F487684

General Info

Members Datasets Scaffolds Average Seq Length
993 229 1986 138

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10145490|Ga0157369_101454902
Length 154
Sequence LAASLNEVLPPQAIGFFVDQSSSMTNRRSRRSPVLLAAALELAGRTVPVKLRNLSEEGALVEGDDLPVEGSTTYFHRNELRLEGKVIWVQGRYAGVAFKERLAPEQVLRNVPKPKLRTATEFKRPGFACRPLTDYERRMVEQWMDLPPVASPRI

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
191 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
192 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.91
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 24.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10145490 3300013105 Bacteria 2506
2 JGI24741J21665_1000867 3300001915 Bacteria 9119
3 JGI24740J21852_10002444 3300001979 Bacteria 8426
4 JGI24740J21852_10015262 3300001979 Bacteria 2809
5 JGI24740J21852_10089584 3300001979 Unclassified 795
6 JGI24740J21852_10107735 3300001979 Unclassified 705
7 JGI24740J21852_10114888 3300001979 Unclassified 677
8 JGI24739J22299_10003964 3300001989 Bacteria 5663
9 JGI24739J22299_10009318 3300001989 Bacteria 3662
10 JGI24737J22298_10002168 3300001990 Bacteria 6998
11 JGI24737J22298_10005610 3300001990 Bacteria 4324
12 JGI24737J22298_10074335 3300001990 Bacteria 1013
13 JGI24743J22301_10061826 3300001991 Bacteria 772
14 JGI24735J21928_10000970 3300002067 Bacteria 10261
15 JGI24735J21928_10001752 3300002067 Bacteria 7650
16 JGI24735J21928_10020585 3300002067 Bacteria 2019
17 JGI24735J21928_10077951 3300002067 Bacteria 949
18 JGI24735J21928_10133519 3300002067 Bacteria 716
19 JGI24735J21928_10142113 3300002067 Unclassified 692
20 JGI25406J46586_10260734 3300003203 Unclassified 510
21 Ga0065715_10211467 3300005293 Unclassified 1312
22 Ga0065715_10465005 3300005293 Bacteria 805
23 Ga0070658_10016564 3300005327 Bacteria 5899
24 Ga0070658_10018275 3300005327 Bacteria 5611
25 Ga0070658_10089282 3300005327 Bacteria 2538
26 Ga0070658_10190935 3300005327 Bacteria 1726
27 Ga0070658_10445404 3300005327 Bacteria 1115
28 Ga0070658_10758480 3300005327 Bacteria 843
29 Ga0070658_10995793 3300005327 Bacteria 729
30 Ga0070676_10009673 3300005328 Bacteria 5213
31 Ga0070676_10184729 3300005328 Bacteria 1358
32 Ga0070676_10349086 3300005328 Bacteria 1017
33 Ga0070676_10497349 3300005328 Unclassified 865
34 Ga0070676_10783907 3300005328 Unclassified 702
35 Ga0070683_100001584 3300005329 Bacteria 17600
36 Ga0070683_100006972 3300005329 Bacteria 9504
37 Ga0070683_100012444 3300005329 Bacteria 7395
38 Ga0070683_100046392 3300005329 Bacteria 4014
39 Ga0070683_100142351 3300005329 Bacteria 2272
40 Ga0070683_100517580 3300005329 Bacteria 1140
41 Ga0070690_100806541 3300005330 Bacteria 728
42 Ga0070690_101461423 3300005330 Unclassified 551
43 Ga0070670_100022358 3300005331 Bacteria 5443
44 Ga0070670_100032462 3300005331 Bacteria 4497
45 Ga0070670_100042083 3300005331 Bacteria 3926
46 Ga0070670_100128865 3300005331 Bacteria 2184
47 Ga0070670_100253068 3300005331 Bacteria 1535
48 Ga0070677_10017821 3300005333 Unclassified 2548
49 Ga0070677_10039196 3300005333 Bacteria 1858
50 Ga0070677_10195632 3300005333 Bacteria 972
51 Ga0070677_10282147 3300005333 Bacteria 837
52 Ga0068869_100007144 3300005334 Bacteria 7117
53 Ga0068869_100569989 3300005334 Bacteria 953
54 Ga0070666_10018749 3300005335 Bacteria 4455
55 Ga0070666_10055794 3300005335 Bacteria 2667
56 Ga0070666_10074253 3300005335 Bacteria 2317
57 Ga0070666_10117152 3300005335 Bacteria 1845
58 Ga0070666_10157780 3300005335 Unclassified 1585
59 Ga0070666_10394078 3300005335 Bacteria 995
60 Ga0070680_100002188 3300005336 Bacteria 14408
61 Ga0070680_100011586 3300005336 Bacteria 6829
62 Ga0070680_100048410 3300005336 Bacteria 3464
63 Ga0070680_100277387 3300005336 Bacteria 1420
64 Ga0070680_100280585 3300005336 Bacteria 1411
65 Ga0070680_100299822 3300005336 Bacteria 1363
66 Ga0070682_100003586 3300005337 Bacteria 8594
67 Ga0070682_100038426 3300005337 Bacteria 2936
68 Ga0070682_100085170 3300005337 Bacteria 2056
69 Ga0070682_100202095 3300005337 Bacteria 1402
70 Ga0070682_100839227 3300005337 Unclassified 750
71 Ga0068868_100016525 3300005338 Bacteria 5483
72 Ga0068868_100089857 3300005338 Bacteria 2473
73 Ga0068868_100714200 3300005338 Unclassified 898
74 Ga0070660_100003337 3300005339 Bacteria 11034
75 Ga0070660_100030266 3300005339 Bacteria 4061
76 Ga0070660_100038928 3300005339 Bacteria 3612
77 Ga0070660_100092565 3300005339 Bacteria 2386
78 Ga0070660_100132154 3300005339 Bacteria 1998
79 Ga0070660_100135947 3300005339 Bacteria 1969
80 Ga0070660_100152144 3300005339 Unclassified 1861
81 Ga0070660_100156277 3300005339 Bacteria 1836
82 Ga0070660_100226822 3300005339 Bacteria 1519
83 Ga0070660_100246347 3300005339 Bacteria 1456
84 Ga0070660_100259918 3300005339 Bacteria 1417
85 Ga0070660_100305876 3300005339 Bacteria 1304
86 Ga0070660_101876991 3300005339 Unclassified 511
87 Ga0070689_100789512 3300005340 Unclassified 834
88 Ga0070691_10032882 3300005341 Bacteria 2438
89 Ga0070691_10074238 3300005341 Bacteria 1654
90 Ga0070661_100004629 3300005344 Bacteria 9467
91 Ga0070661_100016515 3300005344 Bacteria 5221
92 Ga0070661_100026111 3300005344 Unclassified 4198
93 Ga0070661_100030374 3300005344 Bacteria 3903
94 Ga0070661_100031892 3300005344 Bacteria 3812
95 Ga0070661_100082414 3300005344 Unclassified 2375
96 Ga0070661_100107514 3300005344 Unclassified 2080
97 Ga0070661_100113918 3300005344 Bacteria 2021
98 Ga0070661_100194702 3300005344 Unclassified 1547
99 Ga0070661_100384113 3300005344 Bacteria 1107
100 Ga0070661_100422604 3300005344 Bacteria 1057
101 Ga0070661_100477474 3300005344 Bacteria 995
102 Ga0070692_10000457 3300005345 Bacteria 12459
103 Ga0070692_10040506 3300005345 Unclassified 2383
104 Ga0070692_10216645 3300005345 Bacteria 1129
105 Ga0070692_10414175 3300005345 Unclassified 854
106 Ga0070668_100003267 3300005347 Bacteria 11949
107 Ga0070668_100009416 3300005347 Bacteria 7246
108 Ga0070668_100051859 3300005347 Bacteria 3162
109 Ga0070668_100409734 3300005347 Bacteria 1159
110 Ga0070668_100477038 3300005347 Unclassified 1077
111 Ga0070668_100815403 3300005347 Bacteria 830
112 Ga0070668_101135636 3300005347 Unclassified 706
113 Ga0070669_100020434 3300005353 Bacteria 4729
114 Ga0070669_100032975 3300005353 Bacteria 3743
115 Ga0070669_101309023 3300005353 Unclassified 627
116 Ga0070675_100056143 3300005354 Bacteria 3244
117 Ga0070675_100155099 3300005354 Bacteria 1966
118 Ga0070675_100197553 3300005354 Unclassified 1745
119 Ga0070675_100256298 3300005354 Bacteria 1532
120 Ga0070671_100023728 3300005355 Bacteria 5020
121 Ga0070671_100580857 3300005355 Unclassified 968
122 Ga0070671_100607023 3300005355 Unclassified 946
123 Ga0070671_101187810 3300005355 Bacteria 671
124 Ga0070674_100183757 3300005356 Bacteria 1603
125 Ga0070674_100277940 3300005356 Bacteria 1326
126 Ga0070674_100344924 3300005356 Bacteria 1201
127 Ga0070673_100002262 3300005364 Bacteria 11674
128 Ga0070673_100003681 3300005364 Bacteria 9603
129 Ga0070673_100012846 3300005364 Bacteria 5765
130 Ga0070673_100026793 3300005364 Unclassified 4262
131 Ga0070673_100262978 3300005364 Bacteria 1508
132 Ga0070673_100325003 3300005364 Bacteria 1360
133 Ga0070673_100451108 3300005364 Bacteria 1157
134 Ga0070673_100537300 3300005364 Unclassified 1061
135 Ga0070673_100776599 3300005364 Unclassified 883
136 Ga0070673_101156145 3300005364 Bacteria 724
137 Ga0070673_101240329 3300005364 Bacteria 699
138 Ga0070659_100000952 3300005366 Bacteria 21291
139 Ga0070659_100013633 3300005366 Bacteria 6055
140 Ga0070659_100016873 3300005366 Bacteria 5488
141 Ga0070659_100031512 3300005366 Bacteria 4107
142 Ga0070659_100047040 3300005366 Bacteria 3383
143 Ga0070659_100052634 3300005366 Bacteria 3203
144 Ga0070659_100082356 3300005366 Unclassified 2570
145 Ga0070659_100090118 3300005366 Bacteria 2457
146 Ga0070659_100097739 3300005366 Bacteria 2360
147 Ga0070659_100161273 3300005366 Bacteria 1833
148 Ga0070659_100221554 3300005366 Bacteria 1561
149 Ga0070659_100255697 3300005366 Bacteria 1452
150 Ga0070659_100257565 3300005366 Unclassified 1447
151 Ga0070659_100260211 3300005366 Unclassified 1439
152 Ga0070659_100322658 3300005366 Bacteria 1291
153 Ga0070659_100330999 3300005366 Unclassified 1275
154 Ga0070659_100451931 3300005366 Bacteria 1090
155 Ga0070659_100465858 3300005366 Bacteria 1074
156 Ga0070659_100612614 3300005366 Bacteria 936
157 Ga0070659_100719967 3300005366 Bacteria 864
158 Ga0070667_100017309 3300005367 Bacteria 5972
159 Ga0070667_100032746 3300005367 Unclassified 4337
160 Ga0070667_100037562 3300005367 Bacteria 4060
161 Ga0070667_100066053 3300005367 Bacteria 3073
162 Ga0070667_100246800 3300005367 Bacteria 1595
163 Ga0070667_100805577 3300005367 Bacteria 872
164 Ga0070667_100882085 3300005367 Bacteria 832
165 Ga0070714_100026304 3300005435 Bacteria 4808
166 Ga0070714_100040484 3300005435 Bacteria 3928
167 Ga0070714_100170508 3300005435 Unclassified 1975
168 Ga0070714_100178880 3300005435 Bacteria 1929
169 Ga0070700_100647404 3300005441 Unclassified 834
170 Ga0070694_100011422 3300005444 Bacteria 5500
171 Ga0070694_100221368 3300005444 Unclassified 1420
172 Ga0070663_100007719 3300005455 Bacteria 6569
173 Ga0070663_100039836 3300005455 Bacteria 3286
174 Ga0070663_100102619 3300005455 Bacteria 2137
175 Ga0070663_100117035 3300005455 Unclassified 2009
176 Ga0070663_100206373 3300005455 Unclassified 1536
177 Ga0070663_100265782 3300005455 Bacteria 1362
