F487476

General Info

Members Datasets Scaffolds Average Seq Length
984 337 1968 127

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0004656|Ga0316584_0004656_875_1330
Length 151
Sequence MNDGTTLSDRNPSMPTQIDWDDLRRQATAAASRAYAPYSHVHVGAAALVDDGRVVQGVNVENASYGLGTCAENGIASALAASGGGRLVAISVVAGDGRPLAPCGRCRQVLYEFGGKDLLLDGGADGTPVTLGEMLPGAFGPEDVVTRREQQ

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
218 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 2558860280 Kutzneria sp. 744 Isolate Unclassified
327 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
328 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
329 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
330 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
331 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
332 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
333 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
334 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
335 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
336 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
337 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.61
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 7.93
Rhizosphere 90.75
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0004656 3300036712 Bacteria 9092
2 2214909088 2209111006 Bacteria 1401
3 ARcpr5oldR_c005479 3300000041 Bacteria 1089
4 ARCol0yngRDRAFT_1002670 3300000652 Bacteria 1333
5 JGI24745J21846_1001366 3300002073 Bacteria 2356
6 JGI24738J21930_10000561 3300002075 Bacteria 10619
7 JGI25406J46586_10004625 3300003203 Bacteria 6403
8 rootH2_10047530 3300003320 Bacteria 3035
9 Ga0070658_10151231 3300005327 Bacteria 1943
10 Ga0070658_10354259 3300005327 Bacteria 1256
11 Ga0070676_10042736 3300005328 Bacteria 2633
12 Ga0070676_10075566 3300005328 Bacteria 2032
13 Ga0070676_10174224 3300005328 Bacteria 1394
14 Ga0070676_11068759 3300005328 Bacteria 609
15 Ga0070676_11127176 3300005328 Unclassified 594
16 Ga0070676_11314097 3300005328 Unclassified 553
17 Ga0070683_100007373 3300005329 Bacteria 9292
18 Ga0070683_100025155 3300005329 Bacteria 5343
19 Ga0070683_100468315 3300005329 Bacteria 1203
20 Ga0070683_100608994 3300005329 Bacteria 1045
21 Ga0070683_101091354 3300005329 Bacteria 767
22 Ga0070690_100757158 3300005330 Bacteria 750
23 Ga0070690_100996072 3300005330 Unclassified 660
24 Ga0070670_100510681 3300005331 Bacteria 1069
25 Ga0070670_100955941 3300005331 Bacteria 778
26 Ga0070670_101297248 3300005331 Bacteria 666
27 Ga0068869_100022196 3300005334 Bacteria 4371
28 Ga0068869_100232140 3300005334 Bacteria 1466
29 Ga0068869_100299254 3300005334 Bacteria 1298
30 Ga0070666_10874327 3300005335 Bacteria 664
31 Ga0070680_100018180 3300005336 Bacteria 5552
32 Ga0070682_100006877 3300005337 Bacteria 6392
33 Ga0070682_100010912 3300005337 Bacteria 5176
34 Ga0070682_100053405 3300005337 Bacteria 2532
35 Ga0070682_100072014 3300005337 Bacteria 2214
36 Ga0070682_100319289 3300005337 Bacteria 1146
37 Ga0068868_100011827 3300005338 Bacteria 6363
38 Ga0068868_100030465 3300005338 Bacteria 4137
39 Ga0068868_100038418 3300005338 Bacteria 3716
40 Ga0068868_100180751 3300005338 Bacteria 1750
41 Ga0068868_100286935 3300005338 Bacteria 1394
42 Ga0068868_100335513 3300005338 Bacteria 1291
43 Ga0068868_100664699 3300005338 Bacteria 929
44 Ga0070660_100003349 3300005339 Bacteria 11013
45 Ga0070660_100085182 3300005339 Bacteria 2485
46 Ga0070660_100149944 3300005339 Bacteria 1874
47 Ga0070660_100583837 3300005339 Bacteria 933
48 Ga0070660_101198738 3300005339 Unclassified 644
49 Ga0070689_100072458 3300005340 Bacteria 2692
50 Ga0070689_100104231 3300005340 Bacteria 2249
51 Ga0070689_100110319 3300005340 Bacteria 2187
52 Ga0070691_10000980 3300005341 Bacteria 11656
53 Ga0070691_10038406 3300005341 Bacteria 2261
54 Ga0070691_10475037 3300005341 Unclassified 718
55 Ga0070691_10861312 3300005341 Unclassified 556
56 Ga0070687_100149689 3300005343 Bacteria 1369
57 Ga0070687_100166483 3300005343 Bacteria 1308
58 Ga0070687_100915669 3300005343 Bacteria 630
59 Ga0070661_100258984 3300005344 Bacteria 1344
60 Ga0070661_100594909 3300005344 Bacteria 894
61 Ga0070661_101168806 3300005344 Bacteria 643
62 Ga0070692_10000477 3300005345 Bacteria 12289
63 Ga0070692_10018946 3300005345 Bacteria 3316
64 Ga0070692_10224163 3300005345 Bacteria 1113
65 Ga0070692_11313316 3300005345 Unclassified 519
66 Ga0070668_100056380 3300005347 Bacteria 3035
67 Ga0070668_100240840 3300005347 Bacteria 1498
68 Ga0070669_100263907 3300005353 Bacteria 1375
69 Ga0070669_100272529 3300005353 Bacteria 1354
70 Ga0070669_100472844 3300005353 Bacteria 1036
71 Ga0070669_100501299 3300005353 Bacteria 1007
72 Ga0070675_100011418 3300005354 Bacteria 6952
73 Ga0070675_100185784 3300005354 Bacteria 1799
74 Ga0070675_100208373 3300005354 Bacteria 1698
75 Ga0070675_101157882 3300005354 Unclassified 712
76 Ga0070675_101489980 3300005354 Unclassified 624
77 Ga0070675_101794773 3300005354 Unclassified 566
78 Ga0070671_100026781 3300005355 Bacteria 4742
79 Ga0070674_100061968 3300005356 Bacteria 2612
80 Ga0070674_100068163 3300005356 Bacteria 2505
81 Ga0070674_100304854 3300005356 Bacteria 1271
82 Ga0070674_100371351 3300005356 Bacteria 1161
83 Ga0070674_100481096 3300005356 Bacteria 1030
84 Ga0070674_101199609 3300005356 Bacteria 674
85 Ga0070673_100022103 3300005364 Bacteria 4626
86 Ga0070673_100280376 3300005364 Bacteria 1462
87 Ga0070673_100804616 3300005364 Bacteria 868
88 Ga0070673_101714275 3300005364 Bacteria 595
89 Ga0070688_100020857 3300005365 Bacteria 3818
90 Ga0070688_100042250 3300005365 Bacteria 2803
91 Ga0070659_100002964 3300005366 Bacteria 12102
92 Ga0070659_100020779 3300005366 Bacteria 4992
93 Ga0070659_100026771 3300005366 Bacteria 4439
94 Ga0070659_100031619 3300005366 Bacteria 4100
95 Ga0070659_100233987 3300005366 Bacteria 1519
96 Ga0070667_101344063 3300005367 Bacteria 670
97 Ga0070714_100943578 3300005435 Bacteria 838
98 Ga0070701_10005589 3300005438 Bacteria 5207
99 Ga0070701_10021847 3300005438 Bacteria 3061
100 Ga0070705_100094654 3300005440 Bacteria 1871
101 Ga0070705_101411496 3300005440 Bacteria 581
102 Ga0070700_100029006 3300005441 Bacteria 3296
103 Ga0070700_100118197 3300005441 Bacteria 1772
104 Ga0070700_100131663 3300005441 Bacteria 1688
105 Ga0070700_100197878 3300005441 Bacteria 1410
106 Ga0070694_100094261 3300005444 Bacteria 2106
107 Ga0070708_100173014 3300005445 Bacteria 2017
108 Ga0070663_100045244 3300005455 Bacteria 3108
109 Ga0070663_100360685 3300005455 Bacteria 1179
110 Ga0070678_100156227 3300005456 Bacteria 1843
111 Ga0070678_100180491 3300005456 Bacteria 1727
112 Ga0070678_100297831 3300005456 Bacteria 1370
113 Ga0070678_100350880 3300005456 Bacteria 1268
114 Ga0070678_100484863 3300005456 Bacteria 1088
115 Ga0070678_100822689 3300005456 Bacteria 844
116 Ga0070678_100931040 3300005456 Bacteria 796
117 Ga0070678_101242866 3300005456 Bacteria 692
118 Ga0070678_101614861 3300005456 Bacteria 609
119 Ga0070662_100050553 3300005457 Bacteria 2999
120 Ga0070662_100130390 3300005457 Bacteria 1938
121 Ga0070662_100587593 3300005457 Unclassified 936
122 Ga0070662_101006480 3300005457 Unclassified 713
123 Ga0070681_10002072 3300005458 Bacteria 18196
124 Ga0070681_10067466 3300005458 Bacteria 3545
125 Ga0070681_10366609 3300005458 Bacteria 1351
126 Ga0070681_10731612 3300005458 Bacteria 905
127 Ga0068867_100040464 3300005459 Bacteria 3402
128 Ga0068867_100048358 3300005459 Bacteria 3129
129 Ga0068867_100667411 3300005459 Bacteria 914
130 Ga0070685_10026332 3300005466 Bacteria 3205
131 Ga0070685_10094771 3300005466 Bacteria 1813
132 Ga0070685_11302785 3300005466 Unclassified 555
133 Ga0070698_100877886 3300005471 Bacteria 842
134 Ga0070679_100208004 3300005530 Bacteria 1921
135 Ga0070679_100472387 3300005530 Bacteria 1198
136 Ga0070679_100975113 3300005530 Bacteria 791
137 Ga0070684_100007151 3300005535 Bacteria 8672
138 Ga0070684_100050026 3300005535 Bacteria 3629
139 Ga0070684_100069280 3300005535 Bacteria 3103
140 Ga0070684_100281922 3300005535 Bacteria 1522
141 Ga0070684_100396754 3300005535 Bacteria 1272
142 Ga0070684_100515132 3300005535 Bacteria 1108
143 Ga0070684_100571830 3300005535 Bacteria 1050
144 Ga0070684_100581556 3300005535 Bacteria 1040
145 Ga0070684_101453379 3300005535 Unclassified 646
146 Ga0070684_101857343 3300005535 Unclassified 568
147 Ga0068853_100004912 3300005539 Bacteria 10408
148 Ga0068853_100009437 3300005539 Bacteria 7862
149 Ga0068853_100396668 3300005539 Bacteria 1291
150 Ga0068853_101679536 3300005539 Bacteria 616
151 Ga0068853_102482659 3300005539 Bacteria 502
152 Ga0070672_100004959 3300005543 Bacteria 8762
153 Ga0070672_100022319 3300005543 Bacteria 4648
154 Ga0070672_100029322 3300005543 Bacteria 4125
155 Ga0070672_100300688 3300005543 Bacteria 1360
156 Ga0070672_100950821 3300005543 Unclassified 760
157 Ga0070686_100006012 3300005544 Bacteria 6737
158 Ga0070686_100075322 3300005544 Bacteria 2219
159 Ga0070686_100391149 3300005544 Unclassified 1055
160 Ga0070696_100183811 3300005546 Bacteria 1552
161 Ga0070696_100510295 3300005546 Bacteria 958
162 Ga0070696_101321399 3300005546 Unclassified 613
163 Ga0070693_100134038 3300005547 Bacteria 1552
164 Ga0070693_100624259 3300005547 Bacteria 781
