F487476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 984 | 337 | 1968 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0004656|Ga0316584_0004656_875_1330 |
| Length | 151 |
| Sequence | MNDGTTLSDRNPSMPTQIDWDDLRRQATAAASRAYAPYSHVHVGAAALVDDGRVVQGVNVENASYGLGTCAENGIASALAASGGGRLVAISVVAGDGRPLAPCGRCRQVLYEFGGKDLLLDGGADGTPVTLGEMLPGAFGPEDVVTRREQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 104 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 189 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 217 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 218 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 219 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 222 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 223 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 326 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 327 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 328 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 329 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 330 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 331 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 332 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 333 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 334 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 335 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 336 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 337 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.61 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 7.93 |
| Rhizosphere | 90.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0004656 | 3300036712 | Bacteria | 9092 |
| 2 | 2214909088 | 2209111006 | Bacteria | 1401 |
| 3 | ARcpr5oldR_c005479 | 3300000041 | Bacteria | 1089 |
| 4 | ARCol0yngRDRAFT_1002670 | 3300000652 | Bacteria | 1333 |
| 5 | JGI24745J21846_1001366 | 3300002073 | Bacteria | 2356 |
| 6 | JGI24738J21930_10000561 | 3300002075 | Bacteria | 10619 |
| 7 | JGI25406J46586_10004625 | 3300003203 | Bacteria | 6403 |
| 8 | rootH2_10047530 | 3300003320 | Bacteria | 3035 |
| 9 | Ga0070658_10151231 | 3300005327 | Bacteria | 1943 |
| 10 | Ga0070658_10354259 | 3300005327 | Bacteria | 1256 |
| 11 | Ga0070676_10042736 | 3300005328 | Bacteria | 2633 |
| 12 | Ga0070676_10075566 | 3300005328 | Bacteria | 2032 |
| 13 | Ga0070676_10174224 | 3300005328 | Bacteria | 1394 |
| 14 | Ga0070676_11068759 | 3300005328 | Bacteria | 609 |
| 15 | Ga0070676_11127176 | 3300005328 | Unclassified | 594 |
| 16 | Ga0070676_11314097 | 3300005328 | Unclassified | 553 |
| 17 | Ga0070683_100007373 | 3300005329 | Bacteria | 9292 |
| 18 | Ga0070683_100025155 | 3300005329 | Bacteria | 5343 |
| 19 | Ga0070683_100468315 | 3300005329 | Bacteria | 1203 |
| 20 | Ga0070683_100608994 | 3300005329 | Bacteria | 1045 |
| 21 | Ga0070683_101091354 | 3300005329 | Bacteria | 767 |
| 22 | Ga0070690_100757158 | 3300005330 | Bacteria | 750 |
| 23 | Ga0070690_100996072 | 3300005330 | Unclassified | 660 |
| 24 | Ga0070670_100510681 | 3300005331 | Bacteria | 1069 |
| 25 | Ga0070670_100955941 | 3300005331 | Bacteria | 778 |
| 26 | Ga0070670_101297248 | 3300005331 | Bacteria | 666 |
| 27 | Ga0068869_100022196 | 3300005334 | Bacteria | 4371 |
| 28 | Ga0068869_100232140 | 3300005334 | Bacteria | 1466 |
| 29 | Ga0068869_100299254 | 3300005334 | Bacteria | 1298 |
| 30 | Ga0070666_10874327 | 3300005335 | Bacteria | 664 |
| 31 | Ga0070680_100018180 | 3300005336 | Bacteria | 5552 |
| 32 | Ga0070682_100006877 | 3300005337 | Bacteria | 6392 |
| 33 | Ga0070682_100010912 | 3300005337 | Bacteria | 5176 |
| 34 | Ga0070682_100053405 | 3300005337 | Bacteria | 2532 |
| 35 | Ga0070682_100072014 | 3300005337 | Bacteria | 2214 |
| 36 | Ga0070682_100319289 | 3300005337 | Bacteria | 1146 |
| 37 | Ga0068868_100011827 | 3300005338 | Bacteria | 6363 |
| 38 | Ga0068868_100030465 | 3300005338 | Bacteria | 4137 |
| 39 | Ga0068868_100038418 | 3300005338 | Bacteria | 3716 |
| 40 | Ga0068868_100180751 | 3300005338 | Bacteria | 1750 |
| 41 | Ga0068868_100286935 | 3300005338 | Bacteria | 1394 |
| 42 | Ga0068868_100335513 | 3300005338 | Bacteria | 1291 |
| 43 | Ga0068868_100664699 | 3300005338 | Bacteria | 929 |
| 44 | Ga0070660_100003349 | 3300005339 | Bacteria | 11013 |
| 45 | Ga0070660_100085182 | 3300005339 | Bacteria | 2485 |
| 46 | Ga0070660_100149944 | 3300005339 | Bacteria | 1874 |
| 47 | Ga0070660_100583837 | 3300005339 | Bacteria | 933 |
| 48 | Ga0070660_101198738 | 3300005339 | Unclassified | 644 |
| 49 | Ga0070689_100072458 | 3300005340 | Bacteria | 2692 |
| 50 | Ga0070689_100104231 | 3300005340 | Bacteria | 2249 |
| 51 | Ga0070689_100110319 | 3300005340 | Bacteria | 2187 |
| 52 | Ga0070691_10000980 | 3300005341 | Bacteria | 11656 |
| 53 | Ga0070691_10038406 | 3300005341 | Bacteria | 2261 |
| 54 | Ga0070691_10475037 | 3300005341 | Unclassified | 718 |
| 55 | Ga0070691_10861312 | 3300005341 | Unclassified | 556 |
| 56 | Ga0070687_100149689 | 3300005343 | Bacteria | 1369 |
| 57 | Ga0070687_100166483 | 3300005343 | Bacteria | 1308 |
| 58 | Ga0070687_100915669 | 3300005343 | Bacteria | 630 |
| 59 | Ga0070661_100258984 | 3300005344 | Bacteria | 1344 |
| 60 | Ga0070661_100594909 | 3300005344 | Bacteria | 894 |
| 61 | Ga0070661_101168806 | 3300005344 | Bacteria | 643 |
| 62 | Ga0070692_10000477 | 3300005345 | Bacteria | 12289 |
| 63 | Ga0070692_10018946 | 3300005345 | Bacteria | 3316 |
| 64 | Ga0070692_10224163 | 3300005345 | Bacteria | 1113 |
| 65 | Ga0070692_11313316 | 3300005345 | Unclassified | 519 |
| 66 | Ga0070668_100056380 | 3300005347 | Bacteria | 3035 |
| 67 | Ga0070668_100240840 | 3300005347 | Bacteria | 1498 |
| 68 | Ga0070669_100263907 | 3300005353 | Bacteria | 1375 |
| 69 | Ga0070669_100272529 | 3300005353 | Bacteria | 1354 |
| 70 | Ga0070669_100472844 | 3300005353 | Bacteria | 1036 |
| 71 | Ga0070669_100501299 | 3300005353 | Bacteria | 1007 |
| 72 | Ga0070675_100011418 | 3300005354 | Bacteria | 6952 |
| 73 | Ga0070675_100185784 | 3300005354 | Bacteria | 1799 |
| 74 | Ga0070675_100208373 | 3300005354 | Bacteria | 1698 |
| 75 | Ga0070675_101157882 | 3300005354 | Unclassified | 712 |
| 76 | Ga0070675_101489980 | 3300005354 | Unclassified | 624 |
| 77 | Ga0070675_101794773 | 3300005354 | Unclassified | 566 |
| 78 | Ga0070671_100026781 | 3300005355 | Bacteria | 4742 |
| 79 | Ga0070674_100061968 | 3300005356 | Bacteria | 2612 |
| 80 | Ga0070674_100068163 | 3300005356 | Bacteria | 2505 |
| 81 | Ga0070674_100304854 | 3300005356 | Bacteria | 1271 |
| 82 | Ga0070674_100371351 | 3300005356 | Bacteria | 1161 |
| 83 | Ga0070674_100481096 | 3300005356 | Bacteria | 1030 |
| 84 | Ga0070674_101199609 | 3300005356 | Bacteria | 674 |
| 85 | Ga0070673_100022103 | 3300005364 | Bacteria | 4626 |
| 86 | Ga0070673_100280376 | 3300005364 | Bacteria | 1462 |
| 87 | Ga0070673_100804616 | 3300005364 | Bacteria | 868 |
| 88 | Ga0070673_101714275 | 3300005364 | Bacteria | 595 |
| 89 | Ga0070688_100020857 | 3300005365 | Bacteria | 3818 |
| 90 | Ga0070688_100042250 | 3300005365 | Bacteria | 2803 |
| 91 | Ga0070659_100002964 | 3300005366 | Bacteria | 12102 |
| 92 | Ga0070659_100020779 | 3300005366 | Bacteria | 4992 |
| 93 | Ga0070659_100026771 | 3300005366 | Bacteria | 4439 |
| 94 | Ga0070659_100031619 | 3300005366 | Bacteria | 4100 |
| 95 | Ga0070659_100233987 | 3300005366 | Bacteria | 1519 |
| 96 | Ga0070667_101344063 | 3300005367 | Bacteria | 670 |
| 97 | Ga0070714_100943578 | 3300005435 | Bacteria | 838 |
| 98 | Ga0070701_10005589 | 3300005438 | Bacteria | 5207 |
| 99 | Ga0070701_10021847 | 3300005438 | Bacteria | 3061 |
| 100 | Ga0070705_100094654 | 3300005440 | Bacteria | 1871 |
| 101 | Ga0070705_101411496 | 3300005440 | Bacteria | 581 |
| 102 | Ga0070700_100029006 | 3300005441 | Bacteria | 3296 |
| 103 | Ga0070700_100118197 | 3300005441 | Bacteria | 1772 |
| 104 | Ga0070700_100131663 | 3300005441 | Bacteria | 1688 |
| 105 | Ga0070700_100197878 | 3300005441 | Bacteria | 1410 |
| 106 | Ga0070694_100094261 | 3300005444 | Bacteria | 2106 |
| 107 | Ga0070708_100173014 | 3300005445 | Bacteria | 2017 |
| 108 | Ga0070663_100045244 | 3300005455 | Bacteria | 3108 |
| 109 | Ga0070663_100360685 | 3300005455 | Bacteria | 1179 |
| 110 | Ga0070678_100156227 | 3300005456 | Bacteria | 1843 |
| 111 | Ga0070678_100180491 | 3300005456 | Bacteria | 1727 |
| 112 | Ga0070678_100297831 | 3300005456 | Bacteria | 1370 |
| 113 | Ga0070678_100350880 | 3300005456 | Bacteria | 1268 |
| 114 | Ga0070678_100484863 | 3300005456 | Bacteria | 1088 |
| 115 | Ga0070678_100822689 | 3300005456 | Bacteria | 844 |
| 116 | Ga0070678_100931040 | 3300005456 | Bacteria | 796 |
| 117 | Ga0070678_101242866 | 3300005456 | Bacteria | 692 |
| 118 | Ga0070678_101614861 | 3300005456 | Bacteria | 609 |
| 119 | Ga0070662_100050553 | 3300005457 | Bacteria | 2999 |
| 120 | Ga0070662_100130390 | 3300005457 | Bacteria | 1938 |
| 121 | Ga0070662_100587593 | 3300005457 | Unclassified | 936 |
| 122 | Ga0070662_101006480 | 3300005457 | Unclassified | 713 |
| 123 | Ga0070681_10002072 | 3300005458 | Bacteria | 18196 |
| 124 | Ga0070681_10067466 | 3300005458 | Bacteria | 3545 |
| 125 | Ga0070681_10366609 | 3300005458 | Bacteria | 1351 |
| 126 | Ga0070681_10731612 | 3300005458 | Bacteria | 905 |
| 127 | Ga0068867_100040464 | 3300005459 | Bacteria | 3402 |
| 128 | Ga0068867_100048358 | 3300005459 | Bacteria | 3129 |
| 129 | Ga0068867_100667411 | 3300005459 | Bacteria | 914 |
| 130 | Ga0070685_10026332 | 3300005466 | Bacteria | 3205 |
| 131 | Ga0070685_10094771 | 3300005466 | Bacteria | 1813 |
| 132 | Ga0070685_11302785 | 3300005466 | Unclassified | 555 |
| 133 | Ga0070698_100877886 | 3300005471 | Bacteria | 842 |
| 134 | Ga0070679_100208004 | 3300005530 | Bacteria | 1921 |
| 135 | Ga0070679_100472387 | 3300005530 | Bacteria | 1198 |
| 136 | Ga0070679_100975113 | 3300005530 | Bacteria | 791 |
| 137 | Ga0070684_100007151 | 3300005535 | Bacteria | 8672 |
| 138 | Ga0070684_100050026 | 3300005535 | Bacteria | 3629 |
| 139 | Ga0070684_100069280 | 3300005535 | Bacteria | 3103 |
| 140 | Ga0070684_100281922 | 3300005535 | Bacteria | 1522 |
| 141 | Ga0070684_100396754 | 3300005535 | Bacteria | 1272 |
| 142 | Ga0070684_100515132 | 3300005535 | Bacteria | 1108 |
| 143 | Ga0070684_100571830 | 3300005535 | Bacteria | 1050 |
| 144 | Ga0070684_100581556 | 3300005535 | Bacteria | 1040 |
| 145 | Ga0070684_101453379 | 3300005535 | Unclassified | 646 |
| 146 | Ga0070684_101857343 | 3300005535 | Unclassified | 568 |
| 147 | Ga0068853_100004912 | 3300005539 | Bacteria | 10408 |
| 148 | Ga0068853_100009437 | 3300005539 | Bacteria | 7862 |
| 149 | Ga0068853_100396668 | 3300005539 | Bacteria | 1291 |
| 150 | Ga0068853_101679536 | 3300005539 | Bacteria | 616 |
| 151 | Ga0068853_102482659 | 3300005539 | Bacteria | 502 |
| 152 | Ga0070672_100004959 | 3300005543 | Bacteria | 8762 |
| 153 | Ga0070672_100022319 | 3300005543 | Bacteria | 4648 |
| 154 | Ga0070672_100029322 | 3300005543 | Bacteria | 4125 |
| 155 | Ga0070672_100300688 | 3300005543 | Bacteria | 1360 |
| 156 | Ga0070672_100950821 | 3300005543 | Unclassified | 760 |
| 157 | Ga0070686_100006012 | 3300005544 | Bacteria | 6737 |
| 158 | Ga0070686_100075322 | 3300005544 | Bacteria | 2219 |
| 159 | Ga0070686_100391149 | 3300005544 | Unclassified | 1055 |
| 160 | Ga0070696_100183811 | 3300005546 | Bacteria | 1552 |
| 161 | Ga0070696_100510295 | 3300005546 | Bacteria | 958 |
| 162 | Ga0070696_101321399 | 3300005546 | Unclassified | 613 |
| 163 | Ga0070693_100134038 | 3300005547 | Bacteria | 1552 |
| 164 | Ga0070693_100624259 | 3300005547 | Bacteria | 781 |
| 165 | Ga0070665_100025371 | 3300005548 | Bacteria | 5973 |
| 166 | Ga0070665_100222402 | 3300005548 | Bacteria | 1888 |
| 167 | Ga0070665_100556369 | 3300005548 | Bacteria | 1159 |
| 168 | Ga0070665_101988384 | 3300005548 | Bacteria | 587 |
| 169 | Ga0070704_100022573 | 3300005549 | Bacteria | 4098 |
| 170 | Ga0070704_100623963 | 3300005549 | Bacteria | 949 |
| 171 | Ga0068855_100047253 | 3300005563 | Bacteria | 5085 |