178 Ga0070663_100592348 3300005455 Unclassified 931
179 Ga0070663_100770821 3300005455 Unclassified 823
180 Ga0070678_100084285 3300005456 Bacteria 2419
181 Ga0070678_100371528 3300005456 Unclassified 1235
182 Ga0070678_100551631 3300005456 Unclassified 1023
183 Ga0070678_101270431 3300005456 Bacteria 684
184 Ga0070662_100008823 3300005457 Bacteria 6572
185 Ga0070662_100026697 3300005457 Bacteria 4002
186 Ga0070662_100056154 3300005457 Bacteria 2858
187 Ga0070662_100133449 3300005457 Bacteria 1917
188 Ga0070662_100161718 3300005457 Unclassified 1752
189 Ga0070662_100197031 3300005457 Bacteria 1596
190 Ga0070662_100197718 3300005457 Bacteria 1593
191 Ga0070662_100242475 3300005457 Unclassified 1446
192 Ga0070662_100266233 3300005457 Bacteria 1382
193 Ga0070662_100272839 3300005457 Bacteria 1366
194 Ga0070681_10007382 3300005458 Bacteria 10745
195 Ga0070681_10063354 3300005458 Bacteria 3669
196 Ga0070681_10065670 3300005458 Bacteria 3597
197 Ga0070681_10252056 3300005458 Bacteria 1678
198 Ga0070681_10391969 3300005458 Unclassified 1300
199 Ga0070681_10910707 3300005458 Unclassified 798
200 Ga0068867_100007573 3300005459 Bacteria 7684
201 Ga0068867_100135689 3300005459 Bacteria 1917
202 Ga0068867_100157805 3300005459 Unclassified 1787
203 Ga0068867_101318542 3300005459 Viruses 667
204 Ga0068867_101640496 3300005459 Bacteria 602
205 Ga0068867_102032465 3300005459 Unclassified 543
206 Ga0070679_100012704 3300005530 Bacteria 8055
207 Ga0070679_100031193 3300005530 Bacteria 5265
208 Ga0070679_100136079 3300005530 Unclassified 2438
209 Ga0070679_100138052 3300005530 Bacteria 2419
210 Ga0070679_100454789 3300005530 Bacteria 1225
211 Ga0070679_100680354 3300005530 Unclassified 971
212 Ga0070679_100690219 3300005530 Unclassified 964
213 Ga0070679_100752261 3300005530 Bacteria 917
214 Ga0070679_100774990 3300005530 Bacteria 902
215 Ga0070679_100961820 3300005530 Bacteria 798
216 Ga0070684_100064378 3300005535 Bacteria 3216
217 Ga0070684_100067819 3300005535 Bacteria 3135
218 Ga0070684_100113622 3300005535 Bacteria 2430
219 Ga0070684_100352556 3300005535 Unclassified 1354
220 Ga0068853_100015024 3300005539 Bacteria 6361
221 Ga0068853_100073208 3300005539 Bacteria 2986
222 Ga0068853_100108935 3300005539 Bacteria 2458
223 Ga0068853_100127936 3300005539 Unclassified 2271
224 Ga0068853_100206773 3300005539 Bacteria 1788
225 Ga0068853_100381987 3300005539 Unclassified 1315
226 Ga0068853_100418516 3300005539 Bacteria 1256
227 Ga0068853_100483414 3300005539 Bacteria 1167
228 Ga0068853_100503150 3300005539 Bacteria 1144
229 Ga0068853_100538784 3300005539 Bacteria 1105
230 Ga0068853_102264796 3300005539 Unclassified 526
231 Ga0070672_100006694 3300005543 Bacteria 7767
232 Ga0070672_100053147 3300005543 Bacteria 3166
233 Ga0070672_100158575 3300005543 Bacteria 1875
234 Ga0070672_100507355 3300005543 Viruses 1044
235 Ga0070672_100571992 3300005543 Unclassified 983
236 Ga0070696_100142813 3300005546 Unclassified 1751
237 Ga0070696_100158136 3300005546 Bacteria 1668
238 Ga0070696_100287638 3300005546 Bacteria 1255
239 Ga0070696_100788383 3300005546 Unclassified 781
240 Ga0070693_100034766 3300005547 Bacteria 2790
241 Ga0070693_100079256 3300005547 Bacteria 1954
242 Ga0070693_100083179 3300005547 Unclassified 1912
243 Ga0070693_100324832 3300005547 Unclassified 1045
244 Ga0070693_100652817 3300005547 Unclassified 765
245 Ga0070693_101002284 3300005547 Bacteria 632
246 Ga0070665_100016938 3300005548 Bacteria 7307
247 Ga0070665_100038981 3300005548 Bacteria 4777
248 Ga0070665_100102479 3300005548 Bacteria 2866
249 Ga0070665_100201534 3300005548 Bacteria 1991
250 Ga0068855_100001622 3300005563 Bacteria 28214
251 Ga0068855_100019513 3300005563 Bacteria 8147
252 Ga0068855_100028425 3300005563 Bacteria 6689
253 Ga0068855_100138516 3300005563 Unclassified 2775
254 Ga0068855_100355939 3300005563 Bacteria 1612
255 Ga0068855_100381148 3300005563 Bacteria 1548
256 Ga0068855_100415076 3300005563 Bacteria 1473
257 Ga0068855_100477501 3300005563 Bacteria 1357
258 Ga0070664_100000066 3300005564 Bacteria 65204
259 Ga0070664_100026936 3300005564 Bacteria 4774
260 Ga0070664_100030149 3300005564 Unclassified 4525
261 Ga0070664_100046327 3300005564 Bacteria 3672
262 Ga0070664_100072355 3300005564 Bacteria 2956
263 Ga0070664_100077575 3300005564 Bacteria 2856
264 Ga0070664_100137483 3300005564 Unclassified 2149
265 Ga0070664_100195994 3300005564 Unclassified 1801
266 Ga0070664_100196256 3300005564 Unclassified 1799
267 Ga0070664_100210254 3300005564 Unclassified 1738
268 Ga0070664_100307603 3300005564 Unclassified 1433
269 Ga0070664_100493552 3300005564 Bacteria 1128
270 Ga0070664_100496690 3300005564 Bacteria 1124
271 Ga0068857_100003820 3300005577 Bacteria 12676
272 Ga0068857_100036247 3300005577 Bacteria 4371
273 Ga0068857_100052081 3300005577 Bacteria 3632
274 Ga0068857_100054790 3300005577 Bacteria 3539
275 Ga0068857_100062010 3300005577 Bacteria 3323
276 Ga0068857_100102224 3300005577 Unclassified 2572
277 Ga0068857_100109609 3300005577 Bacteria 2481
278 Ga0068857_100128369 3300005577 Bacteria 2285
279 Ga0068857_100202522 3300005577 Unclassified 1809
280 Ga0068857_100519850 3300005577 Bacteria 1119
281 Ga0068854_100011462 3300005578 Bacteria 5776
282 Ga0068854_100027419 3300005578 Bacteria 3926
283 Ga0068854_100028677 3300005578 Bacteria 3848
284 Ga0068854_100030513 3300005578 Bacteria 3739
285 Ga0068854_100050449 3300005578 Bacteria 2977
286 Ga0068854_100056060 3300005578 Bacteria 2839
287 Ga0068854_100185323 3300005578 Unclassified 1628
288 Ga0068854_100253841 3300005578 Bacteria 1405
289 Ga0068854_100330098 3300005578 Bacteria 1242
290 Ga0068856_100000213 3300005614 Bacteria 62582
291 Ga0068856_100036106 3300005614 Bacteria 4846
292 Ga0068856_100052623 3300005614 Bacteria 4016
293 Ga0068856_100082243 3300005614 Bacteria 3196
294 Ga0068856_100109309 3300005614 Bacteria 2761
295 Ga0068856_100121053 3300005614 Bacteria 2618
296 Ga0068856_100189095 3300005614 Bacteria 2073
297 Ga0068856_100268011 3300005614 Unclassified 1723
298 Ga0068856_100373244 3300005614 Unclassified 1445
299 Ga0068856_100374064 3300005614 Bacteria 1443
300 Ga0068856_100788395 3300005614 Unclassified 970
301 Ga0068856_100847412 3300005614 Bacteria 933
302 Ga0068852_100001507 3300005616 Bacteria 15764
303 Ga0068852_100006300 3300005616 Bacteria 8565
304 Ga0068852_100008088 3300005616 Bacteria 7717
305 Ga0068852_100011209 3300005616 Bacteria 6736
306 Ga0068852_100014400 3300005616 Bacteria 6088
307 Ga0068852_100026871 3300005616 Bacteria 4684
308 Ga0068852_100053153 3300005616 Bacteria 3485
309 Ga0068852_100273733 3300005616 Unclassified 1626
310 Ga0068852_100371446 3300005616 Bacteria 1401
311 Ga0068852_100447655 3300005616 Bacteria 1278
312 Ga0068852_100584025 3300005616 Bacteria 1120
313 Ga0068852_100615292 3300005616 Bacteria 1091
314 Ga0068859_100030114 3300005617 Bacteria 5445
315 Ga0068859_100030683 3300005617 Bacteria 5394
316 Ga0068859_100159890 3300005617 Unclassified 2332
317 Ga0068859_100299524 3300005617 Bacteria 1701
318 Ga0068859_100703892 3300005617 Bacteria 1101
319 Ga0068864_100028236 3300005618 Bacteria 4740
320 Ga0068864_100061038 3300005618 Bacteria 3265
321 Ga0068864_100314088 3300005618 Unclassified 1470
322 Ga0068864_100444532 3300005618 Bacteria 1239
323 Ga0068864_101148054 3300005618 Unclassified 774
324 Ga0068861_100583262 3300005719 Bacteria 1024
325 Ga0068851_10016284 3300005834 Bacteria 3556
326 Ga0068851_10020242 3300005834 Bacteria 3219
327 Ga0068851_10080838 3300005834 Bacteria 1697
328 Ga0068851_10153411 3300005834 Unclassified 1261
329 Ga0068851_10227401 3300005834 Bacteria 1050
330 Ga0068851_10501739 3300005834 Bacteria 728
331 Ga0068870_10069758 3300005840 Bacteria 1913
332 Ga0068870_11322177 3300005840 Bacteria 526
333 Ga0068863_100005172 3300005841 Bacteria 12867
334 Ga0068863_100014937 3300005841 Bacteria 7458
335 Ga0068863_100036472 3300005841 Bacteria 4683
336 Ga0068863_100138633 3300005841 Bacteria 2324
337 Ga0068863_100287156 3300005841 Unclassified 1594
338 Ga0068863_100291612 3300005841 Bacteria 1581
339 Ga0068858_100023025 3300005842 Bacteria 5809
340 Ga0068858_100027858 3300005842 Bacteria 5249
341 Ga0068858_100111933 3300005842 Bacteria 2550
342 Ga0068858_100116331 3300005842 Bacteria 2499
343 Ga0068860_100005183 3300005843 Bacteria 13250
344 Ga0068860_100008281 3300005843 Bacteria 10349
345 Ga0068860_100219301 3300005843 Bacteria 1847
346 Ga0068860_100224409 3300005843 Bacteria 1825
347 Ga0068860_100461993 3300005843 Bacteria 1263
348 Ga0068860_100463229 3300005843 Unclassified 1261
349 Ga0068860_100593493 3300005843 Unclassified 1112
350 Ga0068860_101030615 3300005843 Unclassified 841
351 Ga0068862_100002736 3300005844 Bacteria 15475
352 Ga0068862_100028673 3300005844 Bacteria 4689
353 Ga0068862_100048154 3300005844 Bacteria 3639
354 Ga0068862_100260236 3300005844 Unclassified 1584
355 Ga0068862_100410996 3300005844 Bacteria 1268
356 Ga0068862_100630013 3300005844 Unclassified 1032
357 Ga0081539_10028927 3300005985 Bacteria 3476
358 Ga0075366_10321775 3300006195 Bacteria 948
359 Ga0097621_100004831 3300006237 Bacteria 9440
360 Ga0097621_100030925 3300006237 Bacteria 4242
361 Ga0097621_100057667 3300006237 Unclassified 3177
362 Ga0097621_100321242 3300006237 Bacteria 1371
363 Ga0068871_100007517 3300006358 Bacteria 7792
364 Ga0068871_100173586 3300006358 Bacteria 1849
365 Ga0068871_100818466 3300006358 Bacteria 859