165 Ga0070665_100025371 3300005548 Bacteria 5973
166 Ga0070665_100222402 3300005548 Bacteria 1888
167 Ga0070665_100556369 3300005548 Bacteria 1159
168 Ga0070665_101988384 3300005548 Bacteria 587
169 Ga0070704_100022573 3300005549 Bacteria 4098
170 Ga0070704_100623963 3300005549 Bacteria 949
171 Ga0068855_100047253 3300005563 Bacteria 5085
172 Ga0068855_100606283 3300005563 Bacteria 1180
173 Ga0068855_100994228 3300005563 Bacteria 882
174 Ga0068855_101162895 3300005563 Bacteria 804
175 Ga0068855_101962998 3300005563 Bacteria 592
176 Ga0070664_100006431 3300005564 Bacteria 9478
177 Ga0070664_100148507 3300005564 Bacteria 2068
178 Ga0070664_100216847 3300005564 Bacteria 1711
179 Ga0070664_100337635 3300005564 Bacteria 1368
180 Ga0070664_100789400 3300005564 Bacteria 887
181 Ga0068857_100389205 3300005577 Bacteria 1296
182 Ga0068857_100822508 3300005577 Bacteria 888
183 Ga0068857_101515383 3300005577 Bacteria 653
184 Ga0068857_101524848 3300005577 Bacteria 651
185 Ga0068857_102166955 3300005577 Bacteria 545
186 Ga0068854_100003631 3300005578 Bacteria 9657
187 Ga0068854_100047594 3300005578 Bacteria 3057
188 Ga0068854_100136767 3300005578 Bacteria 1876
189 Ga0068854_100137616 3300005578 Bacteria 1871
190 Ga0068854_100462633 3300005578 Bacteria 1062
191 Ga0068856_100048087 3300005614 Bacteria 4202
192 Ga0068856_100343764 3300005614 Bacteria 1510
193 Ga0068856_100524345 3300005614 Bacteria 1206
194 Ga0070702_100084711 3300005615 Bacteria 1907
195 Ga0070702_100319036 3300005615 Bacteria 1082
196 Ga0070702_100612026 3300005615 Bacteria 818
197 Ga0070702_100897223 3300005615 Bacteria 694
198 Ga0068852_100007514 3300005616 Bacteria 7957
199 Ga0068852_100054355 3300005616 Bacteria 3451
200 Ga0068852_100057069 3300005616 Bacteria 3377
201 Ga0068852_100352319 3300005616 Bacteria 1438
202 Ga0068852_100527587 3300005616 Bacteria 1179
203 Ga0068852_100889232 3300005616 Bacteria 907
204 Ga0068859_100157554 3300005617 Bacteria 2348
205 Ga0068859_101542097 3300005617 Bacteria 734
206 Ga0068864_100118253 3300005618 Bacteria 2366
207 Ga0068864_100216304 3300005618 Bacteria 1766
208 Ga0068864_102383574 3300005618 Unclassified 535
209 Ga0068866_10120722 3300005718 Bacteria 1476
210 Ga0068866_10164880 3300005718 Bacteria 1295
211 Ga0068866_10373102 3300005718 Bacteria 913
212 Ga0068866_10459000 3300005718 Bacteria 835
213 Ga0068866_10563461 3300005718 Bacteria 764
214 Ga0068866_10568960 3300005718 Bacteria 760
215 Ga0068866_10594368 3300005718 Bacteria 746
216 Ga0068861_100032453 3300005719 Bacteria 3844
217 Ga0068861_100214674 3300005719 Bacteria 1622
218 Ga0068861_100265831 3300005719 Bacteria 1471
219 Ga0068861_100746821 3300005719 Bacteria 914
220 Ga0068851_10111038 3300005834 Bacteria 1463
221 Ga0068851_10167962 3300005834 Bacteria 1209
222 Ga0068870_10028157 3300005840 Bacteria 2818
223 Ga0068870_10341515 3300005840 Bacteria 958
224 Ga0068863_100781526 3300005841 Bacteria 952
225 Ga0068858_100058586 3300005842 Bacteria 3562
226 Ga0068858_100624962 3300005842 Bacteria 1046
227 Ga0068858_101832014 3300005842 Bacteria 599
228 Ga0068860_100159255 3300005843 Bacteria 2176
229 Ga0068860_100535839 3300005843 Bacteria 1172
230 Ga0081455_10911023 3300005937 Bacteria 546
231 Ga0081539_10001549 3300005985 Bacteria 38322
232 Ga0081539_10109064 3300005985 Bacteria 1397
233 Ga0070717_10088475 3300006028 Bacteria 2610
234 Ga0075365_10326889 3300006038 Bacteria 1080
235 Ga0075432_10002049 3300006058 Bacteria 6703
236 Ga0097621_100107927 3300006237 Bacteria 2350
237 Ga0097621_100119480 3300006237 Bacteria 2234
238 Ga0097621_101296766 3300006237 Bacteria 688
239 Ga0097621_101788053 3300006237 Bacteria 586
240 Ga0068871_101319170 3300006358 Bacteria 679
241 Ga0068871_101487195 3300006358 Unclassified 640
242 Ga0075428_100004576 3300006844 Bacteria 15296
243 Ga0075428_100501474 3300006844 Bacteria 1299
244 Ga0075428_100770776 3300006844 Unclassified 1023
245 Ga0075431_101309827 3300006847 Bacteria 685
246 Ga0075433_10037639 3300006852 Bacteria 4174
247 Ga0075433_10608600 3300006852 Unclassified 959
248 Ga0075434_100006726 3300006871 Bacteria 10564
249 Ga0075434_100837205 3300006871 Bacteria 936
250 Ga0075429_100009096 3300006880 Bacteria 8626
251 Ga0068865_100002718 3300006881 Bacteria 10501
252 Ga0068865_100016943 3300006881 Bacteria 4675
253 Ga0068865_100046880 3300006881 Bacteria 2967
254 Ga0068865_100082195 3300006881 Bacteria 2315
255 Ga0068865_100111307 3300006881 Bacteria 2020
256 Ga0068865_101127271 3300006881 Bacteria 692
257 Ga0097620_100157559 3300006931 Bacteria 2348
258 Ga0097620_101541996 3300006931 Bacteria 734
259 Ga0075435_100048596 3300007076 Bacteria 3409
260 Ga0075435_100069936 3300007076 Bacteria 2864
261 Ga0099794_10000307 3300007265 Bacteria 16696
262 Ga0105251_10124016 3300009011 Bacteria 1173
263 Ga0105240_12473632 3300009093 Bacteria 537
264 Ga0111539_10008396 3300009094 Bacteria 13142
265 Ga0111539_10056574 3300009094 Bacteria 4661
266 Ga0111539_10330305 3300009094 Bacteria 1775
267 Ga0111539_10359368 3300009094 Bacteria 1695
268 Ga0111539_10557635 3300009094 Bacteria 1334
269 Ga0111539_10625196 3300009094 Bacteria 1254
270 Ga0111539_10836169 3300009094 Bacteria 1071
271 Ga0105245_10009579 3300009098 Bacteria 8450
272 Ga0105245_10027685 3300009098 Bacteria 4994
273 Ga0105245_10077600 3300009098 Bacteria 3029
274 Ga0105245_10259436 3300009098 Bacteria 1691
275 Ga0105245_10456665 3300009098 Bacteria 1287
276 Ga0105245_10566406 3300009098 Bacteria 1159
277 Ga0105245_10749425 3300009098 Bacteria 1012
278 Ga0105245_10872505 3300009098 Unclassified 941
279 Ga0105245_11147490 3300009098 Unclassified 824
280 Ga0105245_11852785 3300009098 Bacteria 656
281 Ga0105247_10008745 3300009101 Bacteria 6179
282 Ga0105247_10798906 3300009101 Bacteria 720
283 Ga0105247_11242169 3300009101 Bacteria 595
284 Ga0114129_10137571 3300009147 Bacteria 3351
285 Ga0114129_10944225 3300009147 Bacteria 1090
286 Ga0114129_12486249 3300009147 Bacteria 619
287 Ga0105243_10002349 3300009148 Bacteria 15832
288 Ga0105243_10021154 3300009148 Bacteria 4937
289 Ga0105243_10245021 3300009148 Bacteria 1597
290 Ga0105243_10394576 3300009148 Bacteria 1284
291 Ga0105243_11021514 3300009148 Unclassified 831
292 Ga0105243_12393996 3300009148 Bacteria 566
293 Ga0105243_12550490 3300009148 Bacteria 551
294 Ga0105241_10134873 3300009174 Bacteria 2003
295 Ga0105241_10320466 3300009174 Bacteria 1336
296 Ga0105241_10439146 3300009174 Bacteria 1152
297 Ga0105242_10007255 3300009176 Bacteria 8548
298 Ga0105242_10440583 3300009176 Bacteria 1226
299 Ga0105242_10449144 3300009176 Unclassified 1215
300 Ga0105242_10502154 3300009176 Bacteria 1154
301 Ga0105242_10537817 3300009176 Bacteria 1118
302 Ga0105242_10540867 3300009176 Bacteria 1115
303 Ga0105248_10118683 3300009177 Bacteria 2984
304 Ga0105248_10527291 3300009177 Bacteria 1332
305 Ga0105248_10665810 3300009177 Bacteria 1174
306 Ga0105248_11063412 3300009177 Bacteria 914
307 Ga0105248_11615840 3300009177 Bacteria 734
308 Ga0105237_10138812 3300009545 Bacteria 2425
309 Ga0105237_10556985 3300009545 Bacteria 1153
310 Ga0105237_11251884 3300009545 Unclassified 748
311 Ga0105238_10013752 3300009551 Bacteria 8179
312 Ga0105238_10140061 3300009551 Bacteria 2396
313 Ga0105238_10431207 3300009551 Bacteria 1314
314 Ga0105238_11143762 3300009551 Unclassified 802
315 Ga0105249_10087271 3300009553 Bacteria 2911
316 Ga0105249_10156124 3300009553 Bacteria 2201
317 Ga0105249_10460894 3300009553 Bacteria 1311
318 Ga0105249_10586938 3300009553 Bacteria 1168
319 Ga0105249_10868213 3300009553 Bacteria 968
320 Ga0105239_10114244 3300010375 Bacteria 2995
321 Ga0105239_10141718 3300010375 Bacteria 2679
322 Ga0105239_10158213 3300010375 Bacteria 2531
323 Ga0105239_10166053 3300010375 Bacteria 2468
324 Ga0105239_11425876 3300010375 Bacteria 800
325 Ga0105246_10007974 3300011119 Bacteria 6500
326 Ga0105246_10040527 3300011119 Bacteria 3144
327 Ga0105246_10439364 3300011119 Bacteria 1094
328 Ga0105246_10872382 3300011119 Unclassified 805
329 Ga0105246_11583657 3300011119 Bacteria 618
330 Ga0157319_1009125 3300012497 Bacteria 774
331 Ga0157338_1028621 3300012515 Bacteria 697
332 Ga0157373_11426740 3300013100 Unclassified 527
333 Ga0157371_10095050 3300013102 Bacteria 2112
334 Ga0157371_10131099 3300013102 Bacteria 1783
335 Ga0157370_10056428 3300013104 Bacteria 3738
336 Ga0157370_10540706 3300013104 Bacteria 1068
337 Ga0157369_10023164 3300013105 Bacteria 6918
338 Ga0157369_10082680 3300013105 Bacteria 3435
339 Ga0157369_10232236 3300013105 Bacteria 1928
340 Ga0157369_10622670 3300013105 Bacteria 1113
341 Ga0157369_11864152 3300013105 Bacteria 610
342 Ga0157374_10265013 3300013296 Bacteria 1693
343 Ga0157374_10613779 3300013296 Bacteria 1098
344 Ga0157374_12432637 3300013296 Bacteria 551
345 Ga0157378_10327084 3300013297 Bacteria 1491
346 Ga0157378_10976063 3300013297 Bacteria 881
347 Ga0157378_12939382 3300013297 Bacteria 528
348 Ga0163162_10199870 3300013306 Bacteria 2128
349 Ga0163162_10237364 3300013306 Bacteria 1954
350 Ga0163162_10889346 3300013306 Bacteria 1004
351 Ga0163162_11252932 3300013306 Unclassified 842
352 Ga0157372_10080529 3300013307 Bacteria 3685
353 Ga0157372_10446894 3300013307 Bacteria 1507