| 172 | Ga0068855_100606283 | 3300005563 | Bacteria | 1180 |
| 173 | Ga0068855_100994228 | 3300005563 | Bacteria | 882 |
| 174 | Ga0068855_101162895 | 3300005563 | Bacteria | 804 |
| 175 | Ga0068855_101962998 | 3300005563 | Bacteria | 592 |
| 176 | Ga0070664_100006431 | 3300005564 | Bacteria | 9478 |
| 177 | Ga0070664_100148507 | 3300005564 | Bacteria | 2068 |
| 178 | Ga0070664_100216847 | 3300005564 | Bacteria | 1711 |
| 179 | Ga0070664_100337635 | 3300005564 | Bacteria | 1368 |
| 180 | Ga0070664_100789400 | 3300005564 | Bacteria | 887 |
| 181 | Ga0068857_100389205 | 3300005577 | Bacteria | 1296 |
| 182 | Ga0068857_100822508 | 3300005577 | Bacteria | 888 |
| 183 | Ga0068857_101515383 | 3300005577 | Bacteria | 653 |
| 184 | Ga0068857_101524848 | 3300005577 | Bacteria | 651 |
| 185 | Ga0068857_102166955 | 3300005577 | Bacteria | 545 |
| 186 | Ga0068854_100003631 | 3300005578 | Bacteria | 9657 |
| 187 | Ga0068854_100047594 | 3300005578 | Bacteria | 3057 |
| 188 | Ga0068854_100136767 | 3300005578 | Bacteria | 1876 |
| 189 | Ga0068854_100137616 | 3300005578 | Bacteria | 1871 |
| 190 | Ga0068854_100462633 | 3300005578 | Bacteria | 1062 |
| 191 | Ga0068856_100048087 | 3300005614 | Bacteria | 4202 |
| 192 | Ga0068856_100343764 | 3300005614 | Bacteria | 1510 |
| 193 | Ga0068856_100524345 | 3300005614 | Bacteria | 1206 |
| 194 | Ga0070702_100084711 | 3300005615 | Bacteria | 1907 |
| 195 | Ga0070702_100319036 | 3300005615 | Bacteria | 1082 |
| 196 | Ga0070702_100612026 | 3300005615 | Bacteria | 818 |
| 197 | Ga0070702_100897223 | 3300005615 | Bacteria | 694 |
| 198 | Ga0068852_100007514 | 3300005616 | Bacteria | 7957 |
| 199 | Ga0068852_100054355 | 3300005616 | Bacteria | 3451 |
| 200 | Ga0068852_100057069 | 3300005616 | Bacteria | 3377 |
| 201 | Ga0068852_100352319 | 3300005616 | Bacteria | 1438 |
| 202 | Ga0068852_100527587 | 3300005616 | Bacteria | 1179 |
| 203 | Ga0068852_100889232 | 3300005616 | Bacteria | 907 |
| 204 | Ga0068859_100157554 | 3300005617 | Bacteria | 2348 |
| 205 | Ga0068859_101542097 | 3300005617 | Bacteria | 734 |
| 206 | Ga0068864_100118253 | 3300005618 | Bacteria | 2366 |
| 207 | Ga0068864_100216304 | 3300005618 | Bacteria | 1766 |
| 208 | Ga0068864_102383574 | 3300005618 | Unclassified | 535 |
| 209 | Ga0068866_10120722 | 3300005718 | Bacteria | 1476 |
| 210 | Ga0068866_10164880 | 3300005718 | Bacteria | 1295 |
| 211 | Ga0068866_10373102 | 3300005718 | Bacteria | 913 |
| 212 | Ga0068866_10459000 | 3300005718 | Bacteria | 835 |
| 213 | Ga0068866_10563461 | 3300005718 | Bacteria | 764 |
| 214 | Ga0068866_10568960 | 3300005718 | Bacteria | 760 |
| 215 | Ga0068866_10594368 | 3300005718 | Bacteria | 746 |
| 216 | Ga0068861_100032453 | 3300005719 | Bacteria | 3844 |
| 217 | Ga0068861_100214674 | 3300005719 | Bacteria | 1622 |
| 218 | Ga0068861_100265831 | 3300005719 | Bacteria | 1471 |
| 219 | Ga0068861_100746821 | 3300005719 | Bacteria | 914 |
| 220 | Ga0068851_10111038 | 3300005834 | Bacteria | 1463 |
| 221 | Ga0068851_10167962 | 3300005834 | Bacteria | 1209 |
| 222 | Ga0068870_10028157 | 3300005840 | Bacteria | 2818 |
| 223 | Ga0068870_10341515 | 3300005840 | Bacteria | 958 |
| 224 | Ga0068863_100781526 | 3300005841 | Bacteria | 952 |
| 225 | Ga0068858_100058586 | 3300005842 | Bacteria | 3562 |
| 226 | Ga0068858_100624962 | 3300005842 | Bacteria | 1046 |
| 227 | Ga0068858_101832014 | 3300005842 | Bacteria | 599 |
| 228 | Ga0068860_100159255 | 3300005843 | Bacteria | 2176 |
| 229 | Ga0068860_100535839 | 3300005843 | Bacteria | 1172 |
| 230 | Ga0081455_10911023 | 3300005937 | Bacteria | 546 |
| 231 | Ga0081539_10001549 | 3300005985 | Bacteria | 38322 |
| 232 | Ga0081539_10109064 | 3300005985 | Bacteria | 1397 |
| 233 | Ga0070717_10088475 | 3300006028 | Bacteria | 2610 |
| 234 | Ga0075365_10326889 | 3300006038 | Bacteria | 1080 |
| 235 | Ga0075432_10002049 | 3300006058 | Bacteria | 6703 |
| 236 | Ga0097621_100107927 | 3300006237 | Bacteria | 2350 |
| 237 | Ga0097621_100119480 | 3300006237 | Bacteria | 2234 |
| 238 | Ga0097621_101296766 | 3300006237 | Bacteria | 688 |
| 239 | Ga0097621_101788053 | 3300006237 | Bacteria | 586 |
| 240 | Ga0068871_101319170 | 3300006358 | Bacteria | 679 |
| 241 | Ga0068871_101487195 | 3300006358 | Unclassified | 640 |
| 242 | Ga0075428_100004576 | 3300006844 | Bacteria | 15296 |
| 243 | Ga0075428_100501474 | 3300006844 | Bacteria | 1299 |
| 244 | Ga0075428_100770776 | 3300006844 | Unclassified | 1023 |
| 245 | Ga0075431_101309827 | 3300006847 | Bacteria | 685 |
| 246 | Ga0075433_10037639 | 3300006852 | Bacteria | 4174 |
| 247 | Ga0075433_10608600 | 3300006852 | Unclassified | 959 |
| 248 | Ga0075434_100006726 | 3300006871 | Bacteria | 10564 |
| 249 | Ga0075434_100837205 | 3300006871 | Bacteria | 936 |
| 250 | Ga0075429_100009096 | 3300006880 | Bacteria | 8626 |
| 251 | Ga0068865_100002718 | 3300006881 | Bacteria | 10501 |
| 252 | Ga0068865_100016943 | 3300006881 | Bacteria | 4675 |
| 253 | Ga0068865_100046880 | 3300006881 | Bacteria | 2967 |
| 254 | Ga0068865_100082195 | 3300006881 | Bacteria | 2315 |
| 255 | Ga0068865_100111307 | 3300006881 | Bacteria | 2020 |
| 256 | Ga0068865_101127271 | 3300006881 | Bacteria | 692 |
| 257 | Ga0097620_100157559 | 3300006931 | Bacteria | 2348 |
| 258 | Ga0097620_101541996 | 3300006931 | Bacteria | 734 |
| 259 | Ga0075435_100048596 | 3300007076 | Bacteria | 3409 |
| 260 | Ga0075435_100069936 | 3300007076 | Bacteria | 2864 |
| 261 | Ga0099794_10000307 | 3300007265 | Bacteria | 16696 |
| 262 | Ga0105251_10124016 | 3300009011 | Bacteria | 1173 |
| 263 | Ga0105240_12473632 | 3300009093 | Bacteria | 537 |
| 264 | Ga0111539_10008396 | 3300009094 | Bacteria | 13142 |
| 265 | Ga0111539_10056574 | 3300009094 | Bacteria | 4661 |
| 266 | Ga0111539_10330305 | 3300009094 | Bacteria | 1775 |
| 267 | Ga0111539_10359368 | 3300009094 | Bacteria | 1695 |
| 268 | Ga0111539_10557635 | 3300009094 | Bacteria | 1334 |
| 269 | Ga0111539_10625196 | 3300009094 | Bacteria | 1254 |
| 270 | Ga0111539_10836169 | 3300009094 | Bacteria | 1071 |
| 271 | Ga0105245_10009579 | 3300009098 | Bacteria | 8450 |
| 272 | Ga0105245_10027685 | 3300009098 | Bacteria | 4994 |
| 273 | Ga0105245_10077600 | 3300009098 | Bacteria | 3029 |
| 274 | Ga0105245_10259436 | 3300009098 | Bacteria | 1691 |
| 275 | Ga0105245_10456665 | 3300009098 | Bacteria | 1287 |
| 276 | Ga0105245_10566406 | 3300009098 | Bacteria | 1159 |
| 277 | Ga0105245_10749425 | 3300009098 | Bacteria | 1012 |
| 278 | Ga0105245_10872505 | 3300009098 | Unclassified | 941 |
| 279 | Ga0105245_11147490 | 3300009098 | Unclassified | 824 |
| 280 | Ga0105245_11852785 | 3300009098 | Bacteria | 656 |
| 281 | Ga0105247_10008745 | 3300009101 | Bacteria | 6179 |
| 282 | Ga0105247_10798906 | 3300009101 | Bacteria | 720 |
| 283 | Ga0105247_11242169 | 3300009101 | Bacteria | 595 |
| 284 | Ga0114129_10137571 | 3300009147 | Bacteria | 3351 |
| 285 | Ga0114129_10944225 | 3300009147 | Bacteria | 1090 |
| 286 | Ga0114129_12486249 | 3300009147 | Bacteria | 619 |
| 287 | Ga0105243_10002349 | 3300009148 | Bacteria | 15832 |
| 288 | Ga0105243_10021154 | 3300009148 | Bacteria | 4937 |
| 289 | Ga0105243_10245021 | 3300009148 | Bacteria | 1597 |
| 290 | Ga0105243_10394576 | 3300009148 | Bacteria | 1284 |
| 291 | Ga0105243_11021514 | 3300009148 | Unclassified | 831 |
| 292 | Ga0105243_12393996 | 3300009148 | Bacteria | 566 |
| 293 | Ga0105243_12550490 | 3300009148 | Bacteria | 551 |
| 294 | Ga0105241_10134873 | 3300009174 | Bacteria | 2003 |
| 295 | Ga0105241_10320466 | 3300009174 | Bacteria | 1336 |
| 296 | Ga0105241_10439146 | 3300009174 | Bacteria | 1152 |
| 297 | Ga0105242_10007255 | 3300009176 | Bacteria | 8548 |
| 298 | Ga0105242_10440583 | 3300009176 | Bacteria | 1226 |
| 299 | Ga0105242_10449144 | 3300009176 | Unclassified | 1215 |
| 300 | Ga0105242_10502154 | 3300009176 | Bacteria | 1154 |
| 301 | Ga0105242_10537817 | 3300009176 | Bacteria | 1118 |
| 302 | Ga0105242_10540867 | 3300009176 | Bacteria | 1115 |
| 303 | Ga0105248_10118683 | 3300009177 | Bacteria | 2984 |
| 304 | Ga0105248_10527291 | 3300009177 | Bacteria | 1332 |
| 305 | Ga0105248_10665810 | 3300009177 | Bacteria | 1174 |
| 306 | Ga0105248_11063412 | 3300009177 | Bacteria | 914 |
| 307 | Ga0105248_11615840 | 3300009177 | Bacteria | 734 |
| 308 | Ga0105237_10138812 | 3300009545 | Bacteria | 2425 |
| 309 | Ga0105237_10556985 | 3300009545 | Bacteria | 1153 |
| 310 | Ga0105237_11251884 | 3300009545 | Unclassified | 748 |
| 311 | Ga0105238_10013752 | 3300009551 | Bacteria | 8179 |
| 312 | Ga0105238_10140061 | 3300009551 | Bacteria | 2396 |
| 313 | Ga0105238_10431207 | 3300009551 | Bacteria | 1314 |
| 314 | Ga0105238_11143762 | 3300009551 | Unclassified | 802 |
| 315 | Ga0105249_10087271 | 3300009553 | Bacteria | 2911 |
| 316 | Ga0105249_10156124 | 3300009553 | Bacteria | 2201 |
| 317 | Ga0105249_10460894 | 3300009553 | Bacteria | 1311 |
| 318 | Ga0105249_10586938 | 3300009553 | Bacteria | 1168 |
| 319 | Ga0105249_10868213 | 3300009553 | Bacteria | 968 |
| 320 | Ga0105239_10114244 | 3300010375 | Bacteria | 2995 |
| 321 | Ga0105239_10141718 | 3300010375 | Bacteria | 2679 |
| 322 | Ga0105239_10158213 | 3300010375 | Bacteria | 2531 |
| 323 | Ga0105239_10166053 | 3300010375 | Bacteria | 2468 |
| 324 | Ga0105239_11425876 | 3300010375 | Bacteria | 800 |
| 325 | Ga0105246_10007974 | 3300011119 | Bacteria | 6500 |
| 326 | Ga0105246_10040527 | 3300011119 | Bacteria | 3144 |
| 327 | Ga0105246_10439364 | 3300011119 | Bacteria | 1094 |
| 328 | Ga0105246_10872382 | 3300011119 | Unclassified | 805 |
| 329 | Ga0105246_11583657 | 3300011119 | Bacteria | 618 |
| 330 | Ga0157319_1009125 | 3300012497 | Bacteria | 774 |
| 331 | Ga0157338_1028621 | 3300012515 | Bacteria | 697 |
| 332 | Ga0157373_11426740 | 3300013100 | Unclassified | 527 |
| 333 | Ga0157371_10095050 | 3300013102 | Bacteria | 2112 |
| 334 | Ga0157371_10131099 | 3300013102 | Bacteria | 1783 |
| 335 | Ga0157370_10056428 | 3300013104 | Bacteria | 3738 |
| 336 | Ga0157370_10540706 | 3300013104 | Bacteria | 1068 |
| 337 | Ga0157369_10023164 | 3300013105 | Bacteria | 6918 |
| 338 | Ga0157369_10082680 | 3300013105 | Bacteria | 3435 |
| 339 | Ga0157369_10232236 | 3300013105 | Bacteria | 1928 |
| 340 | Ga0157369_10622670 | 3300013105 | Bacteria | 1113 |
| 341 | Ga0157369_11864152 | 3300013105 | Bacteria | 610 |
| 342 | Ga0157374_10265013 | 3300013296 | Bacteria | 1693 |
| 343 | Ga0157374_10613779 | 3300013296 | Bacteria | 1098 |
| 344 | Ga0157374_12432637 | 3300013296 | Bacteria | 551 |
| 345 | Ga0157378_10327084 | 3300013297 | Bacteria | 1491 |
| 346 | Ga0157378_10976063 | 3300013297 | Bacteria | 881 |
| 347 | Ga0157378_12939382 | 3300013297 | Bacteria | 528 |
| 348 | Ga0163162_10199870 | 3300013306 | Bacteria | 2128 |
| 349 | Ga0163162_10237364 | 3300013306 | Bacteria | 1954 |
| 350 | Ga0163162_10889346 | 3300013306 | Bacteria | 1004 |
| 351 | Ga0163162_11252932 | 3300013306 | Unclassified | 842 |
| 352 | Ga0157372_10080529 | 3300013307 | Bacteria | 3685 |
| 353 | Ga0157372_10446894 | 3300013307 | Bacteria | 1507 |
| 354 | Ga0157372_10539285 | 3300013307 | Bacteria | 1360 |
| 355 | Ga0157372_10572869 | 3300013307 | Bacteria | 1316 |
| 356 | Ga0157375_10011579 | 3300013308 | Bacteria | 7792 |
| 357 | Ga0157375_10041949 | 3300013308 | Bacteria | 4423 |
| 358 | Ga0157375_10607593 | 3300013308 | Bacteria | 1252 |
| 359 | Ga0157375_10695520 | 3300013308 | Bacteria | 1171 |
| 360 | Ga0163163_10065425 | 3300014325 | Bacteria | 3609 |
| 361 | Ga0163163_10264117 | 3300014325 | Bacteria | 1772 |
| 362 | Ga0163163_11893635 | 3300014325 | Unclassified | 656 |
| 363 | Ga0157380_10015681 | 3300014326 | Bacteria | 5571 |
| 364 | Ga0157380_10049173 | 3300014326 | Bacteria | 3324 |
| 365 | Ga0157380_10084589 | 3300014326 | Bacteria | 2601 |
| 366 | Ga0157380_10695781 | 3300014326 | Bacteria | 1021 |
| 367 | Ga0157380_11132031 | 3300014326 | Bacteria | 823 |
| 368 | Ga0157377_10010972 | 3300014745 | Bacteria | 4505 |
| 369 | Ga0157377_10019262 | 3300014745 | Bacteria | 3563 |
