F487268

General Info

Members Datasets Scaffolds Average Seq Length
977 664 326 388

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000444|JGI25151J46595_100004444
Length 461
Sequence MLPPTAGVGMAIFVSPGVAADPNLIAPQLAYLITRTCIRLSVLSVGETRPDNVHKPRIYFLHKDISMKPIRNLHMMMASAAFLTLAGPALALDGADMMKKLNAATSAGGTVITFEKADVDGDTVTATGVQVGYANLPGDTLKIGDLTFEGVEETEGGGYYAKGVSFPDIDMSQEEGRFSAKDILIVGLTIPANASGDTLNDILLYETVSTGPIALNIKGKDVLAIESIESNLGRQDGGFAYDANVAGIKADLSQVEEASAKEAIAKLGLTTLDGTVTMKGNWEIENGKVAVDEYAFDFKNIGRLNFAVDFSGYTLGFIRSLQQAVKTAEANPNKEEANQAAGLAMLGLMQQLTFNSASIRFDDASITKKALDYAGSQQGVTGDQLAQSLKGLVPMMMAQLNLPELQNQVSAAVNTYLDGPKNLTISAAPEKPVPFPMIMGAAMGAPNTIPSVLGVNVTAND

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516143018 Ensifer sp. BR816 Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
39 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2519899620 Rhizobium sp. Pop5 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
46 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
47 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
48 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
49 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
50 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
51 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
52 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
53 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
54 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
55 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
56 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
57 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
58 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
59 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
60 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
61 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
62 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
63 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
64 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
65 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
66 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
67 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
68 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
69 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
70 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
71 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
72 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
73 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
74 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
75 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
76 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
77 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
78 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
79 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
80 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
81 2643221557 Ensifer sp. Root558 Isolate Unclassified
82 2643221568 Rhizobium sp. Root564 Isolate Unclassified
83 2643221582 Rhizobium sp. Root651 Isolate Unclassified
84 2643221599 Rhizobium sp. Root708 Isolate Unclassified
85 2643221607 Rhizobium sp. Root73 Isolate Unclassified
86 2643221610 Ensifer sp. Root74 Isolate Unclassified
87 2643221618 Ensifer sp. Root231 Isolate Unclassified
88 2643221626 Ensifer sp. Root31 Isolate Unclassified
89 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
90 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
91 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
92 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
93 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
94 2643221655 Ensifer sp. Root1252 Isolate Unclassified
95 2643221659 Ensifer sp. Root127 Isolate Unclassified
96 2643221668 Ensifer sp. Root423 Isolate Unclassified
97 2643221675 Ensifer sp. Root1298 Isolate Unclassified
98 2643221680 Ensifer sp. Root1312 Isolate Unclassified
99 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
100 2643221688 Rhizobium sp. Root482 Isolate Unclassified
101 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
102 2643221693 Rhizobium sp. Root491 Isolate Unclassified
103 2643221698 Ensifer sp. Root142 Isolate Unclassified
104 2643221712 Ensifer sp. Root258 Isolate Unclassified
105 2643221718 Rhizobium sp. Root268 Isolate Unclassified
106 2643221719 Rhizobium sp. Root274 Isolate Unclassified
107 2643221723 Ensifer sp. Root278 Isolate Unclassified
108 2643221726 Ensifer sp. Root954 Isolate Unclassified
109 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
110 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
111 2718217882 Rhizobium sp. N741 Isolate Nodule
112 2718217927 Rhizobium sp. N324 Isolate Nodule
113 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
114 2718218009 Rhizobium sp. N561 Isolate Nodule
115 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
116 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
117 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
118 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
119 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
120 2718218363 Rhizobium sp. N113 Isolate Nodule
121 2718218365 Rhizobium sp. N731 Isolate Nodule
122 2718218366 Rhizobium sp. N621 Isolate Nodule
123 2718218423 Rhizobium sp. N941 Isolate Nodule
124 2721755514 Rhizobium sp. N6212 Isolate Nodule
125 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
126 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
127 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
128 2721755809 Rhizobium sp. N541 Isolate Nodule
129 2721755810 Rhizobium sp. N871 Isolate Nodule
130 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
131 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
132 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
133 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
134 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
135 2728369365 Rhizobium sp. N1341 Isolate Nodule
136 2728369397 Rhizobium sp. N1314 Isolate Nodule
137 2738541293 Rhizobium sp. GV031 Isolate Unclassified
138 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
139 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
140 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
141 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
142 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
143 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
144 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
145 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
146 2791355256 Rhizobium sp. M10 Isolate Nodule
147 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
148 2791355260 Rhizobium sp. L9 Isolate Nodule
149 2791355261 Rhizobium sp. J15 Isolate Nodule
150 2791355262 Rhizobium sp. M1 Isolate Nodule
151 2791355263 Rhizobium chutanense C5 Isolate Nodule
152 2791355264 Rhizobium sp. S9 Isolate Nodule
153 2791355265 Rhizobium sp. H4 Isolate Nodule
154 2791355266 Rhizobium sp. L43 Isolate Nodule
155 2791355267 Rhizobium sp. L18 Isolate Nodule
156 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
157 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
158 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
159 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
160 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
161 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
162 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
163 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
164 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
165 2802429633 Rhizobium anhuiense J3 Isolate Nodule
166 2802429634 Rhizobium anhuiense S10 Isolate Nodule
167 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
168 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
169 2802429637 Rhizobium anhuiense C15 Isolate Nodule
170 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
171 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
172 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
173 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
174 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
175 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
176 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
177 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
178 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
179 2838048938 Rhizobium pisi 27/80 Isolate Nodule
180 2838061910 Rhizobium phaseoli L15 Isolate Nodule
181 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
182 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
183 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
184 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
185 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
186 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
187 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
188 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
189 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
190 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
191 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
192 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
193 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
194 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
195 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
196 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
197 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
198 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
199 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
200 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
201 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
202 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
203 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
204 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
205 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
206 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
207 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
208 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
209 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
210 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
211 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
212 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
213 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
214 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
215 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
216 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
217 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
218 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
219 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
220 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
221 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
222 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
223 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
224 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
225 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
226 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
227 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
228 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
229 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
230 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
231 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
232 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
233 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
234 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
235 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
236 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
237 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
238 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
239 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
240 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
241 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
242 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
243 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
244 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
245 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
246 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
247 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
248 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
252 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
253 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
254 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
255 2844163670 Ensifer sp. 1H6 Isolate Unclassified
256 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
257 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
258 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
259 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