354 Ga0157372_10539285 3300013307 Bacteria 1360
355 Ga0157372_10572869 3300013307 Bacteria 1316
356 Ga0157375_10011579 3300013308 Bacteria 7792
357 Ga0157375_10041949 3300013308 Bacteria 4423
358 Ga0157375_10607593 3300013308 Bacteria 1252
359 Ga0157375_10695520 3300013308 Bacteria 1171
360 Ga0163163_10065425 3300014325 Bacteria 3609
361 Ga0163163_10264117 3300014325 Bacteria 1772
362 Ga0163163_11893635 3300014325 Unclassified 656
363 Ga0157380_10015681 3300014326 Bacteria 5571
364 Ga0157380_10049173 3300014326 Bacteria 3324
365 Ga0157380_10084589 3300014326 Bacteria 2601
366 Ga0157380_10695781 3300014326 Bacteria 1021
367 Ga0157380_11132031 3300014326 Bacteria 823
368 Ga0157377_10010972 3300014745 Bacteria 4505
369 Ga0157377_10019262 3300014745 Bacteria 3563
370 Ga0157377_10049273 3300014745 Bacteria 2367
371 Ga0157377_10075820 3300014745 Bacteria 1954
372 Ga0157377_10545471 3300014745 Unclassified 818
373 Ga0157377_10650445 3300014745 Bacteria 759
374 Ga0157377_10741826 3300014745 Bacteria 718
375 Ga0157377_11137711 3300014745 Bacteria 600
376 Ga0157379_10162091 3300014968 Bacteria 2018
377 Ga0157379_10213578 3300014968 Bacteria 1747
378 Ga0157379_10344908 3300014968 Bacteria 1363
379 Ga0157379_12038782 3300014968 Bacteria 568
380 Ga0157379_12049376 3300014968 Bacteria 566
381 Ga0157376_10097055 3300014969 Bacteria 2566
382 Ga0157376_10201439 3300014969 Bacteria 1832
383 Ga0157376_10292296 3300014969 Bacteria 1539
384 Ga0163161_10111553 3300017792 Bacteria 2045
385 Ga0163161_10456649 3300017792 Bacteria 1033
386 Ga0206356_11069134 3300020070 Bacteria 1126
387 Ga0206353_10319247 3300020082 Bacteria 771
388 Ga0206353_10919167 3300020082 Bacteria 2019
389 Ga0206353_12054229 3300020082 Bacteria 611
390 Ga0207697_10223013 3300025315 Bacteria 832
391 Ga0207682_10266903 3300025893 Bacteria 799
392 Ga0207692_10000336 3300025898 Bacteria 16286
393 Ga0207642_10164885 3300025899 Bacteria 1193
394 Ga0207642_10248761 3300025899 Bacteria 1008
395 Ga0207642_10340074 3300025899 Bacteria 882
396 Ga0207642_10387551 3300025899 Unclassified 833
397 Ga0207642_10647204 3300025899 Unclassified 662
398 Ga0207688_10002702 3300025901 Bacteria 9605
399 Ga0207688_10005424 3300025901 Bacteria 6934
400 Ga0207688_10038105 3300025901 Bacteria 2667
401 Ga0207688_10059564 3300025901 Bacteria 2150
402 Ga0207688_10195994 3300025901 Bacteria 1210
403 Ga0207645_10039118 3300025907 Bacteria 3039
404 Ga0207645_10210791 3300025907 Bacteria 1280
405 Ga0207645_10332757 3300025907 Unclassified 1014
406 Ga0207643_10015561 3300025908 Bacteria 4142
407 Ga0207643_10070140 3300025908 Bacteria 2015
408 Ga0207643_10107242 3300025908 Bacteria 1642
409 Ga0207705_10020346 3300025909 Bacteria 4745
410 Ga0207705_11158972 3300025909 Bacteria 594
411 Ga0207654_10081749 3300025911 Bacteria 1946
412 Ga0207654_10359371 3300025911 Bacteria 1004
413 Ga0207707_10057939 3300025912 Bacteria 3372
414 Ga0207707_10170265 3300025912 Bacteria 1903
415 Ga0207707_10807397 3300025912 Bacteria 781
416 Ga0207707_11300126 3300025912 Unclassified 584
417 Ga0207671_10577271 3300025914 Bacteria 896
418 Ga0207671_10796994 3300025914 Bacteria 749
419 Ga0207671_10934872 3300025914 Unclassified 685
420 Ga0207660_10057827 3300025917 Bacteria 2778
421 Ga0207662_10015924 3300025918 Bacteria 4236
422 Ga0207662_10033120 3300025918 Bacteria 3010
423 Ga0207662_10073238 3300025918 Bacteria 2077
424 Ga0207662_11225371 3300025918 Bacteria 533
425 Ga0207657_10004668 3300025919 Bacteria 14470
426 Ga0207657_10117075 3300025919 Bacteria 2195
427 Ga0207657_10167145 3300025919 Bacteria 1784
428 Ga0207657_10390611 3300025919 Bacteria 1095
429 Ga0207657_10498022 3300025919 Bacteria 954
430 Ga0207657_10680583 3300025919 Bacteria 800
431 Ga0207649_10603809 3300025920 Bacteria 844
432 Ga0207649_10659850 3300025920 Bacteria 809
433 Ga0207649_10814686 3300025920 Bacteria 729
434 Ga0207649_10959519 3300025920 Unclassified 672
435 Ga0207652_10018886 3300025921 Bacteria 5659
436 Ga0207652_10147014 3300025921 Bacteria 2110
437 Ga0207652_10488995 3300025921 Bacteria 1108
438 Ga0207681_10498960 3300025923 Bacteria 996
439 Ga0207681_10810326 3300025923 Bacteria 782
440 Ga0207681_10892380 3300025923 Bacteria 744
441 Ga0207694_10022103 3300025924 Bacteria 4823
442 Ga0207694_10081387 3300025924 Bacteria 2544
443 Ga0207694_10408822 3300025924 Bacteria 1129
444 Ga0207694_10937516 3300025924 Unclassified 732
445 Ga0207650_10508265 3300025925 Bacteria 1007
446 Ga0207650_11313275 3300025925 Bacteria 616
447 Ga0207650_11533356 3300025925 Bacteria 566
448 Ga0207659_10129452 3300025926 Bacteria 1946
449 Ga0207659_10455277 3300025926 Bacteria 1078
450 Ga0207659_10573477 3300025926 Bacteria 960
451 Ga0207659_10631930 3300025926 Bacteria 914
452 Ga0207687_10029484 3300025927 Bacteria 3692
453 Ga0207687_10071190 3300025927 Bacteria 2484
454 Ga0207687_10150820 3300025927 Bacteria 1774
455 Ga0207687_10164047 3300025927 Bacteria 1708
456 Ga0207687_10199333 3300025927 Bacteria 1563
457 Ga0207687_10355760 3300025927 Bacteria 1194
458 Ga0207687_10398627 3300025927 Bacteria 1131
459 Ga0207687_10477414 3300025927 Bacteria 1038
460 Ga0207664_10467620 3300025929 Bacteria 1127
461 Ga0207644_10229331 3300025931 Bacteria 1475
462 Ga0207690_10004794 3300025932 Bacteria 7980
463 Ga0207690_10087404 3300025932 Bacteria 2193
464 Ga0207690_10171411 3300025932 Bacteria 1626
465 Ga0207690_10448369 3300025932 Bacteria 1037
466 Ga0207706_10017578 3300025933 Bacteria 6443
467 Ga0207706_10024437 3300025933 Bacteria 5417
468 Ga0207706_10075771 3300025933 Bacteria 2959
469 Ga0207706_10169364 3300025933 Bacteria 1919
470 Ga0207686_10522428 3300025934 Bacteria 924
471 Ga0207709_10006589 3300025935 Bacteria 6520
472 Ga0207709_10024537 3300025935 Bacteria 3444
473 Ga0207709_10034083 3300025935 Bacteria 2998
474 Ga0207709_10174636 3300025935 Bacteria 1511
475 Ga0207670_10013623 3300025936 Bacteria 4800
476 Ga0207670_10173642 3300025936 Bacteria 1618
477 Ga0207670_11392304 3300025936 Unclassified 595
478 Ga0207669_10027065 3300025937 Bacteria 3131
479 Ga0207669_10172756 3300025937 Bacteria 1540
480 Ga0207669_10275657 3300025937 Bacteria 1266
481 Ga0207669_10281319 3300025937 Bacteria 1255
482 Ga0207669_10334146 3300025937 Bacteria 1164
483 Ga0207669_11162982 3300025937 Unclassified 653
484 Ga0207704_10055971 3300025938 Bacteria 2413
485 Ga0207704_10110245 3300025938 Bacteria 1858
486 Ga0207704_10154177 3300025938 Bacteria 1625
487 Ga0207704_11153470 3300025938 Bacteria 660
488 Ga0207691_10006179 3300025940 Bacteria 11573
489 Ga0207691_10012070 3300025940 Bacteria 8287
490 Ga0207691_10056012 3300025940 Bacteria 3593
491 Ga0207691_10360396 3300025940 Bacteria 1243
492 Ga0207691_11314379 3300025940 Bacteria 597
493 Ga0207711_10048669 3300025941 Bacteria 3627
494 Ga0207711_10054697 3300025941 Bacteria 3426
495 Ga0207711_10726207 3300025941 Bacteria 926
496 Ga0207689_10087402 3300025942 Bacteria 2561
497 Ga0207689_10384423 3300025942 Bacteria 1169
498 Ga0207689_10420132 3300025942 Bacteria 1116
499 Ga0207689_10642372 3300025942 Bacteria 894
500 Ga0207689_10741218 3300025942 Bacteria 829
501 Ga0207661_10001401 3300025944 Bacteria 16231
502 Ga0207661_10004390 3300025944 Bacteria 9888
503 Ga0207661_10012644 3300025944 Bacteria 6144
504 Ga0207661_10025210 3300025944 Bacteria 4519
505 Ga0207661_10154472 3300025944 Bacteria 1986
506 Ga0207661_10608626 3300025944 Unclassified 1003
507 Ga0207661_11218200 3300025944 Bacteria 692
508 Ga0207661_11617560 3300025944 Bacteria 593
509 Ga0207679_10015649 3300025945 Bacteria 5018
510 Ga0207679_10370168 3300025945 Bacteria 1254
511 Ga0207679_10858718 3300025945 Bacteria 829
512 Ga0207679_11569902 3300025945 Bacteria 603
513 Ga0207667_10509059 3300025949 Bacteria 1220
514 Ga0207667_10687394 3300025949 Bacteria 1026
515 Ga0207667_11466221 3300025949 Bacteria 654
516 Ga0207651_10802156 3300025960 Bacteria 835
517 Ga0207651_11377418 3300025960 Bacteria 635
518 Ga0207712_10296749 3300025961 Bacteria 1325
519 Ga0207712_10436167 3300025961 Bacteria 1108
520 Ga0207668_10086315 3300025972 Bacteria 2292
521 Ga0207668_11097865 3300025972 Unclassified 713
522 Ga0207668_11642329 3300025972 Unclassified 580
523 Ga0207640_10013470 3300025981 Bacteria 4689
524 Ga0207640_10028329 3300025981 Bacteria 3424
525 Ga0207640_10055471 3300025981 Bacteria 2596
526 Ga0207658_10156723 3300025986 Bacteria 1862
527 Ga0207658_10486961 3300025986 Bacteria 1097
528 Ga0207677_10029362 3300026023 Bacteria 3493
529 Ga0207677_10411424 3300026023 Bacteria 1149
530 Ga0207677_10478502 3300026023 Bacteria 1072
531 Ga0207703_10881702 3300026035 Bacteria 856
532 Ga0207703_11438066 3300026035 Unclassified 663
533 Ga0207639_10004159 3300026041 Bacteria 9743
534 Ga0207639_10020326 3300026041 Bacteria 4751
535 Ga0207639_10424051 3300026041 Bacteria 1203
536 Ga0207639_11126765 3300026041 Bacteria 736
537 Ga0207639_11391708 3300026041 Bacteria 658
538 Ga0207678_10026025 3300026067 Bacteria 5105
539 Ga0207678_10098282 3300026067 Bacteria 2501
540 Ga0207678_10234121 3300026067 Bacteria 1573
541 Ga0207678_10261434 3300026067 Bacteria 1483
542 Ga0207678_11215736 3300026067 Bacteria 667
543 Ga0207708_10043433 3300026075 Bacteria 3425
544 Ga0207708_10088736 3300026075 Bacteria 2382
545 Ga0207708_10110674 3300026075 Bacteria 2131