| 370 | Ga0157377_10049273 | 3300014745 | Bacteria | 2367 |
| 371 | Ga0157377_10075820 | 3300014745 | Bacteria | 1954 |
| 372 | Ga0157377_10545471 | 3300014745 | Unclassified | 818 |
| 373 | Ga0157377_10650445 | 3300014745 | Bacteria | 759 |
| 374 | Ga0157377_10741826 | 3300014745 | Bacteria | 718 |
| 375 | Ga0157377_11137711 | 3300014745 | Bacteria | 600 |
| 376 | Ga0157379_10162091 | 3300014968 | Bacteria | 2018 |
| 377 | Ga0157379_10213578 | 3300014968 | Bacteria | 1747 |
| 378 | Ga0157379_10344908 | 3300014968 | Bacteria | 1363 |
| 379 | Ga0157379_12038782 | 3300014968 | Bacteria | 568 |
| 380 | Ga0157379_12049376 | 3300014968 | Bacteria | 566 |
| 381 | Ga0157376_10097055 | 3300014969 | Bacteria | 2566 |
| 382 | Ga0157376_10201439 | 3300014969 | Bacteria | 1832 |
| 383 | Ga0157376_10292296 | 3300014969 | Bacteria | 1539 |
| 384 | Ga0163161_10111553 | 3300017792 | Bacteria | 2045 |
| 385 | Ga0163161_10456649 | 3300017792 | Bacteria | 1033 |
| 386 | Ga0206356_11069134 | 3300020070 | Bacteria | 1126 |
| 387 | Ga0206353_10319247 | 3300020082 | Bacteria | 771 |
| 388 | Ga0206353_10919167 | 3300020082 | Bacteria | 2019 |
| 389 | Ga0206353_12054229 | 3300020082 | Bacteria | 611 |
| 390 | Ga0207697_10223013 | 3300025315 | Bacteria | 832 |
| 391 | Ga0207682_10266903 | 3300025893 | Bacteria | 799 |
| 392 | Ga0207692_10000336 | 3300025898 | Bacteria | 16286 |
| 393 | Ga0207642_10164885 | 3300025899 | Bacteria | 1193 |
| 394 | Ga0207642_10248761 | 3300025899 | Bacteria | 1008 |
| 395 | Ga0207642_10340074 | 3300025899 | Bacteria | 882 |
| 396 | Ga0207642_10387551 | 3300025899 | Unclassified | 833 |
| 397 | Ga0207642_10647204 | 3300025899 | Unclassified | 662 |
| 398 | Ga0207688_10002702 | 3300025901 | Bacteria | 9605 |
| 399 | Ga0207688_10005424 | 3300025901 | Bacteria | 6934 |
| 400 | Ga0207688_10038105 | 3300025901 | Bacteria | 2667 |
| 401 | Ga0207688_10059564 | 3300025901 | Bacteria | 2150 |
| 402 | Ga0207688_10195994 | 3300025901 | Bacteria | 1210 |
| 403 | Ga0207645_10039118 | 3300025907 | Bacteria | 3039 |
| 404 | Ga0207645_10210791 | 3300025907 | Bacteria | 1280 |
| 405 | Ga0207645_10332757 | 3300025907 | Unclassified | 1014 |
| 406 | Ga0207643_10015561 | 3300025908 | Bacteria | 4142 |
| 407 | Ga0207643_10070140 | 3300025908 | Bacteria | 2015 |
| 408 | Ga0207643_10107242 | 3300025908 | Bacteria | 1642 |
| 409 | Ga0207705_10020346 | 3300025909 | Bacteria | 4745 |
| 410 | Ga0207705_11158972 | 3300025909 | Bacteria | 594 |
| 411 | Ga0207654_10081749 | 3300025911 | Bacteria | 1946 |
| 412 | Ga0207654_10359371 | 3300025911 | Bacteria | 1004 |
| 413 | Ga0207707_10057939 | 3300025912 | Bacteria | 3372 |
| 414 | Ga0207707_10170265 | 3300025912 | Bacteria | 1903 |
| 415 | Ga0207707_10807397 | 3300025912 | Bacteria | 781 |
| 416 | Ga0207707_11300126 | 3300025912 | Unclassified | 584 |
| 417 | Ga0207671_10577271 | 3300025914 | Bacteria | 896 |
| 418 | Ga0207671_10796994 | 3300025914 | Bacteria | 749 |
| 419 | Ga0207671_10934872 | 3300025914 | Unclassified | 685 |
| 420 | Ga0207660_10057827 | 3300025917 | Bacteria | 2778 |
| 421 | Ga0207662_10015924 | 3300025918 | Bacteria | 4236 |
| 422 | Ga0207662_10033120 | 3300025918 | Bacteria | 3010 |
| 423 | Ga0207662_10073238 | 3300025918 | Bacteria | 2077 |
| 424 | Ga0207662_11225371 | 3300025918 | Bacteria | 533 |
| 425 | Ga0207657_10004668 | 3300025919 | Bacteria | 14470 |
| 426 | Ga0207657_10117075 | 3300025919 | Bacteria | 2195 |
| 427 | Ga0207657_10167145 | 3300025919 | Bacteria | 1784 |
| 428 | Ga0207657_10390611 | 3300025919 | Bacteria | 1095 |
| 429 | Ga0207657_10498022 | 3300025919 | Bacteria | 954 |
| 430 | Ga0207657_10680583 | 3300025919 | Bacteria | 800 |
| 431 | Ga0207649_10603809 | 3300025920 | Bacteria | 844 |
| 432 | Ga0207649_10659850 | 3300025920 | Bacteria | 809 |
| 433 | Ga0207649_10814686 | 3300025920 | Bacteria | 729 |
| 434 | Ga0207649_10959519 | 3300025920 | Unclassified | 672 |
| 435 | Ga0207652_10018886 | 3300025921 | Bacteria | 5659 |
| 436 | Ga0207652_10147014 | 3300025921 | Bacteria | 2110 |
| 437 | Ga0207652_10488995 | 3300025921 | Bacteria | 1108 |
| 438 | Ga0207681_10498960 | 3300025923 | Bacteria | 996 |
| 439 | Ga0207681_10810326 | 3300025923 | Bacteria | 782 |
| 440 | Ga0207681_10892380 | 3300025923 | Bacteria | 744 |
| 441 | Ga0207694_10022103 | 3300025924 | Bacteria | 4823 |
| 442 | Ga0207694_10081387 | 3300025924 | Bacteria | 2544 |
| 443 | Ga0207694_10408822 | 3300025924 | Bacteria | 1129 |
| 444 | Ga0207694_10937516 | 3300025924 | Unclassified | 732 |
| 445 | Ga0207650_10508265 | 3300025925 | Bacteria | 1007 |
| 446 | Ga0207650_11313275 | 3300025925 | Bacteria | 616 |
| 447 | Ga0207650_11533356 | 3300025925 | Bacteria | 566 |
| 448 | Ga0207659_10129452 | 3300025926 | Bacteria | 1946 |
| 449 | Ga0207659_10455277 | 3300025926 | Bacteria | 1078 |
| 450 | Ga0207659_10573477 | 3300025926 | Bacteria | 960 |
| 451 | Ga0207659_10631930 | 3300025926 | Bacteria | 914 |
| 452 | Ga0207687_10029484 | 3300025927 | Bacteria | 3692 |
| 453 | Ga0207687_10071190 | 3300025927 | Bacteria | 2484 |
| 454 | Ga0207687_10150820 | 3300025927 | Bacteria | 1774 |
| 455 | Ga0207687_10164047 | 3300025927 | Bacteria | 1708 |
| 456 | Ga0207687_10199333 | 3300025927 | Bacteria | 1563 |
| 457 | Ga0207687_10355760 | 3300025927 | Bacteria | 1194 |
| 458 | Ga0207687_10398627 | 3300025927 | Bacteria | 1131 |
| 459 | Ga0207687_10477414 | 3300025927 | Bacteria | 1038 |
| 460 | Ga0207664_10467620 | 3300025929 | Bacteria | 1127 |
| 461 | Ga0207644_10229331 | 3300025931 | Bacteria | 1475 |
| 462 | Ga0207690_10004794 | 3300025932 | Bacteria | 7980 |
| 463 | Ga0207690_10087404 | 3300025932 | Bacteria | 2193 |
| 464 | Ga0207690_10171411 | 3300025932 | Bacteria | 1626 |
| 465 | Ga0207690_10448369 | 3300025932 | Bacteria | 1037 |
| 466 | Ga0207706_10017578 | 3300025933 | Bacteria | 6443 |
| 467 | Ga0207706_10024437 | 3300025933 | Bacteria | 5417 |
| 468 | Ga0207706_10075771 | 3300025933 | Bacteria | 2959 |
| 469 | Ga0207706_10169364 | 3300025933 | Bacteria | 1919 |
| 470 | Ga0207686_10522428 | 3300025934 | Bacteria | 924 |
| 471 | Ga0207709_10006589 | 3300025935 | Bacteria | 6520 |
| 472 | Ga0207709_10024537 | 3300025935 | Bacteria | 3444 |
| 473 | Ga0207709_10034083 | 3300025935 | Bacteria | 2998 |
| 474 | Ga0207709_10174636 | 3300025935 | Bacteria | 1511 |
| 475 | Ga0207670_10013623 | 3300025936 | Bacteria | 4800 |
| 476 | Ga0207670_10173642 | 3300025936 | Bacteria | 1618 |
| 477 | Ga0207670_11392304 | 3300025936 | Unclassified | 595 |
| 478 | Ga0207669_10027065 | 3300025937 | Bacteria | 3131 |
| 479 | Ga0207669_10172756 | 3300025937 | Bacteria | 1540 |
| 480 | Ga0207669_10275657 | 3300025937 | Bacteria | 1266 |
| 481 | Ga0207669_10281319 | 3300025937 | Bacteria | 1255 |
| 482 | Ga0207669_10334146 | 3300025937 | Bacteria | 1164 |
| 483 | Ga0207669_11162982 | 3300025937 | Unclassified | 653 |
| 484 | Ga0207704_10055971 | 3300025938 | Bacteria | 2413 |
| 485 | Ga0207704_10110245 | 3300025938 | Bacteria | 1858 |
| 486 | Ga0207704_10154177 | 3300025938 | Bacteria | 1625 |
| 487 | Ga0207704_11153470 | 3300025938 | Bacteria | 660 |
| 488 | Ga0207691_10006179 | 3300025940 | Bacteria | 11573 |
| 489 | Ga0207691_10012070 | 3300025940 | Bacteria | 8287 |
| 490 | Ga0207691_10056012 | 3300025940 | Bacteria | 3593 |
| 491 | Ga0207691_10360396 | 3300025940 | Bacteria | 1243 |
| 492 | Ga0207691_11314379 | 3300025940 | Bacteria | 597 |
| 493 | Ga0207711_10048669 | 3300025941 | Bacteria | 3627 |
| 494 | Ga0207711_10054697 | 3300025941 | Bacteria | 3426 |
| 495 | Ga0207711_10726207 | 3300025941 | Bacteria | 926 |
| 496 | Ga0207689_10087402 | 3300025942 | Bacteria | 2561 |
| 497 | Ga0207689_10384423 | 3300025942 | Bacteria | 1169 |
| 498 | Ga0207689_10420132 | 3300025942 | Bacteria | 1116 |
| 499 | Ga0207689_10642372 | 3300025942 | Bacteria | 894 |
| 500 | Ga0207689_10741218 | 3300025942 | Bacteria | 829 |
| 501 | Ga0207661_10001401 | 3300025944 | Bacteria | 16231 |
| 502 | Ga0207661_10004390 | 3300025944 | Bacteria | 9888 |
| 503 | Ga0207661_10012644 | 3300025944 | Bacteria | 6144 |
| 504 | Ga0207661_10025210 | 3300025944 | Bacteria | 4519 |
| 505 | Ga0207661_10154472 | 3300025944 | Bacteria | 1986 |
| 506 | Ga0207661_10608626 | 3300025944 | Unclassified | 1003 |
| 507 | Ga0207661_11218200 | 3300025944 | Bacteria | 692 |
| 508 | Ga0207661_11617560 | 3300025944 | Bacteria | 593 |
| 509 | Ga0207679_10015649 | 3300025945 | Bacteria | 5018 |
| 510 | Ga0207679_10370168 | 3300025945 | Bacteria | 1254 |
| 511 | Ga0207679_10858718 | 3300025945 | Bacteria | 829 |
| 512 | Ga0207679_11569902 | 3300025945 | Bacteria | 603 |
| 513 | Ga0207667_10509059 | 3300025949 | Bacteria | 1220 |
| 514 | Ga0207667_10687394 | 3300025949 | Bacteria | 1026 |
| 515 | Ga0207667_11466221 | 3300025949 | Bacteria | 654 |
| 516 | Ga0207651_10802156 | 3300025960 | Bacteria | 835 |
| 517 | Ga0207651_11377418 | 3300025960 | Bacteria | 635 |
| 518 | Ga0207712_10296749 | 3300025961 | Bacteria | 1325 |
| 519 | Ga0207712_10436167 | 3300025961 | Bacteria | 1108 |
| 520 | Ga0207668_10086315 | 3300025972 | Bacteria | 2292 |
| 521 | Ga0207668_11097865 | 3300025972 | Unclassified | 713 |
| 522 | Ga0207668_11642329 | 3300025972 | Unclassified | 580 |
| 523 | Ga0207640_10013470 | 3300025981 | Bacteria | 4689 |
| 524 | Ga0207640_10028329 | 3300025981 | Bacteria | 3424 |
| 525 | Ga0207640_10055471 | 3300025981 | Bacteria | 2596 |
| 526 | Ga0207658_10156723 | 3300025986 | Bacteria | 1862 |
| 527 | Ga0207658_10486961 | 3300025986 | Bacteria | 1097 |
| 528 | Ga0207677_10029362 | 3300026023 | Bacteria | 3493 |
| 529 | Ga0207677_10411424 | 3300026023 | Bacteria | 1149 |
| 530 | Ga0207677_10478502 | 3300026023 | Bacteria | 1072 |
| 531 | Ga0207703_10881702 | 3300026035 | Bacteria | 856 |
| 532 | Ga0207703_11438066 | 3300026035 | Unclassified | 663 |
| 533 | Ga0207639_10004159 | 3300026041 | Bacteria | 9743 |
| 534 | Ga0207639_10020326 | 3300026041 | Bacteria | 4751 |
| 535 | Ga0207639_10424051 | 3300026041 | Bacteria | 1203 |
| 536 | Ga0207639_11126765 | 3300026041 | Bacteria | 736 |
| 537 | Ga0207639_11391708 | 3300026041 | Bacteria | 658 |
| 538 | Ga0207678_10026025 | 3300026067 | Bacteria | 5105 |
| 539 | Ga0207678_10098282 | 3300026067 | Bacteria | 2501 |
| 540 | Ga0207678_10234121 | 3300026067 | Bacteria | 1573 |
| 541 | Ga0207678_10261434 | 3300026067 | Bacteria | 1483 |
| 542 | Ga0207678_11215736 | 3300026067 | Bacteria | 667 |
| 543 | Ga0207708_10043433 | 3300026075 | Bacteria | 3425 |
| 544 | Ga0207708_10088736 | 3300026075 | Bacteria | 2382 |
| 545 | Ga0207708_10110674 | 3300026075 | Bacteria | 2131 |
| 546 | Ga0207708_10431179 | 3300026075 | Bacteria | 1095 |
| 547 | Ga0207702_10045257 | 3300026078 | Bacteria | 3702 |
| 548 | Ga0207702_10292185 | 3300026078 | Bacteria | 1544 |
| 549 | Ga0207702_10889572 | 3300026078 | Bacteria | 882 |
| 550 | Ga0207641_10681284 | 3300026088 | Bacteria | 1011 |
| 551 | Ga0207641_12160407 | 3300026088 | Bacteria | 557 |
| 552 | Ga0207648_10019875 | 3300026089 | Bacteria | 6062 |
| 553 | Ga0207648_10053732 | 3300026089 | Bacteria | 3520 |
| 554 | Ga0207648_10093417 | 3300026089 | Bacteria | 2631 |
| 555 | Ga0207648_10206627 | 3300026089 | Bacteria | 1743 |
| 556 | Ga0207648_10714125 | 3300026089 | Bacteria | 929 |
| 557 | Ga0207676_10335445 | 3300026095 | Bacteria | 1393 |
| 558 | Ga0207676_10490247 | 3300026095 | Unclassified | 1165 |
| 559 | Ga0207676_11169623 | 3300026095 | Unclassified | 762 |
| 560 | Ga0207676_11811258 | 3300026095 | Bacteria | 609 |
| 561 | Ga0207674_10054243 | 3300026116 | Bacteria | 4081 |
| 562 | Ga0207674_10080542 | 3300026116 | Bacteria | 3259 |
| 563 | Ga0207674_10244465 | 3300026116 | Bacteria | 1741 |
| 564 | Ga0207674_10257311 | 3300026116 | Bacteria | 1693 |
| 565 | Ga0207675_100034122 | 3300026118 | Bacteria | 4743 |
| 566 | Ga0207675_100098962 | 3300026118 | Bacteria | 2747 |
| 567 | Ga0207675_101001052 | 3300026118 | Bacteria | 854 |
| 568 | Ga0207683_10039661 | 3300026121 | Bacteria | 4109 |