366 Ga0075431_101560271 3300006847 Unclassified 618
367 Ga0075433_10096914 3300006852 Unclassified 2610
368 Ga0075434_100077462 3300006871 Bacteria 3320
369 Ga0068865_100030645 3300006881 Bacteria 3579
370 Ga0068865_100448526 3300006881 Bacteria 1066
371 Ga0068865_100494219 3300006881 Bacteria 1019
372 Ga0097620_100030114 3300006931 Bacteria 5445
373 Ga0097620_100030685 3300006931 Bacteria 5394
374 Ga0097620_100159890 3300006931 Unclassified 2332
375 Ga0097620_100299543 3300006931 Bacteria 1701
376 Ga0097620_100703896 3300006931 Bacteria 1101
377 Ga0075435_100114674 3300007076 Bacteria 2243
378 Ga0105240_10009782 3300009093 Bacteria 13538
379 Ga0105240_10037918 3300009093 Bacteria 6188
380 Ga0105240_10204343 3300009093 Bacteria 2313
381 Ga0111539_10228685 3300009094 Unclassified 2166
382 Ga0105245_12089080 3300009098 Unclassified 620
383 Ga0105247_10525326 3300009101 Unclassified 866
384 Ga0114129_10471580 3300009147 Bacteria 1644
385 Ga0105243_10035268 3300009148 Bacteria 3877
386 Ga0105243_11407605 3300009148 Unclassified 718
387 Ga0105243_11416958 3300009148 Viruses 716
388 Ga0105241_10057130 3300009174 Bacteria 2993
389 Ga0105241_10244469 3300009174 Unclassified 1518
390 Ga0105241_10309138 3300009174 Bacteria 1359
391 Ga0105241_10332714 3300009174 Bacteria 1313
392 Ga0105241_11138797 3300009174 Bacteria 736
393 Ga0105241_11732985 3300009174 Unclassified 608
394 Ga0105242_10073172 3300009176 Bacteria 2848
395 Ga0105248_10010355 3300009177 Bacteria 10266
396 Ga0105248_10031916 3300009177 Bacteria 5885
397 Ga0105248_10047959 3300009177 Bacteria 4790
398 Ga0105248_10126192 3300009177 Bacteria 2887
399 Ga0105248_12875060 3300009177 Unclassified 549
400 Ga0105237_10010455 3300009545 Bacteria 9867
401 Ga0105237_10612210 3300009545 Bacteria 1096
402 Ga0105238_10002513 3300009551 Bacteria 18352
403 Ga0105238_10008543 3300009551 Bacteria 10246
404 Ga0105238_10017853 3300009551 Bacteria 7213
405 Ga0105238_10092286 3300009551 Unclassified 3016
406 Ga0105238_12304016 3300009551 Unclassified 574
407 Ga0105249_10008517 3300009553 Bacteria 8942
408 Ga0105249_10041715 3300009553 Bacteria 4172
409 Ga0105249_10054591 3300009553 Bacteria 3654
410 Ga0105249_11940707 3300009553 Bacteria 661
411 Ga0105239_10151161 3300010375 Bacteria 2591
412 Ga0105239_10186338 3300010375 Bacteria 2322
413 Ga0105239_10680213 3300010375 Unclassified 1176
414 Ga0105239_13367732 3300010375 Unclassified 520
415 Ga0105246_10006278 3300011119 Bacteria 7255
416 Ga0105246_10598571 3300011119 Unclassified 952
417 Ga0157373_10001899 3300013100 Bacteria 15862
418 Ga0157373_10014261 3300013100 Bacteria 5830
419 Ga0157373_10018364 3300013100 Bacteria 5093
420 Ga0157373_10028680 3300013100 Bacteria 4014
421 Ga0157373_10225276 3300013100 Bacteria 1323
422 Ga0157373_10244567 3300013100 Unclassified 1268
423 Ga0157373_10637514 3300013100 Unclassified 777
424 Ga0157373_10664608 3300013100 Bacteria 762
425 Ga0157373_10711032 3300013100 Bacteria 737
426 Ga0157371_10016811 3300013102 Bacteria 5448
427 Ga0157371_10058821 3300013102 Bacteria 2726
428 Ga0157371_10086721 3300013102 Bacteria 2217
429 Ga0157371_10150516 3300013102 Unclassified 1659
430 Ga0157371_10177241 3300013102 Bacteria 1524
431 Ga0157371_10606201 3300013102 Bacteria 815
432 Ga0157371_10617416 3300013102 Unclassified 807
433 Ga0157371_10646989 3300013102 Bacteria 789
434 Ga0157371_10840626 3300013102 Unclassified 694
435 Ga0157371_10846090 3300013102 Unclassified 691
436 Ga0157371_10924914 3300013102 Unclassified 662
437 Ga0157371_11248668 3300013102 Unclassified 574
438 Ga0157370_10015357 3300013104 Bacteria 7783
439 Ga0157370_10030530 3300013104 Bacteria 5280
440 Ga0157370_10043152 3300013104 Bacteria 4342
441 Ga0157370_10049602 3300013104 Bacteria 4017
442 Ga0157370_10087657 3300013104 Bacteria 2924
443 Ga0157370_10165632 3300013104 Bacteria 2055
444 Ga0157370_10266640 3300013104 Bacteria 1582
445 Ga0157370_10267555 3300013104 Bacteria 1579
446 Ga0157370_10529143 3300013104 Bacteria 1081
447 Ga0157370_10997233 3300013104 Unclassified 758
448 Ga0157369_10011269 3300013105 Bacteria 10158
449 Ga0157369_10026544 3300013105 Bacteria 6424
450 Ga0157369_10097016 3300013105 Unclassified 3144
451 Ga0157369_10110514 3300013105 Bacteria 2922
452 Ga0157369_10136161 3300013105 Bacteria 2600
453 Ga0157369_10252179 3300013105 Unclassified 1841
454 Ga0157369_10966875 3300013105 Bacteria 872
455 Ga0157374_10158088 3300013296 Bacteria 2207
456 Ga0157374_10451423 3300013296 Unclassified 1287
457 Ga0157374_11150481 3300013296 Bacteria 797
458 Ga0157378_11020559 3300013297 Unclassified 862
459 Ga0163162_10021069 3300013306 Bacteria 6412
460 Ga0163162_10115725 3300013306 Bacteria 2782
461 Ga0163162_10743552 3300013306 Unclassified 1100
462 Ga0163162_11602953 3300013306 Unclassified 742
463 Ga0157372_10004040 3300013307 Bacteria 15730
464 Ga0157372_10029471 3300013307 Bacteria 5993
465 Ga0157372_10044454 3300013307 Bacteria 4922
466 Ga0157372_10099009 3300013307 Bacteria 3326
467 Ga0157372_10102994 3300013307 Bacteria 3261
468 Ga0157372_10340606 3300013307 Bacteria 1746
469 Ga0157372_10385244 3300013307 Bacteria 1633
470 Ga0157372_10443753 3300013307 Bacteria 1512
471 Ga0157372_10700979 3300013307 Unclassified 1178
472 Ga0157372_10750785 3300013307 Bacteria 1134
473 Ga0157372_11277799 3300013307 Bacteria 847
474 Ga0157372_11319716 3300013307 Unclassified 832
475 Ga0157375_10014100 3300013308 Bacteria 7126
476 Ga0157375_10168279 3300013308 Bacteria 2338
477 Ga0157375_10289995 3300013308 Bacteria 1799
478 Ga0157375_10566424 3300013308 Bacteria 1297
479 Ga0163163_10037594 3300014325 Bacteria 4711
480 Ga0163163_10983305 3300014325 Unclassified 907
481 Ga0157380_11459356 3300014326 Bacteria 736
482 Ga0182008_10296950 3300014497 Unclassified 844
483 Ga0182008_10461846 3300014497 Bacteria 692
484 Ga0157377_10020706 3300014745 Unclassified 3450
485 Ga0157379_10063298 3300014968 Bacteria 3308
486 Ga0157376_12650254 3300014969 Bacteria 541
487 Ga0163161_10257971 3300017792 Unclassified 1361
488 Ga0163161_10456764 3300017792 Unclassified 1033
489 Ga0206356_10965601 3300020070 Unclassified 891
490 Ga0206353_11202403 3300020082 Bacteria 2324
491 Ga0206353_11906044 3300020082 Bacteria 710
492 Ga0207697_10024948 3300025315 Bacteria 2445
493 Ga0207656_10033899 3300025321 Bacteria 2129
494 Ga0207656_10055130 3300025321 Unclassified 1729
495 Ga0207653_10057109 3300025885 Unclassified 1310
496 Ga0207682_10043576 3300025893 Bacteria 1837
497 Ga0207682_10051377 3300025893 Bacteria 1707
498 Ga0207682_10093543 3300025893 Bacteria 1306
499 Ga0207688_10045051 3300025901 Bacteria 2460
500 Ga0207688_10051937 3300025901 Bacteria 2296
501 Ga0207688_10197006 3300025901 Viruses 1207
502 Ga0207680_10038947 3300025903 Unclassified 2754
503 Ga0207680_10103553 3300025903 Bacteria 1833
504 Ga0207680_10145850 3300025903 Bacteria 1573
505 Ga0207680_10188038 3300025903 Bacteria 1400
506 Ga0207680_10286196 3300025903 Bacteria 1146
507 Ga0207647_10000721 3300025904 Bacteria 25921
508 Ga0207647_10002263 3300025904 Bacteria 14665
509 Ga0207647_10002940 3300025904 Bacteria 12822
510 Ga0207647_10006442 3300025904 Bacteria 8531
511 Ga0207647_10015955 3300025904 Bacteria 5135
512 Ga0207647_10064843 3300025904 Bacteria 2219
513 Ga0207647_10146109 3300025904 Bacteria 1384
514 Ga0207647_10149786 3300025904 Unclassified 1364
515 Ga0207647_10152481 3300025904 Bacteria 1350
516 Ga0207647_10452625 3300025904 Unclassified 719
517 Ga0207645_10013495 3300025907 Bacteria 5503
518 Ga0207645_10030977 3300025907 Bacteria 3445
519 Ga0207645_10110577 3300025907 Bacteria 1779
520 Ga0207645_10419571 3300025907 Bacteria 901
521 Ga0207643_10074500 3300025908 Bacteria 1958
522 Ga0207705_10008024 3300025909 Bacteria 7740
523 Ga0207705_10011549 3300025909 Bacteria 6387
524 Ga0207705_10013549 3300025909 Bacteria 5885
525 Ga0207705_10029514 3300025909 Plasmid 3909
526 Ga0207705_10072616 3300025909 Bacteria 2496
527 Ga0207705_10073179 3300025909 Unclassified 2486
528 Ga0207705_10096779 3300025909 Unclassified 2167
529 Ga0207705_10106467 3300025909 Bacteria 2068
530 Ga0207705_10180652 3300025909 Bacteria 1592
531 Ga0207705_10273680 3300025909 Bacteria 1291
532 Ga0207705_10326417 3300025909 Unclassified 1180
533 Ga0207705_11546460 3300025909 Unclassified 501
534 Ga0207654_10351504 3300025911 Bacteria 1015
535 Ga0207654_10368544 3300025911 Unclassified 992
536 Ga0207707_10022651 3300025912 Bacteria 5493
537 Ga0207707_10046847 3300025912 Unclassified 3766
538 Ga0207707_10050263 3300025912 Bacteria 3632
539 Ga0207707_10200554 3300025912 Unclassified 1740
540 Ga0207695_10063905 3300025913 Bacteria 3792
541 Ga0207695_10077027 3300025913 Bacteria 3389
542 Ga0207695_10094177 3300025913 Unclassified 3003
543 Ga0207671_10015467 3300025914 Bacteria 5971
544 Ga0207671_10047665 3300025914 Bacteria 3172
545 Ga0207660_10001191 3300025917 Bacteria 17454
546 Ga0207660_10035170 3300025917 Bacteria 3476
547 Ga0207660_10144721 3300025917 Unclassified 1820
548 Ga0207660_10173356 3300025917 Unclassified 1671
549 Ga0207660_10885451 3300025917 Unclassified 729
550 Ga0207657_10002867 3300025919 Bacteria 18531
551 Ga0207657_10008053 3300025919 Bacteria 10745
552 Ga0207657_10009578 3300025919 Bacteria 9725
553 Ga0207657_10022956 3300025919 Bacteria 5822
554 Ga0207657_10028130 3300025919 Bacteria 5135
555 Ga0207657_10029311 3300025919 Bacteria 5012
556 Ga0207657_10060183 3300025919 Bacteria 3260
