacteria | 3445 |
| 519 | Ga0207645_10110577 | 3300025907 | Bacteria | 1779 |
| 520 | Ga0207645_10419571 | 3300025907 | Bacteria | 901 |
| 521 | Ga0207643_10074500 | 3300025908 | Bacteria | 1958 |
| 522 | Ga0207705_10008024 | 3300025909 | Bacteria | 7740 |
| 523 | Ga0207705_10011549 | 3300025909 | Bacteria | 6387 |
| 524 | Ga0207705_10013549 | 3300025909 | Bacteria | 5885 |
| 525 | Ga0207705_10029514 | 3300025909 | Plasmid | 3909 |
| 526 | Ga0207705_10072616 | 3300025909 | Bacteria | 2496 |
| 527 | Ga0207705_10073179 | 3300025909 | Unclassified | 2486 |
| 528 | Ga0207705_10096779 | 3300025909 | Unclassified | 2167 |
| 529 | Ga0207705_10106467 | 3300025909 | Bacteria | 2068 |
| 530 | Ga0207705_10180652 | 3300025909 | Bacteria | 1592 |
| 531 | Ga0207705_10273680 | 3300025909 | Bacteria | 1291 |
| 532 | Ga0207705_10326417 | 3300025909 | Unclassified | 1180 |
| 533 | Ga0207705_11546460 | 3300025909 | Unclassified | 501 |
| 534 | Ga0207654_10351504 | 3300025911 | Bacteria | 1015 |
| 535 | Ga0207654_10368544 | 3300025911 | Unclassified | 992 |
| 536 | Ga0207707_10022651 | 3300025912 | Bacteria | 5493 |
| 537 | Ga0207707_10046847 | 3300025912 | Unclassified | 3766 |
| 538 | Ga0207707_10050263 | 3300025912 | Bacteria | 3632 |
| 539 | Ga0207707_10200554 | 3300025912 | Unclassified | 1740 |
| 540 | Ga0207695_10063905 | 3300025913 | Bacteria | 3792 |
| 541 | Ga0207695_10077027 | 3300025913 | Bacteria | 3389 |
| 542 | Ga0207695_10094177 | 3300025913 | Unclassified | 3003 |
| 543 | Ga0207671_10015467 | 3300025914 | Bacteria | 5971 |
| 544 | Ga0207671_10047665 | 3300025914 | Bacteria | 3172 |
| 545 | Ga0207660_10001191 | 3300025917 | Bacteria | 17454 |
| 546 | Ga0207660_10035170 | 3300025917 | Bacteria | 3476 |
| 547 | Ga0207660_10144721 | 3300025917 | Unclassified | 1820 |
| 548 | Ga0207660_10173356 | 3300025917 | Unclassified | 1671 |
| 549 | Ga0207660_10885451 | 3300025917 | Unclassified | 729 |
| 550 | Ga0207657_10002867 | 3300025919 | Bacteria | 18531 |
| 551 | Ga0207657_10008053 | 3300025919 | Bacteria | 10745 |
| 552 | Ga0207657_10009578 | 3300025919 | Bacteria | 9725 |
| 553 | Ga0207657_10022956 | 3300025919 | Bacteria | 5822 |
| 554 | Ga0207657_10028130 | 3300025919 | Bacteria | 5135 |
| 555 | Ga0207657_10029311 | 3300025919 | Bacteria | 5012 |
| 556 | Ga0207657_10060183 | 3300025919 | Bacteria | 3260 |
| 557 | Ga0207657_10070842 | 3300025919 | Bacteria | 2953 |
| 558 | Ga0207657_10079248 | 3300025919 | Bacteria | 2764 |
| 559 | Ga0207657_10151116 | 3300025919 | Bacteria | 1892 |
| 560 | Ga0207657_10260087 | 3300025919 | Bacteria | 1381 |
| 561 | Ga0207649_10006009 | 3300025920 | Bacteria | 6588 |
| 562 | Ga0207649_10010089 | 3300025920 | Bacteria | 5182 |
| 563 | Ga0207649_10069552 | 3300025920 | Bacteria | 2242 |
| 564 | Ga0207649_10076186 | 3300025920 | Unclassified | 2158 |
| 565 | Ga0207649_10083885 | 3300025920 | Bacteria | 2069 |
| 566 | Ga0207649_10092977 | 3300025920 | Bacteria | 1978 |
| 567 | Ga0207649_10098297 | 3300025920 | Bacteria | 1932 |
| 568 | Ga0207649_10108864 | 3300025920 | Bacteria | 1847 |
| 569 | Ga0207649_10148370 | 3300025920 | Bacteria | 1612 |
| 570 | Ga0207649_10171364 | 3300025920 | Bacteria | 1512 |
| 571 | Ga0207649_10232399 | 3300025920 | Bacteria | 1319 |
| 572 | Ga0207649_10245050 | 3300025920 | Unclassified | 1288 |
| 573 | Ga0207652_10052973 | 3300025921 | Bacteria | 3485 |
| 574 | Ga0207652_10128149 | 3300025921 | Unclassified | 2262 |
| 575 | Ga0207652_10172658 | 3300025921 | Bacteria | 1940 |
| 576 | Ga0207652_10200976 | 3300025921 | Bacteria | 1793 |
| 577 | Ga0207652_10639002 | 3300025921 | Unclassified | 952 |
| 578 | Ga0207652_11210053 | 3300025921 | Unclassified | 657 |
| 579 | Ga0207681_10008742 | 3300025923 | Bacteria | 6188 |
| 580 | Ga0207681_10047145 | 3300025923 | Bacteria | 2901 |
| 581 | Ga0207681_10299015 | 3300025923 | Bacteria | 1273 |
| 582 | Ga0207681_10411100 | 3300025923 | Bacteria | 1095 |
| 583 | Ga0207681_10605975 | 3300025923 | Bacteria | 905 |
| 584 | Ga0207681_11760464 | 3300025923 | Unclassified | 517 |
| 585 | Ga0207694_10001011 | 3300025924 | Bacteria | 24528 |
| 586 | Ga0207694_10031528 | 3300025924 | Bacteria | 4050 |
| 587 | Ga0207694_10181029 | 3300025924 | Bacteria | 1709 |
| 588 | Ga0207694_10279765 | 3300025924 | Unclassified | 1370 |
| 589 | Ga0207694_11755117 | 3300025924 | Unclassified | 522 |
| 590 | Ga0207650_10006425 | 3300025925 | Bacteria | 8010 |
| 591 | Ga0207650_10013438 | 3300025925 | Bacteria | 5669 |
| 592 | Ga0207650_10020000 | 3300025925 | Bacteria | 4714 |
| 593 | Ga0207650_10196649 | 3300025925 | Bacteria | 1613 |
| 594 | Ga0207650_10506385 | 3300025925 | Bacteria | 1009 |
| 595 | Ga0207650_11111577 | 3300025925 | Bacteria | 673 |
| 596 | Ga0207659_10060719 | 3300025926 | Unclassified | 2722 |
| 597 | Ga0207659_10211152 | 3300025926 | Bacteria | 1556 |
| 598 | Ga0207659_10709100 | 3300025926 | Unclassified | 862 |
| 599 | Ga0207687_10212147 | 3300025927 | Unclassified | 1520 |
| 600 | Ga0207664_10007802 | 3300025929 | Bacteria | 7433 |
| 601 | Ga0207664_10029928 | 3300025929 | Bacteria | 4153 |
| 602 | Ga0207664_11404326 | 3300025929 | Unclassified | 619 |
| 603 | Ga0207664_11982082 | 3300025929 | Bacteria | 505 |
| 604 | Ga0207644_10022018 | 3300025931 | Bacteria | 4348 |
| 605 | Ga0207644_10134227 | 3300025931 | Bacteria | 1899 |
| 606 | Ga0207644_10201331 | 3300025931 | Unclassified | 1571 |
| 607 | Ga0207644_10310474 | 3300025931 | Bacteria | 1273 |
| 608 | Ga0207644_10339824 | 3300025931 | Unclassified | 1217 |
| 609 | Ga0207690_10001891 | 3300025932 | Bacteria | 12848 |
| 610 | Ga0207690_10006698 | 3300025932 | Bacteria | 6826 |
| 611 | Ga0207690_10011850 | 3300025932 | Bacteria | 5213 |
| 612 | Ga0207690_10015745 | 3300025932 | Bacteria | 4588 |
| 613 | Ga0207690_10038089 | 3300025932 | Bacteria | 3127 |
| 614 | Ga0207690_10061615 | 3300025932 | Bacteria | 2551 |
| 615 | Ga0207690_10066029 | 3300025932 | Bacteria | 2476 |
| 616 | Ga0207690_10163215 | 3300025932 | Bacteria | 1663 |
| 617 | Ga0207690_10182575 | 3300025932 | Bacteria | 1581 |
| 618 | Ga0207690_10284597 | 3300025932 | Bacteria | 1288 |
| 619 | Ga0207690_10459273 | 3300025932 | Bacteria | 1025 |
| 620 | Ga0207690_10572068 | 3300025932 | Bacteria | 920 |
| 621 | Ga0207690_10824636 | 3300025932 | Unclassified | 767 |
| 622 | Ga0207690_10892118 | 3300025932 | Unclassified | 737 |
| 623 | Ga0207690_11060609 | 3300025932 | Bacteria | 675 |
| 624 | Ga0207690_11069111 | 3300025932 | Bacteria | 672 |
| 625 | Ga0207690_11084396 | 3300025932 | Bacteria | 667 |
| 626 | Ga0207690_11172023 | 3300025932 | Bacteria | 641 |
| 627 | Ga0207706_10001211 | 3300025933 | Bacteria | 26067 |
| 628 | Ga0207706_10002133 | 3300025933 | Bacteria | 19359 |
| 629 | Ga0207706_10007955 | 3300025933 | Bacteria | 9789 |
| 630 | Ga0207706_10025809 | 3300025933 | Bacteria | 5263 |
| 631 | Ga0207706_10028223 | 3300025933 | Bacteria | 5013 |
| 632 | Ga0207706_10047473 | 3300025933 | Bacteria | 3799 |
| 633 | Ga0207706_10071714 | 3300025933 | Bacteria | 3047 |
| 634 | Ga0207706_10077606 | 3300025933 | Bacteria | 2921 |
| 635 | Ga0207706_10132127 | 3300025933 | Unclassified | 2195 |
| 636 | Ga0207706_10152015 | 3300025933 | Bacteria | 2036 |
| 637 | Ga0207706_10297553 | 3300025933 | Bacteria | 1406 |
| 638 | Ga0207706_10362241 | 3300025933 | Bacteria | 1260 |
| 639 | Ga0207706_10378374 | 3300025933 | Viruses | 1229 |
| 640 | Ga0207706_10439236 | 3300025933 | Unclassified | 1130 |
| 641 | Ga0207706_10451707 | 3300025933 | Bacteria | 1111 |
| 642 | Ga0207686_10051627 | 3300025934 | Bacteria | 2562 |
| 643 | Ga0207709_10472310 | 3300025935 | Unclassified | 974 |
| 644 | Ga0207709_10905195 | 3300025935 | Viruses | 717 |
| 645 | Ga0207670_10358206 | 3300025936 | Unclassified | 1157 |
| 646 | Ga0207669_10161360 | 3300025937 | Bacteria | 1584 |
| 647 | Ga0207669_10359053 | 3300025937 | Bacteria | 1128 |
| 648 | Ga0207669_10867151 | 3300025937 | Bacteria | 752 |
| 649 | Ga0207704_10378311 | 3300025938 | Unclassified | 1111 |
| 650 | Ga0207704_10724837 | 3300025938 | Unclassified | 825 |