| 569 | Ga0207683_10047754 | 3300026121 | Bacteria | 3748 |
| 570 | Ga0207683_10138197 | 3300026121 | Bacteria | 2194 |
| 571 | Ga0207683_10143088 | 3300026121 | Bacteria | 2155 |
| 572 | Ga0207683_10185004 | 3300026121 | Bacteria | 1890 |
| 573 | Ga0207683_10187701 | 3300026121 | Bacteria | 1876 |
| 574 | Ga0207683_10811651 | 3300026121 | Bacteria | 868 |
| 575 | Ga0207683_10880247 | 3300026121 | Bacteria | 831 |
| 576 | Ga0207683_11340645 | 3300026121 | Bacteria | 662 |
| 577 | Ga0207683_11721044 | 3300026121 | Bacteria | 576 |
| 578 | Ga0207698_10003693 | 3300026142 | Bacteria | 9257 |
| 579 | Ga0207698_10011159 | 3300026142 | Bacteria | 5812 |
| 580 | Ga0207698_10331098 | 3300026142 | Bacteria | 1430 |
| 581 | Ga0207698_10777415 | 3300026142 | Bacteria | 958 |
| 582 | Ga0207428_10000196 | 3300027907 | Bacteria | 84609 |
| 583 | Ga0207428_10232024 | 3300027907 | Bacteria | 1381 |
| 584 | Ga0207428_10592126 | 3300027907 | Unclassified | 800 |
| 585 | Ga0268266_10089805 | 3300028379 | Bacteria | 2691 |
| 586 | Ga0268266_10133796 | 3300028379 | Bacteria | 2219 |
| 587 | Ga0268266_10316417 | 3300028379 | Bacteria | 1460 |
| 588 | Ga0268266_10757020 | 3300028379 | Bacteria | 937 |
| 589 | Ga0268266_11899865 | 3300028379 | Bacteria | 569 |
| 590 | Ga0268266_11935240 | 3300028379 | Unclassified | 563 |
| 591 | Ga0268265_11048751 | 3300028380 | Bacteria | 807 |
| 592 | Ga0268265_11250514 | 3300028380 | Unclassified | 741 |
| 593 | Ga0268264_10140772 | 3300028381 | Bacteria | 2151 |
| 594 | Ga0268264_11133242 | 3300028381 | Bacteria | 791 |
| 595 | Ga0268264_12312786 | 3300028381 | Unclassified | 544 |
| 596 | Ga0265338_10012358 | 3300028800 | Bacteria | 9737 |
| 597 | Ga0265338_10195170 | 3300028800 | Bacteria | 1531 |
| 598 | Ga0307511_10000068 | 3300030521 | Bacteria | 85766 |
| 599 | Ga0265320_10022250 | 3300031240 | Bacteria | 3394 |
| 600 | Ga0265325_10015123 | 3300031241 | Bacteria | 4347 |
| 601 | Ga0265340_10020367 | 3300031247 | Bacteria | 3409 |
| 602 | Ga0265339_10004305 | 3300031249 | Bacteria | 9738 |
| 603 | Ga0265313_10011970 | 3300031595 | Bacteria | 5348 |
| 604 | Ga0265342_10058329 | 3300031712 | Bacteria | 2282 |
| 605 | Ga0316576_10327874 | 3300031727 | Bacteria | 1141 |
| 606 | Ga0316578_10118144 | 3300031728 | Bacteria | 1593 |
| 607 | Ga0307413_10093700 | 3300031824 | Bacteria | 1964 |
| 608 | Ga0307410_10125557 | 3300031852 | Bacteria | 1878 |
| 609 | Ga0307407_10055129 | 3300031903 | Bacteria | 2296 |
| 610 | Ga0307409_100098887 | 3300031995 | Bacteria | 2414 |
| 611 | Ga0307416_101240234 | 3300032002 | Bacteria | 851 |
| 612 | Ga0316588_1000278 | 3300033528 | Bacteria | 6330 |
| 613 | Ga0316596_1000488 | 3300033541 | Bacteria | 6746 |
| 614 | Ga0373948_0087443 | 3300034817 | Unclassified | 719 |
| 615 | Ga0373959_0083744 | 3300034820 | Bacteria | 738 |
| 616 | Ga0373938_0043793 | 3300034957 | Bacteria | 1002 |
| 617 | Ga0373949_0068539 | 3300035090 | Bacteria | 925 |
| 618 | Ga0373932_0372529 | 3300035112 | Unclassified | 547 |
| 619 | Ga0373939_0365268 | 3300035114 | Bacteria | 591 |
| 620 | Ga0373941_0179771 | 3300035115 | Bacteria | 793 |
| 621 | Ga0373941_0219513 | 3300035115 | Unclassified | 730 |
| 622 | Ga0373956_0006542 | 3300035119 | Bacteria | 4668 |
| 623 | Ga0373960_0019883 | 3300035121 | Bacteria | 1770 |
| 624 | Ga0373960_0150787 | 3300035121 | Bacteria | 794 |
| 625 | Ga0373961_0075960 | 3300035241 | Bacteria | 1048 |
| 626 | Ga0373962_0160680 | 3300035242 | Unclassified | 741 |
| 627 | Ga0373931_0373197 | 3300035691 | Unclassified | 897 |
| 628 | Ga0395900_0042570 | 3300037418 | Bacteria | 4680 |
| 629 | Ga0395900_0242836 | 3300037418 | Bacteria | 1806 |
| 630 | Ga0395900_0332171 | 3300037418 | Bacteria | 1498 |
| 631 | Ga0395898_0005829 | 3300037466 | Bacteria | 13257 |
| 632 | Ga0395898_0198473 | 3300037466 | Bacteria | 1916 |
| 633 | Ga0395898_0249307 | 3300037466 | Bacteria | 1694 |
| 634 | Ga0395898_0394653 | 3300037466 | Bacteria | 1319 |
| 635 | Ga0395898_0432360 | 3300037466 | Unclassified | 1254 |
| 636 | Ga0395905_0110050 | 3300037471 | Bacteria | 2587 |
| 637 | Ga0395901_0002259 | 3300038443 | Bacteria | 19671 |
| 638 | Ga0395901_0178479 | 3300038443 | Bacteria | 2227 |
| 639 | Ga0395901_1135316 | 3300038443 | Bacteria | 750 |
| 640 | Ga0436365_0958401 | 3300039437 | Bacteria | 2340 |
| 641 | Ga0451797_0123153 | 3300041453 | Bacteria | 808 |
| 642 | Ga0451802_0445110 | 3300041460 | Unclassified | 511 |
| 643 | Ga0451837_1044833 | 3300041494 | Bacteria | 1998 |
| 644 | Ga0451845_0171825 | 3300041501 | Bacteria | 1716 |
| 645 | Ga0451851_0313660 | 3300041507 | Bacteria | 1259 |
| 646 | Ga0451843_1748667 | 3300041509 | Bacteria | 876 |
| 647 | Ga0451853_3587584 | 3300041512 | Bacteria | 2492 |
| 648 | Ga0450911_018118 | 3300042115 | Bacteria | 925 |
| 649 | Ga0450906_009617 | 3300042145 | Bacteria | 1840 |
| 650 | Ga0450907_004935 | 3300042146 | Bacteria | 2270 |
| 651 | Ga0466969_0001566 | 3300044656 | Bacteria | 12258 |
| 652 | Ga0466965_0640734 | 3300044683 | Bacteria | 606 |
| 653 | Ga0466966_0002535 | 3300044684 | Bacteria | 11959 |
| 654 | Ga0466961_0019309 | 3300044693 | Bacteria | 4385 |
| 655 | Ga0466961_0052937 | 3300044693 | Bacteria | 2591 |
| 656 | Ga0466963_0804115 | 3300044694 | Bacteria | 663 |
| 657 | Ga0466963_1234974 | 3300044694 | Bacteria | 525 |
| 658 | Ga0466964_0105995 | 3300044706 | Bacteria | 1246 |
| 659 | Ga0466964_0339486 | 3300044706 | Bacteria | 769 |
| 660 | Ga0466971_0222972 | 3300044719 | Bacteria | 894 |
| 661 | Ga0466970_0161823 | 3300044765 | Bacteria | 1238 |
| 662 | Ga0466960_0174647 | 3300044901 | Bacteria | 1161 |
| 663 | Ga0466959_0006446 | 3300045049 | Bacteria | 8125 |
| 664 | Ga0466967_0003830 | 3300045976 | Bacteria | 9956 |
| 665 | Ga0466967_1278515 | 3300045976 | Bacteria | 731 |
| 666 | Ga0495603_0008050 | 3300046455 | Bacteria | 6369 |
| 667 | Ga0495603_0018293 | 3300046455 | Bacteria | 4239 |
| 668 | Ga0495629_0865506 | 3300046459 | Bacteria | 594 |
| 669 | Ga0495641_0427403 | 3300046461 | Bacteria | 602 |
| 670 | Ga0495651_0695531 | 3300046462 | Bacteria | 634 |
| 671 | Ga0495653_0225794 | 3300046463 | Bacteria | 1256 |
| 672 | Ga0495582_0253928 | 3300046473 | Unclassified | 1008 |
| 673 | Ga0495639_0297137 | 3300046475 | Bacteria | 805 |
| 674 | Ga0495583_0390834 | 3300046506 | Unclassified | 547 |
| 675 | Ga0495628_1108876 | 3300046516 | Bacteria | 540 |
| 676 | Ga0495630_0107299 | 3300046517 | Bacteria | 2115 |
| 677 | Ga0495631_0181831 | 3300046518 | Bacteria | 901 |
| 678 | Ga0495637_0055098 | 3300046520 | Bacteria | 1650 |
| 679 | Ga0495587_0604946 | 3300046536 | Bacteria | 603 |
| 680 | Ga0495645_0709373 | 3300046543 | Bacteria | 610 |
| 681 | Ga0495622_0132942 | 3300046557 | Bacteria | 1132 |
| 682 | Ga0495656_0090950 | 3300046615 | Unclassified | 1395 |
| 683 | Ga0495656_0190111 | 3300046615 | Unclassified | 1014 |
| 684 | Ga0495634_0346448 | 3300046642 | Bacteria | 890 |
| 685 | Ga0495647_0252370 | 3300046681 | Bacteria | 786 |
| 686 | Ga0495670_0263485 | 3300046691 | Bacteria | 920 |
| 687 | Ga0495670_0509520 | 3300046691 | Unclassified | 654 |
| 688 | Ga0495671_0120055 | 3300046692 | Bacteria | 1283 |
| 689 | Ga0495589_0279937 | 3300046794 | Bacteria | 776 |
| 690 | Ga0495589_0366741 | 3300046794 | Unclassified | 663 |
| 691 | Ga0495604_0126955 | 3300047317 | Bacteria | 1838 |
| 692 | Ga0495674_0197470 | 3300047319 | Bacteria | 1670 |
| 693 | Ga0495672_0000834 | 3300047320 | Bacteria | 32942 |
| 694 | Ga0495676_0099533 | 3300047321 | Bacteria | 2155 |
| 695 | Ga0495676_0485329 | 3300047321 | Bacteria | 812 |
| 696 | Ga0495683_0392238 | 3300047323 | Unclassified | 579 |
| 697 | Ga0495677_0010463 | 3300047445 | Bacteria | 3407 |
| 698 | Ga0495673_0207062 | 3300047469 | Bacteria | 731 |
| 699 | Ga0495602_0121209 | 3300048088 | Bacteria | 2104 |
| 700 | Ga0496100_0055538 | 3300048903 | Bacteria | 2588 |
| 701 | Ga0496100_0413259 | 3300048903 | Bacteria | 1029 |
| 702 | Ga0496100_0517865 | 3300048903 | Unclassified | 920 |
| 703 | Ga0496100_0556357 | 3300048903 | Bacteria | 888 |
| 704 | Ga0496100_0666481 | 3300048903 | Bacteria | 811 |
| 705 | Ga0496100_1484140 | 3300048903 | Unclassified | 535 |
| 706 | Ga0496101_0045796 | 3300048904 | Bacteria | 3135 |
| 707 | Ga0496101_0138593 | 3300048904 | Bacteria | 1853 |
| 708 | Ga0496101_0215438 | 3300048904 | Bacteria | 1489 |
| 709 | Ga0496101_0236364 | 3300048904 | Bacteria | 1421 |
| 710 | Ga0496101_1190444 | 3300048904 | Bacteria | 597 |
| 711 | Ga0496101_1410486 | 3300048904 | Unclassified | 543 |
| 712 | Ga0496102_0317510 | 3300048905 | Bacteria | 1468 |
| 713 | Ga0496102_0596031 | 3300048905 | Bacteria | 1028 |
| 714 | Ga0496103_0236915 | 3300048906 | Bacteria | 1174 |
| 715 | Ga0496103_0764774 | 3300048906 | Unclassified | 610 |
| 716 | Ga0496104_0160845 | 3300048907 | Bacteria | 2154 |
| 717 | Ga0496104_0173027 | 3300048907 | Bacteria | 2070 |
| 718 | Ga0496104_0390145 | 3300048907 | Bacteria | 1305 |
| 719 | Ga0496104_1141285 | 3300048907 | Bacteria | 683 |
| 720 | Ga0496105_0098528 | 3300048908 | Bacteria | 2414 |
| 721 | Ga0496105_0260501 | 3300048908 | Bacteria | 1402 |
| 722 | Ga0496105_0366587 | 3300048908 | Unclassified | 1148 |
| 723 | Ga0496105_0468365 | 3300048908 | Unclassified | 993 |
| 724 | Ga0496105_0492253 | 3300048908 | Bacteria | 963 |
| 725 | Ga0496105_0598598 | 3300048908 | Bacteria | 856 |
| 726 | Ga0496106_0043538 | 3300048909 | Bacteria | 3368 |
| 727 | Ga0496106_0073267 | 3300048909 | Bacteria | 2620 |
| 728 | Ga0496106_0449278 | 3300048909 | Bacteria | 1035 |
| 729 | Ga0496106_0738087 | 3300048909 | Unclassified | 783 |
| 730 | Ga0496107_0481075 | 3300048910 | Bacteria | 921 |
| 731 | Ga0496108_0004142 | 3300048911 | Bacteria | 11659 |
| 732 | Ga0496108_0180895 | 3300048911 | Bacteria | 1826 |
| 733 | Ga0496108_0227143 | 3300048911 | Bacteria | 1622 |
| 734 | Ga0496108_0251800 | 3300048911 | Bacteria | 1536 |
| 735 | Ga0496108_0367789 | 3300048911 | Bacteria | 1255 |
| 736 | Ga0496108_0469703 | 3300048911 | Bacteria | 1099 |
| 737 | Ga0496109_0006116 | 3300048912 | Bacteria | 10112 |
| 738 | Ga0496109_0168905 | 3300048912 | Bacteria | 2051 |
| 739 | Ga0496109_0695179 | 3300048912 | Bacteria | 954 |
| 740 | Ga0496109_1176640 | 3300048912 | Bacteria | 703 |
| 741 | Ga0496109_1343481 | 3300048912 | Unclassified | 650 |
| 742 | Ga0496109_1491184 | 3300048912 | Unclassified | 611 |
| 743 | Ga0496109_1787030 | 3300048912 | Bacteria | 548 |
| 744 | Ga0496110_0004582 | 3300048913 | Bacteria | 10738 |
| 745 | Ga0496110_0023137 | 3300048913 | Bacteria | 5284 |
| 746 | Ga0496110_0026771 | 3300048913 | Bacteria | 4938 |
| 747 | Ga0496110_0064289 | 3300048913 | Bacteria | 3242 |
| 748 | Ga0496110_0110596 | 3300048913 | Bacteria | 2469 |
| 749 | Ga0496110_0861309 | 3300048913 | Bacteria | 811 |
| 750 | Ga0496110_0865248 | 3300048913 | Bacteria | 809 |
| 751 | Ga0496111_0000612 | 3300048914 | Bacteria | 18851 |
| 752 | Ga0496111_0022732 | 3300048914 | Bacteria | 4393 |
| 753 | Ga0496111_0031837 | 3300048914 | Bacteria | 3758 |
| 754 | Ga0496111_0134388 | 3300048914 | Bacteria | 1832 |
| 755 | Ga0496111_0323063 | 3300048914 | Bacteria | 1143 |
| 756 | Ga0496111_0644053 | 3300048914 | Bacteria | 773 |
| 757 | Ga0496111_0954357 | 3300048914 | Bacteria | 616 |
| 758 | Ga0496112_0007171 | 3300048915 | Bacteria | 9873 |
| 759 | Ga0496112_0548633 | 3300048915 | Bacteria | 1090 |
| 760 | Ga0496112_0567577 | 3300048915 | Bacteria | 1068 |
| 761 | Ga0496112_0624792 | 3300048915 | Bacteria | 1008 |
| 762 | Ga0496112_1156929 | 3300048915 | Bacteria | 691 |
| 763 | Ga0496113_0380639 | 3300048916 | Bacteria | 1133 |
| 764 | Ga0496114_0072801 | 3300048917 | Bacteria | 2891 |
| 765 | Ga0496114_0109009 | 3300048917 | Bacteria | 2371 |
| 766 | Ga0496114_0174056 | 3300048917 | Bacteria | 1877 |
| 767 | Ga0496114_0221463 | 3300048917 | Bacteria | 1661 |
| 768 | Ga0496114_0231725 | 3300048917 | Bacteria | 1623 |
| 769 | Ga0496114_0270984 | 3300048917 | Bacteria | 1496 |