557 Ga0207657_10070842 3300025919 Bacteria 2953
558 Ga0207657_10079248 3300025919 Bacteria 2764
559 Ga0207657_10151116 3300025919 Bacteria 1892
560 Ga0207657_10260087 3300025919 Bacteria 1381
561 Ga0207649_10006009 3300025920 Bacteria 6588
562 Ga0207649_10010089 3300025920 Bacteria 5182
563 Ga0207649_10069552 3300025920 Bacteria 2242
564 Ga0207649_10076186 3300025920 Unclassified 2158
565 Ga0207649_10083885 3300025920 Bacteria 2069
566 Ga0207649_10092977 3300025920 Bacteria 1978
567 Ga0207649_10098297 3300025920 Bacteria 1932
568 Ga0207649_10108864 3300025920 Bacteria 1847
569 Ga0207649_10148370 3300025920 Bacteria 1612
570 Ga0207649_10171364 3300025920 Bacteria 1512
571 Ga0207649_10232399 3300025920 Bacteria 1319
572 Ga0207649_10245050 3300025920 Unclassified 1288
573 Ga0207652_10052973 3300025921 Bacteria 3485
574 Ga0207652_10128149 3300025921 Unclassified 2262
575 Ga0207652_10172658 3300025921 Bacteria 1940
576 Ga0207652_10200976 3300025921 Bacteria 1793
577 Ga0207652_10639002 3300025921 Unclassified 952
578 Ga0207652_11210053 3300025921 Unclassified 657
579 Ga0207681_10008742 3300025923 Bacteria 6188
580 Ga0207681_10047145 3300025923 Bacteria 2901
581 Ga0207681_10299015 3300025923 Bacteria 1273
582 Ga0207681_10411100 3300025923 Bacteria 1095
583 Ga0207681_10605975 3300025923 Bacteria 905
584 Ga0207681_11760464 3300025923 Unclassified 517
585 Ga0207694_10001011 3300025924 Bacteria 24528
586 Ga0207694_10031528 3300025924 Bacteria 4050
587 Ga0207694_10181029 3300025924 Bacteria 1709
588 Ga0207694_10279765 3300025924 Unclassified 1370
589 Ga0207694_11755117 3300025924 Unclassified 522
590 Ga0207650_10006425 3300025925 Bacteria 8010
591 Ga0207650_10013438 3300025925 Bacteria 5669
592 Ga0207650_10020000 3300025925 Bacteria 4714
593 Ga0207650_10196649 3300025925 Bacteria 1613
594 Ga0207650_10506385 3300025925 Bacteria 1009
595 Ga0207650_11111577 3300025925 Bacteria 673
596 Ga0207659_10060719 3300025926 Unclassified 2722
597 Ga0207659_10211152 3300025926 Bacteria 1556
598 Ga0207659_10709100 3300025926 Unclassified 862
599 Ga0207687_10212147 3300025927 Unclassified 1520
600 Ga0207664_10007802 3300025929 Bacteria 7433
601 Ga0207664_10029928 3300025929 Bacteria 4153
602 Ga0207664_11404326 3300025929 Unclassified 619
603 Ga0207664_11982082 3300025929 Bacteria 505
604 Ga0207644_10022018 3300025931 Bacteria 4348
605 Ga0207644_10134227 3300025931 Bacteria 1899
606 Ga0207644_10201331 3300025931 Unclassified 1571
607 Ga0207644_10310474 3300025931 Bacteria 1273
608 Ga0207644_10339824 3300025931 Unclassified 1217
609 Ga0207690_10001891 3300025932 Bacteria 12848
610 Ga0207690_10006698 3300025932 Bacteria 6826
611 Ga0207690_10011850 3300025932 Bacteria 5213
612 Ga0207690_10015745 3300025932 Bacteria 4588
613 Ga0207690_10038089 3300025932 Bacteria 3127
614 Ga0207690_10061615 3300025932 Bacteria 2551
615 Ga0207690_10066029 3300025932 Bacteria 2476
616 Ga0207690_10163215 3300025932 Bacteria 1663
617 Ga0207690_10182575 3300025932 Bacteria 1581
618 Ga0207690_10284597 3300025932 Bacteria 1288
619 Ga0207690_10459273 3300025932 Bacteria 1025
620 Ga0207690_10572068 3300025932 Bacteria 920
621 Ga0207690_10824636 3300025932 Unclassified 767
622 Ga0207690_10892118 3300025932 Unclassified 737
623 Ga0207690_11060609 3300025932 Bacteria 675
624 Ga0207690_11069111 3300025932 Bacteria 672
625 Ga0207690_11084396 3300025932 Bacteria 667
626 Ga0207690_11172023 3300025932 Bacteria 641
627 Ga0207706_10001211 3300025933 Bacteria 26067
628 Ga0207706_10002133 3300025933 Bacteria 19359
629 Ga0207706_10007955 3300025933 Bacteria 9789
630 Ga0207706_10025809 3300025933 Bacteria 5263
631 Ga0207706_10028223 3300025933 Bacteria 5013
632 Ga0207706_10047473 3300025933 Bacteria 3799
633 Ga0207706_10071714 3300025933 Bacteria 3047
634 Ga0207706_10077606 3300025933 Bacteria 2921
635 Ga0207706_10132127 3300025933 Unclassified 2195
636 Ga0207706_10152015 3300025933 Bacteria 2036
637 Ga0207706_10297553 3300025933 Bacteria 1406
638 Ga0207706_10362241 3300025933 Bacteria 1260
639 Ga0207706_10378374 3300025933 Viruses 1229
640 Ga0207706_10439236 3300025933 Unclassified 1130
641 Ga0207706_10451707 3300025933 Bacteria 1111
642 Ga0207686_10051627 3300025934 Bacteria 2562
643 Ga0207709_10472310 3300025935 Unclassified 974
644 Ga0207709_10905195 3300025935 Viruses 717
645 Ga0207670_10358206 3300025936 Unclassified 1157
646 Ga0207669_10161360 3300025937 Bacteria 1584
647 Ga0207669_10359053 3300025937 Bacteria 1128
648 Ga0207669_10867151 3300025937 Bacteria 752
649 Ga0207704_10378311 3300025938 Unclassified 1111
650 Ga0207704_10724837 3300025938 Unclassified 825
651 Ga0207691_10004966 3300025940 Bacteria 12835
652 Ga0207691_10014906 3300025940 Bacteria 7407
653 Ga0207691_10071051 3300025940 Bacteria 3142
654 Ga0207691_10129771 3300025940 Bacteria 2227
655 Ga0207691_10223053 3300025940 Bacteria 1634
656 Ga0207691_10301112 3300025940 Bacteria 1377
657 Ga0207711_10006337 3300025941 Bacteria 9978
658 Ga0207711_10010388 3300025941 Bacteria 7730
659 Ga0207711_10062345 3300025941 Bacteria 3216
660 Ga0207711_10077519 3300025941 Bacteria 2897
661 Ga0207711_11277288 3300025941 Bacteria 676
662 Ga0207689_10070162 3300025942 Bacteria 2879
663 Ga0207661_10027360 3300025944 Bacteria 4355
664 Ga0207661_10319413 3300025944 Bacteria 1396
665 Ga0207679_10004621 3300025945 Bacteria 8574
666 Ga0207679_10020613 3300025945 Bacteria 4451
667 Ga0207679_10022960 3300025945 Bacteria 4257
668 Ga0207679_10065533 3300025945 Bacteria 2718
669 Ga0207679_10066772 3300025945 Bacteria 2696
670 Ga0207679_10135932 3300025945 Bacteria 1979
671 Ga0207679_10144393 3300025945 Bacteria 1928
672 Ga0207679_10345768 3300025945 Bacteria 1295
673 Ga0207679_10986398 3300025945 Unclassified 772
674 Ga0207679_11962342 3300025945 Unclassified 533
675 Ga0207667_10018675 3300025949 Bacteria 7768
676 Ga0207667_10036759 3300025949 Bacteria 5243
677 Ga0207667_10039888 3300025949 Bacteria 5001
678 Ga0207667_10084198 3300025949 Bacteria 3292
679 Ga0207667_10139366 3300025949 Unclassified 2497
680 Ga0207667_10498013 3300025949 Unclassified 1236
681 Ga0207667_10558596 3300025949 Bacteria 1157
682 Ga0207651_10015209 3300025960 Bacteria 4465
683 Ga0207651_10157945 3300025960 Bacteria 1774
684 Ga0207651_10181125 3300025960 Bacteria 1671
685 Ga0207651_10208266 3300025960 Bacteria 1572
686 Ga0207651_10219835 3300025960 Bacteria 1535
687 Ga0207651_10253680 3300025960 Bacteria 1440
688 Ga0207651_10445167 3300025960 Bacteria 1110
689 Ga0207651_11059540 3300025960 Bacteria 726
690 Ga0207651_11112693 3300025960 Unclassified 708
691 Ga0207712_10000491 3300025961 Bacteria 32766
692 Ga0207712_10128652 3300025961 Bacteria 1927
693 Ga0207712_10363988 3300025961 Unclassified 1206
694 Ga0207668_10000060 3300025972 Bacteria 89732
695 Ga0207668_10032560 3300025972 Bacteria 3446
696 Ga0207668_10041358 3300025972 Bacteria 3115
697 Ga0207668_10085237 3300025972 Bacteria 2305
698 Ga0207668_10618779 3300025972 Unclassified 945
699 Ga0207668_10913405 3300025972 Bacteria 782
700 Ga0207668_11000093 3300025972 Bacteria 747
701 Ga0207640_10023295 3300025981 Bacteria 3719
702 Ga0207640_10040624 3300025981 Unclassified 2952
703 Ga0207640_10042763 3300025981 Bacteria 2891
704 Ga0207640_10047489 3300025981 Unclassified 2769
705 Ga0207640_10086875 3300025981 Unclassified 2154
706 Ga0207640_10154754 3300025981 Bacteria 1689
707 Ga0207640_10189194 3300025981 Bacteria 1550
708 Ga0207640_10575084 3300025981 Bacteria 950
709 Ga0207658_10004678 3300025986 Bacteria 9481
710 Ga0207658_10019496 3300025986 Bacteria 4691
711 Ga0207658_10112917 3300025986 Bacteria 2152
712 Ga0207658_10126910 3300025986 Bacteria 2043
713 Ga0207658_10340918 3300025986 Bacteria 1302
714 Ga0207658_10487671 3300025986 Bacteria 1096
715 Ga0207658_10495499 3300025986 Bacteria 1088
716 Ga0207658_10645155 3300025986 Bacteria 954
717 Ga0207677_10217586 3300026023 Unclassified 1530
718 Ga0207677_10565586 3300026023 Unclassified 993
719 Ga0207677_10596869 3300026023 Unclassified 968
720 Ga0207677_12237934 3300026023 Unclassified 509
721 Ga0207703_10002126 3300026035 Bacteria 17427
722 Ga0207703_10150927 3300026035 Bacteria 2026
723 Ga0207703_10448077 3300026035 Unclassified 1205
724 Ga0207639_10000144 3300026041 Bacteria 53312
725 Ga0207639_10067079 3300026041 Bacteria 2791
726 Ga0207639_10068559 3300026041 Bacteria 2764
727 Ga0207639_10088892 3300026041 Bacteria 2467
728 Ga0207639_10119957 3300026041 Bacteria 2159
729 Ga0207639_10149113 3300026041 Unclassified 1957
730 Ga0207639_10208717 3300026041 Bacteria 1680
731 Ga0207639_10311645 3300026041 Unclassified 1394
732 Ga0207639_10612872 3300026041 Bacteria 1004
733 Ga0207639_10997780 3300026041 Bacteria 784
734 Ga0207639_11244523 3300026041 Unclassified 698
735 Ga0207678_10004202 3300026067 Bacteria 12924
736 Ga0207678_10005267 3300026067 Bacteria 11583
737 Ga0207678_10007936 3300026067 Bacteria 9360
738 Ga0207678_10021689 3300026067 Bacteria 5633
739 Ga0207678_10023348 3300026067 Bacteria 5409
740 Ga0207678_10028383 3300026067 Bacteria 4885
741 Ga0207678_10033913 3300026067 Bacteria 4446
742 Ga0207678_10179676 3300026067 Bacteria 1807
743 Ga0207678_10228200 3300026067 Bacteria 1594
744 Ga0207678_10313820 3300026067 Bacteria 1348
745 Ga0207678_11452084 3300026067 Unclassified 606
746 Ga0207708_11969659 3300026075 Unclassified 512
747 Ga0207702_10016603 3300026078 Bacteria 6092
748 Ga0207702_10041084 3300026078 Bacteria 3877
749 Ga0207702_10064566 3300026078 Bacteria 3133