546 Ga0207708_10431179 3300026075 Bacteria 1095
547 Ga0207702_10045257 3300026078 Bacteria 3702
548 Ga0207702_10292185 3300026078 Bacteria 1544
549 Ga0207702_10889572 3300026078 Bacteria 882
550 Ga0207641_10681284 3300026088 Bacteria 1011
551 Ga0207641_12160407 3300026088 Bacteria 557
552 Ga0207648_10019875 3300026089 Bacteria 6062
553 Ga0207648_10053732 3300026089 Bacteria 3520
554 Ga0207648_10093417 3300026089 Bacteria 2631
555 Ga0207648_10206627 3300026089 Bacteria 1743
556 Ga0207648_10714125 3300026089 Bacteria 929
557 Ga0207676_10335445 3300026095 Bacteria 1393
558 Ga0207676_10490247 3300026095 Unclassified 1165
559 Ga0207676_11169623 3300026095 Unclassified 762
560 Ga0207676_11811258 3300026095 Bacteria 609
561 Ga0207674_10054243 3300026116 Bacteria 4081
562 Ga0207674_10080542 3300026116 Bacteria 3259
563 Ga0207674_10244465 3300026116 Bacteria 1741
564 Ga0207674_10257311 3300026116 Bacteria 1693
565 Ga0207675_100034122 3300026118 Bacteria 4743
566 Ga0207675_100098962 3300026118 Bacteria 2747
567 Ga0207675_101001052 3300026118 Bacteria 854
568 Ga0207683_10039661 3300026121 Bacteria 4109
569 Ga0207683_10047754 3300026121 Bacteria 3748
570 Ga0207683_10138197 3300026121 Bacteria 2194
571 Ga0207683_10143088 3300026121 Bacteria 2155
572 Ga0207683_10185004 3300026121 Bacteria 1890
573 Ga0207683_10187701 3300026121 Bacteria 1876
574 Ga0207683_10811651 3300026121 Bacteria 868
575 Ga0207683_10880247 3300026121 Bacteria 831
576 Ga0207683_11340645 3300026121 Bacteria 662
577 Ga0207683_11721044 3300026121 Bacteria 576
578 Ga0207698_10003693 3300026142 Bacteria 9257
579 Ga0207698_10011159 3300026142 Bacteria 5812
580 Ga0207698_10331098 3300026142 Bacteria 1430
581 Ga0207698_10777415 3300026142 Bacteria 958
582 Ga0207428_10000196 3300027907 Bacteria 84609
583 Ga0207428_10232024 3300027907 Bacteria 1381
584 Ga0207428_10592126 3300027907 Unclassified 800
585 Ga0268266_10089805 3300028379 Bacteria 2691
586 Ga0268266_10133796 3300028379 Bacteria 2219
587 Ga0268266_10316417 3300028379 Bacteria 1460
588 Ga0268266_10757020 3300028379 Bacteria 937
589 Ga0268266_11899865 3300028379 Bacteria 569
590 Ga0268266_11935240 3300028379 Unclassified 563
591 Ga0268265_11048751 3300028380 Bacteria 807
592 Ga0268265_11250514 3300028380 Unclassified 741
593 Ga0268264_10140772 3300028381 Bacteria 2151
594 Ga0268264_11133242 3300028381 Bacteria 791
595 Ga0268264_12312786 3300028381 Unclassified 544
596 Ga0265338_10012358 3300028800 Bacteria 9737
597 Ga0265338_10195170 3300028800 Bacteria 1531
598 Ga0307511_10000068 3300030521 Bacteria 85766
599 Ga0265320_10022250 3300031240 Bacteria 3394
600 Ga0265325_10015123 3300031241 Bacteria 4347
601 Ga0265340_10020367 3300031247 Bacteria 3409
602 Ga0265339_10004305 3300031249 Bacteria 9738
603 Ga0265313_10011970 3300031595 Bacteria 5348
604 Ga0265342_10058329 3300031712 Bacteria 2282
605 Ga0316576_10327874 3300031727 Bacteria 1141
606 Ga0316578_10118144 3300031728 Bacteria 1593
607 Ga0307413_10093700 3300031824 Bacteria 1964
608 Ga0307410_10125557 3300031852 Bacteria 1878
609 Ga0307407_10055129 3300031903 Bacteria 2296
610 Ga0307409_100098887 3300031995 Bacteria 2414
611 Ga0307416_101240234 3300032002 Bacteria 851
612 Ga0316588_1000278 3300033528 Bacteria 6330
613 Ga0316596_1000488 3300033541 Bacteria 6746
614 Ga0373948_0087443 3300034817 Unclassified 719
615 Ga0373959_0083744 3300034820 Bacteria 738
616 Ga0373938_0043793 3300034957 Bacteria 1002
617 Ga0373949_0068539 3300035090 Bacteria 925
618 Ga0373932_0372529 3300035112 Unclassified 547
619 Ga0373939_0365268 3300035114 Bacteria 591
620 Ga0373941_0179771 3300035115 Bacteria 793
621 Ga0373941_0219513 3300035115 Unclassified 730
622 Ga0373956_0006542 3300035119 Bacteria 4668
623 Ga0373960_0019883 3300035121 Bacteria 1770
624 Ga0373960_0150787 3300035121 Bacteria 794
625 Ga0373961_0075960 3300035241 Bacteria 1048
626 Ga0373962_0160680 3300035242 Unclassified 741
627 Ga0373931_0373197 3300035691 Unclassified 897
628 Ga0395900_0042570 3300037418 Bacteria 4680
629 Ga0395900_0242836 3300037418 Bacteria 1806
630 Ga0395900_0332171 3300037418 Bacteria 1498
631 Ga0395898_0005829 3300037466 Bacteria 13257
632 Ga0395898_0198473 3300037466 Bacteria 1916
633 Ga0395898_0249307 3300037466 Bacteria 1694
634 Ga0395898_0394653 3300037466 Bacteria 1319
635 Ga0395898_0432360 3300037466 Unclassified 1254
636 Ga0395905_0110050 3300037471 Bacteria 2587
637 Ga0395901_0002259 3300038443 Bacteria 19671
638 Ga0395901_0178479 3300038443 Bacteria 2227
639 Ga0395901_1135316 3300038443 Bacteria 750
640 Ga0436365_0958401 3300039437 Bacteria 2340
641 Ga0451797_0123153 3300041453 Bacteria 808
642 Ga0451802_0445110 3300041460 Unclassified 511
643 Ga0451837_1044833 3300041494 Bacteria 1998
644 Ga0451845_0171825 3300041501 Bacteria 1716
645 Ga0451851_0313660 3300041507 Bacteria 1259
646 Ga0451843_1748667 3300041509 Bacteria 876
647 Ga0451853_3587584 3300041512 Bacteria 2492
648 Ga0450911_018118 3300042115 Bacteria 925
649 Ga0450906_009617 3300042145 Bacteria 1840
650 Ga0450907_004935 3300042146 Bacteria 2270
651 Ga0466969_0001566 3300044656 Bacteria 12258
652 Ga0466965_0640734 3300044683 Bacteria 606
653 Ga0466966_0002535 3300044684 Bacteria 11959
654 Ga0466961_0019309 3300044693 Bacteria 4385
655 Ga0466961_0052937 3300044693 Bacteria 2591
656 Ga0466963_0804115 3300044694 Bacteria 663
657 Ga0466963_1234974 3300044694 Bacteria 525
658 Ga0466964_0105995 3300044706 Bacteria 1246
659 Ga0466964_0339486 3300044706 Bacteria 769
660 Ga0466971_0222972 3300044719 Bacteria 894
661 Ga0466970_0161823 3300044765 Bacteria 1238
662 Ga0466960_0174647 3300044901 Bacteria 1161
663 Ga0466959_0006446 3300045049 Bacteria 8125
664 Ga0466967_0003830 3300045976 Bacteria 9956
665 Ga0466967_1278515 3300045976 Bacteria 731
666 Ga0495603_0008050 3300046455 Bacteria 6369
667 Ga0495603_0018293 3300046455 Bacteria 4239
668 Ga0495629_0865506 3300046459 Bacteria 594
669 Ga0495641_0427403 3300046461 Bacteria 602
670 Ga0495651_0695531 3300046462 Bacteria 634
671 Ga0495653_0225794 3300046463 Bacteria 1256
672 Ga0495582_0253928 3300046473 Unclassified 1008
673 Ga0495639_0297137 3300046475 Bacteria 805
674 Ga0495583_0390834 3300046506 Unclassified 547
675 Ga0495628_1108876 3300046516 Bacteria 540
676 Ga0495630_0107299 3300046517 Bacteria 2115
677 Ga0495631_0181831 3300046518 Bacteria 901
678 Ga0495637_0055098 3300046520 Bacteria 1650
679 Ga0495587_0604946 3300046536 Bacteria 603
680 Ga0495645_0709373 3300046543 Bacteria 610
681 Ga0495622_0132942 3300046557 Bacteria 1132
682 Ga0495656_0090950 3300046615 Unclassified 1395
683 Ga0495656_0190111 3300046615 Unclassified 1014
684 Ga0495634_0346448 3300046642 Bacteria 890
685 Ga0495647_0252370 3300046681 Bacteria 786
686 Ga0495670_0263485 3300046691 Bacteria 920
687 Ga0495670_0509520 3300046691 Unclassified 654
688 Ga0495671_0120055 3300046692 Bacteria 1283
689 Ga0495589_0279937 3300046794 Bacteria 776
690 Ga0495589_0366741 3300046794 Unclassified 663
691 Ga0495604_0126955 3300047317 Bacteria 1838
692 Ga0495674_0197470 3300047319 Bacteria 1670
693 Ga0495672_0000834 3300047320 Bacteria 32942
694 Ga0495676_0099533 3300047321 Bacteria 2155
695 Ga0495676_0485329 3300047321 Bacteria 812
696 Ga0495683_0392238 3300047323 Unclassified 579
697 Ga0495677_0010463 3300047445 Bacteria 3407
698 Ga0495673_0207062 3300047469 Bacteria 731
699 Ga0495602_0121209 3300048088 Bacteria 2104
700 Ga0496100_0055538 3300048903 Bacteria 2588
701 Ga0496100_0413259 3300048903 Bacteria 1029
702 Ga0496100_0517865 3300048903 Unclassified 920
703 Ga0496100_0556357 3300048903 Bacteria 888
704 Ga0496100_0666481 3300048903 Bacteria 811
705 Ga0496100_1484140 3300048903 Unclassified 535
706 Ga0496101_0045796 3300048904 Bacteria 3135
707 Ga0496101_0138593 3300048904 Bacteria 1853
708 Ga0496101_0215438 3300048904 Bacteria 1489
709 Ga0496101_0236364 3300048904 Bacteria 1421
710 Ga0496101_1190444 3300048904 Bacteria 597
711 Ga0496101_1410486 3300048904 Unclassified 543
712 Ga0496102_0317510 3300048905 Bacteria 1468
713 Ga0496102_0596031 3300048905 Bacteria 1028
714 Ga0496103_0236915 3300048906 Bacteria 1174
715 Ga0496103_0764774 3300048906 Unclassified 610
716 Ga0496104_0160845 3300048907 Bacteria 2154
717 Ga0496104_0173027 3300048907 Bacteria 2070
718 Ga0496104_0390145 3300048907 Bacteria 1305
719 Ga0496104_1141285 3300048907 Bacteria 683
720 Ga0496105_0098528 3300048908 Bacteria 2414
721 Ga0496105_0260501 3300048908 Bacteria 1402
722 Ga0496105_0366587 3300048908 Unclassified 1148
723 Ga0496105_0468365 3300048908 Unclassified 993
724 Ga0496105_0492253 3300048908 Bacteria 963
725 Ga0496105_0598598 3300048908 Bacteria 856
726 Ga0496106_0043538 3300048909 Bacteria 3368
727 Ga0496106_0073267 3300048909 Bacteria 2620
728 Ga0496106_0449278 3300048909 Bacteria 1035
729 Ga0496106_0738087 3300048909 Unclassified 783
730 Ga0496107_0481075 3300048910 Bacteria 921
731 Ga0496108_0004142 3300048911 Bacteria 11659
732 Ga0496108_0180895 3300048911 Bacteria 1826
733 Ga0496108_0227143 3300048911 Bacteria 1622
734 Ga0496108_0251800 3300048911 Bacteria 1536
735 Ga0496108_0367789 3300048911 Bacteria 1255
736 Ga0496108_0469703 3300048911 Bacteria 1099
737 Ga0496109_0006116 3300048912 Bacteria 10112
738 Ga0496109_0168905 3300048912 Bacteria 2051