| 770 | Ga0496114_0310328 | 3300048917 | Bacteria | 1393 |
| 771 | Ga0496114_0559035 | 3300048917 | Bacteria | 1010 |
| 772 | Ga0496114_0700200 | 3300048917 | Bacteria | 888 |
| 773 | Ga0496114_0847009 | 3300048917 | Unclassified | 794 |
| 774 | Ga0496114_0879789 | 3300048917 | Bacteria | 776 |
| 775 | Ga0496114_1092222 | 3300048917 | Unclassified | 682 |
| 776 | Ga0501031_0003039 | 3300049568 | Bacteria | 10723 |
| 777 | Ga0501031_0053137 | 3300049568 | Bacteria | 2639 |
| 778 | Ga0501031_0078772 | 3300049568 | Bacteria | 2147 |
| 779 | Ga0501031_0610977 | 3300049568 | Bacteria | 701 |
| 780 | Ga0501032_0011905 | 3300049569 | Bacteria | 6231 |
| 781 | Ga0501033_0020165 | 3300049570 | Bacteria | 5040 |
| 782 | Ga0501033_0031961 | 3300049570 | Bacteria | 3951 |
| 783 | Ga0501033_0192723 | 3300049570 | Bacteria | 1458 |
| 784 | Ga0501034_0147689 | 3300049571 | Bacteria | 2328 |
| 785 | Ga0501034_0170334 | 3300049571 | Bacteria | 2145 |
| 786 | Ga0501034_0330562 | 3300049571 | Bacteria | 1456 |
| 787 | Ga0501034_0960621 | 3300049571 | Bacteria | 740 |
| 788 | Ga0501036_0017170 | 3300049572 | Bacteria | 6049 |
| 789 | Ga0501036_0046815 | 3300049572 | Bacteria | 3662 |
| 790 | Ga0501036_0119608 | 3300049572 | Bacteria | 2224 |
| 791 | Ga0501036_0497466 | 3300049572 | Bacteria | 1014 |
| 792 | Ga0501036_0570331 | 3300049572 | Bacteria | 940 |
| 793 | Ga0501036_0986106 | 3300049572 | Bacteria | 690 |
| 794 | Ga0501037_0075922 | 3300049573 | Bacteria | 2440 |
| 795 | Ga0501037_0357995 | 3300049573 | Bacteria | 1006 |
| 796 | Ga0501037_0633089 | 3300049573 | Bacteria | 716 |
| 797 | Ga0501038_0023255 | 3300049574 | Bacteria | 5544 |
| 798 | Ga0501038_0045306 | 3300049574 | Bacteria | 3818 |
| 799 | Ga0501038_0398537 | 3300049574 | Bacteria | 1065 |
| 800 | Ga0501039_0021045 | 3300049575 | Bacteria | 5002 |
| 801 | Ga0501039_0046800 | 3300049575 | Bacteria | 3342 |
| 802 | Ga0501039_0090833 | 3300049575 | Bacteria | 2380 |
| 803 | Ga0501039_0280675 | 3300049575 | Bacteria | 1309 |
| 804 | Ga0501039_0311309 | 3300049575 | Bacteria | 1238 |
| 805 | Ga0501039_0605642 | 3300049575 | Bacteria | 859 |
| 806 | Ga0501040_0051099 | 3300049576 | Bacteria | 2828 |
| 807 | Ga0501040_0055634 | 3300049576 | Bacteria | 2713 |
| 808 | Ga0501040_0945750 | 3300049576 | Bacteria | 624 |
| 809 | Ga0501040_0969072 | 3300049576 | Unclassified | 616 |
| 810 | Ga0501041_0003646 | 3300049577 | Bacteria | 8858 |
| 811 | Ga0501041_0082356 | 3300049577 | Bacteria | 1982 |
| 812 | Ga0501041_0185159 | 3300049577 | Archaea | 1304 |
| 813 | Ga0501041_0200397 | 3300049577 | Bacteria | 1251 |
| 814 | Ga0501041_0613652 | 3300049577 | Bacteria | 694 |
| 815 | Ga0501042_0007772 | 3300049578 | Bacteria | 7047 |
| 816 | Ga0501042_0208860 | 3300049578 | Bacteria | 1408 |
| 817 | Ga0501042_0360477 | 3300049578 | Bacteria | 1052 |
| 818 | Ga0501042_0440087 | 3300049578 | Bacteria | 945 |
| 819 | Ga0501042_0575852 | 3300049578 | Bacteria | 818 |
| 820 | Ga0501043_0082637 | 3300049579 | Bacteria | 2525 |
| 821 | Ga0501043_0153086 | 3300049579 | Bacteria | 1804 |
| 822 | Ga0501043_0275419 | 3300049579 | Bacteria | 1291 |
| 823 | Ga0501043_1018361 | 3300049579 | Unclassified | 589 |
| 824 | Ga0501046_0004011 | 3300049580 | Bacteria | 13446 |
| 825 | Ga0501046_0016747 | 3300049580 | Bacteria | 6129 |
| 826 | Ga0501046_0114646 | 3300049580 | Bacteria | 2056 |
| 827 | Ga0501046_0258524 | 3300049580 | Bacteria | 1280 |
| 828 | Ga0501046_0276324 | 3300049580 | Bacteria | 1231 |
| 829 | Ga0501046_0719776 | 3300049580 | Archaea | 702 |
| 830 | Ga0501047_0014875 | 3300049581 | Bacteria | 7407 |
| 831 | Ga0501048_0007483 | 3300049582 | Bacteria | 8275 |
| 832 | Ga0501048_0010731 | 3300049582 | Bacteria | 6831 |
| 833 | Ga0501048_0023818 | 3300049582 | Bacteria | 4471 |
| 834 | Ga0501048_0124448 | 3300049582 | Bacteria | 1823 |
| 835 | Ga0501048_1360202 | 3300049582 | Bacteria | 510 |
| 836 | Ga0501067_0039146 | 3300049583 | Bacteria | 2632 |
| 837 | Ga0501067_0142189 | 3300049583 | Bacteria | 1336 |
| 838 | Ga0501067_0493093 | 3300049583 | Bacteria | 685 |
| 839 | Ga0501068_0002316 | 3300049584 | Bacteria | 10152 |
| 840 | Ga0501068_0016403 | 3300049584 | Bacteria | 4269 |
| 841 | Ga0501068_0119442 | 3300049584 | Bacteria | 1643 |
| 842 | Ga0501068_0222905 | 3300049584 | Bacteria | 1199 |
| 843 | Ga0501068_0378152 | 3300049584 | Bacteria | 912 |
| 844 | Ga0501068_0677313 | 3300049584 | Bacteria | 674 |
| 845 | Ga0501068_0726223 | 3300049584 | Bacteria | 650 |
| 846 | Ga0501069_0031494 | 3300049585 | Bacteria | 2917 |
| 847 | Ga0501069_0111543 | 3300049585 | Bacteria | 1558 |
| 848 | Ga0501069_0196270 | 3300049585 | Bacteria | 1169 |
| 849 | Ga0501069_0201419 | 3300049585 | Bacteria | 1154 |
| 850 | Ga0501069_0289765 | 3300049585 | Bacteria | 959 |
| 851 | Ga0501069_0523835 | 3300049585 | Bacteria | 708 |
| 852 | Ga0501069_0935328 | 3300049585 | Unclassified | 528 |
| 853 | Ga0501070_0040330 | 3300049586 | Bacteria | 3893 |
| 854 | Ga0501070_0167058 | 3300049586 | Bacteria | 1813 |
| 855 | Ga0501070_0565911 | 3300049586 | Bacteria | 909 |
| 856 | Ga0501071_0003292 | 3300049587 | Bacteria | 10088 |
| 857 | Ga0501071_0089334 | 3300049587 | Bacteria | 2261 |
| 858 | Ga0501071_0134395 | 3300049587 | Bacteria | 1839 |
| 859 | Ga0501071_0180425 | 3300049587 | Bacteria | 1582 |
| 860 | Ga0501071_0312912 | 3300049587 | Bacteria | 1191 |
| 861 | Ga0501071_0340590 | 3300049587 | Bacteria | 1140 |
| 862 | Ga0501072_0019784 | 3300049588 | Bacteria | 5208 |
| 863 | Ga0501072_0023598 | 3300049588 | Bacteria | 4777 |
| 864 | Ga0501072_0456136 | 3300049588 | Bacteria | 1012 |
| 865 | Ga0501072_0500562 | 3300049588 | Bacteria | 961 |
| 866 | Ga0501072_0590805 | 3300049588 | Bacteria | 876 |
| 867 | Ga0501072_0786687 | 3300049588 | Bacteria | 746 |
| 868 | Ga0501072_0808157 | 3300049588 | Bacteria | 734 |
| 869 | Ga0501072_0961663 | 3300049588 | Bacteria | 666 |
| 870 | Ga0501072_1005424 | 3300049588 | Bacteria | 650 |
| 871 | Ga0501072_1472019 | 3300049588 | Bacteria | 526 |
| 872 | Ga0501073_0015465 | 3300049589 | Bacteria | 5536 |
| 873 | Ga0501073_0462898 | 3300049589 | Bacteria | 877 |
| 874 | Ga0501074_0011150 | 3300049590 | Bacteria | 6529 |
| 875 | Ga0501074_0045880 | 3300049590 | Bacteria | 3160 |
| 876 | Ga0501074_0405985 | 3300049590 | Bacteria | 966 |
| 877 | Ga0501074_0494986 | 3300049590 | Bacteria | 866 |
| 878 | Ga0501075_0001579 | 3300049591 | Bacteria | 14891 |
| 879 | Ga0501075_0012185 | 3300049591 | Bacteria | 6104 |
| 880 | Ga0501075_0034523 | 3300049591 | Bacteria | 3766 |
| 881 | Ga0501075_0048638 | 3300049591 | Bacteria | 3187 |
| 882 | Ga0501075_0100878 | 3300049591 | Bacteria | 2192 |
| 883 | Ga0501075_0126950 | 3300049591 | Bacteria | 1942 |
| 884 | Ga0501075_0515627 | 3300049591 | Bacteria | 912 |
| 885 | Ga0501075_0777278 | 3300049591 | Bacteria | 729 |
| 886 | Ga0501075_0859977 | 3300049591 | Bacteria | 690 |
| 887 | Ga0501076_0004848 | 3300049592 | Bacteria | 9606 |
| 888 | Ga0501076_0008579 | 3300049592 | Bacteria | 7496 |
| 889 | Ga0501076_0127731 | 3300049592 | Bacteria | 2061 |
| 890 | Ga0501076_0151366 | 3300049592 | Bacteria | 1887 |
| 891 | Ga0501076_0209420 | 3300049592 | Bacteria | 1593 |
| 892 | Ga0501076_0378678 | 3300049592 | Bacteria | 1163 |
| 893 | Ga0501076_0518966 | 3300049592 | Bacteria | 982 |
| 894 | Ga0501076_0695432 | 3300049592 | Bacteria | 839 |
| 895 | Ga0501077_0002154 | 3300049593 | Bacteria | 11898 |
| 896 | Ga0501077_0010835 | 3300049593 | Bacteria | 5679 |
| 897 | Ga0501077_0155981 | 3300049593 | Bacteria | 1449 |
| 898 | Ga0501077_0198454 | 3300049593 | Bacteria | 1274 |
| 899 | Ga0501077_0374001 | 3300049593 | Bacteria | 910 |
| 900 | Ga0501079_0007024 | 3300049741 | Bacteria | 8493 |
| 901 | Ga0501079_0014626 | 3300049741 | Bacteria | 5985 |
| 902 | Ga0501079_0018090 | 3300049741 | Bacteria | 5381 |
| 903 | Ga0501079_0378345 | 3300049741 | Bacteria | 1110 |
| 904 | Ga0501079_0499697 | 3300049741 | Bacteria | 956 |
| 905 | Ga0501079_0799127 | 3300049741 | Bacteria | 743 |
| 906 | Ga0501079_1019351 | 3300049741 | Bacteria | 652 |
| 907 | Ga0501080_0003166 | 3300049742 | Bacteria | 14502 |
| 908 | Ga0501080_0147454 | 3300049742 | Bacteria | 2175 |
| 909 | Ga0501080_0271025 | 3300049742 | Bacteria | 1545 |
| 910 | Ga0501080_0427458 | 3300049742 | Bacteria | 1189 |
| 911 | Ga0501080_0604805 | 3300049742 | Bacteria | 973 |
| 912 | Ga0501081_0020311 | 3300049743 | Bacteria | 4427 |
| 913 | Ga0501081_0224497 | 3300049743 | Bacteria | 1366 |
| 914 | Ga0501081_0280606 | 3300049743 | Bacteria | 1219 |
| 915 | Ga0501081_0341914 | 3300049743 | Bacteria | 1102 |
| 916 | Ga0501083_0072348 | 3300049744 | Bacteria | 2292 |
| 917 | Ga0501083_0094593 | 3300049744 | Bacteria | 1972 |
| 918 | Ga0501083_0226064 | 3300049744 | Bacteria | 1219 |
| 919 | Ga0501035_0023594 | 3300049822 | Bacteria | 5644 |
| 920 | Ga0501035_1277172 | 3300049822 | Bacteria | 567 |
| 921 | Ga0501035_1353336 | 3300049822 | Bacteria | 547 |
| 922 | Ga0501044_0628455 | 3300049823 | Bacteria | 965 |
| 923 | Ga0501044_0677284 | 3300049823 | Bacteria | 918 |
| 924 | Ga0501045_0001676 | 3300049824 | Bacteria | 14903 |
| 925 | Ga0501045_0016348 | 3300049824 | Bacteria | 5268 |
| 926 | Ga0501045_0042477 | 3300049824 | Bacteria | 3308 |
| 927 | Ga0501045_0105301 | 3300049824 | Bacteria | 2090 |
| 928 | Ga0501045_0412479 | 3300049824 | Unclassified | 1005 |
| 929 | Ga0501045_0534806 | 3300049824 | Bacteria | 870 |
| 930 | Ga0501045_0539697 | 3300049824 | Bacteria | 865 |
| 931 | Ga0501045_0743578 | 3300049824 | Bacteria | 723 |
| 932 | Ga0501045_1247971 | 3300049824 | Unclassified | 542 |
| 933 | Ga0501045_1413142 | 3300049824 | Bacteria | 505 |
| 934 | nmdc:mga0yw44_269082_c1 | 3300050492 | Bacteria | 1137 |
| 935 | nmdc:mga05p37_17839_c1 | 3300050507 | Bacteria | 8568 |
| 936 | nmdc:mga09592_13054_c1 | 3300050508 | Bacteria | 6781 |
| 937 | nmdc:mga08y16_1244507_c1 | 3300050511 | Unclassified | 713 |
| 938 | nmdc:mga08y16_140182_c1 | 3300050511 | Bacteria | 2514 |
| 939 | nmdc:mga08y16_1507784_c1 | 3300050511 | Bacteria | 633 |
| 940 | nmdc:mga08y16_22195_c1 | 3300050511 | Bacteria | 6699 |
| 941 | nmdc:mga0n895_79651_c1 | 3300050512 | Bacteria | 3262 |
| 942 | nmdc:mga0n895_95417_c1 | 3300050512 | Bacteria | 2979 |
| 943 | nmdc:mga0rr50_598616_c1 | 3300050513 | Bacteria | 940 |
| 944 | nmdc:mga0rr50_724127_c1 | 3300050513 | Bacteria | 849 |
| 945 | nmdc:mga08x19_125640_c1 | 3300050514 | Bacteria | 1722 |
| 946 | nmdc:mga0a205_1351114_c1 | 3300050515 | Unclassified | 560 |
| 947 | nmdc:mga0a205_334097_c1 | 3300050515 | Bacteria | 1385 |
| 948 | Ga0495655_0278511 | 3300053083 | Bacteria | 569 |
| 949 | Ga0495595_0217905 | 3300053084 | Bacteria | 952 |
| 950 | Ga0495619_0062240 | 3300053085 | Bacteria | 2484 |
| 951 | Ga0501084_0027520 | 3300054114 | Bacteria | 4750 |
| 952 | Ga0501084_0039885 | 3300054114 | Bacteria | 3927 |
| 953 | Ga0501084_0100670 | 3300054114 | Bacteria | 2426 |
| 954 | Ga0501084_0104688 | 3300054114 | Bacteria | 2376 |
| 955 | Ga0501084_0240389 | 3300054114 | Bacteria | 1528 |
| 956 | Ga0501084_0264534 | 3300054114 | Bacteria | 1452 |
| 957 | Ga0501084_0473248 | 3300054114 | Bacteria | 1059 |
| 958 | Ga0501084_0845784 | 3300054114 | Bacteria | 770 |
| 959 | Ga0501082_0002118 | 3300060353 | Bacteria | 17481 |
| 960 | Ga0501082_0029744 | 3300060353 | Bacteria | 4706 |
| 961 | Ga0501082_0093172 | 3300060353 | Bacteria | 2603 |
| 962 | Ga0501082_0155187 | 3300060353 | Bacteria | 1989 |
| 963 | Ga0501082_0562072 | 3300060353 | Unclassified | 998 |
| 964 | Ga0501082_0634008 | 3300060353 | Bacteria | 935 |
| 965 | Ga0501082_0885230 | 3300060353 | Bacteria | 781 |
| 966 | Ga0501082_1096098 | 3300060353 | Bacteria | 696 |
| 967 | Ga0530510_0009505 | 3300061734 | Bacteria | 6817 |
| 968 | Ga0530510_0040739 | 3300061734 | Bacteria | 3352 |
| 969 | Ga0530510_0051825 | 3300061734 | Bacteria | 2966 |
| 970 | Ga0530510_0238991 | 3300061734 | Bacteria | 1352 |