750 Ga0207702_10097792 3300026078 Bacteria 2584
751 Ga0207702_10313537 3300026078 Bacteria 1492
752 Ga0207702_10516710 3300026078 Bacteria 1165
753 Ga0207702_10891429 3300026078 Unclassified 881
754 Ga0207641_10050697 3300026088 Bacteria 3512
755 Ga0207641_10067143 3300026088 Unclassified 3071
756 Ga0207641_10075483 3300026088 Bacteria 2911
757 Ga0207641_10107531 3300026088 Unclassified 2467
758 Ga0207641_10213549 3300026088 Bacteria 1785
759 Ga0207641_10983206 3300026088 Bacteria 840
760 Ga0207648_10084888 3300026089 Bacteria 2762
761 Ga0207648_10171676 3300026089 Bacteria 1917
762 Ga0207648_10442512 3300026089 Bacteria 1182
763 Ga0207648_11123441 3300026089 Viruses 737
764 Ga0207648_11340653 3300026089 Bacteria 672
765 Ga0207676_10031236 3300026095 Bacteria 4004
766 Ga0207676_10192462 3300026095 Unclassified 1796
767 Ga0207676_10583407 3300026095 Bacteria 1072
768 Ga0207676_10783001 3300026095 Unclassified 929
769 Ga0207676_11280098 3300026095 Unclassified 728
770 Ga0207674_10000057 3300026116 Bacteria 113117
771 Ga0207674_10001662 3300026116 Bacteria 28614
772 Ga0207674_10003393 3300026116 Bacteria 19537
773 Ga0207674_10005462 3300026116 Bacteria 15097
774 Ga0207674_10005506 3300026116 Bacteria 15034
775 Ga0207674_10009490 3300026116 Bacteria 11111
776 Ga0207674_10031060 3300026116 Bacteria 5613
777 Ga0207674_10082958 3300026116 Bacteria 3205
778 Ga0207674_10137769 3300026116 Bacteria 2401
779 Ga0207674_10305632 3300026116 Bacteria 1540
780 Ga0207674_11298845 3300026116 Unclassified 697
781 Ga0207675_100232883 3300026118 Unclassified 1777
782 Ga0207683_10013896 3300026121 Bacteria 6864
783 Ga0207683_10032849 3300026121 Bacteria 4508
784 Ga0207683_10136735 3300026121 Bacteria 2206
785 Ga0207683_11461502 3300026121 Unclassified 631
786 Ga0207698_10004897 3300026142 Bacteria 8212
787 Ga0207698_10005264 3300026142 Bacteria 7956
788 Ga0207698_10018006 3300026142 Bacteria 4804
789 Ga0207698_10025656 3300026142 Bacteria 4156
790 Ga0207698_10031060 3300026142 Bacteria 3851
791 Ga0207698_10064988 3300026142 Bacteria 2863
792 Ga0207698_10074647 3300026142 Bacteria 2706
793 Ga0207698_10111067 3300026142 Bacteria 2297
794 Ga0207698_10129960 3300026142 Bacteria 2150
795 Ga0207698_10147504 3300026142 Bacteria 2037
796 Ga0207698_10245211 3300026142 Unclassified 1635
797 Ga0207698_10436726 3300026142 Bacteria 1260
798 Ga0209973_1064924 3300027252 Bacteria 565
799 Ga0207428_10270523 3300027907 Unclassified 1263
800 Ga0268266_10018502 3300028379 Bacteria 5936
801 Ga0268266_10035908 3300028379 Bacteria 4216
802 Ga0268266_11007504 3300028379 Bacteria 806
803 Ga0268266_11517825 3300028379 Bacteria 645
804 Ga0268265_10001537 3300028380 Bacteria 19180
805 Ga0268265_10007179 3300028380 Bacteria 7528
806 Ga0268265_10030723 3300028380 Bacteria 3872
807 Ga0268265_10038772 3300028380 Bacteria 3507
808 Ga0268265_10152777 3300028380 Unclassified 1949
809 Ga0268265_10691125 3300028380 Bacteria 985
810 Ga0268264_10002057 3300028381 Bacteria 17945
811 Ga0268264_10005564 3300028381 Bacteria 10670
812 Ga0268264_10128315 3300028381 Bacteria 2244
813 Ga0268264_10159804 3300028381 Bacteria 2029
814 Ga0268264_10380254 3300028381 Bacteria 1352
815 Ga0268264_10455707 3300028381 Unclassified 1240
816 Ga0268264_10558342 3300028381 Unclassified 1124
817 Ga0268264_10706932 3300028381 Unclassified 1001
818 Ga0307408_100035403 3300031548 Bacteria 3504
819 Ga0307408_100108533 3300031548 Bacteria 2128
820 Ga0307408_100307098 3300031548 Bacteria 1331
821 Ga0307405_10035211 3300031731 Bacteria 2988
822 Ga0307405_10836544 3300031731 Bacteria 774
823 Ga0307405_11238438 3300031731 Bacteria 647
824 Ga0307413_10379851 3300031824 Unclassified 1100
825 Ga0307413_10973116 3300031824 Unclassified 725
826 Ga0307410_10069565 3300031852 Bacteria 2435
827 Ga0307410_10113802 3300031852 Bacteria 1962
828 Ga0307410_10324176 3300031852 Bacteria 1223
829 Ga0307406_10370043 3300031901 Bacteria 1126
830 Ga0307407_10033193 3300031903 Bacteria 2814
831 Ga0307407_10359763 3300031903 Unclassified 1033
832 Ga0307407_10466134 3300031903 Bacteria 920
833 Ga0307412_10098027 3300031911 Bacteria 2066
834 Ga0307412_10280147 3300031911 Bacteria 1309
835 Ga0307412_10538855 3300031911 Unclassified 978
836 Ga0307409_100029124 3300031995 Bacteria 3947
837 Ga0307409_100029392 3300031995 Bacteria 3933
838 Ga0307409_100093976 3300031995 Bacteria 2466
839 Ga0307409_100259724 3300031995 Bacteria 1593
840 Ga0307409_100334698 3300031995 Bacteria 1422
841 Ga0307409_101343713 3300031995 Bacteria 740
842 Ga0307416_100079830 3300032002 Bacteria 2759
843 Ga0307416_100265384 3300032002 Bacteria 1681
844 Ga0307416_100298724 3300032002 Bacteria 1599
845 Ga0307416_100558524 3300032002 Bacteria 1219
846 Ga0307414_10232308 3300032004 Unclassified 1521
847 Ga0307414_10641895 3300032004 Bacteria 956
848 Ga0307411_10018944 3300032005 Bacteria 3962
849 Ga0307411_10233691 3300032005 Bacteria 1435
850 Ga0307411_10298865 3300032005 Bacteria 1290
851 Ga0307411_10996208 3300032005 Bacteria 750
852 Ga0307415_100099190 3300032126 Bacteria 2131
853 Ga0307415_100118172 3300032126 Bacteria 1982
854 Ga0307415_100697994 3300032126 Bacteria 915
855 Ga0395899_0009507 3300037312 Bacteria 7460
856 Ga0395899_0010217 3300037312 Bacteria 7190
857 Ga0395899_0018320 3300037312 Bacteria 5324
858 Ga0395899_0045303 3300037312 Bacteria 3277
859 Ga0395899_0079016 3300037312 Bacteria 2397
860 Ga0395899_0215691 3300037312 Bacteria 1332
861 Ga0395899_0403532 3300037312 Unclassified 904
862 Ga0395900_0005687 3300037418 Bacteria 13035
863 Ga0395900_0006197 3300037418 Bacteria 12487
864 Ga0395900_0006712 3300037418 Bacteria 11951
865 Ga0395900_0017453 3300037418 Bacteria 7327
866 Ga0395900_0019372 3300037418 Bacteria 6941
867 Ga0395900_0040753 3300037418 Bacteria 4786
868 Ga0395900_0054644 3300037418 Bacteria 4112
869 Ga0395900_0080078 3300037418 Bacteria 3357
870 Ga0395900_0170102 3300037418 Bacteria 2219
871 Ga0395900_0204368 3300037418 Bacteria 1997
872 Ga0395900_0339320 3300037418 Bacteria 1478
873 Ga0395900_0406922 3300037418 Bacteria 1324
874 Ga0395900_0415628 3300037418 Bacteria 1306
875 Ga0395900_0647756 3300037418 Unclassified 993
876 Ga0395900_1289541 3300037418 Bacteria 644
877 Ga0395900_1376937 3300037418 Bacteria 619
878 Ga0395900_1386869 3300037418 Unclassified 616
879 Ga0395898_0012439 3300037466 Bacteria 8797
880 Ga0395898_0058065 3300037466 Bacteria 3768
881 Ga0395898_0061014 3300037466 Bacteria 3663
882 Ga0395898_0069577 3300037466 Bacteria 3405
883 Ga0395898_0090033 3300037466 Bacteria 2953
884 Ga0395898_0160495 3300037466 Bacteria 2150
885 Ga0395898_0212178 3300037466 Bacteria 1847
886 Ga0395898_0275474 3300037466 Bacteria 1605
887 Ga0395898_0301320 3300037466 Unclassified 1529
888 Ga0395898_0422737 3300037466 Bacteria 1270
889 Ga0395898_0954690 3300037466 Bacteria 794
890 Ga0395898_1314696 3300037466 Bacteria 652
891 Ga0395898_1576262 3300037466 Unclassified 581
892 Ga0395898_1805090 3300037466 Unclassified 533
893 Ga0395905_0000092 3300037471 Bacteria 149300
894 Ga0395905_0003268 3300037471 Bacteria 17423
895 Ga0395905_0003469 3300037471 Bacteria 16851
896 Ga0395905_0012841 3300037471 Bacteria 8051
897 Ga0395905_0014738 3300037471 Bacteria 7454
898 Ga0395905_0014833 3300037471 Bacteria 7431
899 Ga0395905_0040395 3300037471 Bacteria 4376
900 Ga0395905_0040523 3300037471 Bacteria 4369
901 Ga0395905_0081486 3300037471 Bacteria 3033
902 Ga0395905_0086334 3300037471 Bacteria 2940
903 Ga0395905_0088899 3300037471 Bacteria 2895
904 Ga0395905_0156710 3300037471 Bacteria 2142
905 Ga0395905_0190693 3300037471 Bacteria 1923
906 Ga0395905_0227419 3300037471 Bacteria 1745
907 Ga0395905_0264169 3300037471 Bacteria 1606
908 Ga0395905_0533048 3300037471 Bacteria 1075
909 Ga0395905_1317341 3300037471 Unclassified 626
910 Ga0395901_0000188 3300038443 Bacteria 78908
911 Ga0395901_0006402 3300038443 Bacteria 11930
912 Ga0395901_0017047 3300038443 Bacteria 7404
913 Ga0395901_0028527 3300038443 Bacteria 5740
914 Ga0395901_0041548 3300038443 Bacteria 4766
915 Ga0395901_0053756 3300038443 Bacteria 4185
916 Ga0395901_0064358 3300038443 Bacteria 3817
917 Ga0395901_0183585 3300038443 Bacteria 2194
918 Ga0395901_0316337 3300038443 Bacteria 1616
919 Ga0395901_0487693 3300038443 Bacteria 1256
920 Ga0395901_1031926 3300038443 Unclassified 796
921 Ga0395901_1257573 3300038443 Bacteria 703
922 Ga0439447_092499 3300041407 Bacteria 695
923 Ga0439461_0021595 3300041410 Unclassified 1284
924 Ga0439465_0068680 3300041413 Bacteria 1185
925 Ga0439432_092058 3300042006 Bacteria 912
926 Ga0439449_0227088 3300042007 Unclassified 700
927 Ga0439452_048573 3300042010 Unclassified 978
928 Ga0439455_0225675 3300042012 Bacteria 545
929 Ga0450914_000674 3300042118 Unclassified 1757
930 Ga0450905_045588 3300042142 Bacteria 705
931 Ga0450889_000204 3300042144 Bacteria 6482
932 Ga0439458_0001172 3300042157 Bacteria 6657
933 Ga0466965_0185687 3300044683 Unclassified 1098
934 Ga0466961_0163574 3300044693 Bacteria 1386
935 Ga0466963_0119656 3300044694 Bacteria 1812
936 Ga0466963_0160984 3300044694 Bacteria 1562
937 Ga0466963_0166996 3300044694 Bacteria 1533
938 Ga0466963_0757508 3300044694 Unclassified 685
939 Ga0466964_0206083 3300044706 Bacteria 947
940 Ga0466964_0398505 3300044706 Bacteria 718
941 Ga0466971_0235334 3300044719 Unclassified 870
942 Ga0466971_0277009 3300044719 Unclassified 802
943 Ga0466971_0705140 3300044719 Unclassified 508
944 Ga0466970_0846263 3300044765 Bacteria 537
945 Ga0466957_0049506 3300044842 Bacteria 2555
946 Ga0466957_0435397 3300044842 Unclassified 901
947 Ga0466957_0654756 3300044842 Unclassified 739
948 Ga0466957_1144408 3300044842 Unclassified 562
949 Ga0466960_0174216 3300044901 Unclassified 1163
950 Ga0466959_0326253 3300045049 Unclassified 1049
951 Ga0466959_0986125 3300045049 Bacteria 561
952 Ga0466958_0083987 3300045836 Bacteria 1963
953 Ga0466967_0001666 3300045976 Bacteria 13169
954 Ga0466967_0004245 3300045976 Bacteria 9621
955 Ga0466967_0015584 3300045976 Bacteria 5961
956 Ga0466967_0021721 3300045976 Bacteria 5221
957 Ga0466967_0222873 3300045976 Bacteria 1793
958 Ga0466967_0425322 3300045976 Bacteria 1295
959 Ga0466967_0445891 3300045976 Unclassified 1264
960 Ga0495663_0008582 3300046525 Unclassified 2834
961 Ga0495621_0041351 3300046539 Unclassified 1618
962 Ga0495668_0293960 3300046616 Bacteria 890
963 Ga0495669_0002162 3300046684 Bacteria 8074
964 Ga0495669_0648474 3300046684 Bacteria 513
965 Ga0495677_0015603 3300047445 Unclassified 2759
966 Ga0495685_089176 3300047447 Bacteria 1023
967 Ga0496100_1318514 3300048903 Unclassified 570
968 Ga0496101_0213898 3300048904 Bacteria 1494
969 Ga0496102_1120389 3300048905 Unclassified 707
970 Ga0496103_0097387 3300048906 Bacteria 1860
971 Ga0496106_0462086 3300048909 Unclassified 1020
972 Ga0496106_0737219 3300048909 Unclassified 784
973 Ga0496107_0154394 3300048910 Bacteria 1699
974 Ga0496107_0354246 3300048910 Bacteria 1092
975 Ga0496107_0449659 3300048910 Bacteria 957
976 Ga0496107_0763371 3300048910 Bacteria 709
977 Ga0496108_0647162 3300048911 Bacteria 919
978 Ga0496109_0557149 3300048912 Bacteria 1081
979 Ga0496111_0115185 3300048914 Bacteria 1982
980 Ga0496111_0296851 3300048914 Unclassified 1198
981 Ga0496111_0702874 3300048914 Bacteria 735
982 Ga0496112_0375992 3300048915 Bacteria 1362
983 Ga0496113_0144734 3300048916 Bacteria 1872
984 Ga0496114_0036993 3300048917 Bacteria 4036
985 Ga0496115_0037736 3300048918 Bacteria 3830
986 nmdc:mga0k408_330179_c1 3300050493 Bacteria 910
987 nmdc:mga06r32_1805631_c1 3300050510 Unclassified 547
988 nmdc:mga08y16_184093_c1 3300050511 Unclassified 2168
989 nmdc:mga0rr50_100459_c1 3300050513 Bacteria 2272
990 nmdc:mga0a205_8689_c1 3300050515 Bacteria 9248
991 Ga0466962_0149268 3300061719 Unclassified 1134
992 Ga0466962_0242704 3300061719 Bacteria 884
993 Ga0466962_0522112 3300061719 Bacteria 602
994 Ga0157369_10145490
995 JGI24741J21665_1000867
996 JGI24740J21852_10002444
997 JGI24740J21852_10015262
998 JGI24740J21852_10089584
999 JGI24740J21852_10107735
1000 JGI24740J21852_10114888
1001 JGI24739J22299_10003964
1002 JGI24739J22299_10009318
1003 JGI24737J22298_10002168
1004 JGI24737J22298_10005610
1005 JGI24737J22298_10074335
1006 JGI24743J22301_10061826
1007 JGI24735J21928_10000970
1008 JGI24735J21928_10001752
1009 JGI24735J21928_10020585
1010 JGI24735J21928_10077951
1011 JGI24735J21928_10133519
1012 JGI24735J21928_10142113
1013 JGI25406J46586_10260734
1014 Ga0065715_10211467
1015 Ga0065715_10465005
1016 Ga0070658_10016564
1017 Ga0070658_10018275
1018 Ga0070658_10089282
1019 Ga0070658_10190935
1020 Ga0070658_10445404
1021 Ga0070658_10758480
1022 Ga0070658_10995793
1023 Ga0070676_10009673
1024 Ga0070676_10184729
1025 Ga0070676_10349086
1026 Ga0070676_10497349
1027 Ga0070676_10783907
1028 Ga0070683_100001584
1029 Ga0070683_100006972
1030 Ga0070683_100012444
1031 Ga0070683_100046392
1032 Ga0070683_100142351
1033 Ga0070683_100517580
1034 Ga0070690_100806541
1035 Ga0070690_101461423
1036 Ga0070670_100022358
1037 Ga0070670_100032462
1038 Ga0070670_100042083
1039 Ga0070670_100128865
1040 Ga0070670_100253068
1041 Ga0070677_10017821
1042 Ga0070677_10039196
1043 Ga0070677_10195632
1044 Ga0070677_10282147
1045 Ga0068869_100007144
1046 Ga0068869_100569989
1047 Ga0070666_10018749
1048 Ga0070666_10055794
1049 Ga0070666_10074253
1050 Ga0070666_10117152
1051 Ga0070666_10157780
1052 Ga0070666_10394078
1053 Ga0070680_100002188
1054 Ga0070680_100011586
1055 Ga0070680_100048410
1056 Ga0070680_100277387
1057 Ga0070680_100280585
1058 Ga0070680_100299822
1059 Ga0070682_100003586
1060 Ga0070682_100038426
1061 Ga0070682_100085170
1062 Ga0070682_100202095
1063 Ga0070682_100839227
1064 Ga0068868_100016525
1065 Ga0068868_100089857
1066 Ga0068868_100714200
1067 Ga0070660_100003337
1068 Ga0070660_100030266
1069 Ga0070660_100038928
1070 Ga0070660_100092565
1071 Ga0070660_100132154
1072 Ga0070660_100135947
1073 Ga0070660_100152144
1074 Ga0070660_100156277
1075 Ga0070660_100226822
1076 Ga0070660_100246347
1077 Ga0070660_100259918
1078 Ga0070660_100305876
1079 Ga0070660_101876991
1080 Ga0070689_100789512
1081 Ga0070691_10032882
1082 Ga0070691_10074238
1083 Ga0070661_100004629
1084 Ga0070661_100016515
1085 Ga0070661_100026111
1086 Ga0070661_100030374
1087 Ga0070661_100031892
1088 Ga0070661_100082414
1089 Ga0070661_100107514
1090 Ga0070661_100113918
1091 Ga0070661_100194702
1092 Ga0070661_100384113
1093 Ga0070661_100422604
1094 Ga0070661_100477474
1095 Ga0070692_10000457
1096 Ga0070692_10040506
1097 Ga0070692_10216645
1098 Ga0070692_10414175
1099 Ga0070668_100003267
1100 Ga0070668_100009416
1101 Ga0070668_100051859
1102 Ga0070668_100409734
1103 Ga0070668_100477038
1104 Ga0070668_100815403
1105 Ga0070668_101135636
1106 Ga0070669_100020434
1107 Ga0070669_100032975
1108 Ga0070669_101309023
1109 Ga0070675_100056143
1110 Ga0070675_100155099
1111 Ga0070675_100197553
1112 Ga0070675_100256298
1113 Ga0070671_100023728
1114 Ga0070671_100580857
1115 Ga0070671_100607023
1116 Ga0070671_101187810
1117 Ga0070674_100183757
1118 Ga0070674_100277940
1119 Ga0070674_100344924
1120 Ga0070673_100002262
1121 Ga0070673_100003681
1122 Ga0070673_100012846
1123 Ga0070673_100026793
1124 Ga0070673_100262978
1125 Ga0070673_100325003
1126 Ga0070673_100451108
1127 Ga0070673_100537300
1128 Ga0070673_100776599
1129 Ga0070673_101156145
1130 Ga0070673_101240329
1131 Ga0070659_100000952
1132 Ga0070659_100013633
1133 Ga0070659_100016873
1134 Ga0070659_100031512
1135 Ga0070659_100047040
1136 Ga0070659_100052634
1137 Ga0070659_100082356
1138 Ga0070659_100090118
1139 Ga0070659_100097739
1140 Ga0070659_100161273
1141 Ga0070659_100221554
1142 Ga0070659_100255697
1143 Ga0070659_100257565
1144 Ga0070659_100260211
1145 Ga0070659_100322658
1146 Ga0070659_100330999
1147 Ga0070659_100451931
1148 Ga0070659_100465858
1149 Ga0070659_100612614
1150 Ga0070659_100719967
1151 Ga0070667_100017309
1152 Ga0070667_100032746
1153 Ga0070667_100037562
1154 Ga0070667_100066053
1155 Ga0070667_100246800
1156 Ga0070667_100805577
1157 Ga0070667_100882085
1158 Ga0070714_100026304
1159 Ga0070714_100040484
1160 Ga0070714_100170508
1161 Ga0070714_100178880
1162 Ga0070700_100647404
1163 Ga0070694_100011422
1164 Ga0070694_100221368
1165 Ga0070663_100007719
1166 Ga0070663_100039836
1167 Ga0070663_100102619
1168 Ga0070663_100117035
1169 Ga0070663_100206373
1170 Ga0070663_100265782
1171 Ga0070663_100592348
1172 Ga0070663_100770821
1173 Ga0070678_100084285
1174 Ga0070678_100371528
1175 Ga0070678_100551631
1176 Ga0070678_101270431
1177 Ga0070662_100008823
1178 Ga0070662_100026697
1179 Ga0070662_100056154
1180 Ga0070662_100133449
1181 Ga0070662_100161718
1182 Ga0070662_100197031
1183 Ga0070662_100197718
1184 Ga0070662_100242475
1185 Ga0070662_100266233
1186 Ga0070662_100272839
1187 Ga0070681_10007382
1188 Ga0070681_10063354
1189 Ga0070681_10065670
1190 Ga0070681_10252056
1191 Ga0070681_10391969
1192 Ga0070681_10910707
1193 Ga0068867_100007573
1194 Ga0068867_100135689
1195 Ga0068867_100157805
1196 Ga0068867_101318542
1197 Ga0068867_101640496
1198 Ga0068867_102032465
1199 Ga0070679_100012704
1200 Ga0070679_100031193
1201 Ga0070679_100136079
1202 Ga0070679_100138052
1203 Ga0070679_100454789
1204 Ga0070679_100680354
1205 Ga0070679_100690219
1206 Ga0070679_100752261
1207 Ga0070679_100774990
1208 Ga0070679_100961820
1209 Ga0070684_100064378
1210 Ga0070684_100067819
1211 Ga0070684_100113622
1212 Ga0070684_100352556
1213 Ga0068853_100015024
1214 Ga0068853_100073208
1215 Ga0068853_100108935
1216 Ga0068853_100127936
1217 Ga0068853_100206773
1218 Ga0068853_100381987
1219 Ga0068853_100418516
1220 Ga0068853_100483414
1221 Ga0068853_100503150
1222 Ga0068853_100538784
1223 Ga0068853_102264796
1224 Ga0070672_100006694
1225 Ga0070672_100053147
1226 Ga0070672_100158575
1227 Ga0070672_100507355
1228 Ga0070672_100571992
1229 Ga0070696_100142813
1230 Ga0070696_100158136
1231 Ga0070696_100287638
1232 Ga0070696_100788383
1233 Ga0070693_100034766
1234 Ga0070693_100079256
1235 Ga0070693_100083179
1236 Ga0070693_100324832
1237 Ga0070693_100652817
1238 Ga0070693_101002284
1239 Ga0070665_100016938
1240 Ga0070665_100038981
1241 Ga0070665_100102479
1242 Ga0070665_100201534
1243 Ga0068855_100001622
1244 Ga0068855_100019513
1245 Ga0068855_100028425
1246 Ga0068855_100138516
1247 Ga0068855_100355939
1248 Ga0068855_100381148
1249 Ga0068855_100415076
1250 Ga0068855_100477501
1251 Ga0070664_100000066
1252 Ga0070664_100026936
1253 Ga0070664_100030149
1254 Ga0070664_100046327
1255 Ga0070664_100072355
1256 Ga0070664_100077575
1257 Ga0070664_100137483
1258 Ga0070664_100195994
1259 Ga0070664_100196256
1260 Ga0070664_100210254
1261 Ga0070664_100307603
1262 Ga0070664_100493552
1263 Ga0070664_100496690
1264 Ga0068857_100003820
1265 Ga0068857_100036247
1266 Ga0068857_100052081
1267 Ga0068857_100054790
1268 Ga0068857_100062010
1269 Ga0068857_100102224
1270 Ga0068857_100109609
1271 Ga0068857_100128369
1272 Ga0068857_100202522
1273 Ga0068857_100519850
1274 Ga0068854_100011462
1275 Ga0068854_100027419
1276 Ga0068854_100028677
1277 Ga0068854_100030513
1278 Ga0068854_100050449
1279 Ga0068854_100056060
1280 Ga0068854_100185323
1281 Ga0068854_100253841
1282 Ga0068854_100330098
1283 Ga0068856_100000213
1284 Ga0068856_100036106
1285 Ga0068856_100052623
1286 Ga0068856_100082243
1287 Ga0068856_100109309
1288 Ga0068856_100121053
1289 Ga0068856_100189095
1290 Ga0068856_100268011
1291 Ga0068856_100373244
1292 Ga0068856_100374064
1293 Ga0068856_100788395
1294 Ga0068856_100847412
1295 Ga0068852_100001507
1296 Ga0068852_100006300
1297 Ga0068852_100008088
1298 Ga0068852_100011209
1299 Ga0068852_100014400
1300 Ga0068852_100026871
1301 Ga0068852_100053153
1302 Ga0068852_100273733
1303 Ga0068852_100371446
1304 Ga0068852_100447655
1305 Ga0068852_100584025
1306 Ga0068852_100615292
1307 Ga0068859_100030114
1308 Ga0068859_100030683
1309 Ga0068859_100159890
1310 Ga0068859_100299524
1311 Ga0068859_100703892
1312 Ga0068864_100028236
1313 Ga0068864_100061038
1314 Ga0068864_100314088
1315 Ga0068864_100444532
1316 Ga0068864_101148054
1317 Ga0068861_100583262
1318 Ga0068851_10016284
1319 Ga0068851_10020242
1320 Ga0068851_10080838
1321 Ga0068851_10153411
1322 Ga0068851_10227401
1323 Ga0068851_10501739
1324 Ga0068870_10069758
1325 Ga0068870_11322177
1326 Ga0068863_100005172
1327 Ga0068863_100014937
1328 Ga0068863_100036472
1329 Ga0068863_100138633
1330 Ga0068863_100287156
1331 Ga0068863_100291612
1332 Ga0068858_100023025
1333 Ga0068858_100027858
1334 Ga0068858_100111933
1335 Ga0068858_100116331
1336 Ga0068860_100005183
1337 Ga0068860_100008281
1338 Ga0068860_100219301
1339 Ga0068860_100224409
1340 Ga0068860_100461993
1341 Ga0068860_100463229
1342 Ga0068860_100593493
1343 Ga0068860_101030615
1344 Ga0068862_100002736
1345 Ga0068862_100028673
1346 Ga0068862_100048154
1347 Ga0068862_100260236
1348 Ga0068862_100410996
1349 Ga0068862_100630013
1350 Ga0081539_10028927
1351 Ga0075366_10321775
1352 Ga0097621_100004831
1353 Ga0097621_100030925
1354 Ga0097621_100057667
1355 Ga0097621_100321242
1356 Ga0068871_100007517
1357 Ga0068871_100173586
1358 Ga0068871_100818466
1359 Ga0075431_101560271
1360 Ga0075433_10096914
1361 Ga0075434_100077462
1362 Ga0068865_100030645
1363 Ga0068865_100448526
1364 Ga0068865_100494219
1365 Ga0097620_100030114
1366 Ga0097620_100030685
1367 Ga0097620_100159890
1368 Ga0097620_100299543
1369 Ga0097620_100703896
1370 Ga0075435_100114674
1371 Ga0105240_10009782
1372 Ga0105240_10037918
1373 Ga0105240_10204343
1374 Ga0111539_10228685
1375 Ga0105245_12089080
1376 Ga0105247_10525326
1377 Ga0114129_10471580
1378 Ga0105243_10035268
1379 Ga0105243_11407605
1380 Ga0105243_11416958
1381 Ga0105241_10057130
1382 Ga0105241_10244469
1383 Ga0105241_10309138
1384 Ga0105241_10332714
1385 Ga0105241_11138797
1386 Ga0105241_11732985
1387 Ga0105242_10073172
1388 Ga0105248_10010355
1389 Ga0105248_10031916
1390 Ga0105248_10047959
1391 Ga0105248_10126192
1392 Ga0105248_12875060
1393 Ga0105237_10010455
1394 Ga0105237_10612210
1395 Ga0105238_10002513
1396 Ga0105238_10008543
1397 Ga0105238_10017853
1398 Ga0105238_10092286
1399 Ga0105238_12304016
1400 Ga0105249_10008517
1401 Ga0105249_10041715
1402 Ga0105249_10054591
1403 Ga0105249_11940707
1404 Ga0105239_10151161
1405 Ga0105239_10186338
1406 Ga0105239_10680213
1407 Ga0105239_13367732
1408 Ga0105246_10006278
1409 Ga0105246_10598571
1410 Ga0157373_10001899
1411 Ga0157373_10014261
1412 Ga0157373_10018364
1413 Ga0157373_10028680
1414 Ga0157373_10225276
1415 Ga0157373_10244567
1416 Ga0157373_10637514
1417 Ga0157373_10664608
1418 Ga0157373_10711032
1419 Ga0157371_10016811
1420 Ga0157371_10058821
1421 Ga0157371_10086721
1422 Ga0157371_10150516
1423 Ga0157371_10177241
1424 Ga0157371_10606201
1425 Ga0157371_10617416
1426 Ga0157371_10646989
1427 Ga0157371_10840626
1428 Ga0157371_10846090
1429 Ga0157371_10924914
1430 Ga0157371_11248668
1431 Ga0157370_10015357
1432 Ga0157370_10030530
1433 Ga0157370_10043152
1434 Ga0157370_10049602
1435 Ga0157370_10087657
1436 Ga0157370_10165632
1437 Ga0157370_10266640
1438 Ga0157370_10267555
1439 Ga0157370_10529143
1440 Ga0157370_10997233
1441 Ga0157369_10011269
1442 Ga0157369_10026544
1443 Ga0157369_10097016
1444 Ga0157369_10110514
1445 Ga0157369_10136161
1446 Ga0157369_10252179
1447 Ga0157369_10966875
1448 Ga0157374_10158088
1449 Ga0157374_10451423
1450 Ga0157374_11150481
1451 Ga0157378_11020559
1452 Ga0163162_10021069
1453 Ga0163162_10115725
1454 Ga0163162_10743552
1455 Ga0163162_11602953
1456 Ga0157372_10004040
1457 Ga0157372_10029471
1458 Ga0157372_10044454
1459 Ga0157372_10099009
1460 Ga0157372_10102994
1461 Ga0157372_10340606
1462 Ga0157372_10385244
1463 Ga0157372_10443753
1464 Ga0157372_10700979
1465 Ga0157372_10750785
1466 Ga0157372_11277799
1467 Ga0157372_11319716
1468 Ga0157375_10014100
1469 Ga0157375_10168279
1470 Ga0157375_10289995
1471 Ga0157375_10566424
1472 Ga0163163_10037594
1473 Ga0163163_10983305
1474 Ga0157380_11459356
1475 Ga0182008_10296950
1476 Ga0182008_10461846
1477 Ga0157377_10020706
1478 Ga0157379_10063298
1479 Ga0157376_12650254
1480 Ga0163161_10257971
1481 Ga0163161_10456764
1482 Ga0206356_10965601
1483 Ga0206353_11202403
1484 Ga0206353_11906044
1485 Ga0207697_10024948
1486 Ga0207656_10033899
1487 Ga0207656_10055130
1488 Ga0207653_10057109
1489 Ga0207682_10043576
1490 Ga0207682_10051377
1491 Ga0207682_10093543
1492 Ga0207688_10045051
1493 Ga0207688_10051937
1494 Ga0207688_10197006
1495 Ga0207680_10038947
1496 Ga0207680_10103553
1497 Ga0207680_10145850
1498 Ga0207680_10188038
1499 Ga0207680_10286196
1500 Ga0207647_10000721
1501 Ga0207647_10002263
1502 Ga0207647_10002940
1503 Ga0207647_10006442
1504 Ga0207647_10015955
1505 Ga0207647_10064843
1506 Ga0207647_10146109
1507 Ga0207647_10149786
1508 Ga0207647_10152481
1509 Ga0207647_10452625
1510 Ga0207645_10013495
1511 Ga0207645_10030977
1512 Ga0207645_10110577
1513 Ga0207645_10419571
1514 Ga0207643_10074500
1515 Ga0207705_10008024
1516 Ga0207705_10011549
1517 Ga0207705_10013549
1518 Ga0207705_10029514
1519 Ga0207705_10072616
1520 Ga0207705_10073179
1521 Ga0207705_10096779
1522 Ga0207705_10106467
1523 Ga0207705_10180652
1524 Ga0207705_10273680
1525 Ga0207705_10326417
1526 Ga0207705_11546460
1527 Ga0207654_10351504
1528 Ga0207654_10368544
1529 Ga0207707_10022651
1530 Ga0207707_10046847
1531 Ga0207707_10050263
1532 Ga0207707_10200554
1533 Ga0207695_10063905
1534 Ga0207695_10077027
1535 Ga0207695_10094177
1536 Ga0207671_10015467
1537 Ga0207671_10047665
1538 Ga0207660_10001191
1539 Ga0207660_10035170
1540 Ga0207660_10144721
1541 Ga0207660_10173356
1542 Ga0207660_10885451
1543 Ga0207657_10002867
1544 Ga0207657_10008053
1545 Ga0207657_10009578
1546 Ga0207657_10022956
1547 Ga0207657_10028130
1548 Ga0207657_10029311
1549 Ga0207657_10060183
1550 Ga0207657_10070842
1551 Ga0207657_10079248
1552 Ga0207657_10151116
1553 Ga0207657_10260087
1554 Ga0207649_10006009
1555 Ga0207649_10010089
1556 Ga0207649_10069552
1557 Ga0207649_10076186
1558 Ga0207649_10083885
1559 Ga0207649_10092977
1560 Ga0207649_10098297
1561 Ga0207649_10108864
1562 Ga0207649_10148370
1563 Ga0207649_10171364
1564 Ga0207649_10232399
1565 Ga0207649_10245050
1566 Ga0207652_10052973
1567 Ga0207652_10128149
1568 Ga0207652_10172658
1569 Ga0207652_10200976
1570 Ga0207652_10639002
1571 Ga0207652_11210053
1572 Ga0207681_10008742
1573 Ga0207681_10047145
1574 Ga0207681_10299015
1575 Ga0207681_10411100
1576 Ga0207681_10605975
1577 Ga0207681_11760464
1578 Ga0207694_10001011
1579 Ga0207694_10031528
1580 Ga0207694_10181029
1581 Ga0207694_10279765
1582 Ga0207694_11755117
1583 Ga0207650_10006425
1584 Ga0207650_10013438
1585 Ga0207650_10020000
1586 Ga0207650_10196649
1587 Ga0207650_10506385
1588 Ga0207650_11111577
1589 Ga0207659_10060719
1590 Ga0207659_10211152
1591 Ga0207659_10709100
1592 Ga0207687_10212147
1593 Ga0207664_10007802
1594 Ga0207664_10029928
1595 Ga0207664_11404326
1596 Ga0207664_11982082
1597 Ga0207644_10022018
1598 Ga0207644_10134227
1599 Ga0207644_10201331
1600 Ga0207644_10310474
1601 Ga0207644_10339824
1602 Ga0207690_10001891
1603 Ga0207690_10006698
1604 Ga0207690_10011850
1605 Ga0207690_10015745
1606 Ga0207690_10038089
1607 Ga0207690_10061615
1608 Ga0207690_10066029
1609 Ga0207690_10163215
1610 Ga0207690_10182575
1611 Ga0207690_10284597
1612 Ga0207690_10459273
1613 Ga0207690_10572068
1614 Ga0207690_10824636
1615 Ga0207690_10892118
1616 Ga0207690_11060609
1617 Ga0207690_11069111
1618 Ga0207690_11084396
1619 Ga0207690_11172023
1620 Ga0207706_10001211
1621 Ga0207706_10002133
1622 Ga0207706_10007955
1623 Ga0207706_10025809
1624 Ga0207706_10028223
1625 Ga0207706_10047473
1626 Ga0207706_10071714
1627 Ga0207706_10077606
1628 Ga0207706_10132127
1629 Ga0207706_10152015
1630 Ga0207706_10297553
1631 Ga0207706_10362241
1632 Ga0207706_10378374
1633 Ga0207706_10439236
1634 Ga0207706_10451707
1635 Ga0207686_10051627
1636 Ga0207709_10472310
1637 Ga0207709_10905195
1638 Ga0207670_10358206
1639 Ga0207669_10161360
1640 Ga0207669_10359053
1641 Ga0207669_10867151
1642 Ga0207704_10378311
1643 Ga0207704_10724837
1644 Ga0207691_10004966
1645 Ga0207691_10014906
1646 Ga0207691_10071051
1647 Ga0207691_10129771
1648 Ga0207691_10223053
1649 Ga0207691_10301112
1650 Ga0207711_10006337
1651 Ga0207711_10010388
1652 Ga0207711_10062345
1653 Ga0207711_10077519
1654 Ga0207711_11277288
1655 Ga0207689_10070162
1656 Ga0207661_10027360