739 Ga0496109_0695179 3300048912 Bacteria 954
740 Ga0496109_1176640 3300048912 Bacteria 703
741 Ga0496109_1343481 3300048912 Unclassified 650
742 Ga0496109_1491184 3300048912 Unclassified 611
743 Ga0496109_1787030 3300048912 Bacteria 548
744 Ga0496110_0004582 3300048913 Bacteria 10738
745 Ga0496110_0023137 3300048913 Bacteria 5284
746 Ga0496110_0026771 3300048913 Bacteria 4938
747 Ga0496110_0064289 3300048913 Bacteria 3242
748 Ga0496110_0110596 3300048913 Bacteria 2469
749 Ga0496110_0861309 3300048913 Bacteria 811
750 Ga0496110_0865248 3300048913 Bacteria 809
751 Ga0496111_0000612 3300048914 Bacteria 18851
752 Ga0496111_0022732 3300048914 Bacteria 4393
753 Ga0496111_0031837 3300048914 Bacteria 3758
754 Ga0496111_0134388 3300048914 Bacteria 1832
755 Ga0496111_0323063 3300048914 Bacteria 1143
756 Ga0496111_0644053 3300048914 Bacteria 773
757 Ga0496111_0954357 3300048914 Bacteria 616
758 Ga0496112_0007171 3300048915 Bacteria 9873
759 Ga0496112_0548633 3300048915 Bacteria 1090
760 Ga0496112_0567577 3300048915 Bacteria 1068
761 Ga0496112_0624792 3300048915 Bacteria 1008
762 Ga0496112_1156929 3300048915 Bacteria 691
763 Ga0496113_0380639 3300048916 Bacteria 1133
764 Ga0496114_0072801 3300048917 Bacteria 2891
765 Ga0496114_0109009 3300048917 Bacteria 2371
766 Ga0496114_0174056 3300048917 Bacteria 1877
767 Ga0496114_0221463 3300048917 Bacteria 1661
768 Ga0496114_0231725 3300048917 Bacteria 1623
769 Ga0496114_0270984 3300048917 Bacteria 1496
770 Ga0496114_0310328 3300048917 Bacteria 1393
771 Ga0496114_0559035 3300048917 Bacteria 1010
772 Ga0496114_0700200 3300048917 Bacteria 888
773 Ga0496114_0847009 3300048917 Unclassified 794
774 Ga0496114_0879789 3300048917 Bacteria 776
775 Ga0496114_1092222 3300048917 Unclassified 682
776 Ga0501031_0003039 3300049568 Bacteria 10723
777 Ga0501031_0053137 3300049568 Bacteria 2639
778 Ga0501031_0078772 3300049568 Bacteria 2147
779 Ga0501031_0610977 3300049568 Bacteria 701
780 Ga0501032_0011905 3300049569 Bacteria 6231
781 Ga0501033_0020165 3300049570 Bacteria 5040
782 Ga0501033_0031961 3300049570 Bacteria 3951
783 Ga0501033_0192723 3300049570 Bacteria 1458
784 Ga0501034_0147689 3300049571 Bacteria 2328
785 Ga0501034_0170334 3300049571 Bacteria 2145
786 Ga0501034_0330562 3300049571 Bacteria 1456
787 Ga0501034_0960621 3300049571 Bacteria 740
788 Ga0501036_0017170 3300049572 Bacteria 6049
789 Ga0501036_0046815 3300049572 Bacteria 3662
790 Ga0501036_0119608 3300049572 Bacteria 2224
791 Ga0501036_0497466 3300049572 Bacteria 1014
792 Ga0501036_0570331 3300049572 Bacteria 940
793 Ga0501036_0986106 3300049572 Bacteria 690
794 Ga0501037_0075922 3300049573 Bacteria 2440
795 Ga0501037_0357995 3300049573 Bacteria 1006
796 Ga0501037_0633089 3300049573 Bacteria 716
797 Ga0501038_0023255 3300049574 Bacteria 5544
798 Ga0501038_0045306 3300049574 Bacteria 3818
799 Ga0501038_0398537 3300049574 Bacteria 1065
800 Ga0501039_0021045 3300049575 Bacteria 5002
801 Ga0501039_0046800 3300049575 Bacteria 3342
802 Ga0501039_0090833 3300049575 Bacteria 2380
803 Ga0501039_0280675 3300049575 Bacteria 1309
804 Ga0501039_0311309 3300049575 Bacteria 1238
805 Ga0501039_0605642 3300049575 Bacteria 859
806 Ga0501040_0051099 3300049576 Bacteria 2828
807 Ga0501040_0055634 3300049576 Bacteria 2713
808 Ga0501040_0945750 3300049576 Bacteria 624
809 Ga0501040_0969072 3300049576 Unclassified 616
810 Ga0501041_0003646 3300049577 Bacteria 8858
811 Ga0501041_0082356 3300049577 Bacteria 1982
812 Ga0501041_0185159 3300049577 Archaea 1304
813 Ga0501041_0200397 3300049577 Bacteria 1251
814 Ga0501041_0613652 3300049577 Bacteria 694
815 Ga0501042_0007772 3300049578 Bacteria 7047
816 Ga0501042_0208860 3300049578 Bacteria 1408
817 Ga0501042_0360477 3300049578 Bacteria 1052
818 Ga0501042_0440087 3300049578 Bacteria 945
819 Ga0501042_0575852 3300049578 Bacteria 818
820 Ga0501043_0082637 3300049579 Bacteria 2525
821 Ga0501043_0153086 3300049579 Bacteria 1804
822 Ga0501043_0275419 3300049579 Bacteria 1291
823 Ga0501043_1018361 3300049579 Unclassified 589
824 Ga0501046_0004011 3300049580 Bacteria 13446
825 Ga0501046_0016747 3300049580 Bacteria 6129
826 Ga0501046_0114646 3300049580 Bacteria 2056
827 Ga0501046_0258524 3300049580 Bacteria 1280
828 Ga0501046_0276324 3300049580 Bacteria 1231
829 Ga0501046_0719776 3300049580 Archaea 702
830 Ga0501047_0014875 3300049581 Bacteria 7407
831 Ga0501048_0007483 3300049582 Bacteria 8275
832 Ga0501048_0010731 3300049582 Bacteria 6831
833 Ga0501048_0023818 3300049582 Bacteria 4471
834 Ga0501048_0124448 3300049582 Bacteria 1823
835 Ga0501048_1360202 3300049582 Bacteria 510
836 Ga0501067_0039146 3300049583 Bacteria 2632
837 Ga0501067_0142189 3300049583 Bacteria 1336
838 Ga0501067_0493093 3300049583 Bacteria 685
839 Ga0501068_0002316 3300049584 Bacteria 10152
840 Ga0501068_0016403 3300049584 Bacteria 4269
841 Ga0501068_0119442 3300049584 Bacteria 1643
842 Ga0501068_0222905 3300049584 Bacteria 1199
843 Ga0501068_0378152 3300049584 Bacteria 912
844 Ga0501068_0677313 3300049584 Bacteria 674
845 Ga0501068_0726223 3300049584 Bacteria 650
846 Ga0501069_0031494 3300049585 Bacteria 2917
847 Ga0501069_0111543 3300049585 Bacteria 1558
848 Ga0501069_0196270 3300049585 Bacteria 1169
849 Ga0501069_0201419 3300049585 Bacteria 1154
850 Ga0501069_0289765 3300049585 Bacteria 959
851 Ga0501069_0523835 3300049585 Bacteria 708
852 Ga0501069_0935328 3300049585 Unclassified 528
853 Ga0501070_0040330 3300049586 Bacteria 3893
854 Ga0501070_0167058 3300049586 Bacteria 1813
855 Ga0501070_0565911 3300049586 Bacteria 909
856 Ga0501071_0003292 3300049587 Bacteria 10088
857 Ga0501071_0089334 3300049587 Bacteria 2261
858 Ga0501071_0134395 3300049587 Bacteria 1839
859 Ga0501071_0180425 3300049587 Bacteria 1582
860 Ga0501071_0312912 3300049587 Bacteria 1191
861 Ga0501071_0340590 3300049587 Bacteria 1140
862 Ga0501072_0019784 3300049588 Bacteria 5208
863 Ga0501072_0023598 3300049588 Bacteria 4777
864 Ga0501072_0456136 3300049588 Bacteria 1012
865 Ga0501072_0500562 3300049588 Bacteria 961
866 Ga0501072_0590805 3300049588 Bacteria 876
867 Ga0501072_0786687 3300049588 Bacteria 746
868 Ga0501072_0808157 3300049588 Bacteria 734
869 Ga0501072_0961663 3300049588 Bacteria 666
870 Ga0501072_1005424 3300049588 Bacteria 650
871 Ga0501072_1472019 3300049588 Bacteria 526
872 Ga0501073_0015465 3300049589 Bacteria 5536
873 Ga0501073_0462898 3300049589 Bacteria 877
874 Ga0501074_0011150 3300049590 Bacteria 6529
875 Ga0501074_0045880 3300049590 Bacteria 3160
876 Ga0501074_0405985 3300049590 Bacteria 966
877 Ga0501074_0494986 3300049590 Bacteria 866
878 Ga0501075_0001579 3300049591 Bacteria 14891
879 Ga0501075_0012185 3300049591 Bacteria 6104
880 Ga0501075_0034523 3300049591 Bacteria 3766
881 Ga0501075_0048638 3300049591 Bacteria 3187
882 Ga0501075_0100878 3300049591 Bacteria 2192
883 Ga0501075_0126950 3300049591 Bacteria 1942
884 Ga0501075_0515627 3300049591 Bacteria 912
885 Ga0501075_0777278 3300049591 Bacteria 729
886 Ga0501075_0859977 3300049591 Bacteria 690
887 Ga0501076_0004848 3300049592 Bacteria 9606
888 Ga0501076_0008579 3300049592 Bacteria 7496
889 Ga0501076_0127731 3300049592 Bacteria 2061
890 Ga0501076_0151366 3300049592 Bacteria 1887
891 Ga0501076_0209420 3300049592 Bacteria 1593
892 Ga0501076_0378678 3300049592 Bacteria 1163
893 Ga0501076_0518966 3300049592 Bacteria 982
894 Ga0501076_0695432 3300049592 Bacteria 839
895 Ga0501077_0002154 3300049593 Bacteria 11898
896 Ga0501077_0010835 3300049593 Bacteria 5679
897 Ga0501077_0155981 3300049593 Bacteria 1449
898 Ga0501077_0198454 3300049593 Bacteria 1274
899 Ga0501077_0374001 3300049593 Bacteria 910
900 Ga0501079_0007024 3300049741 Bacteria 8493
901 Ga0501079_0014626 3300049741 Bacteria 5985
902 Ga0501079_0018090 3300049741 Bacteria 5381
903 Ga0501079_0378345 3300049741 Bacteria 1110
904 Ga0501079_0499697 3300049741 Bacteria 956
905 Ga0501079_0799127 3300049741 Bacteria 743
906 Ga0501079_1019351 3300049741 Bacteria 652
907 Ga0501080_0003166 3300049742 Bacteria 14502
908 Ga0501080_0147454 3300049742 Bacteria 2175
909 Ga0501080_0271025 3300049742 Bacteria 1545
910 Ga0501080_0427458 3300049742 Bacteria 1189
911 Ga0501080_0604805 3300049742 Bacteria 973
912 Ga0501081_0020311 3300049743 Bacteria 4427
913 Ga0501081_0224497 3300049743 Bacteria 1366
914 Ga0501081_0280606 3300049743 Bacteria 1219
915 Ga0501081_0341914 3300049743 Bacteria 1102
916 Ga0501083_0072348 3300049744 Bacteria 2292
917 Ga0501083_0094593 3300049744 Bacteria 1972
918 Ga0501083_0226064 3300049744 Bacteria 1219
919 Ga0501035_0023594 3300049822 Bacteria 5644
920 Ga0501035_1277172 3300049822 Bacteria 567
921 Ga0501035_1353336 3300049822 Bacteria 547
922 Ga0501044_0628455 3300049823 Bacteria 965
923 Ga0501044_0677284 3300049823 Bacteria 918
924 Ga0501045_0001676 3300049824 Bacteria 14903
925 Ga0501045_0016348 3300049824 Bacteria 5268
926 Ga0501045_0042477 3300049824 Bacteria 3308
927 Ga0501045_0105301 3300049824 Bacteria 2090
928 Ga0501045_0412479 3300049824 Unclassified 1005
929 Ga0501045_0534806 3300049824 Bacteria 870
930 Ga0501045_0539697 3300049824 Bacteria 865
931 Ga0501045_0743578 3300049824 Bacteria 723
932 Ga0501045_1247971 3300049824 Unclassified 542
933 Ga0501045_1413142 3300049824 Bacteria 505
934 nmdc:mga0yw44_269082_c1 3300050492 Bacteria 1137