| 971 | Ga0530510_0354912 | 3300061734 | Bacteria | 1102 |
| 972 | Ga0530510_0917114 | 3300061734 | Bacteria | 670 |
| 973 | 2559428936 | 2558860280 | Bacteria | 11429938 |
| 974 | 2795781643 | 2795385470 | Bacteria | 8317180 |
| 975 | 2795795155 | 2795385472 | Bacteria | 6627535 |
| 976 | 2844851953 | 2844849076 | Bacteria | 4091819 |
| 977 | 2857740587 | 2857740372 | Bacteria | 4782044 |
| 978 | 2904499334 | 2904497146 | Bacteria | 4731781 |
| 979 | 2904778436 | 2904776348 | Bacteria | 4658726 |
| 980 | 2919035788 | 2919034639 | Bacteria | 4763403 |
| 981 | 2919538997 | 2919538618 | Bacteria | 4677069 |
| 982 | 2932427578 | 2932426870 | Bacteria | 4547726 |
| 983 | 2933418833 | 2933418574 | Bacteria | 4476724 |
| 984 | 2939648234 | 2939647034 | Bacteria | 4681660 |
| 985 | Ga0316584_0004656 | |||
| 986 | 2214909088 | |||
| 987 | ARcpr5oldR_c005479 | |||
| 988 | ARCol0yngRDRAFT_1002670 | |||
| 989 | JGI24745J21846_1001366 | |||
| 990 | JGI24738J21930_10000561 | |||
| 991 | JGI25406J46586_10004625 | |||
| 992 | rootH2_10047530 | |||
| 993 | Ga0070658_10151231 | |||
| 994 | Ga0070658_10354259 | |||
| 995 | Ga0070676_10042736 | |||
| 996 | Ga0070676_10075566 | |||
| 997 | Ga0070676_10174224 | |||
| 998 | Ga0070676_11068759 | |||
| 999 | Ga0070676_11127176 | |||
| 1000 | Ga0070676_11314097 | |||
| 1001 | Ga0070683_100007373 | |||
| 1002 | Ga0070683_100025155 | |||
| 1003 | Ga0070683_100468315 | |||
| 1004 | Ga0070683_100608994 | |||
| 1005 | Ga0070683_101091354 | |||
| 1006 | Ga0070690_100757158 | |||
| 1007 | Ga0070690_100996072 | |||
| 1008 | Ga0070670_100510681 | |||
| 1009 | Ga0070670_100955941 | |||
| 1010 | Ga0070670_101297248 | |||
| 1011 | Ga0068869_100022196 | |||
| 1012 | Ga0068869_100232140 | |||
| 1013 | Ga0068869_100299254 | |||
| 1014 | Ga0070666_10874327 | |||
| 1015 | Ga0070680_100018180 | |||
| 1016 | Ga0070682_100006877 | |||
| 1017 | Ga0070682_100010912 | |||
| 1018 | Ga0070682_100053405 | |||
| 1019 | Ga0070682_100072014 | |||
| 1020 | Ga0070682_100319289 | |||
| 1021 | Ga0068868_100011827 | |||
| 1022 | Ga0068868_100030465 | |||
| 1023 | Ga0068868_100038418 | |||
| 1024 | Ga0068868_100180751 | |||
| 1025 | Ga0068868_100286935 | |||
| 1026 | Ga0068868_100335513 | |||
| 1027 | Ga0068868_100664699 | |||
| 1028 | Ga0070660_100003349 | |||
| 1029 | Ga0070660_100085182 | |||
| 1030 | Ga0070660_100149944 | |||
| 1031 | Ga0070660_100583837 | |||
| 1032 | Ga0070660_101198738 | |||
| 1033 | Ga0070689_100072458 | |||
| 1034 | Ga0070689_100104231 | |||
| 1035 | Ga0070689_100110319 | |||
| 1036 | Ga0070691_10000980 | |||
| 1037 | Ga0070691_10038406 | |||
| 1038 | Ga0070691_10475037 | |||
| 1039 | Ga0070691_10861312 | |||
| 1040 | Ga0070687_100149689 | |||
| 1041 | Ga0070687_100166483 | |||
| 1042 | Ga0070687_100915669 | |||
| 1043 | Ga0070661_100258984 | |||
| 1044 | Ga0070661_100594909 | |||
| 1045 | Ga0070661_101168806 | |||
| 1046 | Ga0070692_10000477 | |||
| 1047 | Ga0070692_10018946 | |||
| 1048 | Ga0070692_10224163 | |||
| 1049 | Ga0070692_11313316 | |||
| 1050 | Ga0070668_100056380 | |||
| 1051 | Ga0070668_100240840 | |||
| 1052 | Ga0070669_100263907 | |||
| 1053 | Ga0070669_100272529 | |||
| 1054 | Ga0070669_100472844 | |||
| 1055 | Ga0070669_100501299 | |||
| 1056 | Ga0070675_100011418 | |||
| 1057 | Ga0070675_100185784 | |||
| 1058 | Ga0070675_100208373 | |||
| 1059 | Ga0070675_101157882 | |||
| 1060 | Ga0070675_101489980 | |||
| 1061 | Ga0070675_101794773 | |||
| 1062 | Ga0070671_100026781 | |||
| 1063 | Ga0070674_100061968 | |||
| 1064 | Ga0070674_100068163 | |||
| 1065 | Ga0070674_100304854 | |||
| 1066 | Ga0070674_100371351 | |||
| 1067 | Ga0070674_100481096 | |||
| 1068 | Ga0070674_101199609 | |||
| 1069 | Ga0070673_100022103 | |||
| 1070 | Ga0070673_100280376 | |||
| 1071 | Ga0070673_100804616 | |||
| 1072 | Ga0070673_101714275 | |||
| 1073 | Ga0070688_100020857 | |||
| 1074 | Ga0070688_100042250 | |||
| 1075 | Ga0070659_100002964 | |||
| 1076 | Ga0070659_100020779 | |||
| 1077 | Ga0070659_100026771 | |||
| 1078 | Ga0070659_100031619 | |||
| 1079 | Ga0070659_100233987 | |||
| 1080 | Ga0070667_101344063 | |||
| 1081 | Ga0070714_100943578 | |||
| 1082 | Ga0070701_10005589 | |||
| 1083 | Ga0070701_10021847 | |||
| 1084 | Ga0070705_100094654 | |||
| 1085 | Ga0070705_101411496 | |||
| 1086 | Ga0070700_100029006 | |||
| 1087 | Ga0070700_100118197 | |||
| 1088 | Ga0070700_100131663 | |||
| 1089 | Ga0070700_100197878 | |||
| 1090 | Ga0070694_100094261 | |||
| 1091 | Ga0070708_100173014 | |||
| 1092 | Ga0070663_100045244 | |||
| 1093 | Ga0070663_100360685 | |||
| 1094 | Ga0070678_100156227 | |||
| 1095 | Ga0070678_100180491 | |||
| 1096 | Ga0070678_100297831 | |||
| 1097 | Ga0070678_100350880 | |||
| 1098 | Ga0070678_100484863 | |||
| 1099 | Ga0070678_100822689 | |||
| 1100 | Ga0070678_100931040 | |||
| 1101 | Ga0070678_101242866 | |||
| 1102 | Ga0070678_101614861 | |||
| 1103 | Ga0070662_100050553 | |||
| 1104 | Ga0070662_100130390 | |||
| 1105 | Ga0070662_100587593 | |||
| 1106 | Ga0070662_101006480 | |||
| 1107 | Ga0070681_10002072 | |||
| 1108 | Ga0070681_10067466 | |||
| 1109 | Ga0070681_10366609 | |||
| 1110 | Ga0070681_10731612 | |||
| 1111 | Ga0068867_100040464 | |||
| 1112 | Ga0068867_100048358 | |||
| 1113 | Ga0068867_100667411 | |||
| 1114 | Ga0070685_10026332 | |||
| 1115 | Ga0070685_10094771 | |||
| 1116 | Ga0070685_11302785 | |||
| 1117 | Ga0070698_100877886 | |||
| 1118 | Ga0070679_100208004 | |||
| 1119 | Ga0070679_100472387 | |||
| 1120 | Ga0070679_100975113 | |||
| 1121 | Ga0070684_100007151 | |||
| 1122 | Ga0070684_100050026 | |||
| 1123 | Ga0070684_100069280 | |||
| 1124 | Ga0070684_100281922 | |||
| 1125 | Ga0070684_100396754 | |||
| 1126 | Ga0070684_100515132 | |||
| 1127 | Ga0070684_100571830 | |||
| 1128 | Ga0070684_100581556 | |||
| 1129 | Ga0070684_101453379 | |||
| 1130 | Ga0070684_101857343 | |||
| 1131 | Ga0068853_100004912 | |||
| 1132 | Ga0068853_100009437 | |||
| 1133 | Ga0068853_100396668 | |||
| 1134 | Ga0068853_101679536 | |||
| 1135 | Ga0068853_102482659 | |||
| 1136 | Ga0070672_100004959 | |||
| 1137 | Ga0070672_100022319 | |||
| 1138 | Ga0070672_100029322 | |||
| 1139 | Ga0070672_100300688 | |||
| 1140 | Ga0070672_100950821 | |||
| 1141 | Ga0070686_100006012 | |||
| 1142 | Ga0070686_100075322 | |||
| 1143 | Ga0070686_100391149 | |||
| 1144 | Ga0070696_100183811 | |||
| 1145 | Ga0070696_100510295 | |||
| 1146 | Ga0070696_101321399 | |||
| 1147 | Ga0070693_100134038 | |||
| 1148 | Ga0070693_100624259 | |||
| 1149 | Ga0070665_100025371 | |||
| 1150 | Ga0070665_100222402 | |||
| 1151 | Ga0070665_100556369 | |||
| 1152 | Ga0070665_101988384 | |||
| 1153 | Ga0070704_100022573 | |||
| 1154 | Ga0070704_100623963 | |||
| 1155 | Ga0068855_100047253 | |||
| 1156 | Ga0068855_100606283 | |||
| 1157 | Ga0068855_100994228 | |||
| 1158 | Ga0068855_101162895 | |||
| 1159 | Ga0068855_101962998 | |||
| 1160 | Ga0070664_100006431 | |||
| 1161 | Ga0070664_100148507 | |||
| 1162 | Ga0070664_100216847 | |||
| 1163 | Ga0070664_100337635 | |||
| 1164 | Ga0070664_100789400 | |||
| 1165 | Ga0068857_100389205 | |||
| 1166 | Ga0068857_100822508 | |||
| 1167 | Ga0068857_101515383 | |||
| 1168 | Ga0068857_101524848 | |||
| 1169 | Ga0068857_102166955 | |||
| 1170 | Ga0068854_100003631 | |||
| 1171 | Ga0068854_100047594 | |||
| 1172 | Ga0068854_100136767 | |||
| 1173 | Ga0068854_100137616 | |||
| 1174 | Ga0068854_100462633 | |||
| 1175 | Ga0068856_100048087 | |||
| 1176 | Ga0068856_100343764 | |||
| 1177 | Ga0068856_100524345 | |||
| 1178 | Ga0070702_100084711 | |||
| 1179 | Ga0070702_100319036 | |||
| 1180 | Ga0070702_100612026 | |||
| 1181 | Ga0070702_100897223 | |||
| 1182 | Ga0068852_100007514 | |||
| 1183 | Ga0068852_100054355 | |||
| 1184 | Ga0068852_100057069 | |||
| 1185 | Ga0068852_100352319 | |||
| 1186 | Ga0068852_100527587 | |||
| 1187 | Ga0068852_100889232 | |||
| 1188 | Ga0068859_100157554 | |||
| 1189 | Ga0068859_101542097 | |||
| 1190 | Ga0068864_100118253 | |||
| 1191 | Ga0068864_100216304 | |||
| 1192 | Ga0068864_102383574 | |||
| 1193 | Ga0068866_10120722 | |||
| 1194 | Ga0068866_10164880 | |||
| 1195 | Ga0068866_10373102 | |||
| 1196 | Ga0068866_10459000 | |||
| 1197 | Ga0068866_10563461 | |||
| 1198 | Ga0068866_10568960 | |||
| 1199 | Ga0068866_10594368 | |||
| 1200 | Ga0068861_100032453 | |||
| 1201 | Ga0068861_100214674 | |||
| 1202 | Ga0068861_100265831 | |||
| 1203 | Ga0068861_100746821 | |||
| 1204 | Ga0068851_10111038 | |||
| 1205 | Ga0068851_10167962 | |||
| 1206 | Ga0068870_10028157 | |||
| 1207 | Ga0068870_10341515 | |||
| 1208 | Ga0068863_100781526 | |||
| 1209 | Ga0068858_100058586 | |||
| 1210 | Ga0068858_100624962 | |||
| 1211 | Ga0068858_101832014 | |||
| 1212 | Ga0068860_100159255 | |||
| 1213 | Ga0068860_100535839 | |||
| 1214 | Ga0081455_10911023 | |||
| 1215 | Ga0081539_10001549 | |||
| 1216 | Ga0081539_10109064 | |||
| 1217 | Ga0070717_10088475 | |||
| 1218 | Ga0075365_10326889 | |||
| 1219 | Ga0075432_10002049 | |||
| 1220 | Ga0097621_100107927 | |||
| 1221 | Ga0097621_100119480 | |||
| 1222 | Ga0097621_101296766 | |||
| 1223 | Ga0097621_101788053 | |||
| 1224 | Ga0068871_101319170 | |||
| 1225 | Ga0068871_101487195 | |||
| 1226 | Ga0075428_100004576 | |||
| 1227 | Ga0075428_100501474 | |||
| 1228 | Ga0075428_100770776 | |||
| 1229 | Ga0075431_101309827 | |||
| 1230 | Ga0075433_10037639 | |||
| 1231 | Ga0075433_10608600 | |||
| 1232 | Ga0075434_100006726 | |||
| 1233 | Ga0075434_100837205 | |||
| 1234 | Ga0075429_100009096 | |||
| 1235 | Ga0068865_100002718 | |||
| 1236 | Ga0068865_100016943 | |||
| 1237 | Ga0068865_100046880 | |||
| 1238 | Ga0068865_100082195 | |||
| 1239 | Ga0068865_100111307 | |||
| 1240 | Ga0068865_101127271 | |||
| 1241 | Ga0097620_100157559 | |||
| 1242 | Ga0097620_101541996 | |||
| 1243 | Ga0075435_100048596 | |||
| 1244 | Ga0075435_100069936 | |||
| 1245 | Ga0099794_10000307 | |||
| 1246 | Ga0105251_10124016 | |||
| 1247 | Ga0105240_12473632 | |||
| 1248 | Ga0111539_10008396 | |||
| 1249 | Ga0111539_10056574 | |||
| 1250 | Ga0111539_10330305 | |||
| 1251 | Ga0111539_10359368 | |||
| 1252 | Ga0111539_10557635 | |||
| 1253 | Ga0111539_10625196 | |||
| 1254 | Ga0111539_10836169 | |||
| 1255 | Ga0105245_10009579 | |||
| 1256 | Ga0105245_10027685 | |||
| 1257 | Ga0105245_10077600 | |||
| 1258 | Ga0105245_10259436 | |||
| 1259 | Ga0105245_10456665 | |||
| 1260 | Ga0105245_10566406 | |||
| 1261 | Ga0105245_10749425 | |||
| 1262 | Ga0105245_10872505 | |||
| 1263 | Ga0105245_11147490 | |||
| 1264 | Ga0105245_11852785 | |||
| 1265 | Ga0105247_10008745 | |||
| 1266 | Ga0105247_10798906 | |||
| 1267 | Ga0105247_11242169 | |||
| 1268 | Ga0114129_10137571 | |||
| 1269 | Ga0114129_10944225 | |||
| 1270 | Ga0114129_12486249 | |||
| 1271 | Ga0105243_10002349 | |||
| 1272 | Ga0105243_10021154 | |||
| 1273 | Ga0105243_10245021 | |||
| 1274 | Ga0105243_10394576 | |||
| 1275 | Ga0105243_11021514 | |||
| 1276 | Ga0105243_12393996 | |||
| 1277 | Ga0105243_12550490 | |||
| 1278 | Ga0105241_10134873 | |||
| 1279 | Ga0105241_10320466 | |||
| 1280 | Ga0105241_10439146 | |||
| 1281 | Ga0105242_10007255 | |||
| 1282 | Ga0105242_10440583 | |||
| 1283 | Ga0105242_10449144 | |||
| 1284 | Ga0105242_10502154 | |||
| 1285 | Ga0105242_10537817 | |||
| 1286 | Ga0105242_10540867 | |||
| 1287 | Ga0105248_10118683 | |||
| 1288 | Ga0105248_10527291 | |||
| 1289 | Ga0105248_10665810 | |||
| 1290 | Ga0105248_11063412 | |||
| 1291 | Ga0105248_11615840 | |||
| 1292 | Ga0105237_10138812 | |||
| 1293 | Ga0105237_10556985 | |||
| 1294 | Ga0105237_11251884 | |||
| 1295 | Ga0105238_10013752 | |||
| 1296 | Ga0105238_10140061 | |||
| 1297 | Ga0105238_10431207 | |||
| 1298 | Ga0105238_11143762 | |||
| 1299 | Ga0105249_10087271 | |||
| 1300 | Ga0105249_10156124 | |||
| 1301 | Ga0105249_10460894 | |||
| 1302 | Ga0105249_10586938 | |||
| 1303 | Ga0105249_10868213 | |||
| 1304 | Ga0105239_10114244 | |||
| 1305 | Ga0105239_10141718 | |||
| 1306 | Ga0105239_10158213 | |||
| 1307 | Ga0105239_10166053 | |||