| 651 | Ga0207691_10004966 | 3300025940 | Bacteria | 12835 |
| 652 | Ga0207691_10014906 | 3300025940 | Bacteria | 7407 |
| 653 | Ga0207691_10071051 | 3300025940 | Bacteria | 3142 |
| 654 | Ga0207691_10129771 | 3300025940 | Bacteria | 2227 |
| 655 | Ga0207691_10223053 | 3300025940 | Bacteria | 1634 |
| 656 | Ga0207691_10301112 | 3300025940 | Bacteria | 1377 |
| 657 | Ga0207711_10006337 | 3300025941 | Bacteria | 9978 |
| 658 | Ga0207711_10010388 | 3300025941 | Bacteria | 7730 |
| 659 | Ga0207711_10062345 | 3300025941 | Bacteria | 3216 |
| 660 | Ga0207711_10077519 | 3300025941 | Bacteria | 2897 |
| 661 | Ga0207711_11277288 | 3300025941 | Bacteria | 676 |
| 662 | Ga0207689_10070162 | 3300025942 | Bacteria | 2879 |
| 663 | Ga0207661_10027360 | 3300025944 | Bacteria | 4355 |
| 664 | Ga0207661_10319413 | 3300025944 | Bacteria | 1396 |
| 665 | Ga0207679_10004621 | 3300025945 | Bacteria | 8574 |
| 666 | Ga0207679_10020613 | 3300025945 | Bacteria | 4451 |
| 667 | Ga0207679_10022960 | 3300025945 | Bacteria | 4257 |
| 668 | Ga0207679_10065533 | 3300025945 | Bacteria | 2718 |
| 669 | Ga0207679_10066772 | 3300025945 | Bacteria | 2696 |
| 670 | Ga0207679_10135932 | 3300025945 | Bacteria | 1979 |
| 671 | Ga0207679_10144393 | 3300025945 | Bacteria | 1928 |
| 672 | Ga0207679_10345768 | 3300025945 | Bacteria | 1295 |
| 673 | Ga0207679_10986398 | 3300025945 | Unclassified | 772 |
| 674 | Ga0207679_11962342 | 3300025945 | Unclassified | 533 |
| 675 | Ga0207667_10018675 | 3300025949 | Bacteria | 7768 |
| 676 | Ga0207667_10036759 | 3300025949 | Bacteria | 5243 |
| 677 | Ga0207667_10039888 | 3300025949 | Bacteria | 5001 |
| 678 | Ga0207667_10084198 | 3300025949 | Bacteria | 3292 |
| 679 | Ga0207667_10139366 | 3300025949 | Unclassified | 2497 |
| 680 | Ga0207667_10498013 | 3300025949 | Unclassified | 1236 |
| 681 | Ga0207667_10558596 | 3300025949 | Bacteria | 1157 |
| 682 | Ga0207651_10015209 | 3300025960 | Bacteria | 4465 |
| 683 | Ga0207651_10157945 | 3300025960 | Bacteria | 1774 |
| 684 | Ga0207651_10181125 | 3300025960 | Bacteria | 1671 |
| 685 | Ga0207651_10208266 | 3300025960 | Bacteria | 1572 |
| 686 | Ga0207651_10219835 | 3300025960 | Bacteria | 1535 |
| 687 | Ga0207651_10253680 | 3300025960 | Bacteria | 1440 |
| 688 | Ga0207651_10445167 | 3300025960 | Bacteria | 1110 |
| 689 | Ga0207651_11059540 | 3300025960 | Bacteria | 726 |
| 690 | Ga0207651_11112693 | 3300025960 | Unclassified | 708 |
| 691 | Ga0207712_10000491 | 3300025961 | Bacteria | 32766 |
| 692 | Ga0207712_10128652 | 3300025961 | Bacteria | 1927 |
| 693 | Ga0207712_10363988 | 3300025961 | Unclassified | 1206 |
| 694 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 695 | Ga0207668_10032560 | 3300025972 | Bacteria | 3446 |
| 696 | Ga0207668_10041358 | 3300025972 | Bacteria | 3115 |
| 697 | Ga0207668_10085237 | 3300025972 | Bacteria | 2305 |
| 698 | Ga0207668_10618779 | 3300025972 | Unclassified | 945 |
| 699 | Ga0207668_10913405 | 3300025972 | Bacteria | 782 |
| 700 | Ga0207668_11000093 | 3300025972 | Bacteria | 747 |
| 701 | Ga0207640_10023295 | 3300025981 | Bacteria | 3719 |
| 702 | Ga0207640_10040624 | 3300025981 | Unclassified | 2952 |
| 703 | Ga0207640_10042763 | 3300025981 | Bacteria | 2891 |
| 704 | Ga0207640_10047489 | 3300025981 | Unclassified | 2769 |
| 705 | Ga0207640_10086875 | 3300025981 | Unclassified | 2154 |
| 706 | Ga0207640_10154754 | 3300025981 | Bacteria | 1689 |
| 707 | Ga0207640_10189194 | 3300025981 | Bacteria | 1550 |
| 708 | Ga0207640_10575084 | 3300025981 | Bacteria | 950 |
| 709 | Ga0207658_10004678 | 3300025986 | Bacteria | 9481 |
| 710 | Ga0207658_10019496 | 3300025986 | Bacteria | 4691 |
| 711 | Ga0207658_10112917 | 3300025986 | Bacteria | 2152 |
| 712 | Ga0207658_10126910 | 3300025986 | Bacteria | 2043 |
| 713 | Ga0207658_10340918 | 3300025986 | Bacteria | 1302 |
| 714 | Ga0207658_10487671 | 3300025986 | Bacteria | 1096 |
| 715 | Ga0207658_10495499 | 3300025986 | Bacteria | 1088 |
| 716 | Ga0207658_10645155 | 3300025986 | Bacteria | 954 |
| 717 | Ga0207677_10217586 | 3300026023 | Unclassified | 1530 |
| 718 | Ga0207677_10565586 | 3300026023 | Unclassified | 993 |
| 719 | Ga0207677_10596869 | 3300026023 | Unclassified | 968 |
| 720 | Ga0207677_12237934 | 3300026023 | Unclassified | 509 |
| 721 | Ga0207703_10002126 | 3300026035 | Bacteria | 17427 |
| 722 | Ga0207703_10150927 | 3300026035 | Bacteria | 2026 |
| 723 | Ga0207703_10448077 | 3300026035 | Unclassified | 1205 |
| 724 | Ga0207639_10000144 | 3300026041 | Bacteria | 53312 |
| 725 | Ga0207639_10067079 | 3300026041 | Bacteria | 2791 |
| 726 | Ga0207639_10068559 | 3300026041 | Bacteria | 2764 |
| 727 | Ga0207639_10088892 | 3300026041 | Bacteria | 2467 |
| 728 | Ga0207639_10119957 | 3300026041 | Bacteria | 2159 |
| 729 | Ga0207639_10149113 | 3300026041 | Unclassified | 1957 |
| 730 | Ga0207639_10208717 | 3300026041 | Bacteria | 1680 |
| 731 | Ga0207639_10311645 | 3300026041 | Unclassified | 1394 |
| 732 | Ga0207639_10612872 | 3300026041 | Bacteria | 1004 |
| 733 | Ga0207639_10997780 | 3300026041 | Bacteria | 784 |
| 734 | Ga0207639_11244523 | 3300026041 | Unclassified | 698 |
| 735 | Ga0207678_10004202 | 3300026067 | Bacteria | 12924 |
| 736 | Ga0207678_10005267 | 3300026067 | Bacteria | 11583 |
| 737 | Ga0207678_10007936 | 3300026067 | Bacteria | 9360 |
| 738 | Ga0207678_10021689 | 3300026067 | Bacteria | 5633 |
| 739 | Ga0207678_10023348 | 3300026067 | Bacteria | 5409 |
| 740 | Ga0207678_10028383 | 3300026067 | Bacteria | 4885 |
| 741 | Ga0207678_10033913 | 3300026067 | Bacteria | 4446 |
| 742 | Ga0207678_10179676 | 3300026067 | Bacteria | 1807 |
| 743 | Ga0207678_10228200 | 3300026067 | Bacteria | 1594 |
| 744 | Ga0207678_10313820 | 3300026067 | Bacteria | 1348 |
| 745 | Ga0207678_11452084 | 3300026067 | Unclassified | 606 |
| 746 | Ga0207708_11969659 | 3300026075 | Unclassified | 512 |
| 747 | Ga0207702_10016603 | 3300026078 | Bacteria | 6092 |
| 748 | Ga0207702_10041084 | 3300026078 | Bacteria | 3877 |
| 749 | Ga0207702_10064566 | 3300026078 | Bacteria | 3133 |
| 750 | Ga0207702_10097792 | 3300026078 | Bacteria | 2584 |
| 751 | Ga0207702_10313537 | 3300026078 | Bacteria | 1492 |
| 752 | Ga0207702_10516710 | 3300026078 | Bacteria | 1165 |
| 753 | Ga0207702_10891429 | 3300026078 | Unclassified | 881 |
| 754 | Ga0207641_10050697 | 3300026088 | Bacteria | 3512 |
| 755 | Ga0207641_10067143 | 3300026088 | Unclassified | 3071 |
| 756 | Ga0207641_10075483 | 3300026088 | Bacteria | 2911 |
| 757 | Ga0207641_10107531 | 3300026088 | Unclassified | 2467 |
| 758 | Ga0207641_10213549 | 3300026088 | Bacteria | 1785 |
| 759 | Ga0207641_10983206 | 3300026088 | Bacteria | 840 |
| 760 | Ga0207648_10084888 | 3300026089 | Bacteria | 2762 |
| 761 | Ga0207648_10171676 | 3300026089 | Bacteria | 1917 |
| 762 | Ga0207648_10442512 | 3300026089 | Bacteria | 1182 |
| 763 | Ga0207648_11123441 | 3300026089 | Viruses | 737 |
| 764 | Ga0207648_11340653 | 3300026089 | Bacteria | 672 |
| 765 | Ga0207676_10031236 | 3300026095 | Bacteria | 4004 |
| 766 | Ga0207676_10192462 | 3300026095 | Unclassified | 1796 |
| 767 | Ga0207676_10583407 | 3300026095 | Bacteria | 1072 |
| 768 | Ga0207676_10783001 | 3300026095 | Unclassified | 929 |
| 769 | Ga0207676_11280098 | 3300026095 | Unclassified | 728 |
| 770 | Ga0207674_10000057 | 3300026116 | Bacteria | 113117 |
| 771 | Ga0207674_10001662 | 3300026116 | Bacteria | 28614 |
| 772 | Ga0207674_10003393 | 3300026116 | Bacteria | 19537 |
| 773 | Ga0207674_10005462 | 3300026116 | Bacteria | 15097 |
| 774 | Ga0207674_10005506 | 3300026116 | Bacteria | 15034 |
| 775 | Ga0207674_10009490 | 3300026116 | Bacteria | 11111 |
| 776 | Ga0207674_10031060 | 3300026116 | Bacteria | 5613 |
| 777 | Ga0207674_10082958 | 3300026116 | Bacteria | 3205 |
| 778 | Ga0207674_10137769 | 3300026116 | Bacteria | 2401 |
| 779 | Ga0207674_10305632 | 3300026116 | Bacteria | 1540 |
| 780 | Ga0207674_11298845 | 3300026116 | Unclassified | 697 |
| 781 | Ga0207675_100232883 | 3300026118 | Unclassified | 1777 |
| 782 | Ga0207683_10013896 | 3300026121 | Bacteria | 6864 |
| 783 | Ga0207683_10032849 | 3300026121 | Bacteria | 4508 |
| 784 | Ga0207683_10136735 | 3300026121 | Bacteria | 2206 |
| 785 | Ga0207683_11461502 | 3300026121 | Unclassified | 631 |
| 786 | Ga0207698_10004897 | 3300026142 | Bacteria | 8212 |
| 787 | Ga0207698_10005264 | 3300026142 | Bacteria | 7956 |
| 788 | Ga0207698_10018006 | 3300026142 | Bacteria | 4804 |
| 789 | Ga0207698_10025656 | 3300026142 | Bacteria | 4156 |
| 790 | Ga0207698_10031060 | 3300026142 | Bacteria | 3851 |
| 791 | Ga0207698_10064988 | 3300026142 | Bacteria | 2863 |
| 792 | Ga0207698_10074647 | 3300026142 | Bacteria | 2706 |
| 793 | Ga0207698_10111067 | 3300026142 | Bacteria | 2297 |
| 794 | Ga0207698_10129960 | 3300026142 | Bacteria | 2150 |
| 795 | Ga0207698_10147504 | 3300026142 | Bacteria | 2037 |
| 796 | Ga0207698_10245211 | 3300026142 | Unclassified | 1635 |
| 797 | Ga0207698_10436726 | 3300026142 | Bacteria | 1260 |
| 798 | Ga0209973_1064924 | 3300027252 | Bacteria | 565 |
| 799 | Ga0207428_10270523 | 3300027907 | Unclassified | 1263 |
| 800 | Ga0268266_10018502 | 3300028379 | Bacteria | 5936 |
| 801 | Ga0268266_10035908 | 3300028379 | Bacteria | 4216 |
| 802 | Ga0268266_11007504 | 3300028379 | Bacteria | 806 |
| 803 | Ga0268266_11517825 | 3300028379 | Bacteria | 645 |
| 804 | Ga0268265_10001537 | 3300028380 | Bacteria | 19180 |
| 805 | Ga0268265_10007179 | 3300028380 | Bacteria | 7528 |
| 806 | Ga0268265_10030723 | 3300028380 | Bacteria | 3872 |
| 807 | Ga0268265_10038772 | 3300028380 | Bacteria | 3507 |
| 808 | Ga0268265_10152777 | 3300028380 | Unclassified | 1949 |
| 809 | Ga0268265_10691125 | 3300028380 | Bacteria | 985 |
| 810 | Ga0268264_10002057 | 3300028381 | Bacteria | 17945 |
| 811 | Ga0268264_10005564 | 3300028381 | Bacteria | 10670 |
| 812 | Ga0268264_10128315 | 3300028381 | Bacteria | 2244 |
| 813 | Ga0268264_10159804 | 3300028381 | Bacteria | 2029 |
| 814 | Ga0268264_10380254 | 3300028381 | Bacteria | 1352 |
| 815 | Ga0268264_10455707 | 3300028381 | Unclassified | 1240 |
| 816 | Ga0268264_10558342 | 3300028381 | Unclassified | 1124 |
| 817 | Ga0268264_10706932 | 3300028381 | Unclassified | 1001 |
| 818 | Ga0307408_100035403 | 3300031548 | Bacteria | 3504 |
| 819 | Ga0307408_100108533 | 3300031548 | Bacteria | 2128 |
| 820 | Ga0307408_100307098 | 3300031548 | Bacteria | 1331 |
| 821 | Ga0307405_10035211 | 3300031731 | Bacteria | 2988 |
| 822 | Ga0307405_10836544 | 3300031731 | Bacteria | 774 |
| 823 | Ga0307405_11238438 | 3300031731 | Bacteria | 647 |
| 824 | Ga0307413_10379851 | 3300031824 | Unclassified | 1100 |
| 825 | Ga0307413_10973116 | 3300031824 | Unclassified | 725 |
| 826 | Ga0307410_10069565 | 3300031852 | Bacteria | 2435 |
| 827 | Ga0307410_10113802 | 3300031852 | Bacteria | 1962 |
| 828 | Ga0307410_10324176 | 3300031852 | Bacteria | 1223 |
| 829 | Ga0307406_10370043 | 3300031901 | Bacteria | 1126 |
| 830 | Ga0307407_10033193 | 3300031903 | Bacteria | 2814 |
| 831 | Ga0307407_10359763 | 3300031903 | Unclassified | 1033 |
| 832 | Ga0307407_10466134 | 3300031903 | Bacteria | 920 |
| 833 | Ga0307412_10098027 | 3300031911 | Bacteria | 2066 |
| 834 | Ga0307412_10280147 | 3300031911 | Bacteria | 1309 |
| 835 | Ga0307412_10538855 | 3300031911 | Unclassified | 978 |
| 836 | Ga0307409_100029124 | 3300031995 | Bacteria | 3947 |
| 837 | Ga0307409_100029392 | 3300031995 | Bacteria | 3933 |
| 838 | Ga0307409_100093976 | 3300031995 | Bacteria | 2466 |
| 839 | Ga0307409_100259724 | 3300031995 | Bacteria | 1593 |
| 840 | Ga0307409_100334698 | 3300031995 | Bacteria | 1422 |
| 841 | Ga0307409_101343713 | 3300031995 | Bacteria | 740 |
| 842 | Ga0307416_100079830 | 3300032002 | Bacteria | 2759 |
| 843 | Ga0307416_100265384 | 3300032002 | Bacteria | 1681 |
| 844 | Ga0307416_100298724 | 3300032002 | Bacteria | 1599 |
| 845 | Ga0307416_100558524 | 3300032002 | Bacteria | 1219 |
| 846 | Ga0307414_10232308 | 3300032004 | Unclassified | 1521 |
| 847 | Ga0307414_10641895 | 3300032004 | Bacteria | 956 |
| 848 | Ga0307411_10018944 | 3300032005 | Bacteria | 3962 |
| 849 | Ga0307411_10233691 | 3300032005 | Bacteria | 1435 |
| 850 | Ga0307411_10298865 | 3300032005 | Bacteria | 1290 |
| 851 | Ga0307411_10996208 | 3300032005 | Bacteria | 750 |
| 852 | Ga0307415_100099190 | 3300032126 | Bacteria | 2131 |
| 853 | Ga0307415_100118172 | 3300032126 | Bacteria | 1982 |
| 854 | Ga0307415_100697994 | 3300032126 | Bacteria | 915 |
| 855 | Ga0395899_0009507 | 3300037312 | Bacteria | 7460 |
| 856 | Ga0395899_0010217 | 3300037312 | Bacteria | 7190 |
| 857 | Ga0395899_0018320 | 3300037312 | Bacteria | 5324 |
| 858 | Ga0395899_0045303 | 3300037312 | Bacteria | 3277 |
| 859 | Ga0395899_0079016 | 3300037312 | Bacteria | 2397 |
| 860 | Ga0395899_0215691 | 3300037312 | Bacteria | 1332 |
| 861 | Ga0395899_0403532 | 3300037312 | Unclassified | 904 |
| 862 | Ga0395900_0005687 | 3300037418 | Bacteria | 13035 |
| 863 | Ga0395900_0006197 | 3300037418 | Bacteria | 12487 |
| 864 | Ga0395900_0006712 | 3300037418 | Bacteria | 11951 |
| 865 | Ga0395900_0017453 | 3300037418 | Bacteria | 7327 |
| 866 | Ga0395900_0019372 | 3300037418 | Bacteria | 6941 |
| 867 | Ga0395900_0040753 | 3300037418 | Bacteria | 4786 |
| 868 | Ga0395900_0054644 | 3300037418 | Bacteria | 4112 |
| 869 | Ga0395900_0080078 | 3300037418 | Bacteria | 3357 |
| 870 | Ga0395900_0170102 | 3300037418 | Bacteria | 2219 |
| 871 | Ga0395900_0204368 | 3300037418 | Bacteria | 1997 |
| 872 | Ga0395900_0339320 | 3300037418 | Bacteria | 1478 |
| 873 | Ga0395900_0406922 | 3300037418 | Bacteria | 1324 |
| 874 | Ga0395900_0415628 | 3300037418 | Bacteria | 1306 |
| 875 | Ga0395900_0647756 | 3300037418 | Unclassified | 993 |
| 876 | Ga0395900_1289541 | 3300037418 | Bacteria | 644 |
| 877 | Ga0395900_1376937 | 3300037418 | Bacteria | 619 |
| 878 | Ga0395900_1386869 | 3300037418 | Unclassified | 616 |
| 879 | Ga0395898_0012439 | 3300037466 | Bacteria | 8797 |
| 880 | Ga0395898_0058065 | 3300037466 | Bacteria | 3768 |
| 881 | Ga0395898_0061014 | 3300037466 | Bacteria | 3663 |
| 882 | Ga0395898_0069577 | 3300037466 | Bacteria | 3405 |
| 883 | Ga0395898_0090033 | 3300037466 | Bacteria | 2953 |
| 884 | Ga0395898_0160495 | 3300037466 | Bacteria | 2150 |
| 885 | Ga0395898_0212178 | 3300037466 | Bacteria | 1847 |
| 886 | Ga0395898_0275474 | 3300037466 | Bacteria | 1605 |
| 887 | Ga0395898_0301320 | 3300037466 | Unclassified | 1529 |
| 888 | Ga0395898_0422737 | 3300037466 | Bacteria | 1270 |
| 889 | Ga0395898_0954690 | 3300037466 | Bacteria | 794 |
| 890 | Ga0395898_1314696 | 3300037466 | Bacteria | 652 |
| 891 | Ga0395898_1576262 | 3300037466 | Unclassified | 581 |
| 892 | Ga0395898_1805090 | 3300037466 | Unclassified | 533 |
| 893 | Ga0395905_0000092 | 3300037471 | Bacteria | 149300 |
| 894 | Ga0395905_0003268 | 3300037471 | Bacteria | 17423 |
| 895 | Ga0395905_0003469 | 3300037471 | Bacteria | 16851 |
| 896 | Ga0395905_0012841 | 3300037471 | Bacteria | 8051 |
| 897 | Ga0395905_0014738 | 3300037471 | Bacteria | 7454 |
| 898 | Ga0395905_0014833 | 3300037471 | Bacteria | 7431 |
| 899 | Ga0395905_0040395 | 3300037471 | Bacteria | 4376 |
| 900 | Ga0395905_0040523 | 3300037471 | Bacteria | 4369 |
| 901 | Ga0395905_0081486 | 3300037471 | Bacteria | 3033 |
| 902 | Ga0395905_0086334 | 3300037471 | Bacteria | 2940 |
| 903 | Ga0395905_0088899 | 3300037471 | Bacteria | 2895 |
| 904 | Ga0395905_0156710 | 3300037471 | Bacteria | 2142 |
| 905 | Ga0395905_0190693 | 3300037471 | Bacteria | 1923 |
| 906 | Ga0395905_0227419 | 3300037471 | Bacteria | 1745 |
| 907 | Ga0395905_0264169 | 3300037471 | Bacteria | 1606 |
| 908 | Ga0395905_0533048 | 3300037471 | Bacteria | 1075 |
| 909 | Ga0395905_1317341 | 3300037471 | Unclassified | 626 |
| 910 | Ga0395901_0000188 | 3300038443 | Bacteria | 78908 |
| 911 | Ga0395901_0006402 | 3300038443 | Bacteria | 11930 |
| 912 | Ga0395901_0017047 | 3300038443 | Bacteria | 7404 |
| 913 | Ga0395901_0028527 | 3300038443 | Bacteria | 5740 |
| 914 | Ga0395901_0041548 | 3300038443 | Bacteria | 4766 |
| 915 | Ga0395901_0053756 | 3300038443 | Bacteria | 4185 |
| 916 | Ga0395901_0064358 | 3300038443 | Bacteria | 3817 |
| 917 | Ga0395901_0183585 | 3300038443 | Bacteria | 2194 |
| 918 | Ga0395901_0316337 | 3300038443 | Bacteria | 1616 |
| 919 | Ga0395901_0487693 | 3300038443 | Bacteria | 1256 |
| 920 | Ga0395901_1031926 | 3300038443 | Unclassified | 796 |
| 921 | Ga0395901_1257573 | 3300038443 | Bacteria | 703 |
| 922 | Ga0439447_092499 | 3300041407 | Bacteria | 695 |
| 923 | Ga0439461_0021595 | 3300041410 | Unclassified | 1284 |
| 924 | Ga0439465_0068680 | 3300041413 | Bacteria | 1185 |
| 925 | Ga0439432_092058 | 3300042006 | Bacteria | 912 |
| 926 | Ga0439449_0227088 | 3300042007 | Unclassified | 700 |
| 927 | Ga0439452_048573 | 3300042010 | Unclassified | 978 |
| 928 | Ga0439455_0225675 | 3300042012 | Bacteria | 545 |
| 929 | Ga0450914_000674 | 3300042118 | Unclassified | 1757 |
| 930 | Ga0450905_045588 | 3300042142 | Bacteria | 705 |
| 931 | Ga0450889_000204 | 3300042144 | Bacteria | 6482 |
| 932 | Ga0439458_0001172 | 3300042157 | Bacteria | 6657 |
| 933 | Ga0466965_0185687 | 3300044683 | Unclassified | 1098 |
| 934 | Ga0466961_0163574 | 3300044693 | Bacteria | 1386 |
| 935 | Ga0466963_0119656 | 3300044694 | Bacteria | 1812 |
| 936 | Ga0466963_0160984 | 3300044694 | Bacteria | 1562 |
| 937 | Ga0466963_0166996 | 3300044694 | Bacteria | 1533 |
| 938 | Ga0466963_0757508 | 3300044694 | Unclassified | 685 |
| 939 | Ga0466964_0206083 | 3300044706 | Bacteria | 947 |
| 940 | Ga0466964_0398505 | 3300044706 | Bacteria | 718 |
| 941 | Ga0466971_0235334 | 3300044719 | Unclassified | 870 |
| 942 | Ga0466971_0277009 | 3300044719 | Unclassified | 802 |
| 943 | Ga0466971_0705140 | 3300044719 | Unclassified | 508 |
| 944 | Ga0466970_0846263 | 3300044765 | Bacteria | 537 |
| 945 | Ga0466957_0049506 | 3300044842 | Bacteria | 2555 |
| 946 | Ga0466957_0435397 | 3300044842 | Unclassified | 901 |
| 947 | Ga0466957_0654756 | 3300044842 | Unclassified | 739 |
| 948 | Ga0466957_1144408 | 3300044842 | Unclassified | 562 |
| 949 | Ga0466960_0174216 | 3300044901 | Unclassified | 1163 |
| 950 | Ga0466959_0326253 | 3300045049 | Unclassified | 1049 |
| 951 | Ga0466959_0986125 | 3300045049 | Bacteria | 561 |
| 952 | Ga0466958_0083987 | 3300045836 | Bacteria | 1963 |
| 953 | Ga0466967_0001666 | 3300045976 | Bacteria | 13169 |
| 954 | Ga0466967_0004245 | 3300045976 | Bacteria | 9621 |
| 955 | Ga0466967_0015584 | 3300045976 | Bacteria | 5961 |
| 956 | Ga0466967_0021721 | 3300045976 | Bacteria | 5221 |
| 957 | Ga0466967_0222873 | 3300045976 | Bacteria | 1793 |
| 958 | Ga0466967_0425322 | 3300045976 | Bacteria | 1295 |
| 959 | Ga0466967_0445891 | 3300045976 | Unclassified | 1264 |
| 960 | Ga0495663_0008582 | 3300046525 | Unclassified | 2834 |
| 961 | Ga0495621_0041351 | 3300046539 | Unclassified | 1618 |
| 962 | Ga0495668_0293960 | 3300046616 | Bacteria | 890 |
| 963 | Ga0495669_0002162 | 3300046684 | Bacteria | 8074 |
| 964 | Ga0495669_0648474 | 3300046684 | Bacteria | 513 |
| 965 | Ga0495677_0015603 | 3300047445 | Unclassified | 2759 |
| 966 | Ga0495685_089176 | 3300047447 | Bacteria | 1023 |
| 967 | Ga0496100_1318514 | 3300048903 | Unclassified | 570 |
| 968 | Ga0496101_0213898 | 3300048904 | Bacteria | 1494 |
| 969 | Ga0496102_1120389 | 3300048905 | Unclassified | 707 |
| 970 | Ga0496103_0097387 | 3300048906 | Bacteria | 1860 |
| 971 | Ga0496106_0462086 | 3300048909 | Unclassified | 1020 |
| 972 | Ga0496106_0737219 | 3300048909 | Unclassified | 784 |
| 973 | Ga0496107_0154394 | 3300048910 | Bacteria | 1699 |
| 974 | Ga0496107_0354246 | 3300048910 | Bacteria | 1092 |
| 975 | Ga0496107_0449659 | 3300048910 | Bacteria | 957 |
| 976 | Ga0496107_0763371 | 3300048910 | Bacteria | 709 |
| 977 | Ga0496108_0647162 | 3300048911 | Bacteria | 919 |
| 978 | Ga0496109_0557149 | 3300048912 | Bacteria | 1081 |
| 979 | Ga0496111_0115185 | 3300048914 | Bacteria | 1982 |
| 980 | Ga0496111_0296851 | 3300048914 | Unclassified | 1198 |
| 981 | Ga0496111_0702874 | 3300048914 | Bacteria | 735 |
| 982 | Ga0496112_0375992 | 3300048915 | Bacteria | 1362 |
| 983 | Ga0496113_0144734 | 3300048916 | Bacteria | 1872 |
| 984 | Ga0496114_0036993 | 3300048917 | Bacteria | 4036 |
| 985 | Ga0496115_0037736 | 3300048918 | Bacteria | 3830 |
| 986 | nmdc:mga0k408_330179_c1 | 3300050493 | Bacteria | 910 |
| 987 | nmdc:mga06r32_1805631_c1 | 3300050510 | Unclassified | 547 |
| 988 | nmdc:mga08y16_184093_c1 | 3300050511 | Unclassified | 2168 |
| 989 | nmdc:mga0rr50_100459_c1 | 3300050513 | Bacteria | 2272 |
| 990 | nmdc:mga0a205_8689_c1 | 3300050515 | Bacteria | 9248 |
| 991 | Ga0466962_0149268 | 3300061719 | Unclassified | 1134 |
| 992 | Ga0466962_0242704 | 3300061719 | Bacteria | 884 |
| 993 | Ga0466962_0522112 | 3300061719 | Bacteria | 602 |
| 994 | Ga0157369_10145490 | |||
| 995 | JGI24741J21665_1000867 | |||
| 996 | JGI24740J21852_10002444 | |||
| 997 | JGI24740J21852_10015262 | |||
| 998 | JGI24740J21852_10089584 | |||
| 999 | JGI24740J21852_10107735 | |||
| 1000 | JGI24740J21852_10114888 | |||
| 1001 | JGI24739J22299_10003964 | |||
| 1002 | JGI24739J22299_10009318 | |||
| 1003 | JGI24737J22298_10002168 | |||
| 1004 | JGI24737J22298_10005610 | |||
| 1005 | JGI24737J22298_10074335 | |||
| 1006 | JGI24743J22301_10061826 | |||
| 1007 | JGI24735J21928_10000970 | |||
| 1008 | JGI24735J21928_10001752 | |||
| 1009 | JGI24735J21928_10020585 | |||
| 1010 | JGI24735J21928_10077951 | |||
| 1011 | JGI24735J21928_10133519 | |||
| 1012 | JGI24735J21928_10142113 | |||
| 1013 | JGI25406J46586_10260734 | |||
| 1014 | Ga0065715_10211467 | |||
| 1015 | Ga0065715_10465005 | |||
| 1016 | Ga0070658_10016564 | |||
| 1017 | Ga0070658_10018275 | |||
| 1018 | Ga0070658_10089282 | |||
| 1019 | Ga0070658_10190935 | |||
| 1020 | Ga0070658_10445404 | |||
| 1021 | Ga0070658_10758480 | |||
| 1022 | Ga0070658_10995793 | |||
| 1023 | Ga0070676_10009673 | |||
| 1024 | Ga0070676_10184729 | |||
| 1025 | Ga0070676_10349086 | |||
| 1026 | Ga0070676_10497349 | |||
| 1027 | Ga0070676_10783907 | |||
| 1028 | Ga0070683_100001584 | |||
| 1029 | Ga0070683_100006972 | |||
| 1030 | Ga0070683_100012444 | |||
| 1031 | Ga0070683_100046392 | |||
| 1032 | Ga0070683_100142351 | |||
| 1033 | Ga0070683_100517580 | |||
| 1034 | Ga0070690_100806541 | |||
| 1035 | Ga0070690_101461423 | |||
| 1036 | Ga0070670_100022358 | |||
| 1037 | Ga0070670_100032462 | |||
| 1038 | Ga0070670_100042083 | |||
| 1039 | Ga0070670_100128865 | |||
| 1040 | Ga0070670_100253068 | |||
| 1041 | Ga0070677_10017821 | |||
| 1042 | Ga0070677_10039196 | |||
| 1043 | Ga0070677_10195632 | |||
| 1044 | Ga0070677_10282147 | |||
| 1045 | Ga0068869_100007144 | |||
| 1046 | Ga0068869_100569989 | |||
| 1047 | Ga0070666_10018749 | |||
| 1048 | Ga0070666_10055794 | |||
| 1049 | Ga0070666_10074253 | |||
| 1050 | Ga0070666_10117152 | |||
| 1051 | Ga0070666_10157780 | |||
| 1052 | Ga0070666_10394078 | |||
| 1053 | Ga0070680_100002188 | |||
| 1054 | Ga0070680_100011586 | |||
| 1055 | Ga0070680_100048410 | |||
| 1056 | Ga0070680_100277387 | |||
| 1057 | Ga0070680_100280585 | |||
| 1058 | Ga0070680_100299822 | |||
| 1059 | Ga0070682_100003586 | |||
| 1060 | Ga0070682_100038426 | |||
| 1061 | Ga0070682_100085170 | |||
| 1062 | Ga0070682_100202095 | |||
| 1063 | Ga0070682_100839227 | |||
| 1064 | Ga0068868_100016525 | |||
| 1065 | Ga0068868_100089857 | |||
| 1066 | Ga0068868_100714200 | |||
| 1067 | Ga0070660_100003337 | |||
| 1068 | Ga0070660_100030266 | |||
| 1069 | Ga0070660_100038928 | |||
| 1070 | Ga0070660_100092565 | |||
| 1071 | Ga0070660_100132154 | |||
| 1072 | Ga0070660_100135947 | |||
| 1073 | Ga0070660_100152144 | |||
| 1074 | Ga0070660_100156277 | |||
| 1075 | Ga0070660_100226822 | |||
| 1076 | Ga0070660_100246347 | |||
| 1077 | Ga0070660_100259918 | |||
| 1078 | Ga0070660_100305876 | |||
| 1079 | Ga0070660_101876991 | |||
| 1080 | Ga0070689_100789512 | |||
| 1081 | Ga0070691_10032882 | |||
| 1082 | Ga0070691_10074238 | |||
| 1083 | Ga0070661_100004629 | |||
| 1084 | Ga0070661_100016515 | |||
| 1085 | Ga0070661_100026111 | |||
| 1086 | Ga0070661_100030374 | |||
| 1087 | Ga0070661_100031892 | |||
| 1088 | Ga0070661_100082414 | |||
| 1089 | Ga0070661_100107514 | |||
| 1090 | Ga0070661_100113918 | |||
| 1091 | Ga0070661_100194702 | |||
| 1092 | Ga0070661_100384113 | |||
| 1093 | Ga0070661_100422604 | |||
| 1094 | Ga0070661_100477474 | |||
| 1095 | Ga0070692_10000457 | |||
| 1096 | Ga0070692_10040506 | |||
| 1097 | Ga0070692_10216645 | |||
| 1098 | Ga0070692_10414175 | |||
| 1099 | Ga0070668_100003267 | |||
| 1100 | Ga0070668_100009416 | |||
| 1101 | Ga0070668_100051859 | |||
| 1102 | Ga0070668_100409734 | |||
| 1103 | Ga0070668_100477038 | |||
| 1104 | Ga0070668_100815403 | |||
| 1105 | Ga0070668_101135636 | |||
| 1106 | Ga0070669_100020434 | |||
| 1107 | Ga0070669_100032975 | |||
| 1108 | Ga0070669_101309023 | |||
| 1109 | Ga0070675_100056143 | |||
| 1110 | Ga0070675_100155099 | |||
| 1111 | Ga0070675_100197553 | |||
| 1112 | Ga0070675_100256298 | |||
| 1113 | Ga0070671_100023728 | |||
| 1114 | Ga0070671_100580857 | |||
| 1115 | Ga0070671_100607023 | |||
| 1116 | Ga0070671_101187810 | |||
| 1117 | Ga0070674_100183757 | |||
| 1118 | Ga0070674_100277940 | |||
| 1119 | Ga0070674_100344924 | |||
| 1120 | Ga0070673_100002262 | |||
| 1121 | Ga0070673_100003681 | |||
| 1122 | Ga0070673_100012846 | |||
| 1123 | Ga0070673_100026793 | |||
| 1124 | Ga0070673_100262978 | |||
| 1125 | Ga0070673_100325003 | |||
| 1126 | Ga0070673_100451108 | |||
| 1127 | Ga0070673_100537300 | |||
| 1128 | Ga0070673_100776599 | |||
| 1129 | Ga0070673_101156145 | |||
| 1130 | Ga0070673_101240329 | |||
| 1131 | Ga0070659_100000952 | |||
| 1132 | Ga0070659_100013633 | |||
| 1133 | Ga0070659_100016873 | |||
| 1134 | Ga0070659_100031512 | |||
| 1135 | Ga0070659_100047040 | |||
| 1136 | Ga0070659_100052634 | |||
| 1137 | Ga0070659_100082356 | |||
| 1138 | Ga0070659_100090118 | |||
| 1139 | Ga0070659_100097739 | |||
| 1140 | Ga0070659_100161273 | |||
| 1141 | Ga0070659_100221554 | |||
| 1142 | Ga0070659_100255697 | |||
| 1143 | Ga0070659_100257565 | |||
| 1144 | Ga0070659_100260211 | |||
| 1145 | Ga0070659_100322658 | |||
| 1146 | Ga0070659_100330999 | |||
| 1147 | Ga0070659_100451931 | |||
| 1148 | Ga0070659_100465858 | |||
| 1149 | Ga0070659_100612614 | |||
| 1150 | Ga0070659_100719967 | |||
| 1151 | Ga0070667_100017309 | |||
| 1152 | Ga0070667_100032746 | |||
| 1153 | Ga0070667_100037562 | |||
| 1154 | Ga0070667_100066053 | |||
| 1155 | Ga0070667_100246800 | |||
| 1156 | Ga0070667_100805577 | |||
| 1157 | Ga0070667_100882085 | |||
| 1158 | Ga0070714_100026304 | |||
| 1159 | Ga0070714_100040484 | |||
| 1160 | Ga0070714_100170508 | |||
| 1161 | Ga0070714_100178880 | |||
| 1162 | Ga0070700_100647404 | |||
| 1163 | Ga0070694_100011422 | |||
| 1164 | Ga0070694_100221368 | |||
| 1165 | Ga0070663_100007719 | |||
| 1166 | Ga0070663_100039836 | |||
| 1167 | Ga0070663_100102619 | |||
| 1168 | Ga0070663_100117035 | |||
| 1169 | Ga0070663_100206373 | |||
| 1170 | Ga0070663_100265782 | |||
| 1171 | Ga0070663_100592348 | |||
| 1172 | Ga0070663_100770821 | |||
| 1173 | Ga0070678_100084285 | |||
| 1174 | Ga0070678_100371528 | |||
| 1175 | Ga0070678_100551631 | |||
| 1176 | Ga0070678_101270431 | |||
| 1177 | Ga0070662_100008823 | |||
| 1178 | Ga0070662_100026697 | |||
| 1179 | Ga0070662_100056154 | |||
| 1180 | Ga0070662_100133449 | |||
| 1181 | Ga0070662_100161718 | |||
| 1182 | Ga0070662_100197031 | |||
| 1183 | Ga0070662_100197718 | |||
| 1184 | Ga0070662_100242475 | |||
| 1185 | Ga0070662_100266233 | |||
| 1186 | Ga0070662_100272839 | |||
| 1187 | Ga0070681_10007382 | |||
| 1188 | Ga0070681_10063354 | |||
| 1189 | Ga0070681_10065670 | |||
| 1190 | Ga0070681_10252056 | |||
| 1191 | Ga0070681_10391969 | |||
| 1192 | Ga0070681_10910707 | |||
| 1193 | Ga0068867_100007573 | |||
| 1194 | Ga0068867_100135689 | |||
| 1195 | Ga0068867_100157805 | |||
| 1196 | Ga0068867_101318542 | |||
| 1197 | Ga0068867_101640496 | |||
| 1198 | Ga0068867_102032465 | |||
| 1199 | Ga0070679_100012704 | |||
| 1200 | Ga0070679_100031193 | |||
| 1201 | Ga0070679_100136079 | |||
| 1202 | Ga0070679_100138052 | |||
| 1203 | Ga0070679_100454789 | |||
| 1204 | Ga0070679_100680354 | |||
| 1205 | Ga0070679_100690219 | |||
| 1206 | Ga0070679_100752261 | |||
| 1207 | Ga0070679_100774990 | |||
| 1208 | Ga0070679_100961820 | |||
| 1209 | Ga0070684_100064378 | |||
| 1210 | Ga0070684_100067819 | |||
| 1211 | Ga0070684_100113622 | |||
| 1212 | Ga0070684_100352556 | |||
| 1213 | Ga0068853_100015024 | |||
| 1214 | Ga0068853_100073208 | |||
| 1215 | Ga0068853_100108935 | |||
| 1216 | Ga0068853_100127936 | |||
| 1217 | Ga0068853_100206773 | |||
| 1218 | Ga0068853_100381987 | |||
| 1219 | Ga0068853_100418516 | |||
| 1220 | Ga0068853_100483414 | |||
| 1221 | Ga0068853_100503150 | |||
| 1222 | Ga0068853_100538784 | |||
| 1223 | Ga0068853_102264796 | |||
| 1224 | Ga0070672_100006694 | |||
| 1225 | Ga0070672_100053147 | |||
| 1226 | Ga0070672_100158575 | |||
| 1227 | Ga0070672_100507355 | |||
| 1228 | Ga0070672_100571992 | |||
| 1229 | Ga0070696_100142813 | |||
| 1230 | Ga0070696_100158136 | |||
| 1231 | Ga0070696_100287638 | |||
| 1232 | Ga0070696_100788383 | |||
| 1233 | Ga0070693_100034766 | |||
| 1234 | Ga0070693_100079256 | |||
| 1235 | Ga0070693_100083179 | |||
| 1236 | Ga0070693_100324832 | |||
| 1237 | Ga0070693_100652817 | |||
| 1238 | Ga0070693_101002284 | |||
| 1239 | Ga0070665_100016938 | |||
| 1240 | Ga0070665_100038981 | |||
| 1241 | Ga0070665_100102479 | |||
| 1242 | Ga0070665_100201534 | |||
| 1243 | Ga0068855_100001622 | |||
| 1244 | Ga0068855_100019513 | |||
| 1245 | Ga0068855_100028425 | |||
| 1246 | Ga0068855_100138516 | |||
| 1247 | Ga0068855_100355939 | |||
| 1248 | Ga0068855_100381148 | |||
| 1249 | Ga0068855_100415076 | |||
| 1250 | Ga0068855_100477501 | |||
| 1251 | Ga0070664_100000066 | |||
| 1252 | Ga0070664_100026936 | |||
| 1253 | Ga0070664_100030149 | |||
| 1254 | Ga0070664_100046327 | |||
| 1255 | Ga0070664_100072355 | |||
| 1256 | Ga0070664_100077575 | |||
| 1257 | Ga0070664_100137483 | |||
| 1258 | Ga0070664_100195994 | |||
| 1259 | Ga0070664_100196256 | |||
| 1260 | Ga0070664_100210254 | |||
| 1261 | Ga0070664_100307603 | |||
| 1262 | Ga0070664_100493552 | |||
| 1263 | Ga0070664_100496690 | |||
| 1264 | Ga0068857_100003820 | |||
| 1265 | Ga0068857_100036247 | |||
| 1266 | Ga0068857_100052081 | |||
| 1267 | Ga0068857_100054790 | |||
| 1268 | Ga0068857_100062010 | |||
| 1269 | Ga0068857_100102224 | |||
| 1270 | Ga0068857_100109609 | |||
| 1271 | Ga0068857_100128369 | |||
| 1272 | Ga0068857_100202522 | |||
| 1273 | Ga0068857_100519850 | |||
| 1274 | Ga0068854_100011462 | |||
| 1275 | Ga0068854_100027419 | |||
| 1276 | Ga0068854_100028677 | |||
| 1277 | Ga0068854_100030513 | |||
| 1278 | Ga0068854_100050449 | |||
| 1279 | Ga0068854_100056060 | |||
| 1280 | Ga0068854_100185323 | |||
| 1281 | Ga0068854_100253841 | |||
| 1282 | Ga0068854_100330098 | |||
| 1283 | Ga0068856_100000213 | |||
| 1284 | Ga0068856_100036106 | |||
| 1285 | Ga0068856_100052623 | |||
| 1286 | Ga0068856_100082243 | |||
| 1287 | Ga0068856_100109309 | |||
| 1288 | Ga0068856_100121053 | |||
| 1289 | Ga0068856_100189095 | |||
| 1290 | Ga0068856_100268011 | |||
| 1291 | Ga0068856_100373244 | |||
| 1292 | Ga0068856_100374064 | |||
| 1293 | Ga0068856_100788395 | |||
| 1294 | Ga0068856_100847412 | |||
| 1295 | Ga0068852_100001507 | |||
| 1296 | Ga0068852_100006300 | |||
| 1297 | Ga0068852_100008088 | |||
| 1298 | Ga0068852_100011209 | |||
| 1299 | Ga0068852_100014400 | |||
| 1300 | Ga0068852_100026871 | |||
| 1301 | Ga0068852_100053153 | |||
| 1302 | Ga0068852_100273733 | |||
| 1303 | Ga0068852_100371446 | |||
| 1304 | Ga0068852_100447655 | |||
| 1305 | Ga0068852_100584025 | |||
| 1306 | Ga0068852_100615292 | |||
| 1307 | Ga0068859_100030114 | |||
| 1308 | Ga0068859_100030683 | |||
| 1309 | Ga0068859_100159890 | |||
| 1310 | Ga0068859_100299524 | |||
| 1311 | Ga0068859_100703892 | |||
| 1312 | Ga0068864_100028236 | |||
| 1313 | Ga0068864_100061038 | |||
| 1314 | Ga0068864_100314088 | |||
| 1315 | Ga0068864_100444532 | |||
| 1316 | Ga0068864_101148054 | |||
| 1317 | Ga0068861_100583262 | |||
| 1318 | Ga0068851_10016284 | |||
| 1319 | Ga0068851_10020242 | |||
| 1320 | Ga0068851_10080838 | |||
| 1321 | Ga0068851_10153411 | |||
| 1322 | Ga0068851_10227401 | |||