935 nmdc:mga05p37_17839_c1 3300050507 Bacteria 8568
936 nmdc:mga09592_13054_c1 3300050508 Bacteria 6781
937 nmdc:mga08y16_1244507_c1 3300050511 Unclassified 713
938 nmdc:mga08y16_140182_c1 3300050511 Bacteria 2514
939 nmdc:mga08y16_1507784_c1 3300050511 Bacteria 633
940 nmdc:mga08y16_22195_c1 3300050511 Bacteria 6699
941 nmdc:mga0n895_79651_c1 3300050512 Bacteria 3262
942 nmdc:mga0n895_95417_c1 3300050512 Bacteria 2979
943 nmdc:mga0rr50_598616_c1 3300050513 Bacteria 940
944 nmdc:mga0rr50_724127_c1 3300050513 Bacteria 849
945 nmdc:mga08x19_125640_c1 3300050514 Bacteria 1722
946 nmdc:mga0a205_1351114_c1 3300050515 Unclassified 560
947 nmdc:mga0a205_334097_c1 3300050515 Bacteria 1385
948 Ga0495655_0278511 3300053083 Bacteria 569
949 Ga0495595_0217905 3300053084 Bacteria 952
950 Ga0495619_0062240 3300053085 Bacteria 2484
951 Ga0501084_0027520 3300054114 Bacteria 4750
952 Ga0501084_0039885 3300054114 Bacteria 3927
953 Ga0501084_0100670 3300054114 Bacteria 2426
954 Ga0501084_0104688 3300054114 Bacteria 2376
955 Ga0501084_0240389 3300054114 Bacteria 1528
956 Ga0501084_0264534 3300054114 Bacteria 1452
957 Ga0501084_0473248 3300054114 Bacteria 1059
958 Ga0501084_0845784 3300054114 Bacteria 770
959 Ga0501082_0002118 3300060353 Bacteria 17481
960 Ga0501082_0029744 3300060353 Bacteria 4706
961 Ga0501082_0093172 3300060353 Bacteria 2603
962 Ga0501082_0155187 3300060353 Bacteria 1989
963 Ga0501082_0562072 3300060353 Unclassified 998
964 Ga0501082_0634008 3300060353 Bacteria 935
965 Ga0501082_0885230 3300060353 Bacteria 781
966 Ga0501082_1096098 3300060353 Bacteria 696
967 Ga0530510_0009505 3300061734 Bacteria 6817
968 Ga0530510_0040739 3300061734 Bacteria 3352
969 Ga0530510_0051825 3300061734 Bacteria 2966
970 Ga0530510_0238991 3300061734 Bacteria 1352
971 Ga0530510_0354912 3300061734 Bacteria 1102
972 Ga0530510_0917114 3300061734 Bacteria 670
973 2559428936 2558860280 Bacteria 11429938
974 2795781643 2795385470 Bacteria 8317180
975 2795795155 2795385472 Bacteria 6627535
976 2844851953 2844849076 Bacteria 4091819
977 2857740587 2857740372 Bacteria 4782044
978 2904499334 2904497146 Bacteria 4731781
979 2904778436 2904776348 Bacteria 4658726
980 2919035788 2919034639 Bacteria 4763403
981 2919538997 2919538618 Bacteria 4677069
982 2932427578 2932426870 Bacteria 4547726
983 2933418833 2933418574 Bacteria 4476724
984 2939648234 2939647034 Bacteria 4681660
985 Ga0316584_0004656
986 2214909088
987 ARcpr5oldR_c005479
988 ARCol0yngRDRAFT_1002670
989 JGI24745J21846_1001366
990 JGI24738J21930_10000561
991 JGI25406J46586_10004625
992 rootH2_10047530
993 Ga0070658_10151231
994 Ga0070658_10354259
995 Ga0070676_10042736
996 Ga0070676_10075566
997 Ga0070676_10174224
998 Ga0070676_11068759
999 Ga0070676_11127176
1000 Ga0070676_11314097
1001 Ga0070683_100007373
1002 Ga0070683_100025155
1003 Ga0070683_100468315
1004 Ga0070683_100608994
1005 Ga0070683_101091354
1006 Ga0070690_100757158
1007 Ga0070690_100996072
1008 Ga0070670_100510681
1009 Ga0070670_100955941
1010 Ga0070670_101297248
1011 Ga0068869_100022196
1012 Ga0068869_100232140
1013 Ga0068869_100299254
1014 Ga0070666_10874327
1015 Ga0070680_100018180
1016 Ga0070682_100006877
1017 Ga0070682_100010912
1018 Ga0070682_100053405
1019 Ga0070682_100072014
1020 Ga0070682_100319289
1021 Ga0068868_100011827
1022 Ga0068868_100030465
1023 Ga0068868_100038418
1024 Ga0068868_100180751
1025 Ga0068868_100286935
1026 Ga0068868_100335513
1027 Ga0068868_100664699
1028 Ga0070660_100003349
1029 Ga0070660_100085182
1030 Ga0070660_100149944
1031 Ga0070660_100583837
1032 Ga0070660_101198738
1033 Ga0070689_100072458
1034 Ga0070689_100104231
1035 Ga0070689_100110319
1036 Ga0070691_10000980
1037 Ga0070691_10038406
1038 Ga0070691_10475037
1039 Ga0070691_10861312
1040 Ga0070687_100149689
1041 Ga0070687_100166483
1042 Ga0070687_100915669
1043 Ga0070661_100258984
1044 Ga0070661_100594909
1045 Ga0070661_101168806
1046 Ga0070692_10000477
1047 Ga0070692_10018946
1048 Ga0070692_10224163
1049 Ga0070692_11313316
1050 Ga0070668_100056380
1051 Ga0070668_100240840
1052 Ga0070669_100263907
1053 Ga0070669_100272529
1054 Ga0070669_100472844
1055 Ga0070669_100501299
1056 Ga0070675_100011418
1057 Ga0070675_100185784
1058 Ga0070675_100208373
1059 Ga0070675_101157882
1060 Ga0070675_101489980
1061 Ga0070675_101794773
1062 Ga0070671_100026781
1063 Ga0070674_100061968
1064 Ga0070674_100068163
1065 Ga0070674_100304854
1066 Ga0070674_100371351
1067 Ga0070674_100481096
1068 Ga0070674_101199609
1069 Ga0070673_100022103
1070 Ga0070673_100280376
1071 Ga0070673_100804616
1072 Ga0070673_101714275
1073 Ga0070688_100020857
1074 Ga0070688_100042250
1075 Ga0070659_100002964
1076 Ga0070659_100020779
1077 Ga0070659_100026771
1078 Ga0070659_100031619
1079 Ga0070659_100233987
1080 Ga0070667_101344063
1081 Ga0070714_100943578
1082 Ga0070701_10005589
1083 Ga0070701_10021847
1084 Ga0070705_100094654
1085 Ga0070705_101411496
1086 Ga0070700_100029006
1087 Ga0070700_100118197
1088 Ga0070700_100131663
1089 Ga0070700_100197878
1090 Ga0070694_100094261
1091 Ga0070708_100173014
1092 Ga0070663_100045244
1093 Ga0070663_100360685
1094 Ga0070678_100156227
1095 Ga0070678_100180491
1096 Ga0070678_100297831
1097 Ga0070678_100350880
1098 Ga0070678_100484863
1099 Ga0070678_100822689
1100 Ga0070678_100931040
1101 Ga0070678_101242866
1102 Ga0070678_101614861
1103 Ga0070662_100050553
1104 Ga0070662_100130390
1105 Ga0070662_100587593
1106 Ga0070662_101006480
1107 Ga0070681_10002072
1108 Ga0070681_10067466
1109 Ga0070681_10366609
1110 Ga0070681_10731612
1111 Ga0068867_100040464
1112 Ga0068867_100048358
1113 Ga0068867_100667411
1114 Ga0070685_10026332
1115 Ga0070685_10094771
1116 Ga0070685_11302785
1117 Ga0070698_100877886
1118 Ga0070679_100208004
1119 Ga0070679_100472387
1120 Ga0070679_100975113
1121 Ga0070684_100007151
1122 Ga0070684_100050026
1123 Ga0070684_100069280
1124 Ga0070684_100281922
1125 Ga0070684_100396754
1126 Ga0070684_100515132
1127 Ga0070684_100571830
1128 Ga0070684_100581556
1129 Ga0070684_101453379
1130 Ga0070684_101857343
1131 Ga0068853_100004912
1132 Ga0068853_100009437
1133 Ga0068853_100396668
1134 Ga0068853_101679536
1135 Ga0068853_102482659
1136 Ga0070672_100004959
1137 Ga0070672_100022319
1138 Ga0070672_100029322
1139 Ga0070672_100300688
1140 Ga0070672_100950821
1141 Ga0070686_100006012
1142 Ga0070686_100075322
1143 Ga0070686_100391149
1144 Ga0070696_100183811
1145 Ga0070696_100510295
1146 Ga0070696_101321399
1147 Ga0070693_100134038
1148 Ga0070693_100624259
1149 Ga0070665_100025371
1150 Ga0070665_100222402
1151 Ga0070665_100556369
1152 Ga0070665_101988384
1153 Ga0070704_100022573
1154 Ga0070704_100623963
1155 Ga0068855_100047253
1156 Ga0068855_100606283
1157 Ga0068855_100994228
1158 Ga0068855_101162895
1159 Ga0068855_101962998
1160 Ga0070664_100006431
1161 Ga0070664_100148507
1162 Ga0070664_100216847
1163 Ga0070664_100337635
1164 Ga0070664_100789400
1165 Ga0068857_100389205
1166 Ga0068857_100822508
1167 Ga0068857_101515383
1168 Ga0068857_101524848
1169 Ga0068857_102166955
1170 Ga0068854_100003631
1171 Ga0068854_100047594
1172 Ga0068854_100136767
1173 Ga0068854_100137616
1174 Ga0068854_100462633
1175 Ga0068856_100048087
1176 Ga0068856_100343764
1177 Ga0068856_100524345
1178 Ga0070702_100084711
1179 Ga0070702_100319036
1180 Ga0070702_100612026
1181 Ga0070702_100897223
1182 Ga0068852_100007514
1183 Ga0068852_100054355
1184 Ga0068852_100057069
1185 Ga0068852_100352319
1186 Ga0068852_100527587
1187 Ga0068852_100889232
1188 Ga0068859_100157554
1189 Ga0068859_101542097
1190 Ga0068864_100118253
1191 Ga0068864_100216304
1192 Ga0068864_102383574
1193 Ga0068866_10120722
1194 Ga0068866_10164880
1195 Ga0068866_10373102
1196 Ga0068866_10459000
1197 Ga0068866_10563461
1198 Ga0068866_10568960
1199 Ga0068866_10594368
1200 Ga0068861_100032453
1201 Ga0068861_100214674
1202 Ga0068861_100265831
1203 Ga0068861_100746821
1204 Ga0068851_10111038
1205 Ga0068851_10167962
1206 Ga0068870_10028157
1207 Ga0068870_10341515
1208 Ga0068863_100781526
1209 Ga0068858_100058586
1210 Ga0068858_100624962
1211 Ga0068858_101832014
1212 Ga0068860_100159255
1213 Ga0068860_100535839
1214 Ga0081455_10911023
1215 Ga0081539_10001549
1216 Ga0081539_10109064
1217 Ga0070717_10088475
1218 Ga0075365_10326889
1219 Ga0075432_10002049
1220 Ga0097621_100107927
1221 Ga0097621_100119480
1222 Ga0097621_101296766
1223 Ga0097621_101788053
1224 Ga0068871_101319170
1225 Ga0068871_101487195
1226 Ga0075428_100004576
1227 Ga0075428_100501474
1228 Ga0075428_100770776
1229 Ga0075431_101309827
1230 Ga0075433_10037639
1231 Ga0075433_10608600
1232 Ga0075434_100006726
1233 Ga0075434_100837205
1234 Ga0075429_100009096
1235 Ga0068865_100002718
1236 Ga0068865_100016943
1237 Ga0068865_100046880
1238 Ga0068865_100082195
1239 Ga0068865_100111307
1240 Ga0068865_101127271
1241 Ga0097620_100157559
1242 Ga0097620_101541996
1243 Ga0075435_100048596
1244 Ga0075435_100069936
1245 Ga0099794_10000307
1246 Ga0105251_10124016
1247 Ga0105240_12473632
1248 Ga0111539_10008396
1249 Ga0111539_10056574
1250 Ga0111539_10330305
1251 Ga0111539_10359368
1252 Ga0111539_10557635
1253 Ga0111539_10625196
1254 Ga0111539_10836169
1255 Ga0105245_10009579
1256 Ga0105245_10027685
1257 Ga0105245_10077600
1258 Ga0105245_10259436
1259 Ga0105245_10456665
1260 Ga0105245_10566406
1261 Ga0105245_10749425
1262 Ga0105245_10872505
1263 Ga0105245_11147490
1264 Ga0105245_11852785
1265 Ga0105247_10008745
1266 Ga0105247_10798906
1267 Ga0105247_11242169
1268 Ga0114129_10137571
1269 Ga0114129_10944225
1270 Ga0114129_12486249
1271 Ga0105243_10002349
1272 Ga0105243_10021154
1273 Ga0105243_10245021
1274 Ga0105243_10394576
1275 Ga0105243_11021514
1276 Ga0105243_12393996
1277 Ga0105243_12550490
1278 Ga0105241_10134873
1279 Ga0105241_10320466
1280 Ga0105241_10439146
1281 Ga0105242_10007255
1282 Ga0105242_10440583
1283 Ga0105242_10449144
1284 Ga0105242_10502154
1285 Ga0105242_10537817
1286 Ga0105242_10540867
1287 Ga0105248_10118683
1288 Ga0105248_10527291
1289 Ga0105248_10665810
1290 Ga0105248_11063412
1291 Ga0105248_11615840
1292 Ga0105237_10138812
1293 Ga0105237_10556985
1294 Ga0105237_11251884
1295 Ga0105238_10013752
1296 Ga0105238_10140061
1297 Ga0105238_10431207
1298 Ga0105238_11143762
1299 Ga0105249_10087271
1300 Ga0105249_10156124
1301 Ga0105249_10460894
1302 Ga0105249_10586938
1303 Ga0105249_10868213
1304 Ga0105239_10114244
1305 Ga0105239_10141718
1306 Ga0105239_10158213
1307 Ga0105239_10166053
1308 Ga0105239_11425876
1309 Ga0105246_10007974
1310 Ga0105246_10040527
1311 Ga0105246_10439364
1312 Ga0105246_10872382
1313 Ga0105246_11583657
1314 Ga0157319_1009125
1315 Ga0157338_1028621
1316 Ga0157373_11426740
1317 Ga0157371_10095050
1318 Ga0157371_10131099
1319 Ga0157370_10056428
1320 Ga0157370_10540706
1321 Ga0157369_10023164
1322 Ga0157369_10082680
1323 Ga0157369_10232236
1324 Ga0157369_10622670
1325 Ga0157369_11864152
1326 Ga0157374_10265013
1327 Ga0157374_10613779
1328 Ga0157374_12432637
1329 Ga0157378_10327084
1330 Ga0157378_10976063
1331 Ga0157378_12939382
1332 Ga0163162_10199870
1333 Ga0163162_10237364
1334 Ga0163162_10889346
1335 Ga0163162_11252932
1336 Ga0157372_10080529
1337 Ga0157372_10446894
1338 Ga0157372_10539285
1339 Ga0157372_10572869
1340 Ga0157375_10011579
1341 Ga0157375_10041949
1342 Ga0157375_10607593
1343 Ga0157375_10695520
1344 Ga0163163_10065425
1345 Ga0163163_10264117
1346 Ga0163163_11893635
1347 Ga0157380_10015681
1348 Ga0157380_10049173
1349 Ga0157380_10084589
1350 Ga0157380_10695781
1351 Ga0157380_11132031
1352 Ga0157377_10010972
1353 Ga0157377_10019262
1354 Ga0157377_10049273
1355 Ga0157377_10075820
1356 Ga0157377_10545471
1357 Ga0157377_10650445
1358 Ga0157377_10741826
1359 Ga0157377_11137711
1360 Ga0157379_10162091
1361 Ga0157379_10213578
1362 Ga0157379_10344908
1363 Ga0157379_12038782
1364 Ga0157379_12049376
1365 Ga0157376_10097055
1366 Ga0157376_10201439
1367 Ga0157376_10292296
1368 Ga0163161_10111553
1369 Ga0163161_10456649
1370 Ga0206356_11069134
1371 Ga0206353_10319247
1372 Ga0206353_10919167
1373 Ga0206353_12054229
1374 Ga0207697_10223013
1375 Ga0207682_10266903
1376 Ga0207692_10000336
1377 Ga0207642_10164885
1378 Ga0207642_10248761
1379 Ga0207642_10340074
1380 Ga0207642_10387551
1381 Ga0207642_10647204
1382 Ga0207688_10002702
1383 Ga0207688_10005424
1384 Ga0207688_10038105
1385 Ga0207688_10059564
1386 Ga0207688_10195994
1387 Ga0207645_10039118
1388 Ga0207645_10210791
1389 Ga0207645_10332757
1390 Ga0207643_10015561
1391 Ga0207643_10070140
1392 Ga0207643_10107242
1393 Ga0207705_10020346
1394 Ga0207705_11158972
1395 Ga0207654_10081749
1396 Ga0207654_10359371
1397 Ga0207707_10057939
1398 Ga0207707_10170265
1399 Ga0207707_10807397
1400 Ga0207707_11300126
1401 Ga0207671_10577271
1402 Ga0207671_10796994
1403 Ga0207671_10934872
1404 Ga0207660_10057827
1405 Ga0207662_10015924
1406 Ga0207662_10033120
1407 Ga0207662_10073238
1408 Ga0207662_11225371
1409 Ga0207657_10004668
1410 Ga0207657_10117075
1411 Ga0207657_10167145
1412 Ga0207657_10390611
1413 Ga0207657_10498022
1414 Ga0207657_10680583
1415 Ga0207649_10603809
1416 Ga0207649_10659850
1417 Ga0207649_10814686
1418 Ga0207649_10959519
1419 Ga0207652_10018886
1420 Ga0207652_10147014
1421 Ga0207652_10488995
1422 Ga0207681_10498960
1423 Ga0207681_10810326
1424 Ga0207681_10892380
1425 Ga0207694_10022103
1426 Ga0207694_10081387
1427 Ga0207694_10408822
1428 Ga0207694_10937516
1429 Ga0207650_10508265
1430 Ga0207650_11313275
1431 Ga0207650_11533356
1432 Ga0207659_10129452
1433 Ga0207659_10455277
1434 Ga0207659_10573477
1435 Ga0207659_10631930
1436 Ga0207687_10029484
1437 Ga0207687_10071190
1438 Ga0207687_10150820
1439 Ga0207687_10164047
1440 Ga0207687_10199333
1441 Ga0207687_10355760
1442 Ga0207687_10398627
1443 Ga0207687_10477414
1444 Ga0207664_10467620
1445 Ga0207644_10229331
1446 Ga0207690_10004794
1447 Ga0207690_10087404
1448 Ga0207690_10171411
1449 Ga0207690_10448369
1450 Ga0207706_10017578
1451 Ga0207706_10024437
1452 Ga0207706_10075771
1453 Ga0207706_10169364
1454 Ga0207686_10522428
1455 Ga0207709_10006589
1456 Ga0207709_10024537
1457 Ga0207709_10034083
1458 Ga0207709_10174636
1459 Ga0207670_10013623
1460 Ga0207670_10173642
1461 Ga0207670_11392304
1462 Ga0207669_10027065
1463 Ga0207669_10172756
1464 Ga0207669_10275657
1465 Ga0207669_10281319
1466 Ga0207669_10334146
1467 Ga0207669_11162982
1468 Ga0207704_10055971
1469 Ga0207704_10110245
1470 Ga0207704_10154177
1471 Ga0207704_11153470
1472 Ga0207691_10006179
1473 Ga0207691_10012070
1474 Ga0207691_10056012
1475 Ga0207691_10360396
1476 Ga0207691_11314379
1477 Ga0207711_10048669
1478 Ga0207711_10054697
1479 Ga0207711_10726207
1480 Ga0207689_10087402
1481 Ga0207689_10384423
1482 Ga0207689_10420132
1483 Ga0207689_10642372
1484 Ga0207689_10741218
1485 Ga0207661_10001401
1486 Ga0207661_10004390
1487 Ga0207661_10012644
1488 Ga0207661_10025210
1489 Ga0207661_10154472
1490 Ga0207661_10608626
1491 Ga0207661_11218200
1492 Ga0207661_11617560
1493 Ga0207679_10015649
1494 Ga0207679_10370168
1495 Ga0207679_10858718
1496 Ga0207679_11569902
1497 Ga0207667_10509059
1498 Ga0207667_10687394
1499 Ga0207667_11466221
1500 Ga0207651_10802156
1501 Ga0207651_11377418
1502 Ga0207712_10296749
1503 Ga0207712_10436167
1504 Ga0207668_10086315
1505 Ga0207668_11097865
1506 Ga0207668_11642329
1507 Ga0207640_10013470
1508 Ga0207640_10028329
1509 Ga0207640_10055471
1510 Ga0207658_10156723
1511 Ga0207658_10486961
1512 Ga0207677_10029362
1513 Ga0207677_10411424
1514 Ga0207677_10478502
1515 Ga0207703_10881702
1516 Ga0207703_11438066
1517 Ga0207639_10004159
1518 Ga0207639_10020326
1519 Ga0207639_10424051
1520 Ga0207639_11126765
1521 Ga0207639_11391708
1522 Ga0207678_10026025
1523 Ga0207678_10098282
1524 Ga0207678_10234121
1525 Ga0207678_10261434
1526 Ga0207678_11215736
1527 Ga0207708_10043433
1528 Ga0207708_10088736
1529 Ga0207708_10110674
1530 Ga0207708_10431179
1531 Ga0207702_10045257
1532 Ga0207702_10292185
1533 Ga0207702_10889572
1534 Ga0207641_10681284
1535 Ga0207641_12160407
1536 Ga0207648_10019875
1537 Ga0207648_10053732
1538 Ga0207648_10093417
1539 Ga0207648_10206627
1540 Ga0207648_10714125
1541 Ga0207676_10335445
1542 Ga0207676_10490247
1543 Ga0207676_11169623
1544 Ga0207676_11811258
1545 Ga0207674_10054243
1546 Ga0207674_10080542
1547 Ga0207674_10244465
1548 Ga0207674_10257311
1549 Ga0207675_100034122
1550 Ga0207675_100098962
1551 Ga0207675_101001052
1552 Ga0207683_10039661
1553 Ga0207683_10047754
1554 Ga0207683_10138197
1555 Ga0207683_10143088
1556 Ga0207683_10185004
1557 Ga0207683_10187701
1558 Ga0207683_10811651
1559 Ga0207683_10880247
1560 Ga0207683_11340645
1561 Ga0207683_11721044
1562 Ga0207698_10003693
1563 Ga0207698_10011159
1564 Ga0207698_10331098
1565 Ga0207698_10777415
1566 Ga0207428_10000196
1567 Ga0207428_10232024
1568 Ga0207428_10592126
1569 Ga0268266_10089805
1570 Ga0268266_10133796
1571 Ga0268266_10316417
1572 Ga0268266_10757020
1573 Ga0268266_11899865
1574 Ga0268266_11935240
1575 Ga0268265_11048751
1576 Ga0268265_11250514
1577 Ga0268264_10140772
1578 Ga0268264_11133242
1579 Ga0268264_12312786
1580 Ga0265338_10012358
1581 Ga0265338_10195170
1582 Ga0307511_10000068
1583 Ga0265320_10022250
1584 Ga0265325_10015123
1585 Ga0265340_10020367
1586 Ga0265339_10004305
1587 Ga0265313_10011970
1588 Ga0265342_10058329
1589 Ga0316576_10327874
1590 Ga0316578_10118144
1591 Ga0307413_10093700
1592 Ga0307410_10125557
1593 Ga0307407_10055129
1594 Ga0307409_100098887
1595 Ga0307416_101240234
1596 Ga0316588_1000278
1597 Ga0316596_1000488
1598 Ga0373948_0087443
1599 Ga0373959_0083744
1600 Ga0373938_0043793
1601 Ga0373949_0068539
1602 Ga0373932_0372529
1603 Ga0373939_0365268
1604 Ga0373941_0179771
1605 Ga0373941_0219513
1606 Ga0373956_0006542
1607 Ga0373960_0019883
1608 Ga0373960_0150787
1609 Ga0373961_0075960
1610 Ga0373962_0160680
1611 Ga0373931_0373197
1612 Ga0395900_0042570
1613 Ga0395900_0242836
1614 Ga0395900_0332171
1615 Ga0395898_0005829
1616 Ga0395898_0198473
1617 Ga0395898_0249307
1618 Ga0395898_0394653
1619 Ga0395898_0432360
1620 Ga0395905_0110050
1621 Ga0395901_0002259
1622 Ga0395901_0178479
1623 Ga0395901_1135316
1624 Ga0436365_0958401
1625 Ga0451797_0123153
1626 Ga0451802_0445110
1627 Ga0451837_1044833
1628 Ga0451845_0171825
1629 Ga0451851_0313660
1630 Ga0451843_1748667
1631 Ga0451853_3587584
1632 Ga0450911_018118
1633 Ga0450906_009617
1634 Ga0450907_004935
1635 Ga0466969_0001566
1636 Ga0466965_0640734
1637 Ga0466966_0002535
1638 Ga0466961_0019309
1639 Ga0466961_0052937
1640 Ga0466963_0804115
1641 Ga0466963_1234974
1642 Ga0466964_0105995
1643 Ga0466964_0339486