| 1308 | Ga0105239_11425876 | |||
| 1309 | Ga0105246_10007974 | |||
| 1310 | Ga0105246_10040527 | |||
| 1311 | Ga0105246_10439364 | |||
| 1312 | Ga0105246_10872382 | |||
| 1313 | Ga0105246_11583657 | |||
| 1314 | Ga0157319_1009125 | |||
| 1315 | Ga0157338_1028621 | |||
| 1316 | Ga0157373_11426740 | |||
| 1317 | Ga0157371_10095050 | |||
| 1318 | Ga0157371_10131099 | |||
| 1319 | Ga0157370_10056428 | |||
| 1320 | Ga0157370_10540706 | |||
| 1321 | Ga0157369_10023164 | |||
| 1322 | Ga0157369_10082680 | |||
| 1323 | Ga0157369_10232236 | |||
| 1324 | Ga0157369_10622670 | |||
| 1325 | Ga0157369_11864152 | |||
| 1326 | Ga0157374_10265013 | |||
| 1327 | Ga0157374_10613779 | |||
| 1328 | Ga0157374_12432637 | |||
| 1329 | Ga0157378_10327084 | |||
| 1330 | Ga0157378_10976063 | |||
| 1331 | Ga0157378_12939382 | |||
| 1332 | Ga0163162_10199870 | |||
| 1333 | Ga0163162_10237364 | |||
| 1334 | Ga0163162_10889346 | |||
| 1335 | Ga0163162_11252932 | |||
| 1336 | Ga0157372_10080529 | |||
| 1337 | Ga0157372_10446894 | |||
| 1338 | Ga0157372_10539285 | |||
| 1339 | Ga0157372_10572869 | |||
| 1340 | Ga0157375_10011579 | |||
| 1341 | Ga0157375_10041949 | |||
| 1342 | Ga0157375_10607593 | |||
| 1343 | Ga0157375_10695520 | |||
| 1344 | Ga0163163_10065425 | |||
| 1345 | Ga0163163_10264117 | |||
| 1346 | Ga0163163_11893635 | |||
| 1347 | Ga0157380_10015681 | |||
| 1348 | Ga0157380_10049173 | |||
| 1349 | Ga0157380_10084589 | |||
| 1350 | Ga0157380_10695781 | |||
| 1351 | Ga0157380_11132031 | |||
| 1352 | Ga0157377_10010972 | |||
| 1353 | Ga0157377_10019262 | |||
| 1354 | Ga0157377_10049273 | |||
| 1355 | Ga0157377_10075820 | |||
| 1356 | Ga0157377_10545471 | |||
| 1357 | Ga0157377_10650445 | |||
| 1358 | Ga0157377_10741826 | |||
| 1359 | Ga0157377_11137711 | |||
| 1360 | Ga0157379_10162091 | |||
| 1361 | Ga0157379_10213578 | |||
| 1362 | Ga0157379_10344908 | |||
| 1363 | Ga0157379_12038782 | |||
| 1364 | Ga0157379_12049376 | |||
| 1365 | Ga0157376_10097055 | |||
| 1366 | Ga0157376_10201439 | |||
| 1367 | Ga0157376_10292296 | |||
| 1368 | Ga0163161_10111553 | |||
| 1369 | Ga0163161_10456649 | |||
| 1370 | Ga0206356_11069134 | |||
| 1371 | Ga0206353_10319247 | |||
| 1372 | Ga0206353_10919167 | |||
| 1373 | Ga0206353_12054229 | |||
| 1374 | Ga0207697_10223013 | |||
| 1375 | Ga0207682_10266903 | |||
| 1376 | Ga0207692_10000336 | |||
| 1377 | Ga0207642_10164885 | |||
| 1378 | Ga0207642_10248761 | |||
| 1379 | Ga0207642_10340074 | |||
| 1380 | Ga0207642_10387551 | |||
| 1381 | Ga0207642_10647204 | |||
| 1382 | Ga0207688_10002702 | |||
| 1383 | Ga0207688_10005424 | |||
| 1384 | Ga0207688_10038105 | |||
| 1385 | Ga0207688_10059564 | |||
| 1386 | Ga0207688_10195994 | |||
| 1387 | Ga0207645_10039118 | |||
| 1388 | Ga0207645_10210791 | |||
| 1389 | Ga0207645_10332757 | |||
| 1390 | Ga0207643_10015561 | |||
| 1391 | Ga0207643_10070140 | |||
| 1392 | Ga0207643_10107242 | |||
| 1393 | Ga0207705_10020346 | |||
| 1394 | Ga0207705_11158972 | |||
| 1395 | Ga0207654_10081749 | |||
| 1396 | Ga0207654_10359371 | |||
| 1397 | Ga0207707_10057939 | |||
| 1398 | Ga0207707_10170265 | |||
| 1399 | Ga0207707_10807397 | |||
| 1400 | Ga0207707_11300126 | |||
| 1401 | Ga0207671_10577271 | |||
| 1402 | Ga0207671_10796994 | |||
| 1403 | Ga0207671_10934872 | |||
| 1404 | Ga0207660_10057827 | |||
| 1405 | Ga0207662_10015924 | |||
| 1406 | Ga0207662_10033120 | |||
| 1407 | Ga0207662_10073238 | |||
| 1408 | Ga0207662_11225371 | |||
| 1409 | Ga0207657_10004668 | |||
| 1410 | Ga0207657_10117075 | |||
| 1411 | Ga0207657_10167145 | |||
| 1412 | Ga0207657_10390611 | |||
| 1413 | Ga0207657_10498022 | |||
| 1414 | Ga0207657_10680583 | |||
| 1415 | Ga0207649_10603809 | |||
| 1416 | Ga0207649_10659850 | |||
| 1417 | Ga0207649_10814686 | |||
| 1418 | Ga0207649_10959519 | |||
| 1419 | Ga0207652_10018886 | |||
| 1420 | Ga0207652_10147014 | |||
| 1421 | Ga0207652_10488995 | |||
| 1422 | Ga0207681_10498960 | |||
| 1423 | Ga0207681_10810326 | |||
| 1424 | Ga0207681_10892380 | |||
| 1425 | Ga0207694_10022103 | |||
| 1426 | Ga0207694_10081387 | |||
| 1427 | Ga0207694_10408822 | |||
| 1428 | Ga0207694_10937516 | |||
| 1429 | Ga0207650_10508265 | |||
| 1430 | Ga0207650_11313275 | |||
| 1431 | Ga0207650_11533356 | |||
| 1432 | Ga0207659_10129452 | |||
| 1433 | Ga0207659_10455277 | |||
| 1434 | Ga0207659_10573477 | |||
| 1435 | Ga0207659_10631930 | |||
| 1436 | Ga0207687_10029484 | |||
| 1437 | Ga0207687_10071190 | |||
| 1438 | Ga0207687_10150820 | |||
| 1439 | Ga0207687_10164047 | |||
| 1440 | Ga0207687_10199333 | |||
| 1441 | Ga0207687_10355760 | |||
| 1442 | Ga0207687_10398627 | |||
| 1443 | Ga0207687_10477414 | |||
| 1444 | Ga0207664_10467620 | |||
| 1445 | Ga0207644_10229331 | |||
| 1446 | Ga0207690_10004794 | |||
| 1447 | Ga0207690_10087404 | |||
| 1448 | Ga0207690_10171411 | |||
| 1449 | Ga0207690_10448369 | |||
| 1450 | Ga0207706_10017578 | |||
| 1451 | Ga0207706_10024437 | |||
| 1452 | Ga0207706_10075771 | |||
| 1453 | Ga0207706_10169364 | |||
| 1454 | Ga0207686_10522428 | |||
| 1455 | Ga0207709_10006589 | |||
| 1456 | Ga0207709_10024537 | |||
| 1457 | Ga0207709_10034083 | |||
| 1458 | Ga0207709_10174636 | |||
| 1459 | Ga0207670_10013623 | |||
| 1460 | Ga0207670_10173642 | |||
| 1461 | Ga0207670_11392304 | |||
| 1462 | Ga0207669_10027065 | |||
| 1463 | Ga0207669_10172756 | |||
| 1464 | Ga0207669_10275657 | |||
| 1465 | Ga0207669_10281319 | |||
| 1466 | Ga0207669_10334146 | |||
| 1467 | Ga0207669_11162982 | |||
| 1468 | Ga0207704_10055971 | |||
| 1469 | Ga0207704_10110245 | |||
| 1470 | Ga0207704_10154177 | |||
| 1471 | Ga0207704_11153470 | |||
| 1472 | Ga0207691_10006179 | |||
| 1473 | Ga0207691_10012070 | |||
| 1474 | Ga0207691_10056012 | |||
| 1475 | Ga0207691_10360396 | |||
| 1476 | Ga0207691_11314379 | |||
| 1477 | Ga0207711_10048669 | |||
| 1478 | Ga0207711_10054697 | |||
| 1479 | Ga0207711_10726207 | |||
| 1480 | Ga0207689_10087402 | |||
| 1481 | Ga0207689_10384423 | |||
| 1482 | Ga0207689_10420132 | |||
| 1483 | Ga0207689_10642372 | |||
| 1484 | Ga0207689_10741218 | |||
| 1485 | Ga0207661_10001401 | |||
| 1486 | Ga0207661_10004390 | |||
| 1487 | Ga0207661_10012644 | |||
| 1488 | Ga0207661_10025210 | |||
| 1489 | Ga0207661_10154472 | |||
| 1490 | Ga0207661_10608626 | |||
| 1491 | Ga0207661_11218200 | |||
| 1492 | Ga0207661_11617560 | |||
| 1493 | Ga0207679_10015649 | |||
| 1494 | Ga0207679_10370168 | |||
| 1495 | Ga0207679_10858718 | |||
| 1496 | Ga0207679_11569902 | |||
| 1497 | Ga0207667_10509059 | |||
| 1498 | Ga0207667_10687394 | |||
| 1499 | Ga0207667_11466221 | |||
| 1500 | Ga0207651_10802156 | |||
| 1501 | Ga0207651_11377418 | |||
| 1502 | Ga0207712_10296749 | |||
| 1503 | Ga0207712_10436167 | |||
| 1504 | Ga0207668_10086315 | |||
| 1505 | Ga0207668_11097865 | |||
| 1506 | Ga0207668_11642329 | |||
| 1507 | Ga0207640_10013470 | |||
| 1508 | Ga0207640_10028329 | |||
| 1509 | Ga0207640_10055471 | |||
| 1510 | Ga0207658_10156723 | |||
| 1511 | Ga0207658_10486961 | |||
| 1512 | Ga0207677_10029362 | |||
| 1513 | Ga0207677_10411424 | |||
| 1514 | Ga0207677_10478502 | |||
| 1515 | Ga0207703_10881702 | |||
| 1516 | Ga0207703_11438066 | |||
| 1517 | Ga0207639_10004159 | |||
| 1518 | Ga0207639_10020326 | |||
| 1519 | Ga0207639_10424051 | |||
| 1520 | Ga0207639_11126765 | |||
| 1521 | Ga0207639_11391708 | |||
| 1522 | Ga0207678_10026025 | |||
| 1523 | Ga0207678_10098282 | |||
| 1524 | Ga0207678_10234121 | |||
| 1525 | Ga0207678_10261434 | |||
| 1526 | Ga0207678_11215736 | |||
| 1527 | Ga0207708_10043433 | |||
| 1528 | Ga0207708_10088736 | |||
| 1529 | Ga0207708_10110674 | |||
| 1530 | Ga0207708_10431179 | |||
| 1531 | Ga0207702_10045257 | |||
| 1532 | Ga0207702_10292185 | |||
| 1533 | Ga0207702_10889572 | |||
| 1534 | Ga0207641_10681284 | |||
| 1535 | Ga0207641_12160407 | |||
| 1536 | Ga0207648_10019875 | |||
| 1537 | Ga0207648_10053732 | |||
| 1538 | Ga0207648_10093417 | |||
| 1539 | Ga0207648_10206627 | |||
| 1540 | Ga0207648_10714125 | |||
| 1541 | Ga0207676_10335445 | |||
| 1542 | Ga0207676_10490247 | |||
| 1543 | Ga0207676_11169623 | |||
| 1544 | Ga0207676_11811258 | |||
| 1545 | Ga0207674_10054243 | |||
| 1546 | Ga0207674_10080542 | |||
| 1547 | Ga0207674_10244465 | |||
| 1548 | Ga0207674_10257311 | |||
| 1549 | Ga0207675_100034122 | |||
| 1550 | Ga0207675_100098962 | |||
| 1551 | Ga0207675_101001052 | |||
| 1552 | Ga0207683_10039661 | |||
| 1553 | Ga0207683_10047754 | |||
| 1554 | Ga0207683_10138197 | |||
| 1555 | Ga0207683_10143088 | |||
| 1556 | Ga0207683_10185004 | |||
| 1557 | Ga0207683_10187701 | |||
| 1558 | Ga0207683_10811651 | |||
| 1559 | Ga0207683_10880247 | |||
| 1560 | Ga0207683_11340645 | |||
| 1561 | Ga0207683_11721044 | |||
| 1562 | Ga0207698_10003693 | |||
| 1563 | Ga0207698_10011159 | |||
| 1564 | Ga0207698_10331098 | |||
| 1565 | Ga0207698_10777415 | |||
| 1566 | Ga0207428_10000196 | |||
| 1567 | Ga0207428_10232024 | |||
| 1568 | Ga0207428_10592126 | |||
| 1569 | Ga0268266_10089805 | |||
| 1570 | Ga0268266_10133796 | |||
| 1571 | Ga0268266_10316417 | |||
| 1572 | Ga0268266_10757020 | |||
| 1573 | Ga0268266_11899865 | |||
| 1574 | Ga0268266_11935240 | |||
| 1575 | Ga0268265_11048751 | |||
| 1576 | Ga0268265_11250514 | |||
| 1577 | Ga0268264_10140772 | |||
| 1578 | Ga0268264_11133242 | |||
| 1579 | Ga0268264_12312786 | |||
| 1580 | Ga0265338_10012358 | |||
| 1581 | Ga0265338_10195170 | |||
| 1582 | Ga0307511_10000068 | |||
| 1583 | Ga0265320_10022250 | |||
| 1584 | Ga0265325_10015123 | |||
| 1585 | Ga0265340_10020367 | |||
| 1586 | Ga0265339_10004305 | |||
| 1587 | Ga0265313_10011970 | |||
| 1588 | Ga0265342_10058329 | |||
| 1589 | Ga0316576_10327874 | |||
| 1590 | Ga0316578_10118144 | |||
| 1591 | Ga0307413_10093700 | |||
| 1592 | Ga0307410_10125557 | |||
| 1593 | Ga0307407_10055129 | |||
| 1594 | Ga0307409_100098887 | |||
| 1595 | Ga0307416_101240234 | |||
| 1596 | Ga0316588_1000278 | |||
| 1597 | Ga0316596_1000488 | |||
| 1598 | Ga0373948_0087443 | |||
| 1599 | Ga0373959_0083744 | |||
| 1600 | Ga0373938_0043793 | |||
| 1601 | Ga0373949_0068539 | |||
| 1602 | Ga0373932_0372529 | |||
| 1603 | Ga0373939_0365268 | |||
| 1604 | Ga0373941_0179771 | |||
| 1605 | Ga0373941_0219513 | |||
| 1606 | Ga0373956_0006542 | |||
| 1607 | Ga0373960_0019883 | |||
| 1608 | Ga0373960_0150787 | |||
| 1609 | Ga0373961_0075960 | |||
| 1610 | Ga0373962_0160680 | |||
| 1611 | Ga0373931_0373197 | |||
| 1612 | Ga0395900_0042570 | |||
| 1613 | Ga0395900_0242836 | |||
| 1614 | Ga0395900_0332171 | |||
| 1615 | Ga0395898_0005829 | |||
| 1616 | Ga0395898_0198473 | |||
| 1617 | Ga0395898_0249307 | |||
| 1618 | Ga0395898_0394653 | |||
| 1619 | Ga0395898_0432360 | |||
| 1620 | Ga0395905_0110050 | |||
| 1621 | Ga0395901_0002259 | |||
| 1622 | Ga0395901_0178479 | |||
| 1623 | Ga0395901_1135316 | |||
| 1624 | Ga0436365_0958401 | |||
| 1625 | Ga0451797_0123153 | |||
| 1626 | Ga0451802_0445110 | |||
| 1627 | Ga0451837_1044833 | |||
| 1628 | Ga0451845_0171825 | |||
| 1629 | Ga0451851_0313660 | |||
| 1630 | Ga0451843_1748667 | |||
| 1631 | Ga0451853_3587584 | |||
| 1632 | Ga0450911_018118 | |||
| 1633 | Ga0450906_009617 | |||
| 1634 | Ga0450907_004935 | |||
| 1635 | Ga0466969_0001566 | |||
| 1636 | Ga0466965_0640734 | |||
| 1637 | Ga0466966_0002535 | |||
| 1638 | Ga0466961_0019309 | |||
| 1639 | Ga0466961_0052937 | |||
| 1640 | Ga0466963_0804115 | |||
| 1641 | Ga0466963_1234974 | |||
| 1642 | Ga0466964_0105995 | |||
| 1643 | Ga0466964_0339486 | |||
| 1644 | Ga0466971_0222972 | |||
| 1645 | Ga0466970_0161823 | |||
| 1646 | Ga0466960_0174647 | |||
| 1647 | Ga0466959_0006446 | |||
| 1648 | Ga0466967_0003830 | |||
| 1649 | Ga0466967_1278515 | |||
| 1650 | Ga0495603_0008050 | |||
| 1651 | Ga0495603_0018293 | |||
| 1652 | Ga0495629_0865506 | |||
| 1653 | Ga0495641_0427403 | |||
| 1654 | Ga0495651_0695531 | |||
| 1655 | Ga0495653_0225794 | |||
| 1656 | Ga0495582_0253928 | |||
| 1657 | Ga0495639_0297137 | |||
| 1658 | Ga0495583_0390834 | |||
| 1659 | Ga0495628_1108876 | |||
| 1660 | Ga0495630_0107299 | |||