260 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
261 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
262 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
263 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
264 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
265 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
266 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
267 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
268 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
269 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
270 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
271 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
272 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
273 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
274 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
275 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
276 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
277 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
278 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
279 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
280 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
281 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
282 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
283 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
284 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
285 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
286 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
287 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
288 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
289 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
290 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
291 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
292 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
293 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
294 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
295 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
296 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
297 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
298 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
299 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
300 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
301 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
302 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
303 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
304 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
305 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
306 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
307 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
308 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
309 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
310 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
311 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
312 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
313 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
314 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
315 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
316 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
317 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
318 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
319 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
320 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
321 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
322 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
323 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
324 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
325 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
326 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
327 2933599457 Rhizobium phaseoli M3 Isolate Nodule
328 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
329 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
330 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
331 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
332 2936381700 Rhizobium chutanense C16 Isolate Unclassified
333 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
334 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
335 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
336 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
337 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
338 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
339 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
340 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
341 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
342 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
343 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
344 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
345 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
346 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
347 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
348 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
349 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
350 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
351 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
352 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
353 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
354 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
355 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
356 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
357 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
358 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
359 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
360 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
361 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
362 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
363 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
364 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
365 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
366 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
367 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
368 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
369 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
370 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
371 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
372 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
373 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
374 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
375 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
376 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
377 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
378 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
379 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
380 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
381 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
382 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
383 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
384 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
385 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
386 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
387 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
388 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
389 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
390 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
391 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
392 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
393 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
394 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
395 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
396 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
397 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
398 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
399 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
400 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
401 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
402 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
403 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
404 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
405 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
406 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
407 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
408 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
409 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
410 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
411 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
412 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
413 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
414 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
415 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
416 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
417 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
418 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
419 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
420 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
421 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
422 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
423 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
424 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
425 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
426 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
427 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
428 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
429 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
430 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
431 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
432 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
433 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
434 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
435 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
436 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
437 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
438 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
439 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
440 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
441 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
442 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
443 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
444 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
445 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
446 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
447 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
448 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
449 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
450 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
451 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
452 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
453 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
454 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
455 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
456 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
457 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
458 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
459 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
460 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
461 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
462 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
463 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
464 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
465 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
466 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
467 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
468 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
469 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
470 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
471 2996887358 Rhizobium sp. R711 Isolate Nodule
472 2996893221 Rhizobium sp. R635 Isolate Nodule
473 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
474 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
475 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
476 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
477 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
478 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
479 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
480 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
481 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
482 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
483 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
484 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
485 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
486 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
487 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
488 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
489 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
490 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
491 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
492 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
493 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
494 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
495 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
496 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
497 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
498 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
499 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
500 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
501 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
502 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
503 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
504 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
505 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
506 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
507 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
508 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
509 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
510 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
511 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
512 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
513 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
514 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
515 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
516 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
517 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
518 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
519 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
520 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
521 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
522 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
523 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
524 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
525 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
526 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
527 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
528 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
529 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
530 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
531 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
532 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
539 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
540 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
541 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
542 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
544 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
545 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
546 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
547 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
548 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
549 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
550 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
551 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
552 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
553 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
554 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
555 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
556 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
557 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
558 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
559 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
560 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
561 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
562 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
563 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
564 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
565 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
566 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
567 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
568 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
569 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
570 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
571 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
572 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
573 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
574 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
575 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
576 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
577 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
578 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
579 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
580 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
581 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
582 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
583 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
584 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
585 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
586 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
587 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
588 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
589 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
590 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
591 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
592 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
593 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
594 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
595 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
596 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
597 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
598 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
599 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
600 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
601 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
602 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
603 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
604 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
605 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
606 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
607 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
608 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
609 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
610 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
611 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
612 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
613 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
614 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
615 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
616 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
617 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
618 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
619 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
620 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
621 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
622 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
623 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
624 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
625 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
626 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
627 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
628 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
629 8005258706 Rhizobium sp. R693 Isolate Nodule
630 8005275841 Rhizobium sp. N4311 Isolate Nodule
631 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
632 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
633 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
634 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
635 8005321885 Rhizobium sp. R72 Isolate Nodule
636 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
637 8005382845 Rhizobium sp. R634 Isolate Nodule
638 8005395548 Rhizobium sp. R339 Isolate Nodule
639 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
640 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
641 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
642 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
643 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
644 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
645 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
646 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
647 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
648 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
649 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
650 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
651 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
652 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
653 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
654 8018176218 Rhizobium sp. N122 Isolate Nodule
655 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
656 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
657 8024501048 Rhizobium sp. H4 Isolate Nodule
658 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
659 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
660 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
661 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
662 8056382006 Rhizobium croatiense 13T Isolate Nodule
663 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
664 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.37
Metatranscriptomes 0
Isolates 66.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 16.89
Nodule 55.68
Rhizoplane 0.82
Rhizosphere 10.85
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001243 3300002773 Bacteria 11639
2 JGI25152J39213_1004889 3300002773 Bacteria 4080
3 JGI25152J39213_1013289 3300002773 Bacteria 1722
4 JGI25150J39212_1000033 3300002774 Bacteria 96269
5 JGI25150J39212_1013292 3300002774 Bacteria 1431
6 JGI25159J45721_1000002 3300002987 Bacteria 289163
7 JGI25151J46595_10000108 3300003187 Bacteria 112874
8 JGI25151J46595_10000444 3300003187 Bacteria 40415
9 JGI25151J46595_10001506 3300003187 Bacteria 15592
10 JGI25151J46595_10003890 3300003187 Bacteria 8056
11 JGI25151J46595_10028687 3300003187 Bacteria 2213
12 JGI25153J46596_10000823 3300003215 Bacteria 18932
13 rootH1_10019515 3300003316 Bacteria 1921
14 rootH1_10055400 3300003323 Bacteria 2403
15 rootH1_10106559 3300003323 Bacteria 1954
16 JGI25160J50197_1000008 3300003354 Bacteria 289163
17 JGI25160J50197_1004315 3300003354 Bacteria 6162
18 JGI25161J50226_1001763 3300003374 Bacteria 6108
19 JGI25161J50226_1004074 3300003374 Bacteria 3148
20 Ga0055526_1001594 3300003771 Bacteria 15907
21 Ga0055526_1002142 3300003771 Bacteria 13537
22 Ga0055526_1004856 3300003771 Bacteria 7924
23 Ga0055526_1013777 3300003771 Bacteria 3387
24 Ga0055526_1014812 3300003771 Bacteria 3176
25 Ga0055524_1001449 3300003775 Bacteria 13589
26 Ga0055524_1001811 3300003775 Bacteria 11706
27 Ga0055524_1004593 3300003775 Bacteria 6346
28 Ga0055524_1004954 3300003775 Bacteria 6037
29 Ga0055524_1012369 3300003775 Bacteria 3277
30 Ga0055524_1021635 3300003775 Bacteria 2125
31 Ga0055536_1003064 3300003781 Bacteria 9122
32 Ga0055536_1003165 3300003781 Bacteria 8922
33 Ga0055528_1000201 3300003790 Bacteria 50283
34 Ga0055528_1000449 3300003790 Bacteria 32894
35 Ga0055528_1000807 3300003790 Bacteria 21594
36 Ga0055528_1001490 3300003790 Bacteria 14222
37 Ga0055528_1004206 3300003790 Bacteria 6987
38 Ga0055528_1005026 3300003790 Bacteria 6246
39 Ga0055528_1027326 3300003790 Bacteria 1610
40 Ga0055540_1000199 3300003792 Bacteria 58155
41 Ga0055540_1000220 3300003792 Bacteria 53660
42 Ga0055540_1000450 3300003792 Bacteria 32053
43 Ga0055540_1002411 3300003792 Bacteria 9894
44 Ga0055540_1014275 3300003792 Bacteria 2374
45 Ga0055531_10003262 3300003794 Bacteria 10413
46 Ga0055531_10004085 3300003794 Bacteria 9038
47 Ga0058692_1001313 3300003856 Bacteria 9365
48 Ga0058692_1001398 3300003856 Bacteria 8921
49 Ga0055543_1000040 3300004625 Bacteria 122485
50 Ga0055543_1001130 3300004625 Bacteria 11435
51 Ga0055543_1003877 3300004625 Bacteria 4235
52 Ga0065165_1000015 3300005262 Bacteria 289201
53 Ga0065165_1002173 3300005262 Bacteria 17716
54 Ga0065165_1023004 3300005262 Bacteria 2122
55 Ga0070668_100105687 3300005347 Bacteria 2236
56 Ga0070671_100123978 3300005355 Bacteria 2175
57 Ga0070665_100077902 3300005548 Bacteria 3321
58 Ga0070665_100105338 3300005548 Bacteria 2822
59 Ga0075365_10001009 3300006038 Bacteria 12058
60 Ga0075365_10004096 3300006038 Bacteria 7661
61 Ga0075365_10025141 3300006038 Bacteria 3767
62 Ga0075368_10000164 3300006042 Bacteria 17808
63 Ga0075363_100118517 3300006048 Bacteria 1476
64 Ga0075362_10002017 3300006177 Bacteria 6690
65 Ga0075367_10000115 3300006178 Bacteria 23047
66 Ga0075367_10005508 3300006178 Bacteria 6299
67 Ga0075367_10034147 3300006178 Bacteria 2936
68 Ga0075369_10000431 3300006186 Bacteria 12762
69 Ga0075369_10000591 3300006186 Bacteria 11485
70 Ga0075369_10032682 3300006186 Bacteria 2202
71 Ga0075366_10022091 3300006195 Bacteria 3699
72 Ga0075366_10062416 3300006195 Bacteria 2214
73 Ga0075370_10003428 3300006353 Bacteria 7547
74 Ga0075370_10015562 3300006353 Bacteria 4075
75 Ga0079104_1000032 3300006946 Bacteria 203094
76 Ga0079104_1006309 3300006946 Bacteria 4520
77 Ga0099826_10000755 3300006948 Bacteria 17058
78 Ga0099826_10135140 3300006948 Bacteria 1432
79 Ga0123341_1003621 3300009765 Bacteria 13298
80 Ga0123342_1008432 3300009766 Bacteria 12982
81 Ga0105246_10175947 3300011119 Bacteria 1643
82 Ga0157314_1001549 3300012500 Bacteria 1632
83 Ga0157373_10003799 3300013100 Bacteria 11419
84 Ga0157371_10000073 3300013102 Bacteria 163215
85 Ga0157371_10004099 3300013102 Bacteria 12876
86 Ga0157371_10176900 3300013102 Bacteria 1526
87 Ga0157370_10003764 3300013104 Bacteria 17705
88 Ga0157370_10025995 3300013104 Bacteria 5785
89 Ga0157369_10023128 3300013105 Bacteria 6925
90 Ga0171463_1001 3300013249 Bacteria 1406070
91 Ga0157372_10137334 3300013307 Bacteria 2816
92 Ga0214544_1000017 3300021320 Bacteria 193638
93 Ga0214542_1000006 3300021321 Bacteria 345164
94 Ga0214542_1020956 3300021321 Bacteria 4648
95 Ga0214543_1000003 3300021327 Bacteria 692327
96 Ga0214543_1000014 3300021327 Bacteria 324986
97 Ga0228711_1001210 3300022739 Bacteria 37182
98 Ga0228710_1002040 3300022740 Bacteria 31310
99 Ga0207425_1000031 3300025245 Bacteria 261181
100 Ga0207425_1003667 3300025245 Bacteria 4835
101 Ga0207425_1006252 3300025245 Bacteria 3278
102 Ga0207425_1010979 3300025245 Bacteria 2183
103 Ga0209129_1000053 3300025258 Bacteria 262823
104 Ga0209129_1000634 3300025258 Bacteria 23492
105 Ga0209129_1002236 3300025258 Bacteria 9689
106 Ga0209129_1002764 3300025258 Bacteria 8184
107 Ga0209673_1000022 3300025273 Bacteria 413125
108 Ga0209673_1000041 3300025273 Bacteria 307397
109 Ga0209673_1000206 3300025273 Bacteria 118136
110 Ga0209673_1000319 3300025273 Bacteria 88129
111 Ga0209673_1000692 3300025273 Bacteria 48181
112 Ga0209673_1000808 3300025273 Bacteria 41434
113 Ga0209673_1003617 3300025273 Bacteria 8949
114 Ga0209673_1004259 3300025273 Bacteria 7775
115 Ga0209673_1004628 3300025273 Bacteria 7281
116 Ga0209673_1005178 3300025273 Bacteria 6661
117 Ga0209673_1006319 3300025273 Bacteria 5748
118 Ga0209130_1000007 3300025284 Bacteria 591584
119 Ga0209676_1006384 3300025292 Bacteria 5835
120 Ga0209025_1000087 3300025294 Bacteria 261181
121 Ga0209025_1000149 3300025294 Bacteria 173393
122 Ga0209025_1000190 3300025294 Bacteria 153726
123 Ga0209025_1000199 3300025294 Bacteria 146058
124 Ga0209025_1000580 3300025294 Bacteria 66332
125 Ga0209025_1001502 3300025294 Bacteria 30072
126 Ga0209025_1005521 3300025294 Bacteria 10266
127 Ga0209025_1009695 3300025294 Bacteria 6659
128 Ga0209025_1012394 3300025294 Bacteria 5467
129 Ga0209564_1000163 3300025295 Bacteria 162077
130 Ga0209564_1000330 3300025295 Bacteria 92033
131 Ga0209564_1000431 3300025295 Bacteria 72866
132 Ga0209564_1000849 3300025295 Bacteria 40905
133 Ga0209564_1002041 3300025295 Bacteria 17458
134 Ga0209564_1004475 3300025295 Bacteria 8535
135 Ga0209564_1011415 3300025295 Bacteria 3981
136 Ga0209758_1000081 3300025297 Bacteria 261181
137 Ga0209758_1000333 3300025297 Bacteria 88318
138 Ga0209758_1000734 3300025297 Bacteria 47906
139 Ga0209758_1000939 3300025297 Bacteria 39327
140 Ga0209758_1001204 3300025297 Bacteria 32572
141 Ga0209758_1002928 3300025297 Bacteria 16440
142 Ga0209758_1017109 3300025297 Bacteria 3635
143 Ga0209050_1009250 3300025298 Bacteria 5080
144 Ga0209050_1011188 3300025298 Bacteria 4294
145 Ga0209256_1000445 3300025299 Bacteria 63065
146 Ga0209256_1001015 3300025299 Bacteria 33142
147 Ga0209256_1001312 3300025299 Bacteria 26677
148 Ga0209256_1001358 3300025299 Bacteria 25823
149 Ga0209256_1001741 3300025299 Bacteria 20794
150 Ga0209256_1001746 3300025299 Bacteria 20729
151 Ga0209256_1002566 3300025299 Bacteria 14517
152 Ga0209256_1007960 3300025299 Bacteria 5049
153 Ga0209256_1008291 3300025299 Bacteria 4852
154 Ga0207426_1000064 3300025302 Bacteria 358276
155 Ga0207426_1000109 3300025302 Bacteria 238665
156 Ga0207426_1000119 3300025302 Bacteria 221800
157 Ga0209051_1000198 3300025303 Bacteria 106688
158 Ga0209051_1000359 3300025303 Bacteria 67167
159 Ga0209051_1002367 3300025303 Bacteria 13635
160 Ga0209051_1022363 3300025303 Bacteria 2663
161 Ga0209051_1026425 3300025303 Bacteria 2340
162 Ga0209051_1027185 3300025303 Bacteria 2286
163 Ga0209051_1027343 3300025303 Bacteria 2275
164 Ga0209257_1003151 3300025304 Bacteria 14707
165 Ga0209257_1003382 3300025304 Bacteria 13774
166 Ga0209257_1003901 3300025304 Bacteria 12155
167 Ga0209257_1004762 3300025304 Bacteria 10130
168 Ga0207644_10085012 3300025931 Bacteria 2346
169 Ga0207711_10105693 3300025941 Bacteria 2497
170 Ga0207668_10178547 3300025972 Bacteria 1672
171 Ga0207678_10079620 3300026067 Bacteria 2805
172 Ga0209281_1000053 3300027111 Bacteria 309587
173 Ga0209281_1000236 3300027111 Bacteria 113362
174 Ga0209281_1000666 3300027111 Bacteria 36327
175 Ga0209371_1000021 3300027312 Bacteria 555864
176 Ga0209371_1004245 3300027312 Bacteria 6362
177 Ga0209282_1000022 3300027666 Bacteria 173388
178 Ga0209282_1000629 3300027666 Bacteria 17376
179 Ga0209813_10029768 3300027866 Bacteria 1601
180 Ga0268266_10052403 3300028379 Bacteria 3504
181 Ga0307515_10000070 3300028794 Bacteria 239322
182 Ga0307515_10014926 3300028794 Bacteria 14357
183 Ga0268256_1000020 3300030500 Bacteria 557873
184 Ga0268256_1003348 3300030500 Bacteria 7303
185 Ga0316181_1139163 3300030744 Bacteria 5262
186 Ga0307513_10079586 3300031456 Bacteria 3385
187 Ga0307406_10010524 3300031901 Bacteria 5220
188 Ga0307412_10003579 3300031911 Bacteria 8628
189 Ga0315914_1000027 3300031967 Bacteria 106536
190 Ga0307409_100375956 3300031995 Bacteria 1349
191 Ga0315913_1000631 3300033430 Bacteria 33112
192 Ga0315915_1000001 3300033464 Bacteria 481518
193 Ga0439436_0008469 3300041404 Bacteria 3164
194 Ga0439465_0007519 3300041413 Bacteria 3463
195 Ga0439465_0015818 3300041413 Bacteria 2353
196 Ga0451787_051032 3300041441 Bacteria 1617
197 Ga0451833_0913720 3300041491 Bacteria 2112
198 Ga0451835_0329127 3300041492 Bacteria 1712
199 Ga0451839_0077661 3300041496 Bacteria 4495
200 Ga0451839_0114975 3300041496 Bacteria 1709
201 Ga0451841_0751739 3300041498 Bacteria 1701
202 Ga0451855_0352143 3300041511 Bacteria 1530
203 Ga0451853_1667796 3300041512 Bacteria 5134
204 Ga0439445_0015344 3300042004 Bacteria 1875
205 Ga0439449_0010462 3300042007 Bacteria 3504
206 Ga0439449_0022808 3300042007 Bacteria 2343
207 Ga0495638_0002549 3300046460 Bacteria 14778
208 Ga0495605_0008724 3300046474 Bacteria 5722
209 Ga0495605_0009088 3300046474 Bacteria 5592
210 Ga0495585_0016393 3300046492 Bacteria 4292
211 Ga0495596_0030458 3300046500 Bacteria 2160
212 Ga0495596_0058932 3300046500 Bacteria 1497
213 Ga0495607_0009038 3300046501 Bacteria 6775
214 Ga0495583_0030338 3300046506 Bacteria 2634
215 Ga0495606_0005770 3300046507 Bacteria 11706
216 Ga0495606_0012175 3300046507 Bacteria 6933
217 Ga0495606_0113139 3300046507 Bacteria 1634
218 Ga0495610_0014615 3300046512 Bacteria 4603
219 Ga0495610_0055380 3300046512 Bacteria 1911
220 Ga0495616_0013560 3300046513 Bacteria 4592
221 Ga0495631_0007040 3300046518 Bacteria 5751
222 Ga0495631_0026357 3300046518 Bacteria 2671
223 Ga0495632_0012967 3300046519 Bacteria 4779
224 Ga0495632_0015919 3300046519 Bacteria 4199
225 Ga0495632_0016241 3300046519 Bacteria 4149
226 Ga0495632_0068628 3300046519 Bacteria 1708
227 Ga0495643_0050188 3300046522 Bacteria 2247
228 Ga0495648_0030409 3300046524 Bacteria 3571
229 Ga0495648_0107941 3300046524 Bacteria 1521
230 Ga0495609_0024570 3300046538 Bacteria 2764
231 Ga0495609_0024956 3300046538 Bacteria 2741
232 Ga0495668_0006418 3300046616 Bacteria 7703
233 Ga0495668_0063244 3300046616 Bacteria 2038
234 Ga0495625_0004700 3300046660 Bacteria 12790
235 Ga0495625_0024849 3300046660 Bacteria 4550
236 Ga0495661_0085929 3300046665 Bacteria 1802
237 Ga0495588_0017711 3300046674 Bacteria 3464
238 Ga0495588_0072233 3300046674 Bacteria 1795
239 Ga0495649_0060736 3300046694 Bacteria 2033
240 Ga0495660_0020566 3300046810 Bacteria 3783
241 Ga0495686_0008615 3300047472 Bacteria 7455
242 Ga0495686_0012232 3300047472 Bacteria 6011
243 Ga0495615_0014196 3300048090 Bacteria 1679
244 Ga0496111_0000394 3300048914 Bacteria 21881
245 Ga0496113_0017407 3300048916 Bacteria 4988
246 Ga0496116_0000135 3300048919 Bacteria 153165
247 Ga0496116_0007052 3300048919 Bacteria 10063
248 Ga0496116_0008985 3300048919 Bacteria 8590
249 Ga0496116_0047278 3300048919 Bacteria 2897
250 Ga0496116_0060750 3300048919 Bacteria 2450
251 Ga0496117_0000002 3300048920 Bacteria 2483758
252 Ga0496117_0005789 3300048920 Bacteria 12828
253 Ga0496117_0019647 3300048920 Bacteria 5540
254 Ga0496117_0038440 3300048920 Bacteria 3548
255 Ga0496117_0051623 3300048920 Bacteria 2905
256 Ga0496117_0056416 3300048920 Bacteria 2736
257 Ga0496118_0000245 3300048921 Bacteria 96235
258 Ga0496118_0001947 3300048921 Bacteria 29250
259 Ga0496118_0016979 3300048921 Bacteria 6648
260 Ga0496118_0021547 3300048921 Bacteria 5668
261 Ga0496118_0033180 3300048921 Bacteria 4241
262 Ga0496118_0128324 3300048921 Bacteria 1634
263 Ga0496119_0014030 3300048922 Bacteria 6310
264 Ga0496119_0020457 3300048922 Bacteria 4830
265 Ga0496120_0002647 3300048923 Bacteria 17677
266 Ga0496121_0008148 3300048924 Bacteria 12447
267 Ga0496122_0000001 3300048925 Bacteria 1827766
268 Ga0496122_0000160 3300048925 Bacteria 159236
269 Ga0496122_0001107 3300048925 Bacteria 46550
270 Ga0496122_0013942 3300048925 Bacteria 7813
271 Ga0496122_0090078 3300048925 Bacteria 2094
272 Ga0496123_0000001 3300048926 Bacteria 1831497
273 Ga0496123_0000034 3300048926 Bacteria 274836
274 Ga0496123_0000562 3300048926 Bacteria 63590
275 Ga0496123_0050252 3300048926 Bacteria 2787
276 Ga0496124_0001469 3300048927 Bacteria 34707
277 Ga0496124_0008294 3300048927 Bacteria 10880
278 Ga0496124_0009040 3300048927 Bacteria 10307
279 Ga0496124_0010776 3300048927 Bacteria 9215
280 Ga0496124_0026679 3300048927 Bacteria 5205
281 Ga0496124_0035334 3300048927 Bacteria 4373
282 Ga0496124_0084609 3300048927 Bacteria 2600
283 Ga0496124_0111089 3300048927 Bacteria 2205
284 Ga0496124_0126084 3300048927 Bacteria 2039
285 Ga0496125_0000001 3300048928 Bacteria 1766138
286 Ga0496125_0001370 3300048928 Bacteria 35861
287 Ga0496125_0014927 3300048928 Bacteria 7543
288 Ga0496125_0022637 3300048928 Bacteria 5829
289 Ga0496126_0004454 3300048929 Bacteria 16733
290 Ga0496126_0006054 3300048929 Bacteria 13575
291 Ga0496126_0078445 3300048929 Bacteria 2926
292 Ga0496126_0139511 3300048929 Bacteria 2088
293 Ga0496126_0164161 3300048929 Bacteria 1896
294 Ga0496126_0211428 3300048929 Bacteria 1633
295 Ga0495678_011947 3300049459 Bacteria 4135
296 Ga0501034_0202779 3300049571 Bacteria 1941
297 nmdc:mga03683_3618_c1 3300050489 Bacteria 5019
298 nmdc:mga03n38_8957_c1 3300050490 Bacteria 3615
299 nmdc:mga00v17_8024_c1 3300050491 Bacteria 5666
300 nmdc:mga0yw44_577_c1 3300050492 Bacteria 13274
301 nmdc:mga0yw44_659_c2 3300050492 Bacteria 9627
302 nmdc:mga0yw44_94411_c1 3300050492 Bacteria 1896
303 nmdc:mga0k408_28833_c1 3300050493 Bacteria 3157
304 nmdc:mga06z11_50021_c1 3300050494 Bacteria 2135
305 nmdc:mga07m45_557_c1 3300050496 Bacteria 15870
306 nmdc:mga0sz30_406_c1 3300050516 Bacteria 16442
307 nmdc:mga0sz30_75082_c1 3300050516 Bacteria 1459
308 Ga0500557_000859 3300053105 Bacteria 4448
309 Ga0500560_013728 3300053107 Bacteria 2139
310 Ga0500569_010302 3300053109 Bacteria 2197
311 Ga0500569_022703 3300053109 Bacteria 1675
312 Ga0500572_001740 3300053111 Bacteria 5648
313 Ga0500594_0002647 3300053118 Bacteria 3891
314 Ga0500618_000652 3300053125 Bacteria 20638
315 Ga0500618_001564 3300053125 Bacteria 9997
316 Ga0500618_020867 3300053125 Bacteria 1602
317 Ga0500618_022713 3300053125 Bacteria 1522
318 Ga0500658_0002179 3300053134 Bacteria 7611
319 Ga0500561_0001461 3300053137 Bacteria 3837
320 Ga0500568_0009346 3300053139 Bacteria 4664
321 Ga0500573_0001777 3300053140 Bacteria 10482
322 Ga0500573_0048703 3300053140 Bacteria 2439
323 Ga0500616_0000744 3300053153 Bacteria 37551
324 Ga0500616_0002152 3300053153 Bacteria 17051
325 Ga0500636_0002001 3300053177 Bacteria 11214
326 Ga0500636_0057718 3300053177 Bacteria 2271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10055400 rootH1_100554003 288
2 3300048927 Ga0496124_0008294 Ga0496124_0008294_7228_8418 309
3 3300048929 Ga0496126_0006054 Ga0496126_0006054_9891_11081 309
4 3300003187 JGI25151J46595_10003890 JGI25151J46595_100038904 310
5 3300025294 Ga0209025_1000149 Ga0209025_1000149127 310
6 3300048920 Ga0496117_0005789 Ga0496117_0005789_2495_3685 310
7 3300048925 Ga0496122_0001107 Ga0496122_0001107_34801_35991 310
8 3300048926 Ga0496123_0000562 Ga0496123_0000562_10588_11778 310
9 3300048928 Ga0496125_0001370 Ga0496125_0001370_24349_25539 310
10 3300049571 Ga0501034_0202779 Ga0501034_0202779_307_1503 318
11 3300003856 Ga0058692_1001313 Ga0058692_10013133 322
12 3300003856 Ga0058692_1001398 Ga0058692_10013985 322
13 3300013102 Ga0157371_10004099 Ga0157371_1000409910 322
14 3300013307 Ga0157372_10137334 Ga0157372_101373342 322
15 3300027312 Ga0209371_1004245 Ga0209371_10042455 322
16 3300030500 Ga0268256_1003348 Ga0268256_10033486 322
17 3300048919 Ga0496116_0000135 Ga0496116_0000135_48535_49725 322
18 3300048927 Ga0496124_0084609 Ga0496124_0084609_919_2109 322
19 3300048929 Ga0496126_0004454 Ga0496126_0004454_10894_12084 322
20 3300028794 Ga0307515_10000070 Ga0307515_10000070113 323
21 3300031456 Ga0307513_10079586 Ga0307513_100795863 323
22 iso_pu_bacteria 2921296804 2921302466 324
23 3300006948 Ga0099826_10135140 Ga0099826_101351401 325
24 3300013100 Ga0157373_10003799 Ga0157373_1000379911 325
25 3300013104 Ga0157370_10025995 Ga0157370_100259955 325
26 3300013105 Ga0157369_10023128 Ga0157369_100231282 325
27 3300006186 Ga0075369_10032682 Ga0075369_100326822 326
28 3300030744 Ga0316181_1139163 Ga0316181_11391632 326
29 iso_pu_bacteria 8005556819 8005562568 327
30 3300021320 Ga0214544_1000017 Ga0214544_1000017118 328
31 3300021321 Ga0214542_1000006 Ga0214542_1000006112 328
32 3300021327 Ga0214543_1000014 Ga0214543_1000014211 328
33 3300003187 JGI25151J46595_10028687 JGI25151J46595_100286872 330
34 3300025294 Ga0209025_1001502 Ga0209025_10015022 330
35 3300046674 Ga0495588_0017711 Ga0495588_0017711_1199_2389 330
36 3300046506 Ga0495583_0030338 Ga0495583_0030338_729_1889 332
37 3300048929 Ga0496126_0139511 Ga0496126_0139511_337_1533 332
38 3300002773 JGI25152J39213_1004889 JGI25152J39213_10048893 334
39 3300003771 Ga0055526_1014812 Ga0055526_10148122 334
40 3300003775 Ga0055524_1012369 Ga0055524_10123693 334
41 3300005347 Ga0070668_100105687 Ga0070668_1001056872 334
42 3300005355 Ga0070671_100123978 Ga0070671_1001239782 334
43 3300006038 Ga0075365_10004096 Ga0075365_100040965 334
44 3300009766 Ga0123342_1008432 Ga0123342_10084325 334
45 3300025294 Ga0209025_1005521 Ga0209025_10055212 335
46 3300025931 Ga0207644_10085012 Ga0207644_100850122 335
47 3300025972 Ga0207668_10178547 Ga0207668_101785472 335
48 3300046460 Ga0495638_0002549 Ga0495638_0002549_3082_4242 335
49 3300046474 Ga0495605_0008724 Ga0495605_0008724_2975_4135 335
50 3300046513 Ga0495616_0013560 Ga0495616_0013560_3050_4210 335
51 3300046518 Ga0495631_0007040 Ga0495631_0007040_1518_2678 335
52 3300046519 Ga0495632_0012967 Ga0495632_0012967_1904_3064 335
53 3300046519 Ga0495632_0016241 Ga0495632_0016241_315_1475 335
54 3300046538 Ga0495609_0024956 Ga0495609_0024956_1079_2239 335
55 3300046616 Ga0495668_0006418 Ga0495668_0006418_3562_4722 335
56 3300046660 Ga0495625_0004700 Ga0495625_0004700_1289_2449 335
57 3300048927 Ga0496124_0001469 Ga0496124_0001469_19019_20209 335
58 3300049459 Ga0495678_011947 Ga0495678_011947_1599_2759 335
59 3300053105 Ga0500557_000859 Ga0500557_000859_2915_4075 335
60 3300053118 Ga0500594_0002647 Ga0500594_0002647_1505_2665 335
61 3300053139 Ga0500568_0009346 Ga0500568_0009346_579_1739 335
62 3300053153 Ga0500616_0000744 Ga0500616_0000744_33309_34469 335
63 3300005548 Ga0070665_100105338 Ga0070665_1001053382 336
64 3300006042 Ga0075368_10000164 Ga0075368_1000016418 336
65 3300006048 Ga0075363_100118517 Ga0075363_1001185171 336
66 3300006178 Ga0075367_10034147 Ga0075367_100341472 336
67 3300006195 Ga0075366_10022091 Ga0075366_100220912 336
68 3300013102 Ga0157371_10000073 Ga0157371_1000007361 336
69 3300013104 Ga0157370_10003764 Ga0157370_1000376413 336
70 3300027866 Ga0209813_10029768 Ga0209813_100297681 336
71 3300028379 Ga0268266_10052403 Ga0268266_100524032 336
72 3300046674 Ga0495588_0072233 Ga0495588_0072233_84_1244 336
73 3300048916 Ga0496113_0017407 Ga0496113_0017407_1280_2470 336
74 3300048919 Ga0496116_0047278 Ga0496116_0047278_824_2014 336
75 3300048920 Ga0496117_0000002 Ga0496117_0000002_1423434_1424624 336
76 3300048921 Ga0496118_0000245 Ga0496118_0000245_90502_91692 336
77 3300048923 Ga0496120_0002647 Ga0496120_0002647_8982_10172 336
78 3300048925 Ga0496122_0000001 Ga0496122_0000001_794223_795413 336
79 3300048926 Ga0496123_0000001 Ga0496123_0000001_797954_799144 336
80 3300048927 Ga0496124_0026679 Ga0496124_0026679_509_1699 336
81 3300048929 Ga0496126_0164161 Ga0496126_0164161_105_1295 336
82 3300050489 nmdc:mga03683_3618_c1 nmdc:mga03683_3618_c1_1309_2499 336
83 3300050490 nmdc:mga03n38_8957_c1 nmdc:mga03n38_8957_c1_2321_3511 336
84 3300050491 nmdc:mga00v17_8024_c1 nmdc:mga00v17_8024_c1_656_1846 336
85 3300050492 nmdc:mga0yw44_659_c2 nmdc:mga0yw44_659_c2_2429_3619 336
86 3300050493 nmdc:mga0k408_28833_c1 nmdc:mga0k408_28833_c1_1390_2580 336
87 3300050494 nmdc:mga06z11_50021_c1 nmdc:mga06z11_50021_c1_21_1211 336
88 3300050516 nmdc:mga0sz30_406_c1 nmdc:mga0sz30_406_c1_11855_13045 336
89 3300053137 Ga0500561_0001461 Ga0500561_0001461_1653_2843 336
90 3300041413 Ga0439465_0007519 Ga0439465_0007519_1768_2955 337
91 3300053125 Ga0500618_020867 Ga0500618_020867_405_1565 337
92 iso_pu_bacteria 2960652885 2960659153 337
93 3300006946 Ga0079104_1000032 Ga0079104_1000032152 338
94 3300027111 Ga0209281_1000053 Ga0209281_1000053259 338
95 3300046519 Ga0495632_0068628 Ga0495632_0068628_436_1596 338
96 3300047472 Ga0495686_0012232 Ga0495686_0012232_3703_4863 338
97 3300053140 Ga0500573_0001777 Ga0500573_0001777_4031_5224 338
98 3300025303 Ga0209051_1027343 Ga0209051_10273432 339
99 3300003790 Ga0055528_1005026 Ga0055528_10050264 340
100 3300041498 Ga0451841_0751739 Ga0451841_0751739_217_1407 340
101 3300048919 Ga0496116_0060750 Ga0496116_0060750_285_1445 340
102 3300048920 Ga0496117_0051623 Ga0496117_0051623_1556_2716 340
103 3300048921 Ga0496118_0016979 Ga0496118_0016979_3486_4646 340
104 3300048927 Ga0496124_0010776 Ga0496124_0010776_7219_8379 340
105 3300006948 Ga0099826_10000755 Ga0099826_100007556 341
106 3300025273 Ga0209673_1003617 Ga0209673_10036178 341
107 3300025297 Ga0209758_1001204 Ga0209758_100120433 341
108 3300025299 Ga0209256_1008291 Ga0209256_10082913 341
109 3300025303 Ga0209051_1026425 Ga0209051_10264253 341
110 3300027666 Ga0209282_1000629 Ga0209282_10006296 341
111 3300041496 Ga0451839_0077661 Ga0451839_0077661_3087_4274 341
112 3300046474 Ga0495605_0009088 Ga0495605_0009088_3741_4928 341
113 3300046500 Ga0495596_0058932 Ga0495596_0058932_31_1218 341
114 3300046501 Ga0495607_0009038 Ga0495607_0009038_1369_2556 341
115 3300046507 Ga0495606_0005770 Ga0495606_0005770_4703_5890 341
116 3300046507 Ga0495606_0113139 Ga0495606_0113139_260_1420 341
117 3300046512 Ga0495610_0014615 Ga0495610_0014615_1142_2329 341
118 3300046518 Ga0495631_0026357 Ga0495631_0026357_693_1880 341
119 3300046519 Ga0495632_0015919 Ga0495632_0015919_2114_3301 341
120 3300046524 Ga0495648_0030409 Ga0495648_0030409_1011_2198 341
121 3300046538 Ga0495609_0024570 Ga0495609_0024570_507_1694 341
122 3300046616 Ga0495668_0063244 Ga0495668_0063244_80_1267 341
123 3300046810 Ga0495660_0020566 Ga0495660_0020566_529_1716 341
124 3300047472 Ga0495686_0008615 Ga0495686_0008615_5947_7134 341
125 3300048920 Ga0496117_0056416 Ga0496117_0056416_1095_2285 341
126 3300048921 Ga0496118_0001947 Ga0496118_0001947_10757_11920 341
127 3300048921 Ga0496118_0128324 Ga0496118_0128324_89_1279 341
128 3300048928 Ga0496125_0022637 Ga0496125_0022637_4064_5254 341
129 3300050492 nmdc:mga0yw44_94411_c1 nmdc:mga0yw44_94411_c1_383_1546 341
130 3300053109 Ga0500569_010302 Ga0500569_010302_195_1382 341
131 3300003781 Ga0055536_1003165 Ga0055536_10031654 342
132 3300003792 Ga0055540_1002411 Ga0055540_10024112 342
133 3300003794 Ga0055531_10004085 Ga0055531_100040852 342
134 3300025297 Ga0209758_1000939 Ga0209758_10009393 342
135 3300025298 Ga0209050_1011188 Ga0209050_10111883 342
136 3300025303 Ga0209051_1002367 Ga0209051_10023676 342
137 3300025304 Ga0209257_1003382 Ga0209257_10033829 342
138 3300006178 Ga0075367_10000115 Ga0075367_1000011512 343
139 3300006186 Ga0075369_10000591 Ga0075369_1000059112 343
140 3300011119 Ga0105246_10175947 Ga0105246_101759472 343
141 3300013102 Ga0157371_10176900 Ga0157371_101769001 343
142 3300046660 Ga0495625_0024849 Ga0495625_0024849_612_1772 343
143 3300048919 Ga0496116_0007052 Ga0496116_0007052_2109_3269 343
144 3300048919 Ga0496116_0008985 Ga0496116_0008985_2653_3813 343
145 3300048924 Ga0496121_0008148 Ga0496121_0008148_2997_4157 343
146 3300048925 Ga0496122_0013942 Ga0496122_0013942_3931_5091 343
147 3300048926 Ga0496123_0050252 Ga0496123_0050252_1245_2405 343
148 3300048927 Ga0496124_0009040 Ga0496124_0009040_7792_8952 343
149 3300048928 Ga0496125_0014927 Ga0496125_0014927_5849_7009 343
150 3300048929 Ga0496126_0078445 Ga0496126_0078445_1541_2701 343
151 3300053125 Ga0500618_022713 Ga0500618_022713_190_1380 343
152 3300025258 Ga0209129_1002764 Ga0209129_10027645 344
153 3300025273 Ga0209673_1004259 Ga0209673_10042594 344
154 3300025294 Ga0209025_1009695 Ga0209025_10096954 344
155 3300025295 Ga0209564_1011415 Ga0209564_10114153 344
156 3300025941 Ga0207711_10105693 Ga0207711_101056933 344
157 3300026067 Ga0207678_10079620 Ga0207678_100796203 344
158 3300048922 Ga0496119_0020457 Ga0496119_0020457_1163_2350 344
159 3300048927 Ga0496124_0126084 Ga0496124_0126084_160_1347 344
160 3300031995 Ga0307409_100375956 Ga0307409_1003759561 345
161 3300041404 Ga0439436_0008469 Ga0439436_0008469_1055_2248 345
162 3300042007 Ga0439449_0010462 Ga0439449_0010462_1035_2225 345
163 iso_pu_bacteria 2509276021 2509390620 345
164 iso_pu_bacteria 2509276033 2509442185 345
165 iso_pu_bacteria 2515154134 2515738363 345
166 iso_pu_bacteria 2516653085 2517080406 345
167 iso_pu_bacteria 2585427526 2585526732 345
168 iso_pu_bacteria 2585427528 2585543170 345
169 iso_pu_bacteria 2585427593 2585841536 345
170 iso_pu_bacteria 2718217882 2719184912 345
171 iso_pu_bacteria 2718217927 2719389435 345
172 iso_pu_bacteria 2718217997 2719668913 345
173 iso_pu_bacteria 2718218009 2719728932 345
174 iso_pu_bacteria 2718218199 2720489606 345
175 iso_pu_bacteria 2718218232 2720610326 345
176 iso_pu_bacteria 2718218233 2720617745 345
177 iso_pu_bacteria 2718218235 2720628887 345
178 iso_pu_bacteria 2718218269 2720772836 345
179 iso_pu_bacteria 2718218363 2721144623 345
180 iso_pu_bacteria 2718218365 2721156135 345
181 iso_pu_bacteria 2718218366 2721161993 345
182 iso_pu_bacteria 2718218423 2721402203 345
183 iso_pu_bacteria 2721755514 2722843138 345
184 iso_pu_bacteria 2721755556 2723030280 345
185 iso_pu_bacteria 2721755684 2723564641 345
186 iso_pu_bacteria 2721755685 2723569674 345
187 iso_pu_bacteria 2721755809 2724036036 345
188 iso_pu_bacteria 2721755810 2724041957 345
189 iso_pu_bacteria 2721755819 2724092865 345
190 iso_pu_bacteria 2721755822 2724101221 345
191 iso_pu_bacteria 2721755823 2724113253 345
192 iso_pu_bacteria 2728369352 2730110813 345
193 iso_pu_bacteria 2728369365 2730161027 345
194 iso_pu_bacteria 2728369397 2730295668 345
195 iso_pu_bacteria 2738541333 2739035238 345
196 iso_pu_bacteria 2765235942 2766068989 345
197 iso_pu_bacteria 2791355256 2793297321 345
198 iso_pu_bacteria 2791355259 2793315121 345
199 iso_pu_bacteria 2791355262 2793334175 345
200 iso_pu_bacteria 2791355263 2793342187 345
201 iso_pu_bacteria 2791355264 2793345800 345
202 iso_pu_bacteria 2791355265 2793354526 345
203 iso_pu_bacteria 2791355266 2793360189 345
204 iso_pu_bacteria 2791355267 2793368662 345
205 iso_pu_bacteria 2802429605 2805930218 345
206 iso_pu_bacteria 2802429606 2805934757 345
207 iso_pu_bacteria 2802429633 2806048140 345
208 iso_pu_bacteria 2802429634 2806054676 345
209 iso_pu_bacteria 2802429635 2806060684 345
210 iso_pu_bacteria 2802429636 2806069396 345
211 iso_pu_bacteria 2802429637 2806076969 345
212 iso_pu_bacteria 2838016132 2838017005 345
213 iso_pu_bacteria 2838042994 2838044188 345
214 iso_pu_bacteria 2838048938 2838050220 345
215 iso_pu_bacteria 2838061910 2838062287 345
216 iso_pu_bacteria 2838068647 2838069341 345
217 iso_pu_bacteria 2838668709 2838673065 345
218 iso_pu_bacteria 2838680041 2838684632 345
219 iso_pu_bacteria 2838686498 2838690581 345
220 iso_pu_bacteria 2838694306 2838698794 345
221 iso_pu_bacteria 2838701080 2838705731 345
222 iso_pu_bacteria 2838707686 2838712326 345
223 iso_pu_bacteria 2838729681 2838733062 345
224 iso_pu_bacteria 2838742623 2838747349 345
225 iso_pu_bacteria 2841851746 2841855502 345
226 iso_pu_bacteria 2841864319 2841866066 345
227 iso_pu_bacteria 2842110456 2842116486 345
228 iso_pu_bacteria 2842118031 2842122725 345
229 iso_pu_bacteria 2842156927 2842160791 345
230 iso_pu_bacteria 2842163707 2842164314 345
231 iso_pu_bacteria 2842180545 2842184407 345
232 iso_pu_bacteria 2842192696 2842196685 345
233 iso_pu_bacteria 2842205361 2842209175 345
234 iso_pu_bacteria 2842229732 2842231990 345
235 iso_pu_bacteria 2842237096 2842241738 345
236 iso_pu_bacteria 2842243621 2842248609 345
237 iso_pu_bacteria 2842250916 2842255411 345
238 iso_pu_bacteria 2842257432 2842262584 345
239 iso_pu_bacteria 2842264693 2842264711 345
240 iso_pu_bacteria 2842271015 2842275105 345
241 iso_pu_bacteria 2842278818 2842282779 345
242 iso_pu_bacteria 2842291075 2842295752 345
243 iso_pu_bacteria 2842304105 2842307459 345
244 iso_pu_bacteria 2842311132 2842312876 345
245 iso_pu_bacteria 2842317721 2842320415 345
246 iso_pu_bacteria 2842341865 2842341963 345
247 iso_pu_bacteria 2842363717 2842364315 345
248 iso_pu_bacteria 2842370503 2842374367 345
249 iso_pu_bacteria 2842377471 2842382156 345
250 iso_pu_bacteria 2842384541 2842389273 345
251 iso_pu_bacteria 2842395702 2842397062 345
252 iso_pu_bacteria 2842402390 2842405578 345
253 iso_pu_bacteria 2842409023 2842412162 345
254 iso_pu_bacteria 2842415677 2842418808 345
255 iso_pu_bacteria 2842422224 2842422532 345
256 iso_pu_bacteria 2842428310 2842429235 345
257 iso_pu_bacteria 2842434925 2842435849 345
258 iso_pu_bacteria 2842441272 2842441290 345
259 iso_pu_bacteria 2842447887 2842449694 345
260 iso_pu_bacteria 2842462802 2842463656 345
261 iso_pu_bacteria 2842469257 2842470178 345
262 iso_pu_bacteria 2842489311 2842489375 345
263 iso_pu_bacteria 2842495871 2842497966 345
264 iso_pu_bacteria 2844454524 2844460237 345
265 iso_pu_bacteria 2891373044 2891377009 345
266 iso_pu_bacteria 2929138655 2929139578 345
267 iso_pu_bacteria 2933570622 2933573885 345
268 iso_pu_bacteria 2933586486 2933592703 345
269 iso_pu_bacteria 2933599457 2933600003 345
270 iso_pu_bacteria 2935894831 2935898711 345
271 iso_pu_bacteria 2935901341 2935906225 345
272 iso_pu_bacteria 2936367885 2936374580 345
273 iso_pu_bacteria 2936375103 2936375984 345
274 iso_pu_bacteria 2936381700 2936385317 345
275 iso_pu_bacteria 2989349275 2989354087 345
276 iso_pu_bacteria 2996893221 2996897541 345
277 iso_pu_bacteria 3003930520 3003932751 345
278 iso_pu_bacteria 8005275841 8005277778 345
279 iso_pu_bacteria 8005282627 8005285898 345
280 iso_pu_bacteria 8005289223 8005295328 345
281 iso_pu_bacteria 8005307578 8005308184 345
282 iso_pu_bacteria 8005376324 8005380658 345
283 iso_pu_bacteria 8005382845 8005383333 345
284 iso_pu_bacteria 8005395548 8005398927 345
285 iso_pu_bacteria 8005430974 8005434396 345
286 iso_pu_bacteria 8005497431 8005502064 345
287 iso_pu_bacteria 8005563573 8005566343 345
288 iso_pu_bacteria 8005570704 8005571395 345
289 iso_pu_bacteria 8005619151 8005624346 345
290 iso_pu_bacteria 8005626139 8005629608 345
291 iso_pu_bacteria 8005668836 8005673487 345
292 iso_pu_bacteria 8005695170 8005697890 345
293 iso_pu_bacteria 8018163183 8018163616 345
294 iso_pu_bacteria 8018176218 8018176338 345
295 iso_pu_bacteria 8023680758 8023681683 345
296 iso_pu_bacteria 8024501048 8024502903 345
297 iso_pu_bacteria 8054558443 8054563102 345
298 iso_pu_bacteria 8056375014 8056378002 345
299 iso_pu_bacteria 8056382006 8056382269 345
300 iso_pu_bacteria 2537561587 2537874145 346
301 iso_pu_bacteria 2554235003 2554247175 346
302 iso_pu_bacteria 2558860242 2559294399 346
303 iso_pu_bacteria 2599185210 2599602532 346
304 iso_pu_bacteria 2600255279 2601608612 346
305 iso_pu_bacteria 2600255308 2601745386 346
306 iso_pu_bacteria 2643221568 2643853623 346
307 iso_pu_bacteria 2643221582 2643918780 346
308 iso_pu_bacteria 2643221693 2644518683 346
309 iso_pu_bacteria 2808606387 2808985828 346
310 iso_pu_bacteria 2818991439 2819555944 346
311 iso_pu_bacteria 2838675328 2838676662 346
312 iso_pu_bacteria 2838714209 2838715546 346
313 iso_pu_bacteria 2838719591 2838720654 346
314 iso_pu_bacteria 2838724970 2838726302 346
315 iso_pu_bacteria 2841846520 2841847585 346
316 iso_pu_bacteria 2841859092 2841859877 346
317 iso_pu_bacteria 2842124991 2842126385 346
318 iso_pu_bacteria 2842130223 2842131555 346
319 iso_pu_bacteria 2842152218 2842153276 346
320 iso_pu_bacteria 2842170452 2842171789 346
321 iso_pu_bacteria 2842175837 2842176895 346
322 iso_pu_bacteria 2842187318 2842188654 346
323 iso_pu_bacteria 2842211629 2842212965 346
324 iso_pu_bacteria 2842224351 2842225416 346
325 iso_pu_bacteria 2842515876 2842516662 346
326 iso_pu_bacteria 2899792073 2899796672 346
327 iso_pu_bacteria 2899845264 2899847021 346
328 iso_pu_bacteria 2919114240 2919115750 346
329 iso_pu_bacteria 2919166419 2919168054 346
330 iso_pu_bacteria 2926754445 2926756689 346
331 iso_pu_bacteria 2926760298 2926760937 346
332 iso_pu_bacteria 2933006813 2933007919 346
333 iso_pu_bacteria 2933011516 2933012696 346
334 iso_pu_bacteria 2933594066 2933595131 346
335 iso_pu_bacteria 2978969890 2978970724 346
336 iso_pu_bacteria 2979095461 2979098830 346
337 iso_pu_bacteria 2979100975 2979105764 346
338 iso_pu_bacteria 2984509177 2984512389 346
339 iso_pu_bacteria 2984518228 2984521249 346
340 iso_pu_bacteria 2984537506 2984540544 346
341 iso_pu_bacteria 2984587000 2984587832 346
342 iso_pu_bacteria 2984601300 2984602740 346
343 iso_pu_bacteria 650716007 650739596 346
344 iso_pu_bacteria 8003570095 8003570650 346
345 iso_pu_bacteria 8054460903 8054461957 346
346 iso_pu_bacteria 8056875544 8056876518 346
347 3300053125 Ga0500618_001564 Ga0500618_001564_6987_8189 347
348 iso_pu_bacteria 2508501122 2509108585 347
349 iso_pu_bacteria 2509276019 2509374388 347
350 iso_pu_bacteria 2510065057 2510305094 347
351 iso_pu_bacteria 2510917026 2511171143 347
352 iso_pu_bacteria 2511231052 2511501086 347
353 iso_pu_bacteria 2512047086 2512532493 347
354 iso_pu_bacteria 2512875026 2512972170 347
355 iso_pu_bacteria 2513237086 2513582861 347
356 iso_pu_bacteria 2513237089 2513604844 347
357 iso_pu_bacteria 2513237091 2513616249 347
358 iso_pu_bacteria 2513237140 2513881028 347
359 iso_pu_bacteria 2513237143 2513902264 347
360 iso_pu_bacteria 2513237156 2513987530 347
361 iso_pu_bacteria 2513237159 2514001945 347
362 iso_pu_bacteria 2513237160 2514008551 347
363 iso_pu_bacteria 2515154107 2515608195 347
364 iso_pu_bacteria 2516143018 2516208949 347
365 iso_pu_bacteria 2516653046 2516892367 347
366 iso_pu_bacteria 2517487022 2517569164 347
367 iso_pu_bacteria 2524023207 2524451066 347
368 iso_pu_bacteria 2551306084 2551680449 347
369 iso_pu_bacteria 2551306085 2551683835 347
370 iso_pu_bacteria 2551306086 2551691313 347
371 iso_pu_bacteria 2551306087 2551698082 347
372 iso_pu_bacteria 2551306089 2551713149 347
373 iso_pu_bacteria 2551306090 2551715849 347
374 iso_pu_bacteria 2551306091 2551730358 347
375 iso_pu_bacteria 2551306092 2551732297 347
376 iso_pu_bacteria 2551306093 2551746241 347
377 iso_pu_bacteria 2558860100 2558863415 347
378 iso_pu_bacteria 2582581283 2585165632 347
379 iso_pu_bacteria 2582581306 2585266094 347
380 iso_pu_bacteria 2582581865 2585387094 347
381 iso_pu_bacteria 2582581866 2585392785 347
382 iso_pu_bacteria 2585427633 2585995183 347
383 iso_pu_bacteria 2585427634 2585999735 347
384 iso_pu_bacteria 2643221607 2644046492 347
385 iso_pu_bacteria 2643221618 2644108919 347
386 iso_pu_bacteria 2643221626 2644151441 347
387 iso_pu_bacteria 2643221636 2644200845 347
388 iso_pu_bacteria 2643221637 2644206131 347
389 iso_pu_bacteria 2643221653 2644296762 347
390 iso_pu_bacteria 2643221655 2644311575 347
391 iso_pu_bacteria 2643221659 2644329833 347
392 iso_pu_bacteria 2643221686 2644479282 347
393 iso_pu_bacteria 2643221688 2644493334 347
394 iso_pu_bacteria 2643221689 2644502331 347
395 iso_pu_bacteria 2643221698 2644546507 347
396 iso_pu_bacteria 2643221712 2644617374 347
397 iso_pu_bacteria 2643221718 2644649778 347
398 iso_pu_bacteria 2643221719 2644655016 347
399 iso_pu_bacteria 2657244999 2657683194 347
400 iso_pu_bacteria 2690316117 2692316757 347
401 iso_pu_bacteria 2751185821 2753460873 347
402 iso_pu_bacteria 2775507049 2776912893 347
403 iso_pu_bacteria 2791355082 2792584233 347
404 iso_pu_bacteria 2791355094 2792638279 347
405 iso_pu_bacteria 2802428858 2802719182 347
406 iso_pu_bacteria 2802428859 2802723264 347
407 iso_pu_bacteria 2802428860 2802732377 347
408 iso_pu_bacteria 2802428861 2802738705 347
409 iso_pu_bacteria 2802428862 2802745243 347
410 iso_pu_bacteria 2802428863 2802751680 347
411 iso_pu_bacteria 2802429268 2804751418 347
412 iso_pu_bacteria 2821123053 2821124348 347
413 iso_pu_bacteria 2838074704 2838076510 347
414 iso_pu_bacteria 2838736955 2838741157 347
415 iso_pu_bacteria 2841840854 2841844946 347
416 iso_pu_bacteria 2842140634 2842144668 347
417 iso_pu_bacteria 2842521101 2842526281 347
418 iso_pu_bacteria 2844163670 2844168439 347
419 iso_pu_bacteria 2847417321 2847418177 347
420 iso_pu_bacteria 2848992105 2848993152 347
421 iso_pu_bacteria 2850079185 2850080546 347
422 iso_pu_bacteria 2854896431 2854897248 347
423 iso_pu_bacteria 2854916844 2854922122 347
424 iso_pu_bacteria 2855825444 2855831439 347
425 iso_pu_bacteria 2855839649 2855840563 347
426 iso_pu_bacteria 2855872281 2855878868 347
427 iso_pu_bacteria 2857531043 2857531928 347
428 iso_pu_bacteria 2858800743 2858801090 347
429 iso_pu_bacteria 2896384573 2896386710 347
430 iso_pu_bacteria 2899803654 2899803844 347
431 iso_pu_bacteria 2913295892 2913297373 347
432 iso_pu_bacteria 2915980308 2915985874 347
433 iso_pu_bacteria 2915986958 2915987361 347
434 iso_pu_bacteria 2915993759 2915996144 347
435 iso_pu_bacteria 2916000859 2916006807 347
436 iso_pu_bacteria 2916007675 2916013990 347
437 iso_pu_bacteria 2916014648 2916020259 347
438 iso_pu_bacteria 2916021584 2916025168 347
439 iso_pu_bacteria 2916028427 2916032653 347
440 iso_pu_bacteria 2916035215 2916038882 347
441 iso_pu_bacteria 2916041962 2916044493 347
442 iso_pu_bacteria 2916048683 2916049599 347
443 iso_pu_bacteria 2916055098 2916055243 347
444 iso_pu_bacteria 2916061851 2916067232 347
445 iso_pu_bacteria 2916068649 2916072397 347
446 iso_pu_bacteria 2916076590 2916082334 347
447 iso_pu_bacteria 2919171160 2919171348 347
448 iso_pu_bacteria 2920760137 2920762806 347
449 iso_pu_bacteria 2920822456 2920823918 347
450 iso_pu_bacteria 2921201388 2921203941 347
451 iso_pu_bacteria 2921208531 2921214149 347
452 iso_pu_bacteria 2921237296 2921243441 347
453 iso_pu_bacteria 2921244191 2921246211 347
454 iso_pu_bacteria 2921250672 2921251456 347
455 iso_pu_bacteria 2921257292 2921257901 347
456 iso_pu_bacteria 2921263974 2921264120 347
457 iso_pu_bacteria 2921282425 2921286264 347
458 iso_pu_bacteria 2921289301 2921289967 347
459 iso_pu_bacteria 2924144063 2924146570 347
460 iso_pu_bacteria 2924150972 2924151213 347
461 iso_pu_bacteria 2924158325 2924160690 347
462 iso_pu_bacteria 2924165586 2924171728 347
463 iso_pu_bacteria 2924172951 2924177509 347
464 iso_pu_bacteria 2924179722 2924185280 347
465 iso_pu_bacteria 2924186466 2924188735 347
466 iso_pu_bacteria 2924193448 2924196648 347
467 iso_pu_bacteria 2924200457 2924203037 347
468 iso_pu_bacteria 2924207177 2924212617 347
469 iso_pu_bacteria 2924214083 2924220476 347
470 iso_pu_bacteria 2924221636 2924224723 347
471 iso_pu_bacteria 2924228884 2924230306 347
472 iso_pu_bacteria 2936996657 2937000987 347
473 iso_pu_bacteria 2937002841 2937004332 347
474 iso_pu_bacteria 2937009748 2937011085 347
475 iso_pu_bacteria 2937016420 2937019417 347
476 iso_pu_bacteria 2937023124 2937028517 347
477 iso_pu_bacteria 2937029754 2937030497 347
478 iso_pu_bacteria 2937036028 2937040897 347
479 iso_pu_bacteria 2937042894 2937048302 347
480 iso_pu_bacteria 2937049772 2937052070 347
481 iso_pu_bacteria 2937056579 2937059188 347
482 iso_pu_bacteria 2937063883 2937067824 347
483 iso_pu_bacteria 2937071275 2937073927 347
484 iso_pu_bacteria 2937078374 2937082857 347
485 iso_pu_bacteria 2937084907 2937091466 347
486 iso_pu_bacteria 2937091812 2937095706 347
487 iso_pu_bacteria 2937098957 2937104101 347
488 iso_pu_bacteria 2937106411 2937110718 347
489 iso_pu_bacteria 2937113482 2937113982 347
490 iso_pu_bacteria 2937119839 2937125480 347
491 iso_pu_bacteria 2937126314 2937126746 347
492 iso_pu_bacteria 2941499720 2941500140 347
493 iso_pu_bacteria 2957375807 2957380494 347
494 iso_pu_bacteria 2957382221 2957382763 347
495 iso_pu_bacteria 2957388812 2957389015 347
496 iso_pu_bacteria 2957395598 2957398319 347
497 iso_pu_bacteria 2957402308 2957407550 347
498 iso_pu_bacteria 2957408893 2957409695 347
499 iso_pu_bacteria 2957415311 2957418867 347
500 iso_pu_bacteria 2957422303 2957423606 347
501 iso_pu_bacteria 2957430029 2957432555 347
502 iso_pu_bacteria 2957437181 2957438916 347
503 iso_pu_bacteria 2957443900 2957449559 347
504 iso_pu_bacteria 2957450854 2957456571 347
505 iso_pu_bacteria 2957457609 2957463355 347
506 iso_pu_bacteria 2957464669 2957466615 347
507 iso_pu_bacteria 2957471148 2957473189 347
508 iso_pu_bacteria 2957478035 2957479903 347
509 iso_pu_bacteria 2957484790 2957486092 347
510 iso_pu_bacteria 2957491536 2957495796 347
511 iso_pu_bacteria 2957498199 2957503570 347
512 iso_pu_bacteria 2957505466 2957509238 347
513 iso_pu_bacteria 2960584000 2960590032 347
514 iso_pu_bacteria 2960591022 2960596032 347
515 iso_pu_bacteria 2960597568 2960598954 347
516 iso_pu_bacteria 2960603979 2960608546 347
517 iso_pu_bacteria 2960610863 2960611893 347
518 iso_pu_bacteria 2960617483 2960617818 347
519 iso_pu_bacteria 2960624210 2960626877 347
520 iso_pu_bacteria 2960631154 2960636281 347
521 iso_pu_bacteria 2960637947 2960643206 347
522 iso_pu_bacteria 2960645483 2960645776 347
523 iso_pu_bacteria 2960660292 2960666264 347
524 iso_pu_bacteria 2960667422 2960668708 347
525 iso_pu_bacteria 2960674078 2960677488 347
526 iso_pu_bacteria 2960680706 2960684903 347
527 iso_pu_bacteria 2960687367 2960689085 347
528 iso_pu_bacteria 2960693952 2960699762 347
529 iso_pu_bacteria 2964607997 2964612596 347
530 iso_pu_bacteria 2964615318 2964617804 347
531 iso_pu_bacteria 2964621998 2964625063 347
532 iso_pu_bacteria 2964628898 2964635367 347
533 iso_pu_bacteria 2964636051 2964642523 347
534 iso_pu_bacteria 2964643177 2964646909 347
535 iso_pu_bacteria 2964649959 2964656352 347
536 iso_pu_bacteria 2964656573 2964659744 347
537 iso_pu_bacteria 2964663802 2964665592 347
538 iso_pu_bacteria 2964670856 2964671033 347
539 iso_pu_bacteria 2964678106 2964679427 347
540 iso_pu_bacteria 2964685014 2964688239 347
541 iso_pu_bacteria 2964691889 2964692155 347
542 iso_pu_bacteria 2964698721 2964702839 347
543 iso_pu_bacteria 2964705432 2964708606 347
544 iso_pu_bacteria 2964712639 2964718672 347
545 iso_pu_bacteria 2964719344 2964722284 347
546 iso_pu_bacteria 2967664464 2967668663 347
547 iso_pu_bacteria 2967671571 2967677854 347
548 iso_pu_bacteria 2967678726 2967681612 347
549 iso_pu_bacteria 2967686174 2967692875 347
550 iso_pu_bacteria 2967693043 2967693362 347
551 iso_pu_bacteria 2967699805 2967702013 347
552 iso_pu_bacteria 2967706974 2967713167 347
553 iso_pu_bacteria 2967714385 2967716412 347
554 iso_pu_bacteria 2967721400 2967723312 347
555 iso_pu_bacteria 2967728569 2967730913 347
556 iso_pu_bacteria 2967735183 2967735560 347
557 iso_pu_bacteria 2967742019 2967747409 347
558 iso_pu_bacteria 2967748971 2967754489 347
559 iso_pu_bacteria 2967755722 2967757011 347
560 iso_pu_bacteria 2967762386 2967763913 347
561 iso_pu_bacteria 2967769361 2967771663 347
562 iso_pu_bacteria 2967775926 2967776685 347
563 iso_pu_bacteria 2970019648 2970020555 347
564 iso_pu_bacteria 2970026789 2970027468 347
565 iso_pu_bacteria 2970033650 2970035716 347
566 iso_pu_bacteria 2970040964 2970045405 347
567 iso_pu_bacteria 2970047711 2970050464 347
568 iso_pu_bacteria 2970054988 2970057936 347
569 iso_pu_bacteria 2970061556 2970063297 347
570 iso_pu_bacteria 2970068827 2970072016 347
571 iso_pu_bacteria 2970076120 2970080488 347
572 iso_pu_bacteria 2970082768 2970086998 347
573 iso_pu_bacteria 2970088815 2970091597 347
574 iso_pu_bacteria 2970095765 2970097498 347
575 iso_pu_bacteria 2970102677 2970105059 347
576 iso_pu_bacteria 2970109326 2970113077 347
577 iso_pu_bacteria 2970116247 2970117836 347
578 iso_pu_bacteria 2970122695 2970123109 347
579 iso_pu_bacteria 2970129317 2970129634 347
580 iso_pu_bacteria 2970136068 2970138777 347
581 iso_pu_bacteria 2970143518 2970146045 347
582 iso_pu_bacteria 2970149975 2970151107 347
583 iso_pu_bacteria 2970156795 2970162878 347
584 iso_pu_bacteria 2970164137 2970166865 347
585 iso_pu_bacteria 2970170962 2970176037 347
586 iso_pu_bacteria 2970177841 2970178464 347
587 iso_pu_bacteria 2970184632 2970187402 347
588 iso_pu_bacteria 2970191845 2970194264 347
589 iso_pu_bacteria 2977516862 2977517859 347
590 iso_pu_bacteria 2977523885 2977527104 347
591 iso_pu_bacteria 2977530762 2977534536 347
592 iso_pu_bacteria 2977537788 2977538104 347
593 iso_pu_bacteria 2977544691 2977549971 347
594 iso_pu_bacteria 2977551784 2977552104 347
595 iso_pu_bacteria 2977558990 2977562826 347
596 iso_pu_bacteria 2977565890 2977566329 347
597 iso_pu_bacteria 2977572785 2977576549 347
598 iso_pu_bacteria 2977579622 2977581209 347
599 iso_pu_bacteria 643692032 643825152 347
600 iso_pu_bacteria 648276728 648736481 347
601 iso_pu_bacteria 8003992118 8003993062 347
602 iso_pu_bacteria 8003999396 8004000298 347
603 iso_pu_bacteria 8005246636 8005251242 347
604 iso_pu_bacteria 8049293176 8049293991 347
605 3300012500 Ga0157314_1001549 Ga0157314_10015491 348
606 iso_pu_bacteria 2509276021 2509387659 348
607 iso_pu_bacteria 2509276033 2509443018 348
608 iso_pu_bacteria 2510065019 2510132355 348
609 iso_pu_bacteria 2510461076 2510898691 348
610 iso_pu_bacteria 2510917028 2511186419 348
611 iso_pu_bacteria 2513237084 2513569194 348
612 iso_pu_bacteria 2513237085 2513578868 348
613 iso_pu_bacteria 2513237088 2513596306 348
614 iso_pu_bacteria 2513237093 2513632701 348
615 iso_pu_bacteria 2513237103 2513709153 348
616 iso_pu_bacteria 2513237146 2513925757 348
617 iso_pu_bacteria 2513237162 2514020696 348
618 iso_pu_bacteria 2515075009 2515111339 348
619 iso_pu_bacteria 2515154113 2515639594 348
620 iso_pu_bacteria 2515154114 2515644349 348
621 iso_pu_bacteria 2515154116 2515659137 348
622 iso_pu_bacteria 2515154134 2515740527 348
623 iso_pu_bacteria 2516653077 2517039980 348
624 iso_pu_bacteria 2516653085 2517075533 348
625 iso_pu_bacteria 2517093000 2517094114 348
626 iso_pu_bacteria 2517287029 2517405932 348
627 iso_pu_bacteria 2519899620 2520378714 348
628 iso_pu_bacteria 2529292951 2530643831 348
629 iso_pu_bacteria 2534681796 2535515779 348
630 iso_pu_bacteria 2582581294 2585203140 348
631 iso_pu_bacteria 2582581299 2585231436 348
632 iso_pu_bacteria 2582581304 2585256555 348
633 iso_pu_bacteria 2582581867 2585400065 348
634 iso_pu_bacteria 2585427526 2585528030 348
635 iso_pu_bacteria 2585427528 2585541369 348
636 iso_pu_bacteria 2585427590 2585822624 348
637 iso_pu_bacteria 2585427593 2585839499 348
638 iso_pu_bacteria 2585427594 2585847155 348
639 iso_pu_bacteria 2599185170 2599418538 348
640 iso_pu_bacteria 2599185352 2600192006 348
641 iso_pu_bacteria 2600254933 2600375328 348
642 iso_pu_bacteria 2615840624 2616296158 348
643 iso_pu_bacteria 2643221557 2643807126 348
644 iso_pu_bacteria 2643221599 2644007986 348
645 iso_pu_bacteria 2643221610 2644069607 348
646 iso_pu_bacteria 2643221634 2644196570 348
647 iso_pu_bacteria 2643221643 2644239043 348
648 iso_pu_bacteria 2643221668 2644380508 348
649 iso_pu_bacteria 2643221675 2644420761 348
650 iso_pu_bacteria 2643221680 2644454286 348
651 iso_pu_bacteria 2643221723 2644675576 348
652 iso_pu_bacteria 2643221726 2644689623 348
653 iso_pu_bacteria 2718217882 2719180345 348
654 iso_pu_bacteria 2718217927 2719384924 348
655 iso_pu_bacteria 2718217997 2719664669 348
656 iso_pu_bacteria 2718218009 2719731094 348
657 iso_pu_bacteria 2718218199 2720491089 348
658 iso_pu_bacteria 2718218232 2720612458 348
659 iso_pu_bacteria 2718218233 2720619300 348
660 iso_pu_bacteria 2718218235 2720630697 348
661 iso_pu_bacteria 2718218269 2720774390 348
662 iso_pu_bacteria 2718218363 2721146439 348
663 iso_pu_bacteria 2718218365 2721157960 348
664 iso_pu_bacteria 2718218366 2721163318 348
665 iso_pu_bacteria 2718218423 2721398644 348
666 iso_pu_bacteria 2721755514 2722839488 348
667 iso_pu_bacteria 2721755556 2723026116 348
668 iso_pu_bacteria 2721755684 2723559660 348
669 iso_pu_bacteria 2721755685 2723566278 348
670 iso_pu_bacteria 2721755809 2724037457 348
671 iso_pu_bacteria 2721755810 2724043850 348
672 iso_pu_bacteria 2721755819 2724088997 348
673 iso_pu_bacteria 2721755822 2724103543 348
674 iso_pu_bacteria 2721755823 2724109380 348
675 iso_pu_bacteria 2724679232 2725946761 348
676 iso_pu_bacteria 2728369352 2730107052 348
677 iso_pu_bacteria 2728369365 2730163582 348
678 iso_pu_bacteria 2728369397 2730297592 348
679 iso_pu_bacteria 2738541293 2738802221 348
680 iso_pu_bacteria 2738541333 2739035959 348
681 iso_pu_bacteria 2765235942 2766067548 348
682 iso_pu_bacteria 2791355256 2793296252 348
683 iso_pu_bacteria 2791355259 2793316174 348
684 iso_pu_bacteria 2791355260 2793321046 348
685 iso_pu_bacteria 2791355261 2793327076 348
686 iso_pu_bacteria 2791355262 2793333669 348
687 iso_pu_bacteria 2791355263 2793339737 348
688 iso_pu_bacteria 2791355264 2793347986 348
689 iso_pu_bacteria 2791355265 2793355147 348
690 iso_pu_bacteria 2791355266 2793358972 348
691 iso_pu_bacteria 2791355267 2793367904 348
692 iso_pu_bacteria 2802429605 2805926527 348
693 iso_pu_bacteria 2802429606 2805933326 348
694 iso_pu_bacteria 2802429633 2806046862 348
695 iso_pu_bacteria 2802429634 2806052445 348
696 iso_pu_bacteria 2802429635 2806058784 348
697 iso_pu_bacteria 2802429636 2806067448 348
698 iso_pu_bacteria 2802429637 2806074047 348
699 iso_pu_bacteria 2818991272 2819242466 348
700 iso_pu_bacteria 2818991461 2819684039 348
701 iso_pu_bacteria 2838016132 2838017339 348
702 iso_pu_bacteria 2838022645 2838023092 348
703 iso_pu_bacteria 2838035591 2838037765 348
704 iso_pu_bacteria 2838042994 2838045984 348
705 iso_pu_bacteria 2838048938 2838049179 348
706 iso_pu_bacteria 2838061910 2838063375 348
707 iso_pu_bacteria 2838068647 2838072966 348
708 iso_pu_bacteria 2838661181 2838662778 348
709 iso_pu_bacteria 2838668709 2838670898 348
710 iso_pu_bacteria 2838680041 2838681394 348
711 iso_pu_bacteria 2838686498 2838688552 348
712 iso_pu_bacteria 2838694306 2838694571 348
713 iso_pu_bacteria 2838701080 2838703269 348
714 iso_pu_bacteria 2838707686 2838707949 348
715 iso_pu_bacteria 2838729681 2838730847 348
716 iso_pu_bacteria 2838742623 2838744259 348
717 iso_pu_bacteria 2841851746 2841856940 348
718 iso_pu_bacteria 2841864319 2841865417 348
719 iso_pu_bacteria 2842077413 2842080820 348
720 iso_pu_bacteria 2842110456 2842115031 348
721 iso_pu_bacteria 2842118031 2842121439 348
722 iso_pu_bacteria 2842146304 2842147507 348
723 iso_pu_bacteria 2842156927 2842160110 348
724 iso_pu_bacteria 2842163707 2842168353 348
725 iso_pu_bacteria 2842180545 2842183273 348
726 iso_pu_bacteria 2842192696 2842198000 348
727 iso_pu_bacteria 2842198810 2842199520 348
728 iso_pu_bacteria 2842205361 2842209974 348
729 iso_pu_bacteria 2842217011 2842221257 348
730 iso_pu_bacteria 2842229732 2842235126 348
731 iso_pu_bacteria 2842237096 2842237360 348
732 iso_pu_bacteria 2842243621 2842245723 348
733 iso_pu_bacteria 2842250916 2842252573 348
734 iso_pu_bacteria 2842257432 2842259627 348
735 iso_pu_bacteria 2842264693 2842266871 348
736 iso_pu_bacteria 2842271015 2842274466 348
737 iso_pu_bacteria 2842278818 2842283428 348
738 iso_pu_bacteria 2842285085 2842287067 348
739 iso_pu_bacteria 2842291075 2842294476 348
740 iso_pu_bacteria 2842304105 2842306709 348
741 iso_pu_bacteria 2842311132 2842314796 348
742 iso_pu_bacteria 2842317721 2842318601 348
743 iso_pu_bacteria 2842341865 2842343539 348
744 iso_pu_bacteria 2842363717 2842365304 348
745 iso_pu_bacteria 2842370503 2842371857 348
746 iso_pu_bacteria 2842377471 2842380874 348
747 iso_pu_bacteria 2842384541 2842387945 348
748 iso_pu_bacteria 2842395702 2842398201 348
749 iso_pu_bacteria 2842402390 2842404335 348
750 iso_pu_bacteria 2842409023 2842410980 348
751 iso_pu_bacteria 2842415677 2842417564 348
752 iso_pu_bacteria 2842422224 2842426348 348
753 iso_pu_bacteria 2842428310 2842431002 348
754 iso_pu_bacteria 2842434925 2842437000 348
755 iso_pu_bacteria 2842441272 2842443078 348
756 iso_pu_bacteria 2842447887 2842453300 348
757 iso_pu_bacteria 2842462802 2842465089 348
758 iso_pu_bacteria 2842469257 2842471685 348
759 iso_pu_bacteria 2842489311 2842493808 348
760 iso_pu_bacteria 2842495871 2842497236 348
761 iso_pu_bacteria 2844454524 2844455068 348
762 iso_pu_bacteria 2857516855 2857520237 348
763 iso_pu_bacteria 2923556063 2923557510 348
764 iso_pu_bacteria 2933016740 2933020755 348
765 iso_pu_bacteria 2933570622 2933573177 348
766 iso_pu_bacteria 2933586486 2933591430 348
767 iso_pu_bacteria 2933599457 2933603881 348
768 iso_pu_bacteria 2935894831 2935895093 348
769 iso_pu_bacteria 2935901341 2935904074 348
770 iso_pu_bacteria 2936367885 2936368067 348
771 iso_pu_bacteria 2936375103 2936381540 348
772 iso_pu_bacteria 2936381700 2936384892 348
773 iso_pu_bacteria 2989776772 2989778256 348
774 iso_pu_bacteria 2996887358 2996888744 348
775 iso_pu_bacteria 2996893221 2996895138 348
776 iso_pu_bacteria 3005452660 3005453513 348
777 iso_pu_bacteria 639633055 639647485 348
778 iso_pu_bacteria 8005258706 8005260016 348
779 iso_pu_bacteria 8005275841 8005279644 348
780 iso_pu_bacteria 8005282627 8005283585 348
781 iso_pu_bacteria 8005289223 8005292844 348
782 iso_pu_bacteria 8005301065 8005304650 348
783 iso_pu_bacteria 8005307578 8005308438 348
784 iso_pu_bacteria 8005321885 8005323271 348
785 iso_pu_bacteria 8005376324 8005376553 348
786 iso_pu_bacteria 8005382845 8005385943 348
787 iso_pu_bacteria 8005395548 8005400275 348
788 iso_pu_bacteria 8005430974 8005437132 348
789 iso_pu_bacteria 8005460587 8005461985 348
790 iso_pu_bacteria 8005497431 8005499391 348
791 iso_pu_bacteria 8005542996 8005544413 348
792 iso_pu_bacteria 8005556819 8005558874 348
793 iso_pu_bacteria 8005563573 8005570489 348
794 iso_pu_bacteria 8005570704 8005572746 348
795 iso_pu_bacteria 8005619151 8005620579 348
796 iso_pu_bacteria 8005626139 8005627054 348
797 iso_pu_bacteria 8005668836 8005670807 348
798 iso_pu_bacteria 8005688590 8005691075 348
799 iso_pu_bacteria 8005695170 8005698724 348
800 iso_pu_bacteria 8018127388 8018131387 348
801 iso_pu_bacteria 8018163183 8018169456 348
802 iso_pu_bacteria 8018176218 8018182563 348
803 iso_pu_bacteria 8023680758 8023686893 348
804 iso_pu_bacteria 8024479707 8024481159 348
805 iso_pu_bacteria 8024501048 8024503201 348
806 iso_pu_bacteria 8056375014 8056380784 348
807 iso_pu_bacteria 8056382006 8056384693 348
808 iso_pu_bacteria 8057874678 8057876351 348
809 3300003187 JGI25151J46595_10000444 JGI25151J46595_100004444 349
810 3300003354 JGI25160J50197_1004315 JGI25160J50197_10043154 349
811 3300003374 JGI25161J50226_1004074 JGI25161J50226_10040741 349
812 3300003775 Ga0055524_1001811 Ga0055524_10018116 349
813 3300003790 Ga0055528_1000449 Ga0055528_10004497 349
814 3300003790 Ga0055528_1001490 Ga0055528_10014907 349
815 3300003792 Ga0055540_1000199 Ga0055540_100019941 349
816 3300003792 Ga0055540_1000450 Ga0055540_10004508 349
817 3300004625 Ga0055543_1003877 Ga0055543_10038773 349
818 3300006038 Ga0075365_10025141 Ga0075365_100251414 349
819 3300006177 Ga0075362_10002017 Ga0075362_100020174 349
820 3300006178 Ga0075367_10005508 Ga0075367_100055084 349
821 3300006186 Ga0075369_10000431 Ga0075369_1000043113 349
822 3300006195 Ga0075366_10062416 Ga0075366_100624162 349
823 3300006353 Ga0075370_10003428 Ga0075370_100034286 349
824 3300025245 Ga0207425_1003667 Ga0207425_10036673 349
825 3300025258 Ga0209129_1002236 Ga0209129_10022366 349
826 3300025273 Ga0209673_1000022 Ga0209673_1000022356 349
827 3300025273 Ga0209673_1000206 Ga0209673_10002065 349
828 3300025273 Ga0209673_1000808 Ga0209673_10008087 349
829 3300025294 Ga0209025_1000190 Ga0209025_100019032 349
830 3300025295 Ga0209564_1000163 Ga0209564_1000163105 349
831 3300025295 Ga0209564_1000849 Ga0209564_100084921 349
832 3300025297 Ga0209758_1000734 Ga0209758_10007346 349
833 3300025299 Ga0209256_1001015 Ga0209256_10010156 349
834 3300025299 Ga0209256_1001746 Ga0209256_10017466 349
835 3300025302 Ga0207426_1000109 Ga0207426_100010995 349
836 3300025303 Ga0209051_1000359 Ga0209051_100035940 349
837 3300025303 Ga0209051_1027185 Ga0209051_10271851 349
838 3300025304 Ga0209257_1003151 Ga0209257_10031517 349
839 3300031901 Ga0307406_10010524 Ga0307406_100105243 349
840 3300048920 Ga0496117_0019647 Ga0496117_0019647_1037_2224 349
841 3300048921 Ga0496118_0033180 Ga0496118_0033180_565_1752 349
842 3300048922 Ga0496119_0014030 Ga0496119_0014030_2426_3613 349
843 3300048925 Ga0496122_0090078 Ga0496122_0090078_736_1923 349
844 3300048927 Ga0496124_0111089 Ga0496124_0111089_743_1930 349
845 3300048928 Ga0496125_0000001 Ga0496125_0000001_1064980_1066167 349
846 3300050496 nmdc:mga07m45_557_c1 nmdc:mga07m45_557_c1_3372_4559 349
847 3300050516 nmdc:mga0sz30_75082_c1 nmdc:mga0sz30_75082_c1_157_1344 349
848 3300053177 Ga0500636_0002001 Ga0500636_0002001_3277_4467 349
849 3300027312 Ga0209371_1000021 Ga0209371_1000021418 350
850 3300030500 Ga0268256_1000020 Ga0268256_1000020424 350
851 3300046665 Ga0495661_0085929 Ga0495661_0085929_419_1609 350
852 3300053107 Ga0500560_013728 Ga0500560_013728_512_1702 350
853 3300053111 Ga0500572_001740 Ga0500572_001740_3440_4630 350
854 3300053177 Ga0500636_0057718 Ga0500636_0057718_675_1865 350
855 3300005262 Ga0065165_1002173 Ga0065165_100217315 351
856 3300005548 Ga0070665_100077902 Ga0070665_1000779023 351
857 3300006038 Ga0075365_10001009 Ga0075365_100010092 351
858 3300006946 Ga0079104_1006309 Ga0079104_10063091 351
859 3300013249 Ga0171463_1001 Ga0171463_1001149 351
860 3300021321 Ga0214542_1020956 Ga0214542_10209564 351
861 3300021327 Ga0214543_1000003 Ga0214543_1000003547 351
862 3300022739 Ga0228711_1001210 Ga0228711_10012103 351
863 3300022740 Ga0228710_1002040 Ga0228710_100204037 351
864 3300025297 Ga0209758_1017109 Ga0209758_10171092 351
865 3300027111 Ga0209281_1000236 Ga0209281_100023658 351
866 3300027111 Ga0209281_1000666 Ga0209281_100066644 351
867 3300027666 Ga0209282_1000022 Ga0209282_1000022167 351
868 3300031967 Ga0315914_1000027 Ga0315914_100002787 351
869 3300033430 Ga0315913_1000631 Ga0315913_100063140 351
870 3300033464 Ga0315915_1000001 Ga0315915_1000001233 351
871 3300042007 Ga0439449_0022808 Ga0439449_0022808_250_1443 351
872 3300048914 Ga0496111_0000394 Ga0496111_0000394_15532_16722 351
873 3300048925 Ga0496122_0000160 Ga0496122_0000160_51514_52701 351
874 3300048926 Ga0496123_0000034 Ga0496123_0000034_81192_82379 351
875 3300048927 Ga0496124_0035334 Ga0496124_0035334_2544_3731 351
876 3300048929 Ga0496126_0211428 Ga0496126_0211428_345_1571 351
877 3300050492 nmdc:mga0yw44_577_c1 nmdc:mga0yw44_577_c1_11338_12528 351
878 3300053125 Ga0500618_000652 Ga0500618_000652_3126_4316 351
879 3300053140 Ga0500573_0048703 Ga0500573_0048703_158_1354 351
880 3300053153 Ga0500616_0002152 Ga0500616_0002152_10951_12141 351
881 iso_pu_bacteria 2510461069 2510839625 351
882 iso_pu_bacteria 2791355091 2792622610 351
883 iso_pu_bacteria 2791355092 2792628469 351
884 3300002773 JGI25152J39213_1001243 JGI25152J39213_10012433 352
885 3300002773 JGI25152J39213_1013289 JGI25152J39213_10132892 352
886 3300002774 JGI25150J39212_1000033 JGI25150J39212_100003387 352
887 3300002774 JGI25150J39212_1013292 JGI25150J39212_10132921 352
888 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002158 352
889 3300003187 JGI25151J46595_10000108 JGI25151J46595_1000010861 352
890 3300003187 JGI25151J46595_10001506 JGI25151J46595_100015068 352
891 3300003215 JGI25153J46596_10000823 JGI25153J46596_1000082310 352
892 3300003316 rootH1_10019515 rootH1_100195152 352
893 3300003323 rootH1_10106559 rootH1_101065592 352
894 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008158 352
895 3300003374 JGI25161J50226_1001763 JGI25161J50226_10017635 352
896 3300003771 Ga0055526_1001594 Ga0055526_10015945 352
897 3300003771 Ga0055526_1002142 Ga0055526_100214213 352
898 3300003771 Ga0055526_1004856 Ga0055526_10048562 352
899 3300003771 Ga0055526_1013777 Ga0055526_10137772 352
900 3300003775 Ga0055524_1001449 Ga0055524_10014498 352
901 3300003775 Ga0055524_1004593 Ga0055524_10045932 352
902 3300003775 Ga0055524_1004954 Ga0055524_10049543 352
903 3300003775 Ga0055524_1021635 Ga0055524_10216352 352
904 3300003781 Ga0055536_1003064 Ga0055536_10030644 352
905 3300003790 Ga0055528_1000201 Ga0055528_100020111 352
906 3300003790 Ga0055528_1000807 Ga0055528_10008079 352
907 3300003790 Ga0055528_1004206 Ga0055528_10042065 352
908 3300003790 Ga0055528_1027326 Ga0055528_10273262 352
909 3300003792 Ga0055540_1000220 Ga0055540_100022030 352
910 3300003792 Ga0055540_1014275 Ga0055540_10142753 352
911 3300003794 Ga0055531_10003262 Ga0055531_1000326211 352
912 3300004625 Ga0055543_1000040 Ga0055543_100004018 352
913 3300004625 Ga0055543_1001130 Ga0055543_100113010 352
914 3300005262 Ga0065165_1000015 Ga0065165_1000015159 352
915 3300005262 Ga0065165_1023004 Ga0065165_10230041 352
916 3300006353 Ga0075370_10015562 Ga0075370_100155622 352
917 3300009765 Ga0123341_1003621 Ga0123341_10036218 352
918 3300025245 Ga0207425_1000031 Ga0207425_100003155 352
919 3300025245 Ga0207425_1006252 Ga0207425_10062522 352
920 3300025245 Ga0207425_1010979 Ga0207425_10109791 352
921 3300025258 Ga0209129_1000053 Ga0209129_100005356 352
922 3300025258 Ga0209129_1000634 Ga0209129_100063425 352
923 3300025273 Ga0209673_1000041 Ga0209673_1000041134 352
924 3300025273 Ga0209673_1000319 Ga0209673_100031962 352
925 3300025273 Ga0209673_1000692 Ga0209673_100069236 352
926 3300025273 Ga0209673_1004628 Ga0209673_10046286 352
927 3300025273 Ga0209673_1005178 Ga0209673_10051783 352
928 3300025273 Ga0209673_1006319 Ga0209673_10063195 352
929 3300025284 Ga0209130_1000007 Ga0209130_1000007144 352
930 3300025292 Ga0209676_1006384 Ga0209676_10063842 352
931 3300025294 Ga0209025_1000087 Ga0209025_100008755 352
932 3300025294 Ga0209025_1000199 Ga0209025_100019966 352
933 3300025294 Ga0209025_1000580 Ga0209025_100058054 352
934 3300025294 Ga0209025_1012394 Ga0209025_10123942 352
935 3300025295 Ga0209564_1000330 Ga0209564_100033027 352
936 3300025295 Ga0209564_1000431 Ga0209564_100043153 352
937 3300025295 Ga0209564_1002041 Ga0209564_100204110 352
938 3300025295 Ga0209564_1004475 Ga0209564_10044756 352
939 3300025297 Ga0209758_1000081 Ga0209758_100008155 352
940 3300025297 Ga0209758_1000333 Ga0209758_100033362 352
941 3300025297 Ga0209758_1002928 Ga0209758_100292817 352
942 3300025298 Ga0209050_1009250 Ga0209050_10092502 352
943 3300025299 Ga0209256_1000445 Ga0209256_100044514 352
944 3300025299 Ga0209256_1001312 Ga0209256_10013129 352
945 3300025299 Ga0209256_1001358 Ga0209256_100135817 352
946 3300025299 Ga0209256_1001741 Ga0209256_10017415 352
947 3300025299 Ga0209256_1002566 Ga0209256_10025669 352
948 3300025299 Ga0209256_1007960 Ga0209256_10079604 352
949 3300025302 Ga0207426_1000064 Ga0207426_1000064144 352
950 3300025302 Ga0207426_1000119 Ga0207426_1000119154 352
951 3300025303 Ga0209051_1000198 Ga0209051_100019883 352
952 3300025303 Ga0209051_1022363 Ga0209051_10223632 352
953 3300025304 Ga0209257_1003901 Ga0209257_100390110 352
954 3300025304 Ga0209257_1004762 Ga0209257_10047624 352
955 3300028794 Ga0307515_10014926 Ga0307515_1001492610 352
956 3300031911 Ga0307412_10003579 Ga0307412_100035796 352
957 3300041413 Ga0439465_0015818 Ga0439465_0015818_372_1559 352
958 3300041441 Ga0451787_051032 Ga0451787_051032_262_1449 352
959 3300041491 Ga0451833_0913720 Ga0451833_0913720_510_1697 352
960 3300041492 Ga0451835_0329127 Ga0451835_0329127_38_1225 352
961 3300041496 Ga0451839_0114975 Ga0451839_0114975_149_1336 352
962 3300041511 Ga0451855_0352143 Ga0451855_0352143_277_1464 352
963 3300041512 Ga0451853_1667796 Ga0451853_1667796_2852_4039 352
964 3300042004 Ga0439445_0015344 Ga0439445_0015344_353_1540 352
965 3300046492 Ga0495585_0016393 Ga0495585_0016393_2376_3563 352
966 3300046500 Ga0495596_0030458 Ga0495596_0030458_111_1298 352
967 3300046507 Ga0495606_0012175 Ga0495606_0012175_5684_6871 352
968 3300046512 Ga0495610_0055380 Ga0495610_0055380_688_1875 352
969 3300046522 Ga0495643_0050188 Ga0495643_0050188_870_2057 352
970 3300046524 Ga0495648_0107941 Ga0495648_0107941_26_1213 352
971 3300046694 Ga0495649_0060736 Ga0495649_0060736_16_1203 352
972 3300048090 Ga0495615_0014196 Ga0495615_0014196_439_1626 352
973 3300048920 Ga0496117_0038440 Ga0496117_0038440_595_1782 352
974 3300048921 Ga0496118_0021547 Ga0496118_0021547_2319_3506 352
975 3300053109 Ga0500569_022703 Ga0500569_022703_60_1247 352
976 3300053134 Ga0500658_0002179 Ga0500658_0002179_428_1615 352
977 iso_pu_bacteria 8005658619 8005659913 352

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q43-assembly1.cif.gz_B crystal structure of ca4-bound can2 (e341a) in complex with oligo-c dna 0.755 59 87
5yzg-assembly1.cif.gz_a the cryo-em structure of human catalytic step i spliceosome (c complex) at 4.1 angstrom resolution 0.4997 42 89
3zh7-assembly1.cif.gz_A the structure of crystal form ii of haemophilus influenzae protein e 0.4895 132 203
3by7-assembly1.cif.gz_E crystal structure of a protein structurally similar to sm/lsm-like rna-binding proteins (jcvi_pep_1096686650277) from uncultured marine organism at 2.60 a resolution 0.4858 43 99
3jb9-assembly1.cif.gz_Z cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.4842 42 94
ID Description Score Start End Superfamily
af_Q54DZ2_6_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6128 134 217 3.30.530.20
af_P45760_32_124_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.5796 111 152 3.30.1300.30
af_Q17476_16_179_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.5617 132 216 3.30.530.20
af_Q18033_862_1142_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.5585 222 257 1.25.40.180
af_Q6ZFJ9_451_569_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.5467 222 289 1.10.560.10
ID Description Score Start End GO Terms
AF-A0A7C1T0A8-F1-model_v4 DUF945 family protein 0.9172 178 352
AF-A0A529FMW2-F1-model_v4 DUF945 domain-containing protein 0.8997 176 352
AF-A0A3S4TXS6-F1-model_v4 DUF945 family protein 0.8951 116 352
AF-A0A529ZJ13-F1-model_v4 DUF945 domain-containing protein 0.8799 108 292
AF-A0A529ZJ13-F1-model_v4 DUF945 domain-containing protein 0.8711 108 292

Feature Viewer

pLDDT pTM Quality
84.75 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map