| 1323 | Ga0068851_10501739 | |||
| 1324 | Ga0068870_10069758 | |||
| 1325 | Ga0068870_11322177 | |||
| 1326 | Ga0068863_100005172 | |||
| 1327 | Ga0068863_100014937 | |||
| 1328 | Ga0068863_100036472 | |||
| 1329 | Ga0068863_100138633 | |||
| 1330 | Ga0068863_100287156 | |||
| 1331 | Ga0068863_100291612 | |||
| 1332 | Ga0068858_100023025 | |||
| 1333 | Ga0068858_100027858 | |||
| 1334 | Ga0068858_100111933 | |||
| 1335 | Ga0068858_100116331 | |||
| 1336 | Ga0068860_100005183 | |||
| 1337 | Ga0068860_100008281 | |||
| 1338 | Ga0068860_100219301 | |||
| 1339 | Ga0068860_100224409 | |||
| 1340 | Ga0068860_100461993 | |||
| 1341 | Ga0068860_100463229 | |||
| 1342 | Ga0068860_100593493 | |||
| 1343 | Ga0068860_101030615 | |||
| 1344 | Ga0068862_100002736 | |||
| 1345 | Ga0068862_100028673 | |||
| 1346 | Ga0068862_100048154 | |||
| 1347 | Ga0068862_100260236 | |||
| 1348 | Ga0068862_100410996 | |||
| 1349 | Ga0068862_100630013 | |||
| 1350 | Ga0081539_10028927 | |||
| 1351 | Ga0075366_10321775 | |||
| 1352 | Ga0097621_100004831 | |||
| 1353 | Ga0097621_100030925 | |||
| 1354 | Ga0097621_100057667 | |||
| 1355 | Ga0097621_100321242 | |||
| 1356 | Ga0068871_100007517 | |||
| 1357 | Ga0068871_100173586 | |||
| 1358 | Ga0068871_100818466 | |||
| 1359 | Ga0075431_101560271 | |||
| 1360 | Ga0075433_10096914 | |||
| 1361 | Ga0075434_100077462 | |||
| 1362 | Ga0068865_100030645 | |||
| 1363 | Ga0068865_100448526 | |||
| 1364 | Ga0068865_100494219 | |||
| 1365 | Ga0097620_100030114 | |||
| 1366 | Ga0097620_100030685 | |||
| 1367 | Ga0097620_100159890 | |||
| 1368 | Ga0097620_100299543 | |||
| 1369 | Ga0097620_100703896 | |||
| 1370 | Ga0075435_100114674 | |||
| 1371 | Ga0105240_10009782 | |||
| 1372 | Ga0105240_10037918 | |||
| 1373 | Ga0105240_10204343 | |||
| 1374 | Ga0111539_10228685 | |||
| 1375 | Ga0105245_12089080 | |||
| 1376 | Ga0105247_10525326 | |||
| 1377 | Ga0114129_10471580 | |||
| 1378 | Ga0105243_10035268 | |||
| 1379 | Ga0105243_11407605 | |||
| 1380 | Ga0105243_11416958 | |||
| 1381 | Ga0105241_10057130 | |||
| 1382 | Ga0105241_10244469 | |||
| 1383 | Ga0105241_10309138 | |||
| 1384 | Ga0105241_10332714 | |||
| 1385 | Ga0105241_11138797 | |||
| 1386 | Ga0105241_11732985 | |||
| 1387 | Ga0105242_10073172 | |||
| 1388 | Ga0105248_10010355 | |||
| 1389 | Ga0105248_10031916 | |||
| 1390 | Ga0105248_10047959 | |||
| 1391 | Ga0105248_10126192 | |||
| 1392 | Ga0105248_12875060 | |||
| 1393 | Ga0105237_10010455 | |||
| 1394 | Ga0105237_10612210 | |||
| 1395 | Ga0105238_10002513 | |||
| 1396 | Ga0105238_10008543 | |||
| 1397 | Ga0105238_10017853 | |||
| 1398 | Ga0105238_10092286 | |||
| 1399 | Ga0105238_12304016 | |||
| 1400 | Ga0105249_10008517 | |||
| 1401 | Ga0105249_10041715 | |||
| 1402 | Ga0105249_10054591 | |||
| 1403 | Ga0105249_11940707 | |||
| 1404 | Ga0105239_10151161 | |||
| 1405 | Ga0105239_10186338 | |||
| 1406 | Ga0105239_10680213 | |||
| 1407 | Ga0105239_13367732 | |||
| 1408 | Ga0105246_10006278 | |||
| 1409 | Ga0105246_10598571 | |||
| 1410 | Ga0157373_10001899 | |||
| 1411 | Ga0157373_10014261 | |||
| 1412 | Ga0157373_10018364 | |||
| 1413 | Ga0157373_10028680 | |||
| 1414 | Ga0157373_10225276 | |||
| 1415 | Ga0157373_10244567 | |||
| 1416 | Ga0157373_10637514 | |||
| 1417 | Ga0157373_10664608 | |||
| 1418 | Ga0157373_10711032 | |||
| 1419 | Ga0157371_10016811 | |||
| 1420 | Ga0157371_10058821 | |||
| 1421 | Ga0157371_10086721 | |||
| 1422 | Ga0157371_10150516 | |||
| 1423 | Ga0157371_10177241 | |||
| 1424 | Ga0157371_10606201 | |||
| 1425 | Ga0157371_10617416 | |||
| 1426 | Ga0157371_10646989 | |||
| 1427 | Ga0157371_10840626 | |||
| 1428 | Ga0157371_10846090 | |||
| 1429 | Ga0157371_10924914 | |||
| 1430 | Ga0157371_11248668 | |||
| 1431 | Ga0157370_10015357 | |||
| 1432 | Ga0157370_10030530 | |||
| 1433 | Ga0157370_10043152 | |||
| 1434 | Ga0157370_10049602 | |||
| 1435 | Ga0157370_10087657 | |||
| 1436 | Ga0157370_10165632 | |||
| 1437 | Ga0157370_10266640 | |||
| 1438 | Ga0157370_10267555 | |||
| 1439 | Ga0157370_10529143 | |||
| 1440 | Ga0157370_10997233 | |||
| 1441 | Ga0157369_10011269 | |||
| 1442 | Ga0157369_10026544 | |||
| 1443 | Ga0157369_10097016 | |||
| 1444 | Ga0157369_10110514 | |||
| 1445 | Ga0157369_10136161 | |||
| 1446 | Ga0157369_10252179 | |||
| 1447 | Ga0157369_10966875 | |||
| 1448 | Ga0157374_10158088 | |||
| 1449 | Ga0157374_10451423 | |||
| 1450 | Ga0157374_11150481 | |||
| 1451 | Ga0157378_11020559 | |||
| 1452 | Ga0163162_10021069 | |||
| 1453 | Ga0163162_10115725 | |||
| 1454 | Ga0163162_10743552 | |||
| 1455 | Ga0163162_11602953 | |||
| 1456 | Ga0157372_10004040 | |||
| 1457 | Ga0157372_10029471 | |||
| 1458 | Ga0157372_10044454 | |||
| 1459 | Ga0157372_10099009 | |||
| 1460 | Ga0157372_10102994 | |||
| 1461 | Ga0157372_10340606 | |||
| 1462 | Ga0157372_10385244 | |||
| 1463 | Ga0157372_10443753 | |||
| 1464 | Ga0157372_10700979 | |||
| 1465 | Ga0157372_10750785 | |||
| 1466 | Ga0157372_11277799 | |||
| 1467 | Ga0157372_11319716 | |||
| 1468 | Ga0157375_10014100 | |||
| 1469 | Ga0157375_10168279 | |||
| 1470 | Ga0157375_10289995 | |||
| 1471 | Ga0157375_10566424 | |||
| 1472 | Ga0163163_10037594 | |||
| 1473 | Ga0163163_10983305 | |||
| 1474 | Ga0157380_11459356 | |||
| 1475 | Ga0182008_10296950 | |||
| 1476 | Ga0182008_10461846 | |||
| 1477 | Ga0157377_10020706 | |||
| 1478 | Ga0157379_10063298 | |||
| 1479 | Ga0157376_12650254 | |||
| 1480 | Ga0163161_10257971 | |||
| 1481 | Ga0163161_10456764 | |||
| 1482 | Ga0206356_10965601 | |||
| 1483 | Ga0206353_11202403 | |||
| 1484 | Ga0206353_11906044 | |||
| 1485 | Ga0207697_10024948 | |||
| 1486 | Ga0207656_10033899 | |||
| 1487 | Ga0207656_10055130 | |||
| 1488 | Ga0207653_10057109 | |||
| 1489 | Ga0207682_10043576 | |||
| 1490 | Ga0207682_10051377 | |||
| 1491 | Ga0207682_10093543 | |||
| 1492 | Ga0207688_10045051 | |||
| 1493 | Ga0207688_10051937 | |||
| 1494 | Ga0207688_10197006 | |||
| 1495 | Ga0207680_10038947 | |||
| 1496 | Ga0207680_10103553 | |||
| 1497 | Ga0207680_10145850 | |||
| 1498 | Ga0207680_10188038 | |||
| 1499 | Ga0207680_10286196 | |||
| 1500 | Ga0207647_10000721 | |||
| 1501 | Ga0207647_10002263 | |||
| 1502 | Ga0207647_10002940 | |||
| 1503 | Ga0207647_10006442 | |||
| 1504 | Ga0207647_10015955 | |||
| 1505 | Ga0207647_10064843 | |||
| 1506 | Ga0207647_10146109 | |||
| 1507 | Ga0207647_10149786 | |||
| 1508 | Ga0207647_10152481 | |||
| 1509 | Ga0207647_10452625 | |||
| 1510 | Ga0207645_10013495 | |||
| 1511 | Ga0207645_10030977 | |||
| 1512 | Ga0207645_10110577 | |||
| 1513 | Ga0207645_10419571 | |||
| 1514 | Ga0207643_10074500 | |||
| 1515 | Ga0207705_10008024 | |||
| 1516 | Ga0207705_10011549 | |||
| 1517 | Ga0207705_10013549 | |||
| 1518 | Ga0207705_10029514 | |||
| 1519 | Ga0207705_10072616 | |||
| 1520 | Ga0207705_10073179 | |||
| 1521 | Ga0207705_10096779 | |||
| 1522 | Ga0207705_10106467 | |||
| 1523 | Ga0207705_10180652 | |||
| 1524 | Ga0207705_10273680 | |||
| 1525 | Ga0207705_10326417 | |||
| 1526 | Ga0207705_11546460 | |||
| 1527 | Ga0207654_10351504 | |||
| 1528 | Ga0207654_10368544 | |||
| 1529 | Ga0207707_10022651 | |||
| 1530 | Ga0207707_10046847 | |||
| 1531 | Ga0207707_10050263 | |||
| 1532 | Ga0207707_10200554 | |||
| 1533 | Ga0207695_10063905 | |||
| 1534 | Ga0207695_10077027 | |||
| 1535 | Ga0207695_10094177 | |||
| 1536 | Ga0207671_10015467 | |||
| 1537 | Ga0207671_10047665 | |||
| 1538 | Ga0207660_10001191 | |||
| 1539 | Ga0207660_10035170 | |||
| 1540 | Ga0207660_10144721 | |||
| 1541 | Ga0207660_10173356 | |||
| 1542 | Ga0207660_10885451 | |||
| 1543 | Ga0207657_10002867 | |||
| 1544 | Ga0207657_10008053 | |||
| 1545 | Ga0207657_10009578 | |||
| 1546 | Ga0207657_10022956 | |||
| 1547 | Ga0207657_10028130 | |||
| 1548 | Ga0207657_10029311 | |||
| 1549 | Ga0207657_10060183 | |||
| 1550 | Ga0207657_10070842 | |||
| 1551 | Ga0207657_10079248 | |||
| 1552 | Ga0207657_10151116 | |||
| 1553 | Ga0207657_10260087 | |||
| 1554 | Ga0207649_10006009 | |||
| 1555 | Ga0207649_10010089 | |||
| 1556 | Ga0207649_10069552 | |||
| 1557 | Ga0207649_10076186 | |||
| 1558 | Ga0207649_10083885 | |||
| 1559 | Ga0207649_10092977 | |||
| 1560 | Ga0207649_10098297 | |||
| 1561 | Ga0207649_10108864 | |||
| 1562 | Ga0207649_10148370 | |||
| 1563 | Ga0207649_10171364 | |||
| 1564 | Ga0207649_10232399 | |||
| 1565 | Ga0207649_10245050 | |||
| 1566 | Ga0207652_10052973 | |||
| 1567 | Ga0207652_10128149 | |||
| 1568 | Ga0207652_10172658 | |||
| 1569 | Ga0207652_10200976 | |||
| 1570 | Ga0207652_10639002 | |||
| 1571 | Ga0207652_11210053 | |||
| 1572 | Ga0207681_10008742 | |||
| 1573 | Ga0207681_10047145 | |||
| 1574 | Ga0207681_10299015 | |||
| 1575 | Ga0207681_10411100 | |||
| 1576 | Ga0207681_10605975 | |||
| 1577 | Ga0207681_11760464 | |||
| 1578 | Ga0207694_10001011 | |||
| 1579 | Ga0207694_10031528 | |||
| 1580 | Ga0207694_10181029 | |||
| 1581 | Ga0207694_10279765 | |||
| 1582 | Ga0207694_11755117 | |||
| 1583 | Ga0207650_10006425 | |||
| 1584 | Ga0207650_10013438 | |||
| 1585 | Ga0207650_10020000 | |||
| 1586 | Ga0207650_10196649 | |||
| 1587 | Ga0207650_10506385 | |||
| 1588 | Ga0207650_11111577 | |||
| 1589 | Ga0207659_10060719 | |||
| 1590 | Ga0207659_10211152 | |||
| 1591 | Ga0207659_10709100 | |||
| 1592 | Ga0207687_10212147 | |||
| 1593 | Ga0207664_10007802 | |||
| 1594 | Ga0207664_10029928 | |||
| 1595 | Ga0207664_11404326 | |||
| 1596 | Ga0207664_11982082 | |||
| 1597 | Ga0207644_10022018 | |||
| 1598 | Ga0207644_10134227 | |||
| 1599 | Ga0207644_10201331 | |||
| 1600 | Ga0207644_10310474 | |||
| 1601 | Ga0207644_10339824 | |||
| 1602 | Ga0207690_10001891 | |||
| 1603 | Ga0207690_10006698 | |||
| 1604 | Ga0207690_10011850 | |||
| 1605 | Ga0207690_10015745 | |||
| 1606 | Ga0207690_10038089 | |||
| 1607 | Ga0207690_10061615 | |||
| 1608 | Ga0207690_10066029 | |||
| 1609 | Ga0207690_10163215 | |||
| 1610 | Ga0207690_10182575 | |||
| 1611 | Ga0207690_10284597 | |||
| 1612 | Ga0207690_10459273 | |||
| 1613 | Ga0207690_10572068 | |||
| 1614 | Ga0207690_10824636 | |||
| 1615 | Ga0207690_10892118 | |||
| 1616 | Ga0207690_11060609 | |||
| 1617 | Ga0207690_11069111 | |||
| 1618 | Ga0207690_11084396 | |||
| 1619 | Ga0207690_11172023 | |||
| 1620 | Ga0207706_10001211 | |||
| 1621 | Ga0207706_10002133 | |||
| 1622 | Ga0207706_10007955 | |||
| 1623 | Ga0207706_10025809 | |||
| 1624 | Ga0207706_10028223 | |||
| 1625 | Ga0207706_10047473 | |||
| 1626 | Ga0207706_10071714 | |||
| 1627 | Ga0207706_10077606 | |||
| 1628 | Ga0207706_10132127 | |||
| 1629 | Ga0207706_10152015 | |||
| 1630 | Ga0207706_10297553 | |||
| 1631 | Ga0207706_10362241 | |||
| 1632 | Ga0207706_10378374 | |||
| 1633 | Ga0207706_10439236 | |||
| 1634 | Ga0207706_10451707 | |||
| 1635 | Ga0207686_10051627 | |||
| 1636 | Ga0207709_10472310 | |||
| 1637 | Ga0207709_10905195 | |||
| 1638 | Ga0207670_10358206 | |||
| 1639 | Ga0207669_10161360 | |||
| 1640 | Ga0207669_10359053 | |||
| 1641 | Ga0207669_10867151 | |||
| 1642 | Ga0207704_10378311 | |||
| 1643 | Ga0207704_10724837 | |||
| 1644 | Ga0207691_10004966 | |||
| 1645 | Ga0207691_10014906 | |||
| 1646 | Ga0207691_10071051 | |||
| 1647 | Ga0207691_10129771 | |||
| 1648 | Ga0207691_10223053 | |||
| 1649 | Ga0207691_10301112 | |||
| 1650 | Ga0207711_10006337 | |||
| 1651 | Ga0207711_10010388 | |||
| 1652 | Ga0207711_10062345 | |||
| 1653 | Ga0207711_10077519 | |||
| 1654 | Ga0207711_11277288 | |||
| 1655 | Ga0207689_10070162 | |||
| 1656 | Ga0207661_10027360 | |||
| 1657 | Ga0207661_10319413 | |||
| 1658 | Ga0207679_10004621 | |||
| 1659 | Ga0207679_10020613 | |||
| 1660 | Ga0207679_10022960 | |||
| 1661 | Ga0207679_10065533 | |||
| 1662 | Ga0207679_10066772 | |||
| 1663 | Ga0207679_10135932 | |||
| 1664 | Ga0207679_10144393 | |||
| 1665 | Ga0207679_10345768 | |||
| 1666 | Ga0207679_10986398 | |||
| 1667 | Ga0207679_11962342 | |||
| 1668 | Ga0207667_10018675 | |||
| 1669 | Ga0207667_10036759 | |||
| 1670 | Ga0207667_10039888 | |||
| 1671 | Ga0207667_10084198 | |||
| 1672 | Ga0207667_10139366 | |||
| 1673 | Ga0207667_10498013 | |||
| 1674 | Ga0207667_10558596 | |||
| 1675 | Ga0207651_10015209 | |||
| 1676 | Ga0207651_10157945 | |||
| 1677 | Ga0207651_10181125 | |||
| 1678 | Ga0207651_10208266 | |||
| 1679 | Ga0207651_10219835 | |||
| 1680 | Ga0207651_10253680 | |||
| 1681 | Ga0207651_10445167 | |||
| 1682 | Ga0207651_11059540 | |||
| 1683 | Ga0207651_11112693 | |||
| 1684 | Ga0207712_10000491 | |||
| 1685 | Ga0207712_10128652 | |||
| 1686 | Ga0207712_10363988 | |||
| 1687 | Ga0207668_10000060 | |||
| 1688 | Ga0207668_10032560 | |||
| 1689 | Ga0207668_10041358 | |||
| 1690 | Ga0207668_10085237 | |||
| 1691 | Ga0207668_10618779 | |||
| 1692 | Ga0207668_10913405 | |||
| 1693 | Ga0207668_11000093 | |||
| 1694 | Ga0207640_10023295 | |||
| 1695 | Ga0207640_10040624 | |||
| 1696 | Ga0207640_10042763 | |||
| 1697 | Ga0207640_10047489 | |||
| 1698 | Ga0207640_10086875 | |||
| 1699 | Ga0207640_10154754 | |||
| 1700 | Ga0207640_10189194 | |||
| 1701 | Ga0207640_10575084 | |||
| 1702 | Ga0207658_10004678 | |||
| 1703 | Ga0207658_10019496 | |||
| 1704 | Ga0207658_10112917 | |||
| 1705 | Ga0207658_10126910 | |||
| 1706 | Ga0207658_10340918 | |||
| 1707 | Ga0207658_10487671 | |||
| 1708 | Ga0207658_10495499 | |||
| 1709 | Ga0207658_10645155 | |||
| 1710 | Ga0207677_10217586 | |||
| 1711 | Ga0207677_10565586 | |||
| 1712 | Ga0207677_10596869 | |||
| 1713 | Ga0207677_12237934 | |||
| 1714 | Ga0207703_10002126 | |||
| 1715 | Ga0207703_10150927 | |||
| 1716 | Ga0207703_10448077 | |||
| 1717 | Ga0207639_10000144 | |||
| 1718 | Ga0207639_10067079 | |||
| 1719 | Ga0207639_10068559 | |||
| 1720 | Ga0207639_10088892 | |||
| 1721 | Ga0207639_10119957 | |||
| 1722 | Ga0207639_10149113 | |||
| 1723 | Ga0207639_10208717 | |||
| 1724 | Ga0207639_10311645 | |||
| 1725 | Ga0207639_10612872 | |||
| 1726 | Ga0207639_10997780 | |||
| 1727 | Ga0207639_11244523 | |||
| 1728 | Ga0207678_10004202 | |||
| 1729 | Ga0207678_10005267 | |||
| 1730 | Ga0207678_10007936 | |||
| 1731 | Ga0207678_10021689 | |||
| 1732 | Ga0207678_10023348 | |||
| 1733 | Ga0207678_10028383 | |||
| 1734 | Ga0207678_10033913 | |||
| 1735 | Ga0207678_10179676 | |||
| 1736 | Ga0207678_10228200 | |||
| 1737 | Ga0207678_10313820 | |||
| 1738 | Ga0207678_11452084 | |||
| 1739 | Ga0207708_11969659 | |||
| 1740 | Ga0207702_10016603 | |||
| 1741 | Ga0207702_10041084 | |||
| 1742 | Ga0207702_10064566 | |||
| 1743 | Ga0207702_10097792 | |||
| 1744 | Ga0207702_10313537 | |||
| 1745 | Ga0207702_10516710 | |||
| 1746 | Ga0207702_10891429 | |||
| 1747 | Ga0207641_10050697 | |||
| 1748 | Ga0207641_10067143 | |||
| 1749 | Ga0207641_10075483 | |||
| 1750 | Ga0207641_10107531 | |||
| 1751 | Ga0207641_10213549 | |||
| 1752 | Ga0207641_10983206 | |||
| 1753 | Ga0207648_10084888 | |||
| 1754 | Ga0207648_10171676 | |||
| 1755 | Ga0207648_10442512 | |||
| 1756 | Ga0207648_11123441 | |||
| 1757 | Ga0207648_11340653 | |||
| 1758 | Ga0207676_10031236 | |||
| 1759 | Ga0207676_10192462 | |||
| 1760 | Ga0207676_10583407 | |||
| 1761 | Ga0207676_10783001 | |||
| 1762 | Ga0207676_11280098 | |||
| 1763 | Ga0207674_10000057 | |||
| 1764 | Ga0207674_10001662 | |||
| 1765 | Ga0207674_10003393 | |||
| 1766 | Ga0207674_10005462 | |||
| 1767 | Ga0207674_10005506 | |||
| 1768 | Ga0207674_10009490 | |||
| 1769 | Ga0207674_10031060 | |||
| 1770 | Ga0207674_10082958 | |||
| 1771 | Ga0207674_10137769 | |||
| 1772 | Ga0207674_10305632 | |||
| 1773 | Ga0207674_11298845 | |||
| 1774 | Ga0207675_100232883 | |||
| 1775 | Ga0207683_10013896 | |||
| 1776 | Ga0207683_10032849 | |||
| 1777 | Ga0207683_10136735 | |||
| 1778 | Ga0207683_11461502 | |||
| 1779 | Ga0207698_10004897 | |||
| 1780 | Ga0207698_10005264 | |||
| 1781 | Ga0207698_10018006 | |||
| 1782 | Ga0207698_10025656 | |||
| 1783 | Ga0207698_10031060 | |||
| 1784 | Ga0207698_10064988 | |||
| 1785 | Ga0207698_10074647 | |||
| 1786 | Ga0207698_10111067 | |||
| 1787 | Ga0207698_10129960 | |||
| 1788 | Ga0207698_10147504 | |||
| 1789 | Ga0207698_10245211 | |||
| 1790 | Ga0207698_10436726 | |||
| 1791 | Ga0209973_1064924 | |||
| 1792 | Ga0207428_10270523 | |||
| 1793 | Ga0268266_10018502 | |||
| 1794 | Ga0268266_10035908 | |||
| 1795 | Ga0268266_11007504 | |||
| 1796 | Ga0268266_11517825 | |||
| 1797 | Ga0268265_10001537 | |||
| 1798 | Ga0268265_10007179 | |||
| 1799 | Ga0268265_10030723 | |||
| 1800 | Ga0268265_10038772 | |||
| 1801 | Ga0268265_10152777 | |||
| 1802 | Ga0268265_10691125 | |||
| 1803 | Ga0268264_10002057 | |||
| 1804 | Ga0268264_10005564 | |||
| 1805 | Ga0268264_10128315 | |||
| 1806 | Ga0268264_10159804 | |||
| 1807 | Ga0268264_10380254 | |||
| 1808 | Ga0268264_10455707 | |||
| 1809 | Ga0268264_10558342 | |||
| 1810 | Ga0268264_10706932 | |||
| 1811 | Ga0307408_100035403 | |||
| 1812 | Ga0307408_100108533 | |||
| 1813 | Ga0307408_100307098 | |||
| 1814 | Ga0307405_10035211 | |||
| 1815 | Ga0307405_10836544 | |||
| 1816 | Ga0307405_11238438 | |||
| 1817 | Ga0307413_10379851 | |||
| 1818 | Ga0307413_10973116 | |||
| 1819 | Ga0307410_10069565 | |||
| 1820 | Ga0307410_10113802 | |||
| 1821 | Ga0307410_10324176 | |||
| 1822 | Ga0307406_10370043 | |||
| 1823 | Ga0307407_10033193 | |||
| 1824 | Ga0307407_10359763 | |||
| 1825 | Ga0307407_10466134 | |||
| 1826 | Ga0307412_10098027 | |||
| 1827 | Ga0307412_10280147 | |||
| 1828 | Ga0307412_10538855 | |||
| 1829 | Ga0307409_100029124 | |||
| 1830 | Ga0307409_100029392 | |||
| 1831 | Ga0307409_100093976 | |||
| 1832 | Ga0307409_100259724 | |||
| 1833 | Ga0307409_100334698 | |||
| 1834 | Ga0307409_101343713 | |||
| 1835 | Ga0307416_100079830 | |||
| 1836 | Ga0307416_100265384 | |||
| 1837 | Ga0307416_100298724 | |||
| 1838 | Ga0307416_100558524 | |||
| 1839 | Ga0307414_10232308 | |||
| 1840 | Ga0307414_10641895 | |||
| 1841 | Ga0307411_10018944 | |||
| 1842 | Ga0307411_10233691 | |||
| 1843 | Ga0307411_10298865 | |||
| 1844 | Ga0307411_10996208 | |||
| 1845 | Ga0307415_100099190 | |||
| 1846 | Ga0307415_100118172 | |||
| 1847 | Ga0307415_100697994 | |||
| 1848 | Ga0395899_0009507 | |||
| 1849 | Ga0395899_0010217 | |||
| 1850 | Ga0395899_0018320 | |||
| 1851 | Ga0395899_0045303 | |||
| 1852 | Ga0395899_0079016 | |||
| 1853 | Ga0395899_0215691 | |||
| 1854 | Ga0395899_0403532 | |||
| 1855 | Ga0395900_0005687 | |||
| 1856 | Ga0395900_0006197 | |||
| 1857 | Ga0395900_0006712 | |||
| 1858 | Ga0395900_0017453 | |||
| 1859 | Ga0395900_0019372 | |||
| 1860 | Ga0395900_0040753 | |||
| 1861 | Ga0395900_0054644 | |||
| 1862 | Ga0395900_0080078 | |||
| 1863 | Ga0395900_0170102 | |||
| 1864 | Ga0395900_0204368 | |||
| 1865 | Ga0395900_0339320 | |||
| 1866 | Ga0395900_0406922 | |||
| 1867 | Ga0395900_0415628 | |||
| 1868 | Ga0395900_0647756 | |||
| 1869 | Ga0395900_1289541 | |||
| 1870 | Ga0395900_1376937 | |||
| 1871 | Ga0395900_1386869 | |||
| 1872 | Ga0395898_0012439 | |||
| 1873 | Ga0395898_0058065 | |||
| 1874 | Ga0395898_0061014 | |||
| 1875 | Ga0395898_0069577 | |||
| 1876 | Ga0395898_0090033 | |||
| 1877 | Ga0395898_0160495 | |||
| 1878 | Ga0395898_0212178 | |||
| 1879 | Ga0395898_0275474 | |||
| 1880 | Ga0395898_0301320 | |||
| 1881 | Ga0395898_0422737 | |||
| 1882 | Ga0395898_0954690 | |||
| 1883 | Ga0395898_1314696 | |||
| 1884 | Ga0395898_1576262 | |||
| 1885 | Ga0395898_1805090 | |||
| 1886 | Ga0395905_0000092 | |||
| 1887 | Ga0395905_0003268 | |||
| 1888 | Ga0395905_0003469 | |||
| 1889 | Ga0395905_0012841 | |||
| 1890 | Ga0395905_0014738 | |||
| 1891 | Ga0395905_0014833 | |||
| 1892 | Ga0395905_0040395 | |||
| 1893 | Ga0395905_0040523 | |||
| 1894 | Ga0395905_0081486 | |||
| 1895 | Ga0395905_0086334 | |||
| 1896 | Ga0395905_0088899 | |||
| 1897 | Ga0395905_0156710 | |||
| 1898 | Ga0395905_0190693 | |||
| 1899 | Ga0395905_0227419 | |||
| 1900 | Ga0395905_0264169 | |||
| 1901 | Ga0395905_0533048 | |||
| 1902 | Ga0395905_1317341 | |||
| 1903 | Ga0395901_0000188 | |||
| 1904 | Ga0395901_0006402 | |||
| 1905 | Ga0395901_0017047 | |||
| 1906 | Ga0395901_0028527 | |||
| 1907 | Ga0395901_0041548 | |||
| 1908 | Ga0395901_0053756 | |||
| 1909 | Ga0395901_0064358 | |||
| 1910 | Ga0395901_0183585 | |||
| 1911 | Ga0395901_0316337 | |||
| 1912 | Ga0395901_0487693 | |||
| 1913 | Ga0395901_1031926 | |||
| 1914 | Ga0395901_1257573 | |||
| 1915 | Ga0439447_092499 | |||
| 1916 | Ga0439461_0021595 | |||
| 1917 | Ga0439465_0068680 | |||
| 1918 | Ga0439432_092058 | |||
| 1919 | Ga0439449_0227088 | |||
| 1920 | Ga0439452_048573 | |||
| 1921 | Ga0439455_0225675 | |||
| 1922 | Ga0450914_000674 | |||
| 1923 | Ga0450905_045588 | |||
| 1924 | Ga0450889_000204 | |||
| 1925 | Ga0439458_0001172 | |||
| 1926 | Ga0466965_0185687 | |||
| 1927 | Ga0466961_0163574 | |||
| 1928 | Ga0466963_0119656 | |||
| 1929 | Ga0466963_0160984 | |||
| 1930 | Ga0466963_0166996 | |||
| 1931 | Ga0466963_0757508 | |||
| 1932 | Ga0466964_0206083 | |||
| 1933 | Ga0466964_0398505 | |||
| 1934 | Ga0466971_0235334 | |||
| 1935 | Ga0466971_0277009 | |||
| 1936 | Ga0466971_0705140 | |||
| 1937 | Ga0466970_0846263 | |||
| 1938 | Ga0466957_0049506 | |||
| 1939 | Ga0466957_0435397 | |||
| 1940 | Ga0466957_0654756 | |||
| 1941 | Ga0466957_1144408 | |||
| 1942 | Ga0466960_0174216 | |||
| 1943 | Ga0466959_0326253 | |||
| 1944 | Ga0466959_0986125 | |||
| 1945 | Ga0466958_0083987 | |||
| 1946 | Ga0466967_0001666 | |||
| 1947 | Ga0466967_0004245 | |||
| 1948 | Ga0466967_0015584 | |||
| 1949 | Ga0466967_0021721 | |||
| 1950 | Ga0466967_0222873 | |||
| 1951 | Ga0466967_0425322 | |||
| 1952 | Ga0466967_0445891 | |||
| 1953 | Ga0495663_0008582 | |||
| 1954 | Ga0495621_0041351 | |||
| 1955 | Ga0495668_0293960 | |||
| 1956 | Ga0495669_0002162 | |||
| 1957 | Ga0495669_0648474 | |||
| 1958 | Ga0495677_0015603 | |||
| 1959 | Ga0495685_089176 | |||
| 1960 | Ga0496100_1318514 | |||
| 1961 | Ga0496101_0213898 | |||
| 1962 | Ga0496102_1120389 | |||
| 1963 | Ga0496103_0097387 | |||
| 1964 | Ga0496106_0462086 | |||
| 1965 | Ga0496106_0737219 | |||
| 1966 | Ga0496107_0154394 | |||
| 1967 | Ga0496107_0354246 | |||
| 1968 | Ga0496107_0449659 | |||
| 1969 | Ga0496107_0763371 | |||
| 1970 | Ga0496108_0647162 | |||
| 1971 | Ga0496109_0557149 | |||
| 1972 | Ga0496111_0115185 | |||
| 1973 | Ga0496111_0296851 | |||
| 1974 | Ga0496111_0702874 | |||
| 1975 | Ga0496112_0375992 | |||
| 1976 | Ga0496113_0144734 | |||
| 1977 | Ga0496114_0036993 | |||
| 1978 | Ga0496115_0037736 | |||
| 1979 | nmdc:mga0k408_330179_c1 | |||
| 1980 | nmdc:mga06r32_1805631_c1 | |||
| 1981 | nmdc:mga08y16_184093_c1 | |||
| 1982 | nmdc:mga0rr50_100459_c1 | |||
| 1983 | nmdc:mga0a205_8689_c1 | |||
| 1984 | Ga0466962_0149268 | |||
| 1985 | Ga0466962_0242704 | |||
| 1986 | Ga0466962_0522112 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7uzk-assembly1.cif.gz_E | rat kidney v1 complex lacking subunit h with sidk and ncoa7b, state 1 | 0.8375 | 34 | 84 |
| 7tmq-assembly1.cif.gz_F | v1 complex lacking subunit c from saccharomyces cerevisiae, state 3 | 0.8358 | 34 | 81 |
| 7une-assembly1.cif.gz_Q | the v1 region of bovine v-atpase in complex with human meak7 (focused refinement) | 0.8344 | 34 | 86 |
| 6vq9-assembly1.cif.gz_D | mammalian v-atpase from rat brain soluble v1 region rotational state 1 with sidk and adp (from focused refinement) | 0.8329 | 34 | 81 |
| 6wm2-assembly1.cif.gz_F | human v-atpase in state 1 with sidk and adp | 0.8299 | 34 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kygA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.7913 | 17 | 83 | 2.40.10.220 |
| 2k8iA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7896 | 48 | 79 | 2.40.10.330 |
| 4dt4A02 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.745 | 41 | 85 | 2.40.10.330 |
| af_Q57670_3_72_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.7365 | 30 | 87 | 2.40.30.20 |
| af_Q54SC0_1_67_2.40.240.20 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.7364 | 37 | 81 | 2.40.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B2AE73-F1-model_v4 | PilZ domain-containing protein | 0.9602 | 32 | 88 |
GO:0035438
|
| AF-A0A7C9IED2-F1-model_v4 | PilZ domain-containing protein | 0.9563 | 18 | 88 |
GO:0035438
|
| AF-A0A6A0RAA2-F1-model_v4 | Uncharacterized protein | 0.9537 | 17 | 82 |
|
| AF-F1ZDH7-F1-model_v4 | PilZ domain-containing protein | 0.9526 | 19 | 90 |
GO:0035438
|
| AF-A0A0T0PZR3-F1-model_v4 | PilZ domain-containing protein | 0.9446 | 17 | 90 |
GO:0035438
|