1644 Ga0466971_0222972
1645 Ga0466970_0161823
1646 Ga0466960_0174647
1647 Ga0466959_0006446
1648 Ga0466967_0003830
1649 Ga0466967_1278515
1650 Ga0495603_0008050
1651 Ga0495603_0018293
1652 Ga0495629_0865506
1653 Ga0495641_0427403
1654 Ga0495651_0695531
1655 Ga0495653_0225794
1656 Ga0495582_0253928
1657 Ga0495639_0297137
1658 Ga0495583_0390834
1659 Ga0495628_1108876
1660 Ga0495630_0107299
1661 Ga0495631_0181831
1662 Ga0495637_0055098
1663 Ga0495587_0604946
1664 Ga0495645_0709373
1665 Ga0495622_0132942
1666 Ga0495656_0090950
1667 Ga0495656_0190111
1668 Ga0495634_0346448
1669 Ga0495647_0252370
1670 Ga0495670_0263485
1671 Ga0495670_0509520
1672 Ga0495671_0120055
1673 Ga0495589_0279937
1674 Ga0495589_0366741
1675 Ga0495604_0126955
1676 Ga0495674_0197470
1677 Ga0495672_0000834
1678 Ga0495676_0099533
1679 Ga0495676_0485329
1680 Ga0495683_0392238
1681 Ga0495677_0010463
1682 Ga0495673_0207062
1683 Ga0495602_0121209
1684 Ga0496100_0055538
1685 Ga0496100_0413259
1686 Ga0496100_0517865
1687 Ga0496100_0556357
1688 Ga0496100_0666481
1689 Ga0496100_1484140
1690 Ga0496101_0045796
1691 Ga0496101_0138593
1692 Ga0496101_0215438
1693 Ga0496101_0236364
1694 Ga0496101_1190444
1695 Ga0496101_1410486
1696 Ga0496102_0317510
1697 Ga0496102_0596031
1698 Ga0496103_0236915
1699 Ga0496103_0764774
1700 Ga0496104_0160845
1701 Ga0496104_0173027
1702 Ga0496104_0390145
1703 Ga0496104_1141285
1704 Ga0496105_0098528
1705 Ga0496105_0260501
1706 Ga0496105_0366587
1707 Ga0496105_0468365
1708 Ga0496105_0492253
1709 Ga0496105_0598598
1710 Ga0496106_0043538
1711 Ga0496106_0073267
1712 Ga0496106_0449278
1713 Ga0496106_0738087
1714 Ga0496107_0481075
1715 Ga0496108_0004142
1716 Ga0496108_0180895
1717 Ga0496108_0227143
1718 Ga0496108_0251800
1719 Ga0496108_0367789
1720 Ga0496108_0469703
1721 Ga0496109_0006116
1722 Ga0496109_0168905
1723 Ga0496109_0695179
1724 Ga0496109_1176640
1725 Ga0496109_1343481
1726 Ga0496109_1491184
1727 Ga0496109_1787030
1728 Ga0496110_0004582
1729 Ga0496110_0023137
1730 Ga0496110_0026771
1731 Ga0496110_0064289
1732 Ga0496110_0110596
1733 Ga0496110_0861309
1734 Ga0496110_0865248
1735 Ga0496111_0000612
1736 Ga0496111_0022732
1737 Ga0496111_0031837
1738 Ga0496111_0134388
1739 Ga0496111_0323063
1740 Ga0496111_0644053
1741 Ga0496111_0954357
1742 Ga0496112_0007171
1743 Ga0496112_0548633
1744 Ga0496112_0567577
1745 Ga0496112_0624792
1746 Ga0496112_1156929
1747 Ga0496113_0380639
1748 Ga0496114_0072801
1749 Ga0496114_0109009
1750 Ga0496114_0174056
1751 Ga0496114_0221463
1752 Ga0496114_0231725
1753 Ga0496114_0270984
1754 Ga0496114_0310328
1755 Ga0496114_0559035
1756 Ga0496114_0700200
1757 Ga0496114_0847009
1758 Ga0496114_0879789
1759 Ga0496114_1092222
1760 Ga0501031_0003039
1761 Ga0501031_0053137
1762 Ga0501031_0078772
1763 Ga0501031_0610977
1764 Ga0501032_0011905
1765 Ga0501033_0020165
1766 Ga0501033_0031961
1767 Ga0501033_0192723
1768 Ga0501034_0147689
1769 Ga0501034_0170334
1770 Ga0501034_0330562
1771 Ga0501034_0960621
1772 Ga0501036_0017170
1773 Ga0501036_0046815
1774 Ga0501036_0119608
1775 Ga0501036_0497466
1776 Ga0501036_0570331
1777 Ga0501036_0986106
1778 Ga0501037_0075922
1779 Ga0501037_0357995
1780 Ga0501037_0633089
1781 Ga0501038_0023255
1782 Ga0501038_0045306
1783 Ga0501038_0398537
1784 Ga0501039_0021045
1785 Ga0501039_0046800
1786 Ga0501039_0090833
1787 Ga0501039_0280675
1788 Ga0501039_0311309
1789 Ga0501039_0605642
1790 Ga0501040_0051099
1791 Ga0501040_0055634
1792 Ga0501040_0945750
1793 Ga0501040_0969072
1794 Ga0501041_0003646
1795 Ga0501041_0082356
1796 Ga0501041_0185159
1797 Ga0501041_0200397
1798 Ga0501041_0613652
1799 Ga0501042_0007772
1800 Ga0501042_0208860
1801 Ga0501042_0360477
1802 Ga0501042_0440087
1803 Ga0501042_0575852
1804 Ga0501043_0082637
1805 Ga0501043_0153086
1806 Ga0501043_0275419
1807 Ga0501043_1018361
1808 Ga0501046_0004011
1809 Ga0501046_0016747
1810 Ga0501046_0114646
1811 Ga0501046_0258524
1812 Ga0501046_0276324
1813 Ga0501046_0719776
1814 Ga0501047_0014875
1815 Ga0501048_0007483
1816 Ga0501048_0010731
1817 Ga0501048_0023818
1818 Ga0501048_0124448
1819 Ga0501048_1360202
1820 Ga0501067_0039146
1821 Ga0501067_0142189
1822 Ga0501067_0493093
1823 Ga0501068_0002316
1824 Ga0501068_0016403
1825 Ga0501068_0119442
1826 Ga0501068_0222905
1827 Ga0501068_0378152
1828 Ga0501068_0677313
1829 Ga0501068_0726223
1830 Ga0501069_0031494
1831 Ga0501069_0111543
1832 Ga0501069_0196270
1833 Ga0501069_0201419
1834 Ga0501069_0289765
1835 Ga0501069_0523835
1836 Ga0501069_0935328
1837 Ga0501070_0040330
1838 Ga0501070_0167058
1839 Ga0501070_0565911
1840 Ga0501071_0003292
1841 Ga0501071_0089334
1842 Ga0501071_0134395
1843 Ga0501071_0180425
1844 Ga0501071_0312912
1845 Ga0501071_0340590
1846 Ga0501072_0019784
1847 Ga0501072_0023598
1848 Ga0501072_0456136
1849 Ga0501072_0500562
1850 Ga0501072_0590805
1851 Ga0501072_0786687
1852 Ga0501072_0808157
1853 Ga0501072_0961663
1854 Ga0501072_1005424
1855 Ga0501072_1472019
1856 Ga0501073_0015465
1857 Ga0501073_0462898
1858 Ga0501074_0011150
1859 Ga0501074_0045880
1860 Ga0501074_0405985
1861 Ga0501074_0494986
1862 Ga0501075_0001579
1863 Ga0501075_0012185
1864 Ga0501075_0034523
1865 Ga0501075_0048638
1866 Ga0501075_0100878
1867 Ga0501075_0126950
1868 Ga0501075_0515627
1869 Ga0501075_0777278
1870 Ga0501075_0859977
1871 Ga0501076_0004848
1872 Ga0501076_0008579
1873 Ga0501076_0127731
1874 Ga0501076_0151366
1875 Ga0501076_0209420
1876 Ga0501076_0378678
1877 Ga0501076_0518966
1878 Ga0501076_0695432
1879 Ga0501077_0002154
1880 Ga0501077_0010835
1881 Ga0501077_0155981
1882 Ga0501077_0198454
1883 Ga0501077_0374001
1884 Ga0501079_0007024
1885 Ga0501079_0014626
1886 Ga0501079_0018090
1887 Ga0501079_0378345
1888 Ga0501079_0499697
1889 Ga0501079_0799127
1890 Ga0501079_1019351
1891 Ga0501080_0003166
1892 Ga0501080_0147454
1893 Ga0501080_0271025
1894 Ga0501080_0427458
1895 Ga0501080_0604805
1896 Ga0501081_0020311
1897 Ga0501081_0224497
1898 Ga0501081_0280606
1899 Ga0501081_0341914
1900 Ga0501083_0072348
1901 Ga0501083_0094593
1902 Ga0501083_0226064
1903 Ga0501035_0023594
1904 Ga0501035_1277172
1905 Ga0501035_1353336
1906 Ga0501044_0628455
1907 Ga0501044_0677284
1908 Ga0501045_0001676
1909 Ga0501045_0016348
1910 Ga0501045_0042477
1911 Ga0501045_0105301
1912 Ga0501045_0412479
1913 Ga0501045_0534806
1914 Ga0501045_0539697
1915 Ga0501045_0743578
1916 Ga0501045_1247971
1917 Ga0501045_1413142
1918 nmdc:mga0yw44_269082_c1
1919 nmdc:mga05p37_17839_c1
1920 nmdc:mga09592_13054_c1
1921 nmdc:mga08y16_1244507_c1
1922 nmdc:mga08y16_140182_c1
1923 nmdc:mga08y16_1507784_c1
1924 nmdc:mga08y16_22195_c1
1925 nmdc:mga0n895_79651_c1
1926 nmdc:mga0n895_95417_c1
1927 nmdc:mga0rr50_598616_c1
1928 nmdc:mga0rr50_724127_c1
1929 nmdc:mga08x19_125640_c1
1930 nmdc:mga0a205_1351114_c1
1931 nmdc:mga0a205_334097_c1
1932 Ga0495655_0278511
1933 Ga0495595_0217905
1934 Ga0495619_0062240
1935 Ga0501084_0027520
1936 Ga0501084_0039885
1937 Ga0501084_0100670
1938 Ga0501084_0104688
1939 Ga0501084_0240389
1940 Ga0501084_0264534
1941 Ga0501084_0473248
1942 Ga0501084_0845784
1943 Ga0501082_0002118
1944 Ga0501082_0029744
1945 Ga0501082_0093172
1946 Ga0501082_0155187
1947 Ga0501082_0562072
1948 Ga0501082_0634008
1949 Ga0501082_0885230
1950 Ga0501082_1096098
1951 Ga0530510_0009505
1952 Ga0530510_0040739
1953 Ga0530510_0051825
1954 Ga0530510_0238991
1955 Ga0530510_0354912
1956 Ga0530510_0917114
1957 2559428936
1958 2795781643
1959 2795795155
1960 2844851953
1961 2857740587
1962 2904499334
1963 2904778436
1964 2919035788
1965 2919538997
1966 2932427578
1967 2933418833
1968 2939648234

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

19

120

0.85

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

1

93

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uwz-assembly1.cif.gz_A bacillus subtilis cytidine deaminase with an arg56 - ala substitution 0.9186 1 123
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.9177 1 118
7zob-assembly2.cif.gz_E metagenomic cytidine deaminase cdd 0.9144 1 122
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.9111 1 116
1mq0-assembly1.cif.gz_A crystal structure of human cytidine deaminase 0.9003 1 123
ID Description Score Start End Superfamily
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9079 2 119 3.40.140.10
af_Q8IDK5_19_216_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8902 74 99 3.40.140.10
1r5tD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.887 4 118 3.40.140.10
af_A0A1D6NE76_27_176_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8798 4 123 3.40.140.10
af_A0A0P0WYM0_4_131_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8766 4 123 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7W0PZU2-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9769 1 119 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A538EGM8-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9667 4 120 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A538D7I5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.955 2 83 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A7W0PZU2-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9532 1 119 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A0C2GXR6-F1-model_v4 Putative cytidine deaminase 0.9523 2 77 GO:0004126
GO:0005829
GO:0008270
GO:0009972

Map