1657 Ga0207661_10319413
1658 Ga0207679_10004621
1659 Ga0207679_10020613
1660 Ga0207679_10022960
1661 Ga0207679_10065533
1662 Ga0207679_10066772
1663 Ga0207679_10135932
1664 Ga0207679_10144393
1665 Ga0207679_10345768
1666 Ga0207679_10986398
1667 Ga0207679_11962342
1668 Ga0207667_10018675
1669 Ga0207667_10036759
1670 Ga0207667_10039888
1671 Ga0207667_10084198
1672 Ga0207667_10139366
1673 Ga0207667_10498013
1674 Ga0207667_10558596
1675 Ga0207651_10015209
1676 Ga0207651_10157945
1677 Ga0207651_10181125
1678 Ga0207651_10208266
1679 Ga0207651_10219835
1680 Ga0207651_10253680
1681 Ga0207651_10445167
1682 Ga0207651_11059540
1683 Ga0207651_11112693
1684 Ga0207712_10000491
1685 Ga0207712_10128652
1686 Ga0207712_10363988
1687 Ga0207668_10000060
1688 Ga0207668_10032560
1689 Ga0207668_10041358
1690 Ga0207668_10085237
1691 Ga0207668_10618779
1692 Ga0207668_10913405
1693 Ga0207668_11000093
1694 Ga0207640_10023295
1695 Ga0207640_10040624
1696 Ga0207640_10042763
1697 Ga0207640_10047489
1698 Ga0207640_10086875
1699 Ga0207640_10154754
1700 Ga0207640_10189194
1701 Ga0207640_10575084
1702 Ga0207658_10004678
1703 Ga0207658_10019496
1704 Ga0207658_10112917
1705 Ga0207658_10126910
1706 Ga0207658_10340918
1707 Ga0207658_10487671
1708 Ga0207658_10495499
1709 Ga0207658_10645155
1710 Ga0207677_10217586
1711 Ga0207677_10565586
1712 Ga0207677_10596869
1713 Ga0207677_12237934
1714 Ga0207703_10002126
1715 Ga0207703_10150927
1716 Ga0207703_10448077
1717 Ga0207639_10000144
1718 Ga0207639_10067079
1719 Ga0207639_10068559
1720 Ga0207639_10088892
1721 Ga0207639_10119957
1722 Ga0207639_10149113
1723 Ga0207639_10208717
1724 Ga0207639_10311645
1725 Ga0207639_10612872
1726 Ga0207639_10997780
1727 Ga0207639_11244523
1728 Ga0207678_10004202
1729 Ga0207678_10005267
1730 Ga0207678_10007936
1731 Ga0207678_10021689
1732 Ga0207678_10023348
1733 Ga0207678_10028383
1734 Ga0207678_10033913
1735 Ga0207678_10179676
1736 Ga0207678_10228200
1737 Ga0207678_10313820
1738 Ga0207678_11452084
1739 Ga0207708_11969659
1740 Ga0207702_10016603
1741 Ga0207702_10041084
1742 Ga0207702_10064566
1743 Ga0207702_10097792
1744 Ga0207702_10313537
1745 Ga0207702_10516710
1746 Ga0207702_10891429
1747 Ga0207641_10050697
1748 Ga0207641_10067143
1749 Ga0207641_10075483
1750 Ga0207641_10107531
1751 Ga0207641_10213549
1752 Ga0207641_10983206
1753 Ga0207648_10084888
1754 Ga0207648_10171676
1755 Ga0207648_10442512
1756 Ga0207648_11123441
1757 Ga0207648_11340653
1758 Ga0207676_10031236
1759 Ga0207676_10192462
1760 Ga0207676_10583407
1761 Ga0207676_10783001
1762 Ga0207676_11280098
1763 Ga0207674_10000057
1764 Ga0207674_10001662
1765 Ga0207674_10003393
1766 Ga0207674_10005462
1767 Ga0207674_10005506
1768 Ga0207674_10009490
1769 Ga0207674_10031060
1770 Ga0207674_10082958
1771 Ga0207674_10137769
1772 Ga0207674_10305632
1773 Ga0207674_11298845
1774 Ga0207675_100232883
1775 Ga0207683_10013896
1776 Ga0207683_10032849
1777 Ga0207683_10136735
1778 Ga0207683_11461502
1779 Ga0207698_10004897
1780 Ga0207698_10005264
1781 Ga0207698_10018006
1782 Ga0207698_10025656
1783 Ga0207698_10031060
1784 Ga0207698_10064988
1785 Ga0207698_10074647
1786 Ga0207698_10111067
1787 Ga0207698_10129960
1788 Ga0207698_10147504
1789 Ga0207698_10245211
1790 Ga0207698_10436726
1791 Ga0209973_1064924
1792 Ga0207428_10270523
1793 Ga0268266_10018502
1794 Ga0268266_10035908
1795 Ga0268266_11007504
1796 Ga0268266_11517825
1797 Ga0268265_10001537
1798 Ga0268265_10007179
1799 Ga0268265_10030723
1800 Ga0268265_10038772
1801 Ga0268265_10152777
1802 Ga0268265_10691125
1803 Ga0268264_10002057
1804 Ga0268264_10005564
1805 Ga0268264_10128315
1806 Ga0268264_10159804
1807 Ga0268264_10380254
1808 Ga0268264_10455707
1809 Ga0268264_10558342
1810 Ga0268264_10706932
1811 Ga0307408_100035403
1812 Ga0307408_100108533
1813 Ga0307408_100307098
1814 Ga0307405_10035211
1815 Ga0307405_10836544
1816 Ga0307405_11238438
1817 Ga0307413_10379851
1818 Ga0307413_10973116
1819 Ga0307410_10069565
1820 Ga0307410_10113802
1821 Ga0307410_10324176
1822 Ga0307406_10370043
1823 Ga0307407_10033193
1824 Ga0307407_10359763
1825 Ga0307407_10466134
1826 Ga0307412_10098027
1827 Ga0307412_10280147
1828 Ga0307412_10538855
1829 Ga0307409_100029124
1830 Ga0307409_100029392
1831 Ga0307409_100093976
1832 Ga0307409_100259724
1833 Ga0307409_100334698
1834 Ga0307409_101343713
1835 Ga0307416_100079830
1836 Ga0307416_100265384
1837 Ga0307416_100298724
1838 Ga0307416_100558524
1839 Ga0307414_10232308
1840 Ga0307414_10641895
1841 Ga0307411_10018944
1842 Ga0307411_10233691
1843 Ga0307411_10298865
1844 Ga0307411_10996208
1845 Ga0307415_100099190
1846 Ga0307415_100118172
1847 Ga0307415_100697994
1848 Ga0395899_0009507
1849 Ga0395899_0010217
1850 Ga0395899_0018320
1851 Ga0395899_0045303
1852 Ga0395899_0079016
1853 Ga0395899_0215691
1854 Ga0395899_0403532
1855 Ga0395900_0005687
1856 Ga0395900_0006197
1857 Ga0395900_0006712
1858 Ga0395900_0017453
1859 Ga0395900_0019372
1860 Ga0395900_0040753
1861 Ga0395900_0054644
1862 Ga0395900_0080078
1863 Ga0395900_0170102
1864 Ga0395900_0204368
1865 Ga0395900_0339320
1866 Ga0395900_0406922
1867 Ga0395900_0415628
1868 Ga0395900_0647756
1869 Ga0395900_1289541
1870 Ga0395900_1376937
1871 Ga0395900_1386869
1872 Ga0395898_0012439
1873 Ga0395898_0058065
1874 Ga0395898_0061014
1875 Ga0395898_0069577
1876 Ga0395898_0090033
1877 Ga0395898_0160495
1878 Ga0395898_0212178
1879 Ga0395898_0275474
1880 Ga0395898_0301320
1881 Ga0395898_0422737
1882 Ga0395898_0954690
1883 Ga0395898_1314696
1884 Ga0395898_1576262
1885 Ga0395898_1805090
1886 Ga0395905_0000092
1887 Ga0395905_0003268
1888 Ga0395905_0003469
1889 Ga0395905_0012841
1890 Ga0395905_0014738
1891 Ga0395905_0014833
1892 Ga0395905_0040395
1893 Ga0395905_0040523
1894 Ga0395905_0081486
1895 Ga0395905_0086334
1896 Ga0395905_0088899
1897 Ga0395905_0156710
1898 Ga0395905_0190693
1899 Ga0395905_0227419
1900 Ga0395905_0264169
1901 Ga0395905_0533048
1902 Ga0395905_1317341
1903 Ga0395901_0000188
1904 Ga0395901_0006402
1905 Ga0395901_0017047
1906 Ga0395901_0028527
1907 Ga0395901_0041548
1908 Ga0395901_0053756
1909 Ga0395901_0064358
1910 Ga0395901_0183585
1911 Ga0395901_0316337
1912 Ga0395901_0487693
1913 Ga0395901_1031926
1914 Ga0395901_1257573
1915 Ga0439447_092499
1916 Ga0439461_0021595
1917 Ga0439465_0068680
1918 Ga0439432_092058
1919 Ga0439449_0227088
1920 Ga0439452_048573
1921 Ga0439455_0225675
1922 Ga0450914_000674
1923 Ga0450905_045588
1924 Ga0450889_000204
1925 Ga0439458_0001172
1926 Ga0466965_0185687
1927 Ga0466961_0163574
1928 Ga0466963_0119656
1929 Ga0466963_0160984
1930 Ga0466963_0166996
1931 Ga0466963_0757508
1932 Ga0466964_0206083
1933 Ga0466964_0398505
1934 Ga0466971_0235334
1935 Ga0466971_0277009
1936 Ga0466971_0705140
1937 Ga0466970_0846263
1938 Ga0466957_0049506
1939 Ga0466957_0435397
1940 Ga0466957_0654756
1941 Ga0466957_1144408
1942 Ga0466960_0174216
1943 Ga0466959_0326253
1944 Ga0466959_0986125
1945 Ga0466958_0083987
1946 Ga0466967_0001666
1947 Ga0466967_0004245
1948 Ga0466967_0015584
1949 Ga0466967_0021721
1950 Ga0466967_0222873
1951 Ga0466967_0425322
1952 Ga0466967_0445891
1953 Ga0495663_0008582
1954 Ga0495621_0041351
1955 Ga0495668_0293960
1956 Ga0495669_0002162
1957 Ga0495669_0648474
1958 Ga0495677_0015603
1959 Ga0495685_089176
1960 Ga0496100_1318514
1961 Ga0496101_0213898
1962 Ga0496102_1120389
1963 Ga0496103_0097387
1964 Ga0496106_0462086
1965 Ga0496106_0737219
1966 Ga0496107_0154394
1967 Ga0496107_0354246
1968 Ga0496107_0449659
1969 Ga0496107_0763371
1970 Ga0496108_0647162
1971 Ga0496109_0557149
1972 Ga0496111_0115185
1973 Ga0496111_0296851
1974 Ga0496111_0702874
1975 Ga0496112_0375992
1976 Ga0496113_0144734
1977 Ga0496114_0036993
1978 Ga0496115_0037736
1979 nmdc:mga0k408_330179_c1
1980 nmdc:mga06r32_1805631_c1
1981 nmdc:mga08y16_184093_c1
1982 nmdc:mga0rr50_100459_c1
1983 nmdc:mga0a205_8689_c1
1984 Ga0466962_0149268
1985 Ga0466962_0242704
1986 Ga0466962_0522112

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

25

111

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uzk-assembly1.cif.gz_E rat kidney v1 complex lacking subunit h with sidk and ncoa7b, state 1 0.8375 34 84
7tmq-assembly1.cif.gz_F v1 complex lacking subunit c from saccharomyces cerevisiae, state 3 0.8358 34 81
7une-assembly1.cif.gz_Q the v1 region of bovine v-atpase in complex with human meak7 (focused refinement) 0.8344 34 86
6vq9-assembly1.cif.gz_D mammalian v-atpase from rat brain soluble v1 region rotational state 1 with sidk and adp (from focused refinement) 0.8329 34 81
6wm2-assembly1.cif.gz_F human v-atpase in state 1 with sidk and adp 0.8299 34 86
ID Description Score Start End Superfamily
3kygA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7913 17 83 2.40.10.220
2k8iA02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7896 48 79 2.40.10.330
4dt4A02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.745 41 85 2.40.10.330
af_Q57670_3_72_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7365 30 87 2.40.30.20
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.7364 37 81 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A1B2AE73-F1-model_v4 PilZ domain-containing protein 0.9602 32 88 GO:0035438
AF-A0A7C9IED2-F1-model_v4 PilZ domain-containing protein 0.9563 18 88 GO:0035438
AF-A0A6A0RAA2-F1-model_v4 Uncharacterized protein 0.9537 17 82
AF-F1ZDH7-F1-model_v4 PilZ domain-containing protein 0.9526 19 90 GO:0035438
AF-A0A0T0PZR3-F1-model_v4 PilZ domain-containing protein 0.9446 17 90 GO:0035438

Map