| 1661 | Ga0495631_0181831 | |||
| 1662 | Ga0495637_0055098 | |||
| 1663 | Ga0495587_0604946 | |||
| 1664 | Ga0495645_0709373 | |||
| 1665 | Ga0495622_0132942 | |||
| 1666 | Ga0495656_0090950 | |||
| 1667 | Ga0495656_0190111 | |||
| 1668 | Ga0495634_0346448 | |||
| 1669 | Ga0495647_0252370 | |||
| 1670 | Ga0495670_0263485 | |||
| 1671 | Ga0495670_0509520 | |||
| 1672 | Ga0495671_0120055 | |||
| 1673 | Ga0495589_0279937 | |||
| 1674 | Ga0495589_0366741 | |||
| 1675 | Ga0495604_0126955 | |||
| 1676 | Ga0495674_0197470 | |||
| 1677 | Ga0495672_0000834 | |||
| 1678 | Ga0495676_0099533 | |||
| 1679 | Ga0495676_0485329 | |||
| 1680 | Ga0495683_0392238 | |||
| 1681 | Ga0495677_0010463 | |||
| 1682 | Ga0495673_0207062 | |||
| 1683 | Ga0495602_0121209 | |||
| 1684 | Ga0496100_0055538 | |||
| 1685 | Ga0496100_0413259 | |||
| 1686 | Ga0496100_0517865 | |||
| 1687 | Ga0496100_0556357 | |||
| 1688 | Ga0496100_0666481 | |||
| 1689 | Ga0496100_1484140 | |||
| 1690 | Ga0496101_0045796 | |||
| 1691 | Ga0496101_0138593 | |||
| 1692 | Ga0496101_0215438 | |||
| 1693 | Ga0496101_0236364 | |||
| 1694 | Ga0496101_1190444 | |||
| 1695 | Ga0496101_1410486 | |||
| 1696 | Ga0496102_0317510 | |||
| 1697 | Ga0496102_0596031 | |||
| 1698 | Ga0496103_0236915 | |||
| 1699 | Ga0496103_0764774 | |||
| 1700 | Ga0496104_0160845 | |||
| 1701 | Ga0496104_0173027 | |||
| 1702 | Ga0496104_0390145 | |||
| 1703 | Ga0496104_1141285 | |||
| 1704 | Ga0496105_0098528 | |||
| 1705 | Ga0496105_0260501 | |||
| 1706 | Ga0496105_0366587 | |||
| 1707 | Ga0496105_0468365 | |||
| 1708 | Ga0496105_0492253 | |||
| 1709 | Ga0496105_0598598 | |||
| 1710 | Ga0496106_0043538 | |||
| 1711 | Ga0496106_0073267 | |||
| 1712 | Ga0496106_0449278 | |||
| 1713 | Ga0496106_0738087 | |||
| 1714 | Ga0496107_0481075 | |||
| 1715 | Ga0496108_0004142 | |||
| 1716 | Ga0496108_0180895 | |||
| 1717 | Ga0496108_0227143 | |||
| 1718 | Ga0496108_0251800 | |||
| 1719 | Ga0496108_0367789 | |||
| 1720 | Ga0496108_0469703 | |||
| 1721 | Ga0496109_0006116 | |||
| 1722 | Ga0496109_0168905 | |||
| 1723 | Ga0496109_0695179 | |||
| 1724 | Ga0496109_1176640 | |||
| 1725 | Ga0496109_1343481 | |||
| 1726 | Ga0496109_1491184 | |||
| 1727 | Ga0496109_1787030 | |||
| 1728 | Ga0496110_0004582 | |||
| 1729 | Ga0496110_0023137 | |||
| 1730 | Ga0496110_0026771 | |||
| 1731 | Ga0496110_0064289 | |||
| 1732 | Ga0496110_0110596 | |||
| 1733 | Ga0496110_0861309 | |||
| 1734 | Ga0496110_0865248 | |||
| 1735 | Ga0496111_0000612 | |||
| 1736 | Ga0496111_0022732 | |||
| 1737 | Ga0496111_0031837 | |||
| 1738 | Ga0496111_0134388 | |||
| 1739 | Ga0496111_0323063 | |||
| 1740 | Ga0496111_0644053 | |||
| 1741 | Ga0496111_0954357 | |||
| 1742 | Ga0496112_0007171 | |||
| 1743 | Ga0496112_0548633 | |||
| 1744 | Ga0496112_0567577 | |||
| 1745 | Ga0496112_0624792 | |||
| 1746 | Ga0496112_1156929 | |||
| 1747 | Ga0496113_0380639 | |||
| 1748 | Ga0496114_0072801 | |||
| 1749 | Ga0496114_0109009 | |||
| 1750 | Ga0496114_0174056 | |||
| 1751 | Ga0496114_0221463 | |||
| 1752 | Ga0496114_0231725 | |||
| 1753 | Ga0496114_0270984 | |||
| 1754 | Ga0496114_0310328 | |||
| 1755 | Ga0496114_0559035 | |||
| 1756 | Ga0496114_0700200 | |||
| 1757 | Ga0496114_0847009 | |||
| 1758 | Ga0496114_0879789 | |||
| 1759 | Ga0496114_1092222 | |||
| 1760 | Ga0501031_0003039 | |||
| 1761 | Ga0501031_0053137 | |||
| 1762 | Ga0501031_0078772 | |||
| 1763 | Ga0501031_0610977 | |||
| 1764 | Ga0501032_0011905 | |||
| 1765 | Ga0501033_0020165 | |||
| 1766 | Ga0501033_0031961 | |||
| 1767 | Ga0501033_0192723 | |||
| 1768 | Ga0501034_0147689 | |||
| 1769 | Ga0501034_0170334 | |||
| 1770 | Ga0501034_0330562 | |||
| 1771 | Ga0501034_0960621 | |||
| 1772 | Ga0501036_0017170 | |||
| 1773 | Ga0501036_0046815 | |||
| 1774 | Ga0501036_0119608 | |||
| 1775 | Ga0501036_0497466 | |||
| 1776 | Ga0501036_0570331 | |||
| 1777 | Ga0501036_0986106 | |||
| 1778 | Ga0501037_0075922 | |||
| 1779 | Ga0501037_0357995 | |||
| 1780 | Ga0501037_0633089 | |||
| 1781 | Ga0501038_0023255 | |||
| 1782 | Ga0501038_0045306 | |||
| 1783 | Ga0501038_0398537 | |||
| 1784 | Ga0501039_0021045 | |||
| 1785 | Ga0501039_0046800 | |||
| 1786 | Ga0501039_0090833 | |||
| 1787 | Ga0501039_0280675 | |||
| 1788 | Ga0501039_0311309 | |||
| 1789 | Ga0501039_0605642 | |||
| 1790 | Ga0501040_0051099 | |||
| 1791 | Ga0501040_0055634 | |||
| 1792 | Ga0501040_0945750 | |||
| 1793 | Ga0501040_0969072 | |||
| 1794 | Ga0501041_0003646 | |||
| 1795 | Ga0501041_0082356 | |||
| 1796 | Ga0501041_0185159 | |||
| 1797 | Ga0501041_0200397 | |||
| 1798 | Ga0501041_0613652 | |||
| 1799 | Ga0501042_0007772 | |||
| 1800 | Ga0501042_0208860 | |||
| 1801 | Ga0501042_0360477 | |||
| 1802 | Ga0501042_0440087 | |||
| 1803 | Ga0501042_0575852 | |||
| 1804 | Ga0501043_0082637 | |||
| 1805 | Ga0501043_0153086 | |||
| 1806 | Ga0501043_0275419 | |||
| 1807 | Ga0501043_1018361 | |||
| 1808 | Ga0501046_0004011 | |||
| 1809 | Ga0501046_0016747 | |||
| 1810 | Ga0501046_0114646 | |||
| 1811 | Ga0501046_0258524 | |||
| 1812 | Ga0501046_0276324 | |||
| 1813 | Ga0501046_0719776 | |||
| 1814 | Ga0501047_0014875 | |||
| 1815 | Ga0501048_0007483 | |||
| 1816 | Ga0501048_0010731 | |||
| 1817 | Ga0501048_0023818 | |||
| 1818 | Ga0501048_0124448 | |||
| 1819 | Ga0501048_1360202 | |||
| 1820 | Ga0501067_0039146 | |||
| 1821 | Ga0501067_0142189 | |||
| 1822 | Ga0501067_0493093 | |||
| 1823 | Ga0501068_0002316 | |||
| 1824 | Ga0501068_0016403 | |||
| 1825 | Ga0501068_0119442 | |||
| 1826 | Ga0501068_0222905 | |||
| 1827 | Ga0501068_0378152 | |||
| 1828 | Ga0501068_0677313 | |||
| 1829 | Ga0501068_0726223 | |||
| 1830 | Ga0501069_0031494 | |||
| 1831 | Ga0501069_0111543 | |||
| 1832 | Ga0501069_0196270 | |||
| 1833 | Ga0501069_0201419 | |||
| 1834 | Ga0501069_0289765 | |||
| 1835 | Ga0501069_0523835 | |||
| 1836 | Ga0501069_0935328 | |||
| 1837 | Ga0501070_0040330 | |||
| 1838 | Ga0501070_0167058 | |||
| 1839 | Ga0501070_0565911 | |||
| 1840 | Ga0501071_0003292 | |||
| 1841 | Ga0501071_0089334 | |||
| 1842 | Ga0501071_0134395 | |||
| 1843 | Ga0501071_0180425 | |||
| 1844 | Ga0501071_0312912 | |||
| 1845 | Ga0501071_0340590 | |||
| 1846 | Ga0501072_0019784 | |||
| 1847 | Ga0501072_0023598 | |||
| 1848 | Ga0501072_0456136 | |||
| 1849 | Ga0501072_0500562 | |||
| 1850 | Ga0501072_0590805 | |||
| 1851 | Ga0501072_0786687 | |||
| 1852 | Ga0501072_0808157 | |||
| 1853 | Ga0501072_0961663 | |||
| 1854 | Ga0501072_1005424 | |||
| 1855 | Ga0501072_1472019 | |||
| 1856 | Ga0501073_0015465 | |||
| 1857 | Ga0501073_0462898 | |||
| 1858 | Ga0501074_0011150 | |||
| 1859 | Ga0501074_0045880 | |||
| 1860 | Ga0501074_0405985 | |||
| 1861 | Ga0501074_0494986 | |||
| 1862 | Ga0501075_0001579 | |||
| 1863 | Ga0501075_0012185 | |||
| 1864 | Ga0501075_0034523 | |||
| 1865 | Ga0501075_0048638 | |||
| 1866 | Ga0501075_0100878 | |||
| 1867 | Ga0501075_0126950 | |||
| 1868 | Ga0501075_0515627 | |||
| 1869 | Ga0501075_0777278 | |||
| 1870 | Ga0501075_0859977 | |||
| 1871 | Ga0501076_0004848 | |||
| 1872 | Ga0501076_0008579 | |||
| 1873 | Ga0501076_0127731 | |||
| 1874 | Ga0501076_0151366 | |||
| 1875 | Ga0501076_0209420 | |||
| 1876 | Ga0501076_0378678 | |||
| 1877 | Ga0501076_0518966 | |||
| 1878 | Ga0501076_0695432 | |||
| 1879 | Ga0501077_0002154 | |||
| 1880 | Ga0501077_0010835 | |||
| 1881 | Ga0501077_0155981 | |||
| 1882 | Ga0501077_0198454 | |||
| 1883 | Ga0501077_0374001 | |||
| 1884 | Ga0501079_0007024 | |||
| 1885 | Ga0501079_0014626 | |||
| 1886 | Ga0501079_0018090 | |||
| 1887 | Ga0501079_0378345 | |||
| 1888 | Ga0501079_0499697 | |||
| 1889 | Ga0501079_0799127 | |||
| 1890 | Ga0501079_1019351 | |||
| 1891 | Ga0501080_0003166 | |||
| 1892 | Ga0501080_0147454 | |||
| 1893 | Ga0501080_0271025 | |||
| 1894 | Ga0501080_0427458 | |||
| 1895 | Ga0501080_0604805 | |||
| 1896 | Ga0501081_0020311 | |||
| 1897 | Ga0501081_0224497 | |||
| 1898 | Ga0501081_0280606 | |||
| 1899 | Ga0501081_0341914 | |||
| 1900 | Ga0501083_0072348 | |||
| 1901 | Ga0501083_0094593 | |||
| 1902 | Ga0501083_0226064 | |||
| 1903 | Ga0501035_0023594 | |||
| 1904 | Ga0501035_1277172 | |||
| 1905 | Ga0501035_1353336 | |||
| 1906 | Ga0501044_0628455 | |||
| 1907 | Ga0501044_0677284 | |||
| 1908 | Ga0501045_0001676 | |||
| 1909 | Ga0501045_0016348 | |||
| 1910 | Ga0501045_0042477 | |||
| 1911 | Ga0501045_0105301 | |||
| 1912 | Ga0501045_0412479 | |||
| 1913 | Ga0501045_0534806 | |||
| 1914 | Ga0501045_0539697 | |||
| 1915 | Ga0501045_0743578 | |||
| 1916 | Ga0501045_1247971 | |||
| 1917 | Ga0501045_1413142 | |||
| 1918 | nmdc:mga0yw44_269082_c1 | |||
| 1919 | nmdc:mga05p37_17839_c1 | |||
| 1920 | nmdc:mga09592_13054_c1 | |||
| 1921 | nmdc:mga08y16_1244507_c1 | |||
| 1922 | nmdc:mga08y16_140182_c1 | |||
| 1923 | nmdc:mga08y16_1507784_c1 | |||
| 1924 | nmdc:mga08y16_22195_c1 | |||
| 1925 | nmdc:mga0n895_79651_c1 | |||
| 1926 | nmdc:mga0n895_95417_c1 | |||
| 1927 | nmdc:mga0rr50_598616_c1 | |||
| 1928 | nmdc:mga0rr50_724127_c1 | |||
| 1929 | nmdc:mga08x19_125640_c1 | |||
| 1930 | nmdc:mga0a205_1351114_c1 | |||
| 1931 | nmdc:mga0a205_334097_c1 | |||
| 1932 | Ga0495655_0278511 | |||
| 1933 | Ga0495595_0217905 | |||
| 1934 | Ga0495619_0062240 | |||
| 1935 | Ga0501084_0027520 | |||
| 1936 | Ga0501084_0039885 | |||
| 1937 | Ga0501084_0100670 | |||
| 1938 | Ga0501084_0104688 | |||
| 1939 | Ga0501084_0240389 | |||
| 1940 | Ga0501084_0264534 | |||
| 1941 | Ga0501084_0473248 | |||
| 1942 | Ga0501084_0845784 | |||
| 1943 | Ga0501082_0002118 | |||
| 1944 | Ga0501082_0029744 | |||
| 1945 | Ga0501082_0093172 | |||
| 1946 | Ga0501082_0155187 | |||
| 1947 | Ga0501082_0562072 | |||
| 1948 | Ga0501082_0634008 | |||
| 1949 | Ga0501082_0885230 | |||
| 1950 | Ga0501082_1096098 | |||
| 1951 | Ga0530510_0009505 | |||
| 1952 | Ga0530510_0040739 | |||
| 1953 | Ga0530510_0051825 | |||
| 1954 | Ga0530510_0238991 | |||
| 1955 | Ga0530510_0354912 | |||
| 1956 | Ga0530510_0917114 | |||
| 1957 | 2559428936 | |||
| 1958 | 2795781643 | |||
| 1959 | 2795795155 | |||
| 1960 | 2844851953 | |||
| 1961 | 2857740587 | |||
| 1962 | 2904499334 | |||
| 1963 | 2904778436 | |||
| 1964 | 2919035788 | |||
| 1965 | 2919538997 | |||
| 1966 | 2932427578 | |||
| 1967 | 2933418833 | |||
| 1968 | 2939648234 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uwz-assembly1.cif.gz_A | bacillus subtilis cytidine deaminase with an arg56 - ala substitution | 0.9186 | 1 | 123 |
| 3dmo-assembly1.cif.gz_C | 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei | 0.9177 | 1 | 118 |
| 7zob-assembly2.cif.gz_E | metagenomic cytidine deaminase cdd | 0.9144 | 1 | 122 |
| 2d30-assembly1.cif.gz_A | crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution | 0.9111 | 1 | 116 |
| 1mq0-assembly1.cif.gz_A | crystal structure of human cytidine deaminase | 0.9003 | 1 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FY04_3_129_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9079 | 2 | 119 | 3.40.140.10 |
| af_Q8IDK5_19_216_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8902 | 74 | 99 | 3.40.140.10 |
| 1r5tD00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.887 | 4 | 118 | 3.40.140.10 |
| af_A0A1D6NE76_27_176_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8798 | 4 | 123 | 3.40.140.10 |
| af_A0A0P0WYM0_4_131_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8766 | 4 | 123 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0PZU2-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9769 | 1 | 119 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A538EGM8-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9667 | 4 | 120 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A538D7I5-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.955 | 2 | 83 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |
| AF-A0A7W0PZU2-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9532 | 1 | 119 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A0C2GXR6-F1-model_v4 | Putative cytidine deaminase | 0.9523 | 2 | 77 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |