F487257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 426 | 1952 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300035111|Ga0373923_0587823|Ga0373923_0587823_132_368 |
| Length | 78 |
| Sequence | MDMMSMVTGMLAAQAGNTQMQVAATIMKSNADAEKSTVLTLLGAGQPSLANVGAGIGGNLNIAAYWFRARRPPGSSPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 242 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 243 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 244 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 245 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 246 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 247 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 366 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 374 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 375 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 379 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 383 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 384 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 385 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 388 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 390 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 391 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 392 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 394 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 395 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 396 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 398 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 399 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 401 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 402 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 409 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 417 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 418 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 419 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 421 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 422 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 425 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 426 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.6 |
| Nodule | 0.1 |
| Rhizoplane | 10.76 |
| Rhizosphere | 69.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373923_0587823 | 3300035111 | Bacteria | 548 |
| 2 | LJQas_1005052 | 3300000549 | Bacteria | 1687 |
| 3 | JGI24737J22298_10154785 | 3300001990 | Bacteria | 676 |
| 4 | JGI24738J21930_10039787 | 3300002075 | Bacteria | 955 |
| 5 | JGI25165J46597_1004162 | 3300003214 | Bacteria | 3207 |
| 6 | Ga0055525_1012404 | 3300003759 | Bacteria | 718 |
| 7 | Ga0055543_1046618 | 3300004625 | Bacteria | 719 |
| 8 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 9 | Ga0065165_1042886 | 3300005262 | Bacteria | 1332 |
| 10 | Ga0065712_10158205 | 3300005290 | Bacteria | 1320 |
| 11 | Ga0065715_10703381 | 3300005293 | Bacteria | 652 |
| 12 | Ga0070658_10388586 | 3300005327 | Bacteria | 1198 |
| 13 | Ga0070658_10499356 | 3300005327 | Bacteria | 1051 |
| 14 | Ga0070683_101724312 | 3300005329 | Bacteria | 602 |
| 15 | Ga0070690_100254481 | 3300005330 | Bacteria | 1243 |
| 16 | Ga0070690_100573102 | 3300005330 | Bacteria | 854 |
| 17 | Ga0070670_100849970 | 3300005331 | Bacteria | 826 |
| 18 | Ga0070670_102113444 | 3300005331 | Bacteria | 519 |
| 19 | Ga0068869_101603191 | 3300005334 | Bacteria | 580 |
| 20 | Ga0068869_101677555 | 3300005334 | Bacteria | 567 |
| 21 | Ga0070666_10355521 | 3300005335 | Bacteria | 1049 |
| 22 | Ga0070680_100022477 | 3300005336 | Bacteria | 5024 |
| 23 | Ga0070680_100106831 | 3300005336 | Bacteria | 2328 |
| 24 | Ga0070680_100388993 | 3300005336 | Bacteria | 1188 |
| 25 | Ga0070680_101413457 | 3300005336 | Bacteria | 602 |
| 26 | Ga0070682_100199594 | 3300005337 | Bacteria | 1410 |
| 27 | Ga0070682_100503951 | 3300005337 | Bacteria | 938 |
| 28 | Ga0068868_100551958 | 3300005338 | Bacteria | 1015 |
| 29 | Ga0068868_100672152 | 3300005338 | Bacteria | 924 |
| 30 | Ga0068868_101189057 | 3300005338 | Bacteria | 705 |
| 31 | Ga0068868_101198812 | 3300005338 | Bacteria | 702 |
| 32 | Ga0068868_102406546 | 3300005338 | Bacteria | 503 |
| 33 | Ga0070660_100012916 | 3300005339 | Bacteria | 5976 |
| 34 | Ga0070660_100853127 | 3300005339 | Bacteria | 767 |
| 35 | Ga0070661_100633583 | 3300005344 | Bacteria | 867 |
| 36 | Ga0070661_100823520 | 3300005344 | Bacteria | 763 |
| 37 | Ga0070692_10581513 | 3300005345 | Bacteria | 738 |
| 38 | Ga0070668_101293542 | 3300005347 | Bacteria | 663 |
| 39 | Ga0070669_100718132 | 3300005353 | Bacteria | 845 |
| 40 | Ga0070671_100083780 | 3300005355 | Bacteria | 2666 |
| 41 | Ga0070671_100575104 | 3300005355 | Bacteria | 973 |
| 42 | Ga0070671_101631769 | 3300005355 | Bacteria | 572 |
| 43 | Ga0070688_100487581 | 3300005365 | Bacteria | 928 |
| 44 | Ga0070659_100060570 | 3300005366 | Bacteria | 2990 |
| 45 | Ga0070659_100372381 | 3300005366 | Bacteria | 1202 |
| 46 | Ga0070659_100906759 | 3300005366 | Bacteria | 770 |
| 47 | Ga0070659_101649241 | 3300005366 | Bacteria | 573 |
| 48 | Ga0070667_100407242 | 3300005367 | Bacteria | 1238 |
| 49 | Ga0070714_100070500 | 3300005435 | Bacteria | 3021 |
| 50 | Ga0070714_100573686 | 3300005435 | Bacteria | 1082 |
| 51 | Ga0070713_100002110 | 3300005436 | Bacteria | 12858 |
| 52 | Ga0070713_100073819 | 3300005436 | Bacteria | 2889 |
| 53 | Ga0070713_101688549 | 3300005436 | Bacteria | 615 |
| 54 | Ga0070710_10003024 | 3300005437 | Bacteria | 7997 |
| 55 | Ga0070710_10005145 | 3300005437 | Bacteria | 6191 |
| 56 | Ga0070711_100007448 | 3300005439 | Bacteria | 6657 |
| 57 | Ga0070711_100065325 | 3300005439 | Bacteria | 2544 |
| 58 | Ga0070711_101015093 | 3300005439 | Unclassified | 712 |
| 59 | Ga0070711_101638382 | 3300005439 | Unclassified | 563 |
| 60 | Ga0070705_101164137 | 3300005440 | Unclassified | 634 |
| 61 | Ga0070663_100152426 | 3300005455 | Bacteria | 1773 |
| 62 | Ga0070663_100221250 | 3300005455 | Bacteria | 1486 |
| 63 | Ga0070663_100232099 | 3300005455 | Bacteria | 1453 |
| 64 | Ga0070678_100256779 | 3300005456 | Bacteria | 1468 |
| 65 | Ga0070678_100581793 | 3300005456 | Bacteria | 997 |
| 66 | Ga0070662_100815495 | 3300005457 | Bacteria | 794 |
| 67 | Ga0070662_101110959 | 3300005457 | Bacteria | 678 |
| 68 | Ga0070681_10513928 | 3300005458 | Bacteria | 1111 |
| 69 | Ga0070681_10721582 | 3300005458 | Bacteria | 913 |
| 70 | Ga0070707_100030468 | 3300005468 | Bacteria | 5137 |
| 71 | Ga0070698_100678742 | 3300005471 | Bacteria | 972 |
| 72 | Ga0070699_100870551 | 3300005518 | Bacteria | 825 |
| 73 | Ga0070699_100992317 | 3300005518 | Bacteria | 770 |
| 74 | Ga0070679_100441747 | 3300005530 | Bacteria | 1246 |
| 75 | Ga0070679_100571162 | 3300005530 | Bacteria | 1074 |
| 76 | Ga0070679_100726725 | 3300005530 | Bacteria | 936 |
| 77 | Ga0070684_100012882 | 3300005535 | Bacteria | 6721 |
| 78 | Ga0070684_101203589 | 3300005535 | Bacteria | 712 |
| 79 | Ga0070697_100088553 | 3300005536 | Bacteria | 2557 |
| 80 | Ga0070697_100111993 | 3300005536 | Bacteria | 2275 |
| 81 | Ga0068853_100006064 | 3300005539 | Bacteria | 9566 |
| 82 | Ga0068853_100267430 | 3300005539 | Bacteria | 1573 |
| 83 | Ga0068853_100601071 | 3300005539 | Bacteria | 1045 |
| 84 | Ga0068853_100638940 | 3300005539 | Bacteria | 1012 |
| 85 | Ga0068853_101803423 | 3300005539 | Bacteria | 593 |
| 86 | Ga0070672_100595373 | 3300005543 | Bacteria | 963 |
| 87 | Ga0070686_100207708 | 3300005544 | Bacteria | 1408 |
| 88 | Ga0070695_100558851 | 3300005545 | Bacteria | 893 |
| 89 | Ga0070695_101529865 | 3300005545 | Bacteria | 556 |
| 90 | Ga0070693_100038550 | 3300005547 | Bacteria | 2671 |
| 91 | Ga0070693_100462484 | 3300005547 | Bacteria | 893 |
| 92 | Ga0070665_100077316 | 3300005548 | Bacteria | 3334 |
| 93 | Ga0070665_101862103 | 3300005548 | Bacteria | 608 |
| 94 | Ga0070665_102416959 | 3300005548 | Bacteria | 528 |
| 95 | Ga0068855_100036277 | 3300005563 | Bacteria | 5870 |
| 96 | Ga0068855_102256571 | 3300005563 | Bacteria | 545 |
| 97 | Ga0068855_102260236 | 3300005563 | Bacteria | 545 |
| 98 | Ga0068855_102284708 | 3300005563 | Bacteria | 542 |
| 99 | Ga0070664_102336172 | 3300005564 | Unclassified | 507 |
| 100 | Ga0068857_100637013 | 3300005577 | Bacteria | 1010 |
| 101 | Ga0068857_101229818 | 3300005577 | Bacteria | 726 |
| 102 | Ga0068857_101732034 | 3300005577 | Unclassified | 611 |
| 103 | Ga0068857_102442697 | 3300005577 | Bacteria | 513 |
| 104 | Ga0068854_100120969 | 3300005578 | Bacteria | 1987 |
| 105 | Ga0068854_101695852 | 3300005578 | Bacteria | 578 |
| 106 | Ga0068854_102117469 | 3300005578 | Bacteria | 520 |
| 107 | Ga0068856_100083698 | 3300005614 | Bacteria | 3168 |
| 108 | Ga0068856_100127315 | 3300005614 | Bacteria | 2550 |
| 109 | Ga0068856_100429315 | 3300005614 | Bacteria | 1342 |
| 110 | Ga0068856_100755112 | 3300005614 | Bacteria | 993 |
| 111 | Ga0068856_102407592 | 3300005614 | Unclassified | 534 |
| 112 | Ga0068852_100029813 | 3300005616 | Bacteria | 4484 |
| 113 | Ga0068852_100155718 | 3300005616 | Bacteria | 2129 |
| 114 | Ga0068852_100270359 | 3300005616 | Bacteria | 1635 |
| 115 | Ga0068852_100421421 | 3300005616 | Bacteria | 1317 |
| 116 | Ga0068852_100576660 | 3300005616 | Bacteria | 1127 |
| 117 | Ga0068852_100589922 | 3300005616 | Bacteria | 1115 |
| 118 | Ga0068852_101399237 | 3300005616 | Bacteria | 721 |
| 119 | Ga0068859_100903678 | 3300005617 | Bacteria | 968 |
| 120 | Ga0068859_102794208 | 3300005617 | Bacteria | 536 |
| 121 | Ga0068864_100311213 | 3300005618 | Bacteria | 1476 |
| 122 | Ga0068864_100815565 | 3300005618 | Bacteria | 918 |
| 123 | Ga0068864_101018497 | 3300005618 | Bacteria | 822 |
| 124 | Ga0068864_101300939 | 3300005618 | Bacteria | 727 |
| 125 | Ga0068864_102528288 | 3300005618 | Bacteria | 519 |
| 126 | Ga0068861_100732763 | 3300005719 | Bacteria | 922 |
| 127 | Ga0068861_101137799 | 3300005719 | Bacteria | 752 |
| 128 | Ga0068851_10004403 | 3300005834 | Bacteria | 6348 |
| 129 | Ga0068851_10285575 | 3300005834 | Bacteria | 945 |
| 130 | Ga0068863_100181929 | 3300005841 | Bacteria | 2018 |
| 131 | Ga0068863_100236108 | 3300005841 | Bacteria | 1764 |
| 132 | Ga0068863_100361282 | 3300005841 | Bacteria | 1415 |
| 133 | Ga0068863_101629367 | 3300005841 | Bacteria | 655 |
| 134 | Ga0068863_102567320 | 3300005841 | Bacteria | 519 |
| 135 | Ga0068858_100216885 | 3300005842 | Bacteria | 1811 |
| 136 | Ga0068858_101132216 | 3300005842 | Bacteria | 769 |
| 137 | Ga0068858_101509736 | 3300005842 | Bacteria | 663 |
| 138 | Ga0068860_100000338 | 3300005843 | Bacteria | 63598 |
| 139 | Ga0068860_100408819 | 3300005843 | Bacteria | 1344 |
| 140 | Ga0068860_101026741 | 3300005843 | Bacteria | 843 |
| 141 | Ga0068860_102511391 | 3300005843 | Unclassified | 535 |
| 142 | Ga0068862_100924922 | 3300005844 | Bacteria | 859 |
| 143 | Ga0081455_10025082 | 3300005937 | Bacteria | 5510 |
| 144 | Ga0081540_1020732 | 3300005983 | Bacteria | 3941 |
| 145 | Ga0081540_1023231 | 3300005983 | Plasmid | 3634 |
| 146 | Ga0081540_1151591 | 3300005983 | Bacteria | 914 |
| 147 | Ga0070717_10121294 | 3300006028 | Bacteria | 2240 |
| 148 | Ga0070717_11108321 | 3300006028 | Bacteria | 721 |
| 149 | Ga0075365_10150424 | 3300006038 | Bacteria | 1619 |
| 150 | Ga0075368_10054498 | 3300006042 | Bacteria | 1593 |
| 151 | Ga0075368_10378092 | 3300006042 | Bacteria | 620 |
| 152 | Ga0075368_10479978 | 3300006042 | Unclassified | 553 |
| 153 | Ga0070715_10011303 | 3300006163 | Bacteria | 3212 |
| 154 | Ga0070715_10758333 | 3300006163 | Bacteria | 585 |
| 155 | Ga0070716_100003075 | 3300006173 | Bacteria | 7790 |
| 156 | Ga0070716_100011221 | 3300006173 | Bacteria | 4511 |
| 157 | Ga0070712_100068092 | 3300006175 | Bacteria | 2535 |
| 158 | Ga0070712_101352213 | 3300006175 | Bacteria | 621 |
| 159 | Ga0070712_101558663 | 3300006175 | Bacteria | 578 |
| 160 | Ga0075367_10814542 | 3300006178 | Bacteria | 595 |
| 161 | Ga0075367_10889374 | 3300006178 | Bacteria | 568 |
| 162 | Ga0075369_10058570 | 3300006186 | Bacteria | 1677 |
| 163 | Ga0097621_100462465 | 3300006237 | Bacteria | 1144 |
| 164 | Ga0097621_100830241 | 3300006237 | Bacteria | 858 |
| 165 | Ga0097621_101196165 | 3300006237 | Bacteria | 716 |
| 166 | Ga0068871_100187620 | 3300006358 | Bacteria | 1779 |
| 167 | Ga0068871_100234210 | 3300006358 | Bacteria | 1595 |
| 168 | Ga0068871_101043215 | 3300006358 | Bacteria | 763 |
| 169 | Ga0075428_102251810 | 3300006844 | Unclassified | 561 |
| 170 | Ga0075431_100214862 | 3300006847 | Bacteria | 1963 |
| 171 | Ga0075433_10037545 | 3300006852 | Bacteria | 4180 |
| 172 | Ga0075434_100617789 | 3300006871 | Bacteria | 1103 |
| 173 | Ga0068865_100483391 | 3300006881 | Bacteria | 1030 |
| 174 | Ga0068865_102080148 | 3300006881 | Unclassified | 516 |
| 175 | Ga0097620_100903714 | 3300006931 | Bacteria | 968 |
| 176 | Ga0097620_102792917 | 3300006931 | Bacteria | 536 |
| 177 | Ga0075435_101805059 | 3300007076 | Unclassified | 537 |
| 178 | Ga0099794_10095572 | 3300007265 | Bacteria | 1479 |
| 179 | Ga0099794_10352659 | 3300007265 | Bacteria | 766 |
| 180 | Ga0099794_10418808 | 3300007265 | Bacteria | 701 |
| 181 | Ga0099795_10008545 | 3300007788 | Bacteria | 2925 |
| 182 | Ga0099795_10015844 | 3300007788 | Bacteria | 2371 |
| 183 | Ga0099795_10031741 | 3300007788 | Bacteria | 1821 |
| 184 | Ga0099795_10054155 | 3300007788 | Bacteria | 1470 |
| 185 | Ga0099795_10075854 | 3300007788 | Bacteria | 1277 |
| 186 | Ga0099795_10189851 | 3300007788 | Unclassified | 862 |
| 187 | Ga0105250_10525641 | 3300009092 | Bacteria | 540 |
| 188 | Ga0105240_10011631 | 3300009093 | Bacteria | 12237 |
| 189 | Ga0105240_10119154 | 3300009093 | Bacteria | 3180 |
| 190 | Ga0105240_10612995 | 3300009093 | Bacteria | 1197 |
| 191 | Ga0111539_10090244 | 3300009094 | Bacteria | 3601 |
| 192 | Ga0105245_10537913 | 3300009098 | Bacteria | 1189 |
| 193 | Ga0105247_10006789 | 3300009101 | Bacteria | 7058 |
| 194 | Ga0105247_10195004 | 3300009101 | Bacteria | 1358 |
| 195 | Ga0105247_10244745 | 3300009101 | Bacteria | 1223 |
| 196 | Ga0105247_10543707 | 3300009101 | Bacteria | 853 |
| 197 | Ga0105243_10274253 | 3300009148 | Bacteria | 1516 |
| 198 | Ga0105243_10393801 | 3300009148 | Bacteria | 1285 |
| 199 | Ga0105241_10212606 | 3300009174 | Bacteria | 1621 |
| 200 | Ga0105241_10246418 | 3300009174 | Bacteria | 1513 |
| 201 | Ga0105241_10410482 | 3300009174 | Bacteria | 1190 |
| 202 | Ga0105241_12478115 | 3300009174 | Bacteria | 519 |
| 203 | Ga0105242_10501718 | 3300009176 | Bacteria | 1154 |
| 204 | Ga0105242_10614612 | 3300009176 | Bacteria | 1052 |
| 205 | Ga0105248_10153524 | 3300009177 | Bacteria | 2598 |
| 206 | Ga0105248_10198655 | 3300009177 | Bacteria | 2259 |
| 207 | Ga0105248_10270760 | 3300009177 | Bacteria | 1912 |
| 208 | Ga0105237_10028867 | 3300009545 | Bacteria | 5645 |
| 209 | Ga0105237_10129523 | 3300009545 | Bacteria | 2518 |
| 210 | Ga0105237_10185326 | 3300009545 | Bacteria | 2081 |
| 211 | Ga0105237_10388578 | 3300009545 | Bacteria | 1400 |
| 212 | Ga0105237_10448581 | 3300009545 | Bacteria | 1296 |
| 213 | Ga0105237_10582942 | 3300009545 | Bacteria | 1125 |
| 214 | Ga0105237_10631722 | 3300009545 | Bacteria | 1078 |
| 215 | Ga0105237_11234268 | 3300009545 | Bacteria | 754 |
| 216 | Ga0105237_11406540 | 3300009545 | Bacteria | 704 |
| 217 | Ga0105237_11957120 | 3300009545 | Bacteria | 594 |
| 218 | Ga0105237_12429049 | 3300009545 | Bacteria | 534 |
| 219 | Ga0105238_10004512 | 3300009551 | Bacteria | 13800 |
| 220 | Ga0105238_10238393 | 3300009551 | Bacteria | 1796 |
| 221 | Ga0105238_11645552 | 3300009551 | Bacteria | 672 |
| 222 | Ga0105249_10715616 | 3300009553 | Bacteria | 1062 |
| 223 | Ga0105249_11011686 | 3300009553 | Bacteria | 900 |
| 224 | Ga0105249_13501321 | 3300009553 | Bacteria | 505 |
| 225 | Ga0099796_10204084 | 3300010159 | Bacteria | 803 |
| 226 | Ga0099796_10328335 | 3300010159 | Bacteria | 654 |
| 227 | Ga0099796_10395194 | 3300010159 | Bacteria | 605 |
| 228 | Ga0099796_10410314 | 3300010159 | Bacteria | 595 |
| 229 | Ga0105239_10069619 | 3300010375 | Bacteria | 3866 |
| 230 | Ga0105239_10112815 | 3300010375 | Bacteria | 3014 |
| 231 | Ga0105239_10181119 | 3300010375 | Bacteria | 2357 |
| 232 | Ga0105239_10272260 | 3300010375 | Bacteria | 1905 |
| 233 | Ga0105239_10278093 | 3300010375 | Bacteria | 1884 |
| 234 | Ga0105239_10774240 | 3300010375 | Bacteria | 1099 |
| 235 | Ga0105239_10892140 | 3300010375 | Bacteria | 1020 |
| 236 | Ga0105239_10937113 | 3300010375 | Bacteria | 994 |
| 237 | Ga0105239_11735329 | 3300010375 | Bacteria | 723 |
| 238 | Ga0105246_10031768 | 3300011119 | Bacteria | 3496 |
| 239 | Ga0105246_10338814 | 3300011119 | Bacteria | 1228 |
| 240 | Ga0105246_10613230 | 3300011119 | Bacteria | 942 |
| 241 | Ga0105246_11401159 | 3300011119 | Bacteria | 652 |
| 242 | Ga0157313_1015837 | 3300012503 | Bacteria | 713 |
| 243 | Ga0157370_10138556 | 3300013104 | Bacteria | 2267 |
| 244 | Ga0157369_10189265 | 3300013105 | Bacteria | 2163 |
| 245 | Ga0157369_10415885 | 3300013105 | Bacteria | 1394 |
| 246 | Ga0157374_10109473 | 3300013296 | Bacteria | 2656 |
| 247 | Ga0157374_10381201 | 3300013296 | Bacteria | 1405 |
| 248 | Ga0157374_11281194 | 3300013296 | Bacteria | 755 |
| 249 | Ga0157378_10181370 | 3300013297 | Bacteria | 1981 |
| 250 | Ga0157378_10240913 | 3300013297 | Bacteria | 1727 |
| 251 | Ga0157378_11001122 | 3300013297 | Bacteria | 870 |
| 252 | Ga0157378_11593750 | 3300013297 | Bacteria | 699 |
| 253 | Ga0163162_10114506 | 3300013306 | Bacteria | 2796 |
| 254 | Ga0163162_10403333 | 3300013306 | Bacteria | 1500 |
| 255 | Ga0163162_11925127 | 3300013306 | Bacteria | 677 |
| 256 | Ga0163162_12609560 | 3300013306 | Bacteria | 581 |
| 257 | Ga0163162_12670804 | 3300013306 | Bacteria | 575 |
| 258 | Ga0157372_10131460 | 3300013307 | Bacteria | 2880 |
| 259 | Ga0157372_11379364 | 3300013307 | Bacteria | 813 |
| 260 | Ga0157372_12531779 | 3300013307 | Bacteria | 589 |
| 261 | Ga0157375_10282303 | 3300013308 | Bacteria | 1823 |
| 262 | Ga0157375_11201538 | 3300013308 | Bacteria | 889 |
| 263 | Ga0157375_11754915 | 3300013308 | Unclassified | 735 |
| 264 | Ga0157375_13511646 | 3300013308 | Bacteria | 522 |
| 265 | Ga0163163_10117278 | 3300014325 | Bacteria | 2694 |
| 266 | Ga0163163_10210261 | 3300014325 | Bacteria | 1994 |
| 267 | Ga0163163_11531445 | 3300014325 | Bacteria | 728 |
| 268 | Ga0163163_11544591 | 3300014325 | Bacteria | 725 |
| 269 | Ga0163163_11934809 | 3300014325 | Bacteria | 650 |
| 270 | Ga0163163_12508340 | 3300014325 | Bacteria | 573 |
| 271 | Ga0157377_10314028 | 3300014745 | Bacteria | 1039 |
| 272 | Ga0157379_10329410 | 3300014968 | Bacteria | 1395 |
| 273 | Ga0157379_10556630 | 3300014968 | Bacteria | 1067 |
| 274 | Ga0157379_10751606 | 3300014968 | Bacteria | 918 |
| 275 | Ga0157379_11026611 | 3300014968 | Bacteria | 787 |
| 276 | Ga0157379_11153457 | 3300014968 | Bacteria | 744 |
| 277 | Ga0157379_11751966 | 3300014968 | Bacteria | 609 |
| 278 | Ga0157376_10026265 | 3300014969 | Bacteria | 4599 |
| 279 | Ga0157376_10514124 | 3300014969 | Bacteria | 1179 |
| 280 | Ga0157376_11130366 | 3300014969 | Bacteria | 810 |
| 281 | Ga0157376_11571115 | 3300014969 | Bacteria | 692 |
| 282 | Ga0157376_11786189 | 3300014969 | Unclassified | 651 |
| 283 | Ga0157376_11908035 | 3300014969 | Bacteria | 631 |
| 284 | Ga0182007_10200408 | 3300015262 | Bacteria | 698 |
| 285 | Ga0163161_10273386 | 3300017792 | Bacteria | 1323 |
| 286 | Ga0206353_11945494 | 3300020082 | Bacteria | 1182 |
| 287 | Ga0209563_100565 | 3300025230 | Bacteria | 12334 |
| 288 | Ga0209677_100794 | 3300025253 | Bacteria | 15885 |
| 289 | Ga0209233_1008827 | 3300025261 | Bacteria | 3093 |
| 290 | Ga0209130_1027206 | 3300025284 | Bacteria | 1218 |
| 291 | Ga0209758_1005254 | 3300025297 | Bacteria | 10133 |
| 292 | Ga0209758_1008667 | 3300025297 | Bacteria | 6525 |
| 293 | Ga0209758_1104867 | 3300025297 | Bacteria | 795 |
| 294 | Ga0207426_1050719 | 3300025302 | Bacteria | 1236 |
| 295 | Ga0209257_1130527 | 3300025304 | Bacteria | 576 |
| 296 | Ga0207656_10001723 | 3300025321 | Bacteria | 7270 |
| 297 | Ga0207692_10004179 | 3300025898 | Bacteria | 5700 |
| 298 | Ga0207692_10099053 | 3300025898 | Bacteria | 1596 |
| 299 | Ga0207710_10005915 | 3300025900 | Bacteria | 5247 |
| 300 | Ga0207710_10264934 | 3300025900 | Bacteria | 862 |
| 301 | Ga0207710_10335126 | 3300025900 | Bacteria | 769 |
| 302 | Ga0207710_10523832 | 3300025900 | Bacteria | 616 |
| 303 | Ga0207688_10146588 | 3300025901 | Bacteria | 1392 |
| 304 | Ga0207680_10130339 | 3300025903 | Bacteria | 1657 |
| 305 | Ga0207680_10390480 | 3300025903 | Bacteria | 982 |
| 306 | Ga0207680_10774819 | 3300025903 | Bacteria | 688 |
| 307 | Ga0207647_10112176 | 3300025904 | Bacteria | 1612 |
| 308 | Ga0207685_10009623 | 3300025905 | Bacteria | 2815 |
| 309 | Ga0207699_10000443 | 3300025906 | Bacteria | 21171 |
| 310 | Ga0207699_10123763 | 3300025906 | Bacteria | 1676 |
| 311 | Ga0207705_10999870 | 3300025909 | Bacteria | 646 |
| 312 | Ga0207654_10020998 | 3300025911 | Bacteria | 3468 |
| 313 | Ga0207654_10534965 | 3300025911 | Bacteria | 831 |
| 314 | Ga0207707_10010412 | 3300025912 | Bacteria | 8069 |
| 315 | Ga0207707_10588304 | 3300025912 | Bacteria | 943 |
| 316 | Ga0207707_10771274 | 3300025912 | Bacteria | 803 |
| 317 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 318 | Ga0207695_10271738 | 3300025913 | Bacteria | 1590 |
| 319 | Ga0207695_10515954 | 3300025913 | Bacteria | 1077 |
| 320 | Ga0207671_10010861 | 3300025914 | Bacteria | 7469 |
| 321 | Ga0207671_10050106 | 3300025914 | Bacteria | 3092 |
| 322 | Ga0207671_10165451 | 3300025914 | Bacteria | 1715 |
| 323 | Ga0207671_10356181 | 3300025914 | Bacteria | 1161 |
| 324 | Ga0207671_10795010 | 3300025914 | Bacteria | 750 |
| 325 | Ga0207671_10828355 | 3300025914 | Bacteria | 733 |
| 326 | Ga0207671_11102496 | 3300025914 | Bacteria | 623 |
| 327 | Ga0207671_11339976 | 3300025914 | Bacteria | 556 |
| 328 | Ga0207693_10005369 | 3300025915 | Bacteria | 10708 |
| 329 | Ga0207693_10532392 | 3300025915 | Bacteria | 917 |
| 330 | Ga0207693_10924030 | 3300025915 | Bacteria | 669 |
| 331 | Ga0207663_10000159 | 3300025916 | Bacteria | 31170 |
| 332 | Ga0207663_10008306 | 3300025916 | Bacteria | 5420 |
| 333 | Ga0207660_10062522 | 3300025917 | Bacteria | 2682 |
| 334 | Ga0207660_10087813 | 3300025917 | Bacteria | 2298 |
| 335 | Ga0207660_10156052 | 3300025917 | Unclassified | 1757 |
| 336 | Ga0207657_10386833 | 3300025919 | Bacteria | 1101 |
| 337 | Ga0207657_10723480 | 3300025919 | Bacteria | 772 |
| 338 | Ga0207649_10473613 | 3300025920 | Bacteria | 949 |
| 339 | Ga0207652_10007627 | 3300025921 | Bacteria | 8707 |
| 340 | Ga0207681_11563343 | 3300025923 | Bacteria | 553 |
| 341 | Ga0207694_10003079 | 3300025924 | Bacteria | 13349 |
| 342 | Ga0207694_10221119 | 3300025924 | Bacteria | 1545 |
| 343 | Ga0207694_11158802 | 3300025924 | Bacteria | 654 |
| 344 | Ga0207650_10879388 | 3300025925 | Bacteria | 761 |
| 345 | Ga0207687_11187462 | 3300025927 | Bacteria | 656 |
| 346 | Ga0207700_10020296 | 3300025928 | Bacteria | 4509 |
| 347 | Ga0207700_10078655 | 3300025928 | Bacteria | 2566 |
| 348 | Ga0207700_10097767 | 3300025928 | Bacteria | 2334 |
| 349 | Ga0207664_10006844 | 3300025929 | Bacteria | 7879 |
| 350 | Ga0207664_10048445 | 3300025929 | Bacteria | 3341 |
| 351 | Ga0207664_10381917 | 3300025929 | Bacteria | 1250 |
| 352 | Ga0207644_10161681 | 3300025931 | Bacteria | 1741 |
| 353 | Ga0207644_10697723 | 3300025931 | Bacteria | 846 |
| 354 | Ga0207690_10018691 | 3300025932 | Bacteria | 4253 |
| 355 | Ga0207690_10764397 | 3300025932 | Bacteria | 797 |
| 356 | Ga0207706_10865678 | 3300025933 | Bacteria | 765 |
| 357 | Ga0207686_10898827 | 3300025934 | Bacteria | 714 |
| 358 | Ga0207709_10901449 | 3300025935 | Bacteria | 719 |
| 359 | Ga0207704_10658807 | 3300025938 | Bacteria | 863 |
| 360 | Ga0207665_10001544 | 3300025939 | Bacteria | 15491 |
| 361 | Ga0207665_10351234 | 3300025939 | Bacteria | 1113 |
| 362 | Ga0207691_11162346 | 3300025940 | Bacteria | 641 |
| 363 | Ga0207711_10153536 | 3300025941 | Bacteria | 2079 |
| 364 | Ga0207711_10487956 | 3300025941 | Bacteria | 1148 |
| 365 | Ga0207711_10764331 | 3300025941 | Bacteria | 900 |
| 366 | Ga0207689_10196260 | 3300025942 | Bacteria | 1666 |
| 367 | Ga0207689_10815045 | 3300025942 | Bacteria | 788 |
| 368 | Ga0207679_10429628 | 3300025945 | Bacteria | 1167 |
| 369 | Ga0207679_10462542 | 3300025945 | Bacteria | 1127 |
| 370 | Ga0207667_10017617 | 3300025949 | Bacteria | 8034 |
| 371 | Ga0207712_11034372 | 3300025961 | Bacteria | 729 |
| 372 | Ga0207712_11120598 | 3300025961 | Bacteria | 701 |
| 373 | Ga0207668_10128780 | 3300025972 | Bacteria | 1929 |
| 374 | Ga0207668_10179991 | 3300025972 | Bacteria | 1666 |
| 375 | Ga0207658_10536757 | 3300025986 | Bacteria | 1045 |
| 376 | Ga0207658_10648447 | 3300025986 | Bacteria | 952 |
| 377 | Ga0207677_10153115 | 3300026023 | Bacteria | 1782 |
| 378 | Ga0207677_11163367 | 3300026023 | Bacteria | 705 |
| 379 | Ga0207703_10428887 | 3300026035 | Bacteria | 1232 |
| 380 | Ga0207703_11047739 | 3300026035 | Bacteria | 783 |
| 381 | Ga0207703_11066277 | 3300026035 | Bacteria | 776 |
| 382 | Ga0207639_10002960 | 3300026041 | Bacteria | 11420 |
| 383 | Ga0207639_10058811 | 3300026041 | Bacteria | 2958 |
| 384 | Ga0207639_10562892 | 3300026041 | Bacteria | 1048 |
| 385 | Ga0207639_10747020 | 3300026041 | Bacteria | 909 |
| 386 | Ga0207639_11000217 | 3300026041 | Bacteria | 783 |
| 387 | Ga0207678_10118720 | 3300026067 | Bacteria | 2257 |
| 388 | Ga0207678_10266094 | 3300026067 | Bacteria | 1470 |
| 389 | Ga0207678_10308359 | 3300026067 | Bacteria | 1361 |
| 390 | Ga0207702_10166453 | 3300026078 | Bacteria | 2017 |
| 391 | Ga0207702_10553278 | 3300026078 | Bacteria | 1126 |
| 392 | Ga0207702_10597236 | 3300026078 | Bacteria | 1083 |
| 393 | Ga0207702_10641392 | 3300026078 | Bacteria | 1044 |
| 394 | Ga0207641_10114966 | 3300026088 | Bacteria | 2392 |
| 395 | Ga0207641_11093053 | 3300026088 | Bacteria | 796 |
| 396 | Ga0207648_10144659 | 3300026089 | Bacteria | 2097 |
| 397 | Ga0207648_10334755 | 3300026089 | Bacteria | 1362 |
| 398 | Ga0207676_10257714 | 3300026095 | Bacteria | 1573 |
| 399 | Ga0207676_11109715 | 3300026095 | Bacteria | 782 |
| 400 | Ga0207676_11681696 | 3300026095 | Bacteria | 633 |
| 401 | Ga0207674_10639890 | 3300026116 | Bacteria | 1027 |
| 402 | Ga0207674_10753766 | 3300026116 | Bacteria | 940 |
| 403 | Ga0207675_100180021 | 3300026118 | Bacteria | 2024 |
| 404 | Ga0207675_100790960 | 3300026118 | Bacteria | 961 |
| 405 | Ga0207675_101993647 | 3300026118 | Bacteria | 598 |
| 406 | Ga0207683_10132131 | 3300026121 | Bacteria | 2246 |
| 407 | Ga0207683_10756772 | 3300026121 | Bacteria | 901 |
| 408 | Ga0207698_10020684 | 3300026142 | Bacteria | 4535 |
| 409 | Ga0207698_10733625 | 3300026142 | Bacteria | 985 |
| 410 | Ga0207698_10953073 | 3300026142 | Bacteria | 867 |
| 411 | Ga0207698_11201516 | 3300026142 | Bacteria | 772 |
| 412 | Ga0207698_11829983 | 3300026142 | Bacteria | 622 |
| 413 | Ga0207698_11942224 | 3300026142 | Bacteria | 603 |
| 414 | Ga0209179_1003483 | 3300027512 | Bacteria | 2273 |
| 415 | Ga0209179_1047726 | 3300027512 | Bacteria | 913 |
| 416 | Ga0209813_10017710 | 3300027866 | Bacteria | 1959 |
| 417 | Ga0207428_10100503 | 3300027907 | Bacteria | 2235 |
| 418 | Ga0268266_11422845 | 3300028379 | Bacteria | 669 |
| 419 | Ga0268265_11597985 | 3300028380 | Bacteria | 657 |
| 420 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 421 | Ga0268264_10376459 | 3300028381 | Bacteria | 1358 |
| 422 | Ga0268264_12421685 | 3300028381 | Bacteria | 531 |
| 423 | Ga0265334_10061058 | 3300028573 | Bacteria | 1421 |
| 424 | Ga0307517_10219501 | 3300028786 | Bacteria | 1158 |
| 425 | Ga0307511_10068005 | 3300030521 | Bacteria | 2636 |
| 426 | Ga0265330_10019295 | 3300031235 | Bacteria | 3126 |
| 427 | Ga0265330_10057988 | 3300031235 | Bacteria | 1688 |
| 428 | Ga0265332_10018917 | 3300031238 | Bacteria | 3041 |
| 429 | Ga0265328_10019996 | 3300031239 | Bacteria | 2566 |
| 430 | Ga0265328_10299135 | 3300031239 | Bacteria | 621 |
| 431 | Ga0265325_10031254 | 3300031241 | Bacteria | 2851 |
| 432 | Ga0265340_10007086 | 3300031247 | Bacteria | 6111 |
| 433 | Ga0265339_10451679 | 3300031249 | Bacteria | 597 |
| 434 | Ga0265331_10044539 | 3300031250 | Bacteria | 2145 |
| 435 | Ga0265331_10045923 | 3300031250 | Bacteria | 2107 |
| 436 | Ga0265331_10222993 | 3300031250 | Bacteria | 847 |
| 437 | Ga0265331_10329848 | 3300031250 | Bacteria | 683 |
| 438 | Ga0265316_10579648 | 3300031344 | Bacteria | 797 |
| 439 | Ga0265316_10597677 | 3300031344 | Bacteria | 783 |
| 440 | Ga0265316_10608495 | 3300031344 | Bacteria | 774 |
| 441 | Ga0307509_10050156 | 3300031507 | Bacteria | 4470 |
| 442 | Ga0307509_10104557 | 3300031507 | Bacteria | 2856 |
| 443 | Ga0307509_10329994 | 3300031507 | Bacteria | 1257 |
| 444 | Ga0307509_10795664 | 3300031507 | Bacteria | 610 |
| 445 | Ga0307509_10883068 | 3300031507 | Bacteria | 559 |
| 446 | Ga0307508_10090477 | 3300031616 | Bacteria | 2647 |
| 447 | Ga0307508_10201686 | 3300031616 | Bacteria | 1589 |
| 448 | Ga0307508_10821670 | 3300031616 | Bacteria | 548 |
| 449 | Ga0265314_10100428 | 3300031711 | Bacteria | 1861 |
| 450 | Ga0265342_10047587 | 3300031712 | Bacteria | 2573 |
| 451 | Ga0265342_10084101 | 3300031712 | Bacteria | 1833 |
| 452 | Ga0307516_10113627 | 3300031730 | Bacteria | 2506 |
| 453 | Ga0307516_10343129 | 3300031730 | Bacteria | 1160 |
| 454 | Ga0307516_10482551 | 3300031730 | Bacteria | 894 |
| 455 | Ga0307507_10035688 | 3300033179 | Bacteria | 5102 |
| 456 | Ga0307510_10070832 | 3300033180 | Bacteria | 3478 |
| 457 | Ga0307510_10153880 | 3300033180 | Bacteria | 1911 |
| 458 | Ga0307510_10346328 | 3300033180 | Bacteria | 937 |
| 459 | Ga0373958_0025359 | 3300034819 | Bacteria | 1128 |
| 460 | Ga0373938_0115955 | 3300034957 | Bacteria | 686 |
| 461 | Ga0373926_0143317 | 3300035083 | Unclassified | 908 |
| 462 | Ga0373928_0072665 | 3300035084 | Bacteria | 854 |
| 463 | Ga0373928_0077986 | 3300035084 | Unclassified | 831 |
| 464 | Ga0373929_0051221 | 3300035085 | Bacteria | 944 |
| 465 | Ga0373934_0009884 | 3300035086 | Bacteria | 3581 |
| 466 | Ga0373940_0267369 | 3300035088 | Bacteria | 581 |
| 467 | Ga0373949_0037641 | 3300035090 | Bacteria | 1178 |
| 468 | Ga0373923_0029194 | 3300035111 | Bacteria | 2210 |
| 469 | Ga0373932_0026950 | 3300035112 | Bacteria | 1568 |
| 470 | Ga0373936_0167631 | 3300035113 | Bacteria | 959 |
| 471 | Ga0373936_0608680 | 3300035113 | Bacteria | 513 |
| 472 | Ga0373941_0023970 | 3300035115 | Bacteria | 1748 |
| 473 | Ga0373941_0156602 | 3300035115 | Bacteria | 839 |
| 474 | Ga0373945_0075540 | 3300035116 | Bacteria | 1283 |
| 475 | Ga0373945_0560706 | 3300035116 | Bacteria | 513 |
| 476 | Ga0373953_0114672 | 3300035117 | Bacteria | 1141 |
| 477 | Ga0373954_0023495 | 3300035118 | Bacteria | 2803 |
| 478 | Ga0373956_0003314 | 3300035119 | Bacteria | 6486 |
| 479 | Ga0373957_0004032 | 3300035120 | Bacteria | 4423 |
| 480 | Ga0373957_0484708 | 3300035120 | Bacteria | 537 |
| 481 | Ga0373960_0176040 | 3300035121 | Bacteria | 744 |
| 482 | Ga0373943_0022410 | 3300035170 | Bacteria | 2927 |
| 483 | Ga0373943_0169974 | 3300035170 | Bacteria | 1192 |
| 484 | Ga0373943_0369118 | 3300035170 | Bacteria | 825 |
| 485 | Ga0373946_0297386 | 3300035171 | Bacteria | 797 |
| 486 | Ga0373946_0543606 | 3300035171 | Unclassified | 599 |
| 487 | Ga0373955_0002545 | 3300035172 | Bacteria | 7980 |
| 488 | Ga0373942_0066210 | 3300035207 | Unclassified | 1045 |
| 489 | Ga0373961_0081783 | 3300035241 | Bacteria | 1017 |
| 490 | Ga0373961_0390696 | 3300035241 | Bacteria | 532 |
| 491 | Ga0373962_0265568 | 3300035242 | Bacteria | 600 |
| 492 | Ga0373924_0005363 | 3300035410 | Bacteria | 4535 |
| 493 | Ga0373931_0003348 | 3300035691 | Bacteria | 7181 |
| 494 | Ga0373931_0003381 | 3300035691 | Bacteria | 7158 |
| 495 | Ga0373931_0091706 | 3300035691 | Bacteria | 1694 |
| 496 | Ga0373935_0066250 | 3300035692 | Bacteria | 2319 |
| 497 | Ga0373935_0091991 | 3300035692 | Bacteria | 1987 |
| 498 | Ga0373935_0214787 | 3300035692 | Bacteria | 1334 |
| 499 | Ga0373935_0895863 | 3300035692 | Bacteria | 657 |
| 500 | Ga0373927_0001975 | 3300035695 | Bacteria | 15129 |
| 501 | Ga0373927_0012306 | 3300035695 | Bacteria | 5692 |
| 502 | Ga0373927_0033149 | 3300035695 | Bacteria | 3363 |
| 503 | Ga0373933_0004241 | 3300035724 | Bacteria | 7898 |
| 504 | Ga0373947_0011731 | 3300035725 | Bacteria | 5022 |
| 505 | Ga0373947_0311329 | 3300035725 | Bacteria | 1051 |
| 506 | Ga0373947_0361666 | 3300035725 | Bacteria | 975 |
| 507 | Ga0373937_0037309 | 3300036401 | Bacteria | 4428 |
| 508 | Ga0373925_0045130 | 3300037068 | Bacteria | 3274 |
| 509 | Ga0373925_0057487 | 3300037068 | Bacteria | 2915 |
| 510 | Ga0373925_0094759 | 3300037068 | Bacteria | 2286 |
| 511 | Ga0373925_0991858 | 3300037068 | Bacteria | 692 |
| 512 | Ga0373925_1217463 | 3300037068 | Bacteria | 619 |
| 513 | Ga0373925_1346045 | 3300037068 | Bacteria | 585 |
| 514 | Ga0395898_0264748 | 3300037466 | Bacteria | 1640 |
| 515 | Ga0436360_0773285 | 3300039438 | Bacteria | 1479 |
| 516 | Ga0436363_1526908 | 3300039450 | Bacteria | 1083 |
| 517 | Ga0451789_1275308 | 3300041443 | Bacteria | 669 |
| 518 | Ga0451791_0807056 | 3300041451 | Bacteria | 790 |
| 519 | Ga0451791_1818816 | 3300041451 | Bacteria | 701 |
| 520 | Ga0451793_0560032 | 3300041452 | Bacteria | 1244 |
| 521 | Ga0451797_0544067 | 3300041453 | Bacteria | 520 |
| 522 | Ga0451795_1486397 | 3300041456 | Bacteria | 761 |
| 523 | Ga0451795_1697835 | 3300041456 | Bacteria | 524 |
| 524 | Ga0451800_1024483 | 3300041459 | Bacteria | 731 |
| 525 | Ga0451800_1187149 | 3300041459 | Bacteria | 757 |
| 526 | Ga0451802_0663882 | 3300041460 | Bacteria | 963 |
| 527 | Ga0451804_1072820 | 3300041463 | Bacteria | 793 |
| 528 | Ga0451807_0961669 | 3300041486 | Bacteria | 596 |
| 529 | Ga0451807_1572561 | 3300041486 | Bacteria | 679 |
| 530 | Ga0451833_1407648 | 3300041491 | Bacteria | 673 |
| 531 | Ga0451835_1187017 | 3300041492 | Bacteria | 613 |
| 532 | Ga0451837_0193938 | 3300041494 | Bacteria | 503 |
| 533 | Ga0451839_0507174 | 3300041496 | Bacteria | 713 |
| 534 | Ga0451841_1267011 | 3300041498 | Bacteria | 870 |
| 535 | Ga0451849_0002782 | 3300041505 | Bacteria | 613 |
| 536 | Ga0451849_0494380 | 3300041505 | Bacteria | 1636 |
| 537 | Ga0451851_0166502 | 3300041507 | Bacteria | 707 |
| 538 | Ga0451853_1365813 | 3300041512 | Bacteria | 939 |
| 539 | Ga0466968_0287594 | 3300044735 | Bacteria | 788 |
| 540 | Ga0495617_191825 | 3300046452 | Bacteria | 641 |
| 541 | Ga0495592_0008547 | 3300046454 | Bacteria | 7685 |
| 542 | Ga0495592_0097532 | 3300046454 | Bacteria | 2099 |
| 543 | Ga0495592_0646140 | 3300046454 | Bacteria | 641 |
| 544 | Ga0495629_0000905 | 3300046459 | Bacteria | 23806 |
| 545 | Ga0495629_0002614 | 3300046459 | Bacteria | 13806 |
| 546 | Ga0495629_0601026 | 3300046459 | Bacteria | 736 |
| 547 | Ga0495629_0890183 | 3300046459 | Bacteria | 584 |
| 548 | Ga0495638_0006758 | 3300046460 | Bacteria | 8304 |
| 549 | Ga0495638_0277112 | 3300046460 | Bacteria | 913 |
| 550 | Ga0495641_0582456 | 3300046461 | Bacteria | 511 |
| 551 | Ga0495651_0040294 | 3300046462 | Bacteria | 3633 |
| 552 | Ga0495651_0178045 | 3300046462 | Bacteria | 1508 |
| 553 | Ga0495651_0200110 | 3300046462 | Bacteria | 1398 |
| 554 | Ga0495651_0304696 | 3300046462 | Bacteria | 1067 |
| 555 | Ga0495653_0006522 | 3300046463 | Bacteria | 9575 |
| 556 | Ga0495653_0047464 | 3300046463 | Bacteria | 3321 |
| 557 | Ga0495580_0280970 | 3300046472 | Bacteria | 1136 |
| 558 | Ga0495580_0863409 | 3300046472 | Bacteria | 583 |
| 559 | Ga0495582_0513581 | 3300046473 | Bacteria | 693 |
| 560 | Ga0495582_0580678 | 3300046473 | Bacteria | 648 |
| 561 | Ga0495639_0069218 | 3300046475 | Bacteria | 1628 |
| 562 | Ga0495639_0743898 | 3300046475 | Bacteria | 507 |
| 563 | Ga0495662_0472764 | 3300046476 | Bacteria | 615 |
| 564 | Ga0495664_0037868 | 3300046477 | Bacteria | 2847 |
| 565 | Ga0495664_0160497 | 3300046477 | Bacteria | 1364 |
| 566 | Ga0495664_0257102 | 3300046477 | Bacteria | 1056 |
| 567 | Ga0495584_0011133 | 3300046491 | Bacteria | 4611 |
| 568 | Ga0495584_0498864 | 3300046491 | Bacteria | 620 |
| 569 | Ga0495584_0613537 | 3300046491 | Unclassified | 555 |
| 570 | Ga0495585_0532994 | 3300046492 | Bacteria | 556 |
| 571 | Ga0495596_0171603 | 3300046500 | Bacteria | 843 |
| 572 | Ga0495607_0145747 | 3300046501 | Bacteria | 1217 |
| 573 | Ga0495607_0206840 | 3300046501 | Bacteria | 968 |
| 574 | Ga0495583_0121654 | 3300046506 | Bacteria | 1098 |
| 575 | Ga0495583_0169620 | 3300046506 | Bacteria | 897 |
| 576 | Ga0495606_0017354 | 3300046507 | Bacteria | 5444 |
| 577 | Ga0495606_0025094 | 3300046507 | Bacteria | 4277 |
| 578 | Ga0495606_0164446 | 3300046507 | Bacteria | 1292 |
| 579 | Ga0495606_0183177 | 3300046507 | Bacteria | 1206 |
| 580 | Ga0495606_0590549 | 3300046507 | Bacteria | 546 |
| 581 | Ga0495608_0011764 | 3300046511 | Bacteria | 6086 |
| 582 | Ga0495608_0011932 | 3300046511 | Bacteria | 6042 |
| 583 | Ga0495608_0138708 | 3300046511 | Bacteria | 1553 |
| 584 | Ga0495610_0145266 | 3300046512 | Bacteria | 1017 |
| 585 | Ga0495616_0120553 | 3300046513 | Bacteria | 1211 |
| 586 | Ga0495618_0141527 | 3300046514 | Bacteria | 1538 |
| 587 | Ga0495618_0185740 | 3300046514 | Bacteria | 1320 |
| 588 | Ga0495620_0094811 | 3300046515 | Bacteria | 1194 |
| 589 | Ga0495620_0197307 | 3300046515 | Bacteria | 775 |
| 590 | Ga0495628_0049172 | 3300046516 | Bacteria | 3339 |
| 591 | Ga0495628_0327571 | 3300046516 | Bacteria | 1129 |
| 592 | Ga0495628_0343235 | 3300046516 | Bacteria | 1099 |
| 593 | Ga0495628_0484301 | 3300046516 | Bacteria | 895 |
| 594 | Ga0495628_1164407 | 3300046516 | Bacteria | 524 |
| 595 | Ga0495628_1259200 | 3300046516 | Bacteria | 500 |
| 596 | Ga0495630_0877610 | 3300046517 | Bacteria | 684 |
| 597 | Ga0495630_1298315 | 3300046517 | Bacteria | 549 |
| 598 | Ga0495631_0066644 | 3300046518 | Bacteria | 1558 |
| 599 | Ga0495631_0250362 | 3300046518 | Bacteria | 755 |
| 600 | Ga0495631_0456230 | 3300046518 | Bacteria | 544 |
| 601 | Ga0495632_0134187 | 3300046519 | Bacteria | 1151 |
| 602 | Ga0495632_0454932 | 3300046519 | Bacteria | 555 |
| 603 | Ga0495643_0010684 | 3300046522 | Bacteria | 5640 |
| 604 | Ga0495648_0001072 | 3300046524 | Bacteria | 27793 |
| 605 | Ga0495648_0005237 | 3300046524 | Bacteria | 10840 |
| 606 | Ga0495648_0115674 | 3300046524 | Bacteria | 1450 |
| 607 | Ga0495648_0191501 | 3300046524 | Bacteria | 1031 |
| 608 | Ga0495648_0276262 | 3300046524 | Bacteria | 798 |
| 609 | Ga0495666_0191530 | 3300046526 | Bacteria | 942 |
| 610 | Ga0495642_0061562 | 3300046528 | Bacteria | 1558 |
| 611 | Ga0495652_0009450 | 3300046529 | Bacteria | 8859 |
| 612 | Ga0495652_0015406 | 3300046529 | Bacteria | 6847 |
| 613 | Ga0495652_0050712 | 3300046529 | Bacteria | 3547 |
| 614 | Ga0495652_0120797 | 3300046529 | Bacteria | 2090 |
| 615 | Ga0495654_0140247 | 3300046530 | Bacteria | 1078 |
| 616 | Ga0495665_0071942 | 3300046531 | Bacteria | 1821 |
| 617 | Ga0495665_0357932 | 3300046531 | Unclassified | 743 |
| 618 | Ga0495640_0003997 | 3300046533 | Bacteria | 11803 |
| 619 | Ga0495640_0005556 | 3300046533 | Bacteria | 10025 |
| 620 | Ga0495586_0584681 | 3300046535 | Bacteria | 645 |
| 621 | Ga0495587_0010964 | 3300046536 | Bacteria | 5748 |
| 622 | Ga0495587_0035730 | 3300046536 | Bacteria | 2992 |
| 623 | Ga0495609_0254242 | 3300046538 | Bacteria | 723 |
| 624 | Ga0495609_0414856 | 3300046538 | Unclassified | 538 |
| 625 | Ga0495597_0046921 | 3300046542 | Bacteria | 1913 |
| 626 | Ga0495597_0235765 | 3300046542 | Bacteria | 723 |
| 627 | Ga0495645_0025866 | 3300046543 | Bacteria | 4261 |
| 628 | Ga0495645_0183083 | 3300046543 | Bacteria | 1433 |
| 629 | Ga0495622_0008090 | 3300046557 | Bacteria | 4875 |
| 630 | Ga0495622_0008469 | 3300046557 | Bacteria | 4761 |
| 631 | Ga0495667_0011440 | 3300046559 | Bacteria | 6004 |
| 632 | Ga0495667_0013790 | 3300046559 | Bacteria | 5459 |
| 633 | Ga0495667_0433148 | 3300046559 | Bacteria | 827 |
| 634 | Ga0495656_0300291 | 3300046615 | Bacteria | 823 |
| 635 | Ga0495668_0085926 | 3300046616 | Bacteria | 1725 |
| 636 | Ga0495611_0206232 | 3300046648 | Bacteria | 916 |
| 637 | Ga0495611_0221977 | 3300046648 | Bacteria | 879 |
| 638 | Ga0495611_0238612 | 3300046648 | Bacteria | 844 |
| 639 | Ga0495611_0339696 | 3300046648 | Bacteria | 690 |
| 640 | Ga0495611_0523836 | 3300046648 | Bacteria | 538 |
| 641 | Ga0495625_0165431 | 3300046660 | Bacteria | 1479 |
| 642 | Ga0495625_0189269 | 3300046660 | Bacteria | 1364 |
| 643 | Ga0495625_0492023 | 3300046660 | Bacteria | 751 |
| 644 | Ga0495625_0601979 | 3300046660 | Bacteria | 660 |
| 645 | Ga0495635_0001821 | 3300046663 | Bacteria | 14407 |
| 646 | Ga0495635_0006294 | 3300046663 | Bacteria | 8269 |
| 647 | Ga0495635_0090798 | 3300046663 | Bacteria | 2089 |
| 648 | Ga0495635_1101818 | 3300046663 | Bacteria | 502 |
| 649 | Ga0495661_0506652 | 3300046665 | Bacteria | 575 |
| 650 | Ga0495588_0015739 | 3300046674 | Bacteria | 3646 |
| 651 | Ga0495588_0116156 | 3300046674 | Bacteria | 1410 |
| 652 | Ga0495657_0004358 | 3300046675 | Bacteria | 11297 |
| 653 | Ga0495657_0026309 | 3300046675 | Bacteria | 4120 |
| 654 | Ga0495657_0181727 | 3300046675 | Bacteria | 1290 |
| 655 | Ga0495657_0281419 | 3300046675 | Bacteria | 995 |
| 656 | Ga0495657_0688941 | 3300046675 | Bacteria | 588 |
| 657 | Ga0495599_0001858 | 3300046678 | Bacteria | 12234 |
| 658 | Ga0495599_0010912 | 3300046678 | Bacteria | 5570 |
| 659 | Ga0495599_0307421 | 3300046678 | Bacteria | 956 |
| 660 | Ga0495623_0009276 | 3300046679 | Bacteria | 6387 |
| 661 | Ga0495623_0243253 | 3300046679 | Bacteria | 1015 |
| 662 | Ga0495623_0455864 | 3300046679 | Bacteria | 680 |
| 663 | Ga0495623_0671572 | 3300046679 | Bacteria | 533 |
| 664 | Ga0495646_0017290 | 3300046680 | Bacteria | 4575 |
| 665 | Ga0495646_0035715 | 3300046680 | Bacteria | 3082 |
| 666 | Ga0495646_0095015 | 3300046680 | Bacteria | 1716 |
| 667 | Ga0495646_0519400 | 3300046680 | Bacteria | 610 |
| 668 | Ga0495658_0013070 | 3300046683 | Bacteria | 4221 |
| 669 | Ga0495658_0087801 | 3300046683 | Bacteria | 1837 |
| 670 | Ga0495658_0136138 | 3300046683 | Bacteria | 1499 |
| 671 | Ga0495613_0004460 | 3300046689 | Bacteria | 10490 |
| 672 | Ga0495613_0083933 | 3300046689 | Bacteria | 2313 |
| 673 | Ga0495613_0104858 | 3300046689 | Bacteria | 2041 |
| 674 | Ga0495613_0257261 | 3300046689 | Bacteria | 1217 |
| 675 | Ga0495624_0028691 | 3300046690 | Bacteria | 3634 |
| 676 | Ga0495671_0594345 | 3300046692 | Unclassified | 526 |
| 677 | Ga0495671_0644793 | 3300046692 | Bacteria | 503 |
| 678 | Ga0495649_0097731 | 3300046694 | Bacteria | 1562 |
| 679 | Ga0495649_0109588 | 3300046694 | Bacteria | 1464 |
| 680 | Ga0495649_0175401 | 3300046694 | Bacteria | 1120 |
| 681 | Ga0495589_0334375 | 3300046794 | Bacteria | 699 |
| 682 | Ga0495600_0003824 | 3300046809 | Bacteria | 8916 |
| 683 | Ga0495600_0020355 | 3300046809 | Bacteria | 4244 |
| 684 | Ga0495600_0035751 | 3300046809 | Bacteria | 3228 |
| 685 | Ga0495600_0499696 | 3300046809 | Bacteria | 747 |
| 686 | Ga0495600_0701056 | 3300046809 | Bacteria | 609 |
| 687 | Ga0495581_0656050 | 3300047315 | Bacteria | 606 |
| 688 | Ga0495604_0001856 | 3300047317 | Bacteria | 17220 |
| 689 | Ga0495604_0022916 | 3300047317 | Bacteria | 4983 |
| 690 | Ga0495604_0070858 | 3300047317 | Bacteria | 2638 |
| 691 | Ga0495604_0933651 | 3300047317 | Bacteria | 540 |
| 692 | Ga0495674_0027269 | 3300047319 | Bacteria | 5221 |
| 693 | Ga0495674_0030306 | 3300047319 | Bacteria | 4920 |
| 694 | Ga0495674_0881623 | 3300047319 | Bacteria | 692 |
| 695 | Ga0495672_0067260 | 3300047320 | Bacteria | 2041 |
| 696 | Ga0495676_0036000 | 3300047321 | Bacteria | 4137 |
| 697 | Ga0495676_0224485 | 3300047321 | Bacteria | 1293 |
| 698 | Ga0495680_0002074 | 3300047322 | Bacteria | 20875 |
| 699 | Ga0495680_0019650 | 3300047322 | Bacteria | 5699 |
| 700 | Ga0495683_0149960 | 3300047323 | Bacteria | 1086 |
| 701 | Ga0495687_074996 | 3300047443 | Bacteria | 1343 |
| 702 | Ga0495687_110801 | 3300047443 | Bacteria | 1009 |
| 703 | Ga0495687_223998 | 3300047443 | Bacteria | 579 |
| 704 | Ga0495687_250438 | 3300047443 | Bacteria | 529 |
| 705 | Ga0495675_0027706 | 3300047444 | Bacteria | 3611 |
| 706 | Ga0495675_0340354 | 3300047444 | Bacteria | 884 |
| 707 | Ga0495673_0110256 | 3300047469 | Bacteria | 1101 |
| 708 | Ga0495673_0306444 | 3300047469 | Bacteria | 568 |
| 709 | Ga0495684_0004165 | 3300047471 | Bacteria | 11295 |
| 710 | Ga0495684_0131796 | 3300047471 | Bacteria | 1877 |
| 711 | Ga0495684_0464318 | 3300047471 | Bacteria | 877 |
| 712 | Ga0495686_0157413 | 3300047472 | Bacteria | 1330 |
| 713 | Ga0495686_0345474 | 3300047472 | Bacteria | 810 |
| 714 | Ga0495686_0570260 | 3300047472 | Bacteria | 589 |
| 715 | Ga0495593_0005823 | 3300047673 | Bacteria | 7267 |
| 716 | Ga0495593_0471247 | 3300047673 | Bacteria | 629 |
| 717 | Ga0495602_0018537 | 3300048088 | Bacteria | 6947 |
| 718 | Ga0495602_0042386 | 3300048088 | Bacteria | 4147 |
| 719 | Ga0495602_0247479 | 3300048088 | Bacteria | 1330 |
| 720 | Ga0495614_0125961 | 3300048089 | Bacteria | 1132 |
| 721 | Ga0495614_0221077 | 3300048089 | Bacteria | 861 |
| 722 | Ga0495626_0065119 | 3300048091 | Bacteria | 1650 |
| 723 | Ga0496100_0058273 | 3300048903 | Bacteria | 2534 |
| 724 | Ga0496100_0180312 | 3300048903 | Bacteria | 1527 |
| 725 | Ga0496100_0239888 | 3300048903 | Bacteria | 1337 |
| 726 | Ga0496100_1162966 | 3300048903 | Bacteria | 608 |
| 727 | Ga0496100_1330518 | 3300048903 | Bacteria | 567 |
| 728 | Ga0496101_0079676 | 3300048904 | Bacteria | 2418 |
| 729 | Ga0496101_0102982 | 3300048904 | Bacteria | 2139 |
| 730 | Ga0496101_0120475 | 3300048904 | Bacteria | 1983 |
| 731 | Ga0496101_0237673 | 3300048904 | Bacteria | 1417 |
| 732 | Ga0496101_0282949 | 3300048904 | Bacteria | 1296 |
| 733 | Ga0496101_0474281 | 3300048904 | Bacteria | 988 |
| 734 | Ga0496101_0484592 | 3300048904 | Bacteria | 977 |
| 735 | Ga0496101_0595013 | 3300048904 | Bacteria | 874 |
| 736 | Ga0496102_0021589 | 3300048905 | Bacteria | 5694 |
| 737 | Ga0496102_0088796 | 3300048905 | Bacteria | 2858 |
| 738 | Ga0496102_0187318 | 3300048905 | Bacteria | 1950 |
| 739 | Ga0496102_0589020 | 3300048905 | Bacteria | 1035 |
| 740 | Ga0496102_0902588 | 3300048905 | Bacteria | 805 |
| 741 | Ga0496102_1251661 | 3300048905 | Bacteria | 661 |
| 742 | Ga0496103_0024113 | 3300048906 | Bacteria | 3669 |
| 743 | Ga0496103_0248244 | 3300048906 | Bacteria | 1145 |
| 744 | Ga0496103_0341384 | 3300048906 | Unclassified | 963 |
| 745 | Ga0496103_0438431 | 3300048906 | Bacteria | 838 |
| 746 | Ga0496103_0562604 | 3300048906 | Bacteria | 727 |
| 747 | Ga0496104_0022050 | 3300048907 | Bacteria | 5853 |
| 748 | Ga0496104_0043610 | 3300048907 | Bacteria | 4212 |
| 749 | Ga0496104_0049102 | 3300048907 | Bacteria | 3979 |
| 750 | Ga0496104_0097805 | 3300048907 | Bacteria | 2809 |
| 751 | Ga0496104_0099649 | 3300048907 | Bacteria | 2781 |
| 752 | Ga0496105_0006148 | 3300048908 | Bacteria | 9202 |
| 753 | Ga0496105_0034179 | 3300048908 | Bacteria | 4180 |
| 754 | Ga0496105_0166665 | 3300048908 | Bacteria | 1807 |
| 755 | Ga0496105_0222861 | 3300048908 | Bacteria | 1535 |
| 756 | Ga0496105_0326209 | 3300048908 | Bacteria | 1229 |
| 757 | Ga0496105_0869151 | 3300048908 | Bacteria | 681 |
| 758 | Ga0496106_0001884 | 3300048909 | Bacteria | 15715 |
| 759 | Ga0496106_0001995 | 3300048909 | Bacteria | 15358 |
| 760 | Ga0496106_0036279 | 3300048909 | Bacteria | 3688 |
| 761 | Ga0496106_0377985 | 3300048909 | Bacteria | 1138 |
| 762 | Ga0496106_1217831 | 3300048909 | Bacteria | 587 |
| 763 | Ga0496107_0041285 | 3300048910 | Bacteria | 3312 |
| 764 | Ga0496107_0158585 | 3300048910 | Bacteria | 1676 |
| 765 | Ga0496107_0600457 | 3300048910 | Bacteria | 813 |
| 766 | Ga0496107_0758261 | 3300048910 | Bacteria | 712 |
| 767 | Ga0496108_0000438 | 3300048911 | Bacteria | 33500 |
| 768 | Ga0496108_0196538 | 3300048911 | Bacteria | 1749 |
| 769 | Ga0496108_0419020 | 3300048911 | Bacteria | 1169 |
| 770 | Ga0496108_0459384 | 3300048911 | Bacteria | 1112 |
| 771 | Ga0496108_1122401 | 3300048911 | Bacteria | 667 |
| 772 | Ga0496108_1576947 | 3300048911 | Unclassified | 544 |
| 773 | Ga0496108_1715653 | 3300048911 | Bacteria | 516 |
| 774 | Ga0496109_0000284 | 3300048912 | Bacteria | 48342 |
| 775 | Ga0496109_0085155 | 3300048912 | Bacteria | 2917 |
| 776 | Ga0496109_0139679 | 3300048912 | Bacteria | 2265 |
| 777 | Ga0496109_1138977 | 3300048912 | Bacteria | 717 |
| 778 | Ga0496109_1354772 | 3300048912 | Bacteria | 647 |
| 779 | Ga0496109_1682969 | 3300048912 | Bacteria | 568 |
| 780 | Ga0496109_1907366 | 3300048912 | Bacteria | 526 |
| 781 | Ga0496110_0012769 | 3300048913 | Bacteria | 6917 |
| 782 | Ga0496110_0052828 | 3300048913 | Bacteria | 3571 |
| 783 | Ga0496110_0087441 | 3300048913 | Bacteria | 2783 |
| 784 | Ga0496110_0271012 | 3300048913 | Bacteria | 1545 |
| 785 | Ga0496110_0451633 | 3300048913 | Bacteria | 1171 |
| 786 | Ga0496110_1020271 | 3300048913 | Bacteria | 735 |
| 787 | Ga0496111_0015727 | 3300048914 | Bacteria | 5202 |
| 788 | Ga0496111_0099475 | 3300048914 | Bacteria | 2136 |
| 789 | Ga0496111_0128224 | 3300048914 | Bacteria | 1876 |
| 790 | Ga0496111_0249384 | 3300048914 | Bacteria | 1318 |
| 791 | Ga0496111_0678566 | 3300048914 | Bacteria | 750 |
| 792 | Ga0496111_0827342 | 3300048914 | Bacteria | 669 |
| 793 | Ga0496111_0945774 | 3300048914 | Bacteria | 619 |
| 794 | Ga0496111_1162300 | 3300048914 | Bacteria | 548 |
| 795 | Ga0496112_0000585 | 3300048915 | Bacteria | 24994 |
| 796 | Ga0496112_0003685 | 3300048915 | Bacteria | 12775 |
| 797 | Ga0496112_0050901 | 3300048915 | Bacteria | 4062 |
| 798 | Ga0496112_0414428 | 3300048915 | Bacteria | 1286 |
| 799 | Ga0496112_0558429 | 3300048915 | Bacteria | 1078 |
| 800 | Ga0496112_0911758 | 3300048915 | Bacteria | 800 |
| 801 | Ga0496113_0009649 | 3300048916 | Bacteria | 6339 |
| 802 | Ga0496113_0058926 | 3300048916 | Bacteria | 2891 |
| 803 | Ga0496113_0664060 | 3300048916 | Bacteria | 833 |
| 804 | Ga0496113_0680963 | 3300048916 | Bacteria | 821 |
| 805 | Ga0496113_0823847 | 3300048916 | Bacteria | 736 |
| 806 | Ga0496113_1338140 | 3300048916 | Bacteria | 556 |
| 807 | Ga0496114_0090633 | 3300048917 | Bacteria | 2596 |
| 808 | Ga0496114_0189648 | 3300048917 | Bacteria | 1798 |
| 809 | Ga0496114_0264124 | 3300048917 | Bacteria | 1516 |
| 810 | Ga0496115_0026483 | 3300048918 | Bacteria | 4526 |
| 811 | Ga0496115_0055387 | 3300048918 | Bacteria | 3185 |
| 812 | Ga0496115_0300079 | 3300048918 | Bacteria | 1316 |
| 813 | Ga0496115_0368588 | 3300048918 | Bacteria | 1169 |
| 814 | Ga0496115_0781394 | 3300048918 | Bacteria | 744 |
| 815 | Ga0496116_0186575 | 3300048919 | Bacteria | 1103 |
| 816 | Ga0496116_0332685 | 3300048919 | Bacteria | 705 |
| 817 | Ga0496116_0373715 | 3300048919 | Bacteria | 642 |
| 818 | Ga0496117_0046794 | 3300048920 | Bacteria | 3109 |
| 819 | Ga0496117_0057574 | 3300048920 | Bacteria | 2698 |
| 820 | Ga0496117_0085423 | 3300048920 | Bacteria | 2054 |
| 821 | Ga0496117_0193458 | 3300048920 | Bacteria | 1156 |
| 822 | Ga0496117_0599508 | 3300048920 | Bacteria | 515 |
| 823 | Ga0496118_0001280 | 3300048921 | Bacteria | 38482 |
| 824 | Ga0496118_0118275 | 3300048921 | Bacteria | 1736 |
| 825 | Ga0496118_0118420 | 3300048921 | Bacteria | 1734 |
| 826 | Ga0496118_0404076 | 3300048921 | Bacteria | 708 |
| 827 | Ga0496118_0404761 | 3300048921 | Bacteria | 707 |
| 828 | Ga0496119_0026620 | 3300048922 | Bacteria | 4004 |
| 829 | Ga0496119_0056622 | 3300048922 | Bacteria | 2375 |
| 830 | Ga0496119_0125648 | 3300048922 | Bacteria | 1404 |
| 831 | Ga0496119_0146044 | 3300048922 | Bacteria | 1272 |
| 832 | Ga0496119_0158838 | 3300048922 | Bacteria | 1204 |
| 833 | Ga0496119_0577773 | 3300048922 | Bacteria | 514 |
| 834 | Ga0496120_0112819 | 3300048923 | Bacteria | 1417 |
| 835 | Ga0496120_0161348 | 3300048923 | Bacteria | 1117 |
| 836 | Ga0496120_0350627 | 3300048923 | Bacteria | 663 |
| 837 | Ga0496121_0000571 | 3300048924 | Bacteria | 69504 |
| 838 | Ga0496121_0004527 | 3300048924 | Bacteria | 18609 |
| 839 | Ga0496121_0005094 | 3300048924 | Bacteria | 17131 |
| 840 | Ga0496121_0060620 | 3300048924 | Bacteria | 3111 |
| 841 | Ga0496121_0716947 | 3300048924 | Bacteria | 599 |
| 842 | Ga0496122_0193710 | 3300048925 | Bacteria | 1197 |
| 843 | Ga0496124_0000267 | 3300048927 | Bacteria | 101138 |
| 844 | Ga0496124_0319932 | 3300048927 | Bacteria | 1111 |
| 845 | Ga0496124_0458125 | 3300048927 | Bacteria | 867 |
| 846 | Ga0496125_0023578 | 3300048928 | Bacteria | 5677 |
| 847 | Ga0496125_0241321 | 3300048928 | Bacteria | 1147 |
| 848 | Ga0496125_0441948 | 3300048928 | Bacteria | 747 |
| 849 | Ga0496126_0011100 | 3300048929 | Bacteria | 9358 |
| 850 | Ga0496126_0012973 | 3300048929 | Bacteria | 8507 |
| 851 | Ga0496126_0053366 | 3300048929 | Bacteria | 3668 |
| 852 | Ga0496126_0103306 | 3300048929 | Bacteria | 2490 |
| 853 | Ga0496126_0338802 | 3300048929 | Bacteria | 1232 |
| 854 | Ga0496126_0461891 | 3300048929 | Bacteria | 1020 |
| 855 | Ga0495678_189926 | 3300049459 | Bacteria | 639 |
| 856 | Ga0495682_0052951 | 3300049460 | Bacteria | 1474 |
| 857 | Ga0495682_0088552 | 3300049460 | Bacteria | 1112 |
| 858 | Ga0495682_0126463 | 3300049460 | Bacteria | 915 |
| 859 | Ga0495682_0191079 | 3300049460 | Bacteria | 727 |
| 860 | nmdc:mga0yw44_241359_c1 | 3300050492 | Bacteria | 1201 |
| 861 | nmdc:mga04h51_40682_c1 | 3300050495 | Bacteria | 1516 |
| 862 | nmdc:mga07m45_686971_c1 | 3300050496 | Bacteria | 589 |
| 863 | nmdc:mga06r32_370599_c1 | 3300050510 | Bacteria | 1415 |
| 864 | nmdc:mga08y16_164334_c1 | 3300050511 | Bacteria | 2306 |
| 865 | nmdc:mga0n895_4019_c1 | 3300050512 | Bacteria | 11968 |
| 866 | nmdc:mga0rr50_102773_c1 | 3300050513 | Bacteria | 2248 |
| 867 | nmdc:mga0rr50_1671757_c1 | 3300050513 | Unclassified | 537 |
| 868 | nmdc:mga0a205_52955_c1 | 3300050515 | Bacteria | 3917 |
| 869 | nmdc:mga0sz30_199934_c1 | 3300050516 | Bacteria | 887 |
| 870 | Ga0495601_0114538 | 3300053077 | Bacteria | 1748 |
| 871 | Ga0495612_0183774 | 3300053078 | Bacteria | 919 |
| 872 | Ga0495612_0349744 | 3300053078 | Bacteria | 667 |
| 873 | Ga0495612_0595934 | 3300053078 | Bacteria | 510 |
| 874 | Ga0500635_0412688 | 3300053080 | Bacteria | 535 |
| 875 | Ga0495655_0015732 | 3300053083 | Bacteria | 1614 |
| 876 | Ga0495655_0302824 | 3300053083 | Bacteria | 550 |
| 877 | Ga0495595_0301113 | 3300053084 | Bacteria | 806 |
| 878 | Ga0495619_0001862 | 3300053085 | Bacteria | 14045 |
| 879 | Ga0495619_0290710 | 3300053085 | Bacteria | 1132 |
| 880 | Ga0500578_0142963 | 3300053086 | Bacteria | 1495 |
| 881 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 882 | Ga0500644_0206194 | 3300053088 | Bacteria | 815 |
| 883 | Ga0500646_0047689 | 3300053090 | Bacteria | 1226 |
| 884 | Ga0500647_0026988 | 3300053091 | Bacteria | 2712 |
| 885 | Ga0500647_0410457 | 3300053091 | Bacteria | 546 |
| 886 | Ga0500583_0022151 | 3300053092 | Bacteria | 2657 |
| 887 | Ga0500651_0011770 | 3300053093 | Bacteria | 5286 |
| 888 | Ga0500651_0070300 | 3300053093 | Bacteria | 2179 |
| 889 | Ga0500651_0263750 | 3300053093 | Bacteria | 998 |
| 890 | Ga0500651_0713650 | 3300053093 | Bacteria | 535 |
| 891 | Ga0500566_0010631 | 3300053094 | Bacteria | 5421 |
| 892 | Ga0500566_0391926 | 3300053094 | Bacteria | 624 |
| 893 | Ga0500566_0409747 | 3300053094 | Bacteria | 604 |
| 894 | Ga0500640_114969 | 3300053095 | Bacteria | 1088 |
| 895 | Ga0500648_254773 | 3300053097 | Bacteria | 821 |
| 896 | Ga0500650_0369910 | 3300053098 | Bacteria | 624 |
| 897 | Ga0500650_0405440 | 3300053098 | Bacteria | 589 |
| 898 | Ga0500650_0478442 | 3300053098 | Bacteria | 531 |
| 899 | Ga0500555_002004 | 3300053103 | Bacteria | 6008 |
| 900 | Ga0500556_0051487 | 3300053104 | Bacteria | 1492 |
| 901 | Ga0500556_0423424 | 3300053104 | Bacteria | 508 |
| 902 | Ga0500557_000150 | 3300053105 | Bacteria | 16181 |
| 903 | Ga0500562_036026 | 3300053108 | Bacteria | 1311 |
| 904 | Ga0500569_008126 | 3300053109 | Bacteria | 2388 |
| 905 | Ga0500572_007916 | 3300053111 | Bacteria | 2471 |
| 906 | Ga0500594_0118910 | 3300053118 | Bacteria | 828 |
| 907 | Ga0500595_002912 | 3300053119 | Bacteria | 8189 |
| 908 | Ga0500595_015775 | 3300053119 | Bacteria | 2829 |
| 909 | Ga0500595_021236 | 3300053119 | Bacteria | 2321 |
| 910 | Ga0500595_033233 | 3300053119 | Bacteria | 1713 |
| 911 | Ga0500595_107255 | 3300053119 | Bacteria | 796 |
| 912 | Ga0500595_126936 | 3300053119 | Bacteria | 719 |
| 913 | Ga0500597_125837 | 3300053120 | Bacteria | 1109 |
| 914 | Ga0500597_238649 | 3300053120 | Bacteria | 749 |
| 915 | Ga0500607_030317 | 3300053121 | Bacteria | 2982 |
| 916 | Ga0500608_059072 | 3300053122 | Bacteria | 1835 |
| 917 | Ga0500608_074760 | 3300053122 | Bacteria | 1607 |
| 918 | Ga0500608_191480 | 3300053122 | Bacteria | 855 |
| 919 | Ga0500614_243929 | 3300053123 | Bacteria | 559 |
| 920 | Ga0500618_143448 | 3300053125 | Bacteria | 544 |
| 921 | Ga0500618_147358 | 3300053125 | Bacteria | 537 |
| 922 | Ga0500642_0000319 | 3300053130 | Bacteria | 16783 |
| 923 | Ga0500642_0000744 | 3300053130 | Bacteria | 9560 |
| 924 | Ga0500642_0354373 | 3300053130 | Bacteria | 650 |
| 925 | Ga0500642_0426861 | 3300053130 | Bacteria | 573 |
| 926 | Ga0500655_027656 | 3300053133 | Bacteria | 1083 |
| 927 | Ga0500559_0126507 | 3300053136 | Bacteria | 1191 |
| 928 | Ga0500564_135492 | 3300053138 | Bacteria | 1062 |
| 929 | Ga0500568_0041701 | 3300053139 | Bacteria | 1843 |
| 930 | Ga0500568_0089469 | 3300053139 | Bacteria | 1162 |
| 931 | Ga0500568_0097936 | 3300053139 | Bacteria | 1102 |
| 932 | Ga0500568_0236400 | 3300053139 | Bacteria | 666 |
| 933 | Ga0500573_0084912 | 3300053140 | Bacteria | 1795 |
| 934 | Ga0500577_0487456 | 3300053142 | Bacteria | 538 |
| 935 | Ga0500588_0094221 | 3300053146 | Bacteria | 1022 |
| 936 | Ga0500588_0228384 | 3300053146 | Bacteria | 695 |
| 937 | Ga0500588_0243205 | 3300053146 | Bacteria | 674 |
| 938 | Ga0500589_084436 | 3300053147 | Bacteria | 1412 |
| 939 | Ga0500590_165249 | 3300053148 | Bacteria | 980 |
| 940 | Ga0500590_167171 | 3300053148 | Bacteria | 972 |
| 941 | Ga0500590_216543 | 3300053148 | Bacteria | 794 |
| 942 | Ga0500604_0130312 | 3300053151 | Bacteria | 845 |
| 943 | Ga0500616_0008142 | 3300053153 | Bacteria | 6550 |
| 944 | Ga0500619_184968 | 3300053154 | Bacteria | 702 |
| 945 | Ga0500620_244986 | 3300053155 | Bacteria | 598 |
| 946 | Ga0500622_0028909 | 3300053156 | Bacteria | 2917 |
| 947 | Ga0500622_0057579 | 3300053156 | Bacteria | 1988 |
| 948 | Ga0500624_019238 | 3300053157 | Bacteria | 1083 |
| 949 | Ga0500627_0025901 | 3300053158 | Bacteria | 2416 |
| 950 | Ga0500627_0156366 | 3300053158 | Bacteria | 1029 |
| 951 | Ga0500633_0301954 | 3300053160 | Bacteria | 589 |
| 952 | Ga0500634_0205400 | 3300053161 | Bacteria | 861 |
| 953 | Ga0500639_042674 | 3300053163 | Bacteria | 2380 |
| 954 | Ga0500639_055223 | 3300053163 | Bacteria | 2060 |
| 955 | Ga0500636_0000335 | 3300053177 | Bacteria | 26103 |
| 956 | Ga0500636_0134018 | 3300053177 | Bacteria | 1377 |
| 957 | Ga0500636_0156489 | 3300053177 | Bacteria | 1247 |
| 958 | Ga0500636_0533613 | 3300053177 | Bacteria | 511 |
| 959 | Ga0500636_0541247 | 3300053177 | Bacteria | 506 |
| 960 | Ga0500637_0270137 | 3300053178 | Bacteria | 941 |
| 961 | Ga0500649_175803 | 3300053722 | Bacteria | 731 |
| 962 | Ga0500570_096368 | 3300053724 | Bacteria | 1264 |
| 963 | Ga0500657_163425 | 3300053728 | Bacteria | 803 |
| 964 | Ga0500625_005839 | 3300053729 | Bacteria | 5186 |
| 965 | Ga0500645_042085 | 3300053730 | Bacteria | 1348 |
| 966 | Ga0500645_094392 | 3300053730 | Bacteria | 847 |
| 967 | Ga0500645_132080 | 3300053730 | Bacteria | 693 |
| 968 | Ga0500552_005516 | 3300053733 | Bacteria | 1382 |
| 969 | Ga0500596_019377 | 3300053735 | Bacteria | 1022 |
| 970 | Ga0500599_000638 | 3300053736 | Bacteria | 3740 |
| 971 | Ga0500601_003226 | 3300053737 | Bacteria | 1767 |
| 972 | Ga0500601_043352 | 3300053737 | Bacteria | 550 |
| 973 | Ga0500613_059047 | 3300053738 | Bacteria | 615 |
| 974 | Ga0500661_008314 | 3300055283 | Bacteria | 1908 |
| 975 | Ga0500661_017485 | 3300055283 | Bacteria | 1281 |
| 976 | 2509146373 | 2508501128 | Bacteria | 8613869 |
| 977 | Ga0373923_0587823 | |||
| 978 | LJQas_1005052 | |||
| 979 | JGI24737J22298_10154785 | |||
| 980 | JGI24738J21930_10039787 | |||
| 981 | JGI25165J46597_1004162 | |||
| 982 | Ga0055525_1012404 | |||
| 983 | Ga0055543_1046618 | |||
| 984 | Ga0065165_1000370 | |||
| 985 | Ga0065165_1042886 | |||
| 986 | Ga0065712_10158205 | |||
| 987 | Ga0065715_10703381 | |||
| 988 | Ga0070658_10388586 | |||
| 989 | Ga0070658_10499356 | |||
| 990 | Ga0070683_101724312 | |||
| 991 | Ga0070690_100254481 | |||
| 992 | Ga0070690_100573102 | |||
| 993 | Ga0070670_100849970 | |||
| 994 | Ga0070670_102113444 | |||
| 995 | Ga0068869_101603191 | |||
| 996 | Ga0068869_101677555 | |||
| 997 | Ga0070666_10355521 | |||
| 998 | Ga0070680_100022477 | |||
| 999 | Ga0070680_100106831 | |||
| 1000 | Ga0070680_100388993 | |||
| 1001 | Ga0070680_101413457 | |||
| 1002 | Ga0070682_100199594 | |||
| 1003 | Ga0070682_100503951 | |||
| 1004 | Ga0068868_100551958 | |||
| 1005 | Ga0068868_100672152 | |||
| 1006 | Ga0068868_101189057 | |||
| 1007 | Ga0068868_101198812 | |||
| 1008 | Ga0068868_102406546 | |||
| 1009 | Ga0070660_100012916 | |||
| 1010 | Ga0070660_100853127 | |||
| 1011 | Ga0070661_100633583 | |||
| 1012 | Ga0070661_100823520 | |||
| 1013 | Ga0070692_10581513 | |||
| 1014 | Ga0070668_101293542 | |||
| 1015 | Ga0070669_100718132 | |||
| 1016 | Ga0070671_100083780 | |||
| 1017 | Ga0070671_100575104 | |||
| 1018 | Ga0070671_101631769 | |||
| 1019 | Ga0070688_100487581 | |||
| 1020 | Ga0070659_100060570 | |||
| 1021 | Ga0070659_100372381 | |||
| 1022 | Ga0070659_100906759 | |||
| 1023 | Ga0070659_101649241 | |||
| 1024 | Ga0070667_100407242 | |||
| 1025 | Ga0070714_100070500 | |||
| 1026 | Ga0070714_100573686 | |||
| 1027 | Ga0070713_100002110 | |||
| 1028 | Ga0070713_100073819 | |||
| 1029 | Ga0070713_101688549 | |||
| 1030 | Ga0070710_10003024 | |||
| 1031 | Ga0070710_10005145 | |||
| 1032 | Ga0070711_100007448 | |||
| 1033 | Ga0070711_100065325 | |||
| 1034 | Ga0070711_101015093 | |||
| 1035 | Ga0070711_101638382 | |||
| 1036 | Ga0070705_101164137 | |||
| 1037 | Ga0070663_100152426 | |||
| 1038 | Ga0070663_100221250 | |||
| 1039 | Ga0070663_100232099 | |||
| 1040 | Ga0070678_100256779 | |||
| 1041 | Ga0070678_100581793 | |||
| 1042 | Ga0070662_100815495 | |||
| 1043 | Ga0070662_101110959 | |||
| 1044 | Ga0070681_10513928 | |||
| 1045 | Ga0070681_10721582 | |||
| 1046 | Ga0070707_100030468 | |||
| 1047 | Ga0070698_100678742 | |||
| 1048 | Ga0070699_100870551 | |||
| 1049 | Ga0070699_100992317 | |||
| 1050 | Ga0070679_100441747 | |||
| 1051 | Ga0070679_100571162 | |||
| 1052 | Ga0070679_100726725 | |||
| 1053 | Ga0070684_100012882 | |||
| 1054 | Ga0070684_101203589 | |||
| 1055 | Ga0070697_100088553 | |||
| 1056 | Ga0070697_100111993 | |||
| 1057 | Ga0068853_100006064 | |||
| 1058 | Ga0068853_100267430 | |||
| 1059 | Ga0068853_100601071 | |||
| 1060 | Ga0068853_100638940 | |||
| 1061 | Ga0068853_101803423 | |||
| 1062 | Ga0070672_100595373 | |||
| 1063 | Ga0070686_100207708 | |||
| 1064 | Ga0070695_100558851 | |||
| 1065 | Ga0070695_101529865 | |||
| 1066 | Ga0070693_100038550 | |||
| 1067 | Ga0070693_100462484 | |||
| 1068 | Ga0070665_100077316 | |||
| 1069 | Ga0070665_101862103 | |||
| 1070 | Ga0070665_102416959 | |||
| 1071 | Ga0068855_100036277 | |||
| 1072 | Ga0068855_102256571 | |||
| 1073 | Ga0068855_102260236 | |||
| 1074 | Ga0068855_102284708 | |||
| 1075 | Ga0070664_102336172 | |||
| 1076 | Ga0068857_100637013 | |||
| 1077 | Ga0068857_101229818 | |||
| 1078 | Ga0068857_101732034 | |||
| 1079 | Ga0068857_102442697 | |||
| 1080 | Ga0068854_100120969 | |||
| 1081 | Ga0068854_101695852 | |||
| 1082 | Ga0068854_102117469 | |||
| 1083 | Ga0068856_100083698 | |||
| 1084 | Ga0068856_100127315 | |||
| 1085 | Ga0068856_100429315 | |||
| 1086 | Ga0068856_100755112 | |||
| 1087 | Ga0068856_102407592 | |||
| 1088 | Ga0068852_100029813 | |||
| 1089 | Ga0068852_100155718 | |||
| 1090 | Ga0068852_100270359 | |||
| 1091 | Ga0068852_100421421 | |||
| 1092 | Ga0068852_100576660 | |||
| 1093 | Ga0068852_100589922 | |||
| 1094 | Ga0068852_101399237 | |||
| 1095 | Ga0068859_100903678 | |||
| 1096 | Ga0068859_102794208 | |||
| 1097 | Ga0068864_100311213 | |||
| 1098 | Ga0068864_100815565 | |||
| 1099 | Ga0068864_101018497 | |||
| 1100 | Ga0068864_101300939 | |||
| 1101 | Ga0068864_102528288 | |||
| 1102 | Ga0068861_100732763 | |||
| 1103 | Ga0068861_101137799 | |||
| 1104 | Ga0068851_10004403 | |||
| 1105 | Ga0068851_10285575 | |||
| 1106 | Ga0068863_100181929 | |||
| 1107 | Ga0068863_100236108 | |||
| 1108 | Ga0068863_100361282 | |||
| 1109 | Ga0068863_101629367 | |||
| 1110 | Ga0068863_102567320 | |||
| 1111 | Ga0068858_100216885 | |||
| 1112 | Ga0068858_101132216 | |||
| 1113 | Ga0068858_101509736 | |||
| 1114 | Ga0068860_100000338 | |||
| 1115 | Ga0068860_100408819 | |||
| 1116 | Ga0068860_101026741 | |||
| 1117 | Ga0068860_102511391 | |||
| 1118 | Ga0068862_100924922 | |||
| 1119 | Ga0081455_10025082 | |||
| 1120 | Ga0081540_1020732 | |||
| 1121 | Ga0081540_1023231 | |||
| 1122 | Ga0081540_1151591 | |||
| 1123 | Ga0070717_10121294 | |||
| 1124 | Ga0070717_11108321 | |||
| 1125 | Ga0075365_10150424 | |||
| 1126 | Ga0075368_10054498 | |||
| 1127 | Ga0075368_10378092 | |||
| 1128 | Ga0075368_10479978 | |||
| 1129 | Ga0070715_10011303 | |||
| 1130 | Ga0070715_10758333 | |||
| 1131 | Ga0070716_100003075 | |||
| 1132 | Ga0070716_100011221 | |||
| 1133 | Ga0070712_100068092 | |||
| 1134 | Ga0070712_101352213 | |||
| 1135 | Ga0070712_101558663 | |||
| 1136 | Ga0075367_10814542 | |||
| 1137 | Ga0075367_10889374 | |||
| 1138 | Ga0075369_10058570 | |||
| 1139 | Ga0097621_100462465 | |||
| 1140 | Ga0097621_100830241 | |||
| 1141 | Ga0097621_101196165 | |||
| 1142 | Ga0068871_100187620 | |||
| 1143 | Ga0068871_100234210 | |||
| 1144 | Ga0068871_101043215 | |||
| 1145 | Ga0075428_102251810 | |||
| 1146 | Ga0075431_100214862 | |||
| 1147 | Ga0075433_10037545 | |||
| 1148 | Ga0075434_100617789 | |||
| 1149 | Ga0068865_100483391 | |||
| 1150 | Ga0068865_102080148 | |||
| 1151 | Ga0097620_100903714 | |||
| 1152 | Ga0097620_102792917 | |||
| 1153 | Ga0075435_101805059 | |||
| 1154 | Ga0099794_10095572 | |||
| 1155 | Ga0099794_10352659 | |||
| 1156 | Ga0099794_10418808 | |||
| 1157 | Ga0099795_10008545 | |||
| 1158 | Ga0099795_10015844 | |||
| 1159 | Ga0099795_10031741 | |||
| 1160 | Ga0099795_10054155 | |||
| 1161 | Ga0099795_10075854 | |||
| 1162 | Ga0099795_10189851 | |||
| 1163 | Ga0105250_10525641 | |||
| 1164 | Ga0105240_10011631 | |||
| 1165 | Ga0105240_10119154 | |||
| 1166 | Ga0105240_10612995 | |||
| 1167 | Ga0111539_10090244 | |||
| 1168 | Ga0105245_10537913 | |||
| 1169 | Ga0105247_10006789 | |||
| 1170 | Ga0105247_10195004 | |||
| 1171 | Ga0105247_10244745 | |||
| 1172 | Ga0105247_10543707 | |||
| 1173 | Ga0105243_10274253 | |||
| 1174 | Ga0105243_10393801 | |||
| 1175 | Ga0105241_10212606 | |||
| 1176 | Ga0105241_10246418 | |||
| 1177 | Ga0105241_10410482 | |||
| 1178 | Ga0105241_12478115 | |||
| 1179 | Ga0105242_10501718 | |||
| 1180 | Ga0105242_10614612 | |||
| 1181 | Ga0105248_10153524 | |||
| 1182 | Ga0105248_10198655 | |||
| 1183 | Ga0105248_10270760 | |||
| 1184 | Ga0105237_10028867 | |||
| 1185 | Ga0105237_10129523 | |||
| 1186 | Ga0105237_10185326 | |||
| 1187 | Ga0105237_10388578 | |||
| 1188 | Ga0105237_10448581 | |||
| 1189 | Ga0105237_10582942 | |||
| 1190 | Ga0105237_10631722 | |||
| 1191 | Ga0105237_11234268 | |||
| 1192 | Ga0105237_11406540 | |||
| 1193 | Ga0105237_11957120 | |||
| 1194 | Ga0105237_12429049 | |||
| 1195 | Ga0105238_10004512 | |||
| 1196 | Ga0105238_10238393 | |||
| 1197 | Ga0105238_11645552 | |||
| 1198 | Ga0105249_10715616 | |||
| 1199 | Ga0105249_11011686 | |||
| 1200 | Ga0105249_13501321 | |||
| 1201 | Ga0099796_10204084 | |||
| 1202 | Ga0099796_10328335 | |||
| 1203 | Ga0099796_10395194 | |||
| 1204 | Ga0099796_10410314 | |||
| 1205 | Ga0105239_10069619 | |||
| 1206 | Ga0105239_10112815 | |||
| 1207 | Ga0105239_10181119 | |||
| 1208 | Ga0105239_10272260 | |||
| 1209 | Ga0105239_10278093 | |||
| 1210 | Ga0105239_10774240 | |||
| 1211 | Ga0105239_10892140 | |||
| 1212 | Ga0105239_10937113 | |||
| 1213 | Ga0105239_11735329 | |||
| 1214 | Ga0105246_10031768 | |||
| 1215 | Ga0105246_10338814 | |||
| 1216 | Ga0105246_10613230 | |||
| 1217 | Ga0105246_11401159 | |||
| 1218 | Ga0157313_1015837 | |||
| 1219 | Ga0157370_10138556 | |||
| 1220 | Ga0157369_10189265 | |||
| 1221 | Ga0157369_10415885 | |||
| 1222 | Ga0157374_10109473 | |||
| 1223 | Ga0157374_10381201 | |||
| 1224 | Ga0157374_11281194 | |||
| 1225 | Ga0157378_10181370 | |||
| 1226 | Ga0157378_10240913 | |||
| 1227 | Ga0157378_11001122 | |||
| 1228 | Ga0157378_11593750 | |||
| 1229 | Ga0163162_10114506 | |||
| 1230 | Ga0163162_10403333 | |||
| 1231 | Ga0163162_11925127 | |||
| 1232 | Ga0163162_12609560 | |||
| 1233 | Ga0163162_12670804 | |||
| 1234 | Ga0157372_10131460 | |||
| 1235 | Ga0157372_11379364 | |||
| 1236 | Ga0157372_12531779 | |||
| 1237 | Ga0157375_10282303 | |||
| 1238 | Ga0157375_11201538 | |||
| 1239 | Ga0157375_11754915 | |||
| 1240 | Ga0157375_13511646 | |||
| 1241 | Ga0163163_10117278 | |||
| 1242 | Ga0163163_10210261 | |||
| 1243 | Ga0163163_11531445 | |||
| 1244 | Ga0163163_11544591 | |||
| 1245 | Ga0163163_11934809 | |||
| 1246 | Ga0163163_12508340 | |||
| 1247 | Ga0157377_10314028 | |||
| 1248 | Ga0157379_10329410 | |||
| 1249 | Ga0157379_10556630 | |||
| 1250 | Ga0157379_10751606 | |||
| 1251 | Ga0157379_11026611 | |||
| 1252 | Ga0157379_11153457 | |||
| 1253 | Ga0157379_11751966 | |||
| 1254 | Ga0157376_10026265 | |||
| 1255 | Ga0157376_10514124 | |||
| 1256 | Ga0157376_11130366 | |||
| 1257 | Ga0157376_11571115 | |||
| 1258 | Ga0157376_11786189 | |||
| 1259 | Ga0157376_11908035 | |||
| 1260 | Ga0182007_10200408 | |||
| 1261 | Ga0163161_10273386 | |||
| 1262 | Ga0206353_11945494 | |||
| 1263 | Ga0209563_100565 | |||
| 1264 | Ga0209677_100794 | |||
| 1265 | Ga0209233_1008827 | |||
| 1266 | Ga0209130_1027206 | |||
| 1267 | Ga0209758_1005254 | |||
| 1268 | Ga0209758_1008667 | |||
| 1269 | Ga0209758_1104867 | |||
| 1270 | Ga0207426_1050719 | |||
| 1271 | Ga0209257_1130527 | |||
| 1272 | Ga0207656_10001723 | |||
| 1273 | Ga0207692_10004179 | |||
| 1274 | Ga0207692_10099053 | |||
| 1275 | Ga0207710_10005915 | |||
| 1276 | Ga0207710_10264934 | |||
| 1277 | Ga0207710_10335126 | |||
| 1278 | Ga0207710_10523832 | |||
| 1279 | Ga0207688_10146588 | |||
| 1280 | Ga0207680_10130339 | |||
| 1281 | Ga0207680_10390480 | |||
| 1282 | Ga0207680_10774819 | |||
| 1283 | Ga0207647_10112176 | |||
| 1284 | Ga0207685_10009623 | |||
| 1285 | Ga0207699_10000443 | |||
| 1286 | Ga0207699_10123763 | |||
| 1287 | Ga0207705_10999870 | |||
| 1288 | Ga0207654_10020998 | |||
| 1289 | Ga0207654_10534965 | |||
| 1290 | Ga0207707_10010412 | |||
| 1291 | Ga0207707_10588304 | |||
| 1292 | Ga0207707_10771274 | |||
| 1293 | Ga0207695_10000059 | |||
| 1294 | Ga0207695_10271738 | |||
| 1295 | Ga0207695_10515954 | |||
| 1296 | Ga0207671_10010861 | |||
| 1297 | Ga0207671_10050106 | |||
| 1298 | Ga0207671_10165451 | |||
| 1299 | Ga0207671_10356181 | |||
| 1300 | Ga0207671_10795010 | |||
| 1301 | Ga0207671_10828355 | |||
| 1302 | Ga0207671_11102496 | |||
| 1303 | Ga0207671_11339976 | |||
| 1304 | Ga0207693_10005369 | |||
| 1305 | Ga0207693_10532392 | |||
| 1306 | Ga0207693_10924030 | |||
| 1307 | Ga0207663_10000159 | |||
| 1308 | Ga0207663_10008306 | |||
| 1309 | Ga0207660_10062522 | |||
| 1310 | Ga0207660_10087813 | |||
| 1311 | Ga0207660_10156052 | |||
| 1312 | Ga0207657_10386833 | |||
| 1313 | Ga0207657_10723480 | |||
| 1314 | Ga0207649_10473613 | |||
| 1315 | Ga0207652_10007627 | |||
| 1316 | Ga0207681_11563343 | |||
| 1317 | Ga0207694_10003079 | |||
| 1318 | Ga0207694_10221119 | |||
| 1319 | Ga0207694_11158802 | |||
| 1320 | Ga0207650_10879388 | |||
| 1321 | Ga0207687_11187462 | |||
| 1322 | Ga0207700_10020296 | |||
| 1323 | Ga0207700_10078655 | |||
| 1324 | Ga0207700_10097767 | |||
| 1325 | Ga0207664_10006844 | |||
| 1326 | Ga0207664_10048445 | |||
| 1327 | Ga0207664_10381917 | |||
| 1328 | Ga0207644_10161681 | |||
| 1329 | Ga0207644_10697723 | |||
| 1330 | Ga0207690_10018691 | |||
| 1331 | Ga0207690_10764397 | |||
| 1332 | Ga0207706_10865678 | |||
| 1333 | Ga0207686_10898827 | |||
| 1334 | Ga0207709_10901449 | |||
| 1335 | Ga0207704_10658807 | |||
| 1336 | Ga0207665_10001544 | |||
| 1337 | Ga0207665_10351234 | |||
| 1338 | Ga0207691_11162346 | |||
| 1339 | Ga0207711_10153536 | |||
| 1340 | Ga0207711_10487956 | |||
| 1341 | Ga0207711_10764331 | |||
| 1342 | Ga0207689_10196260 | |||
| 1343 | Ga0207689_10815045 | |||
| 1344 | Ga0207679_10429628 | |||
| 1345 | Ga0207679_10462542 | |||
| 1346 | Ga0207667_10017617 | |||
| 1347 | Ga0207712_11034372 | |||
| 1348 | Ga0207712_11120598 | |||
| 1349 | Ga0207668_10128780 | |||
| 1350 | Ga0207668_10179991 | |||
| 1351 | Ga0207658_10536757 | |||
| 1352 | Ga0207658_10648447 | |||
| 1353 | Ga0207677_10153115 | |||
| 1354 | Ga0207677_11163367 | |||
| 1355 | Ga0207703_10428887 | |||
| 1356 | Ga0207703_11047739 | |||
| 1357 | Ga0207703_11066277 | |||
| 1358 | Ga0207639_10002960 | |||
| 1359 | Ga0207639_10058811 | |||
| 1360 | Ga0207639_10562892 | |||
| 1361 | Ga0207639_10747020 | |||
| 1362 | Ga0207639_11000217 | |||
| 1363 | Ga0207678_10118720 | |||
| 1364 | Ga0207678_10266094 | |||
| 1365 | Ga0207678_10308359 | |||
| 1366 | Ga0207702_10166453 | |||
| 1367 | Ga0207702_10553278 | |||
| 1368 | Ga0207702_10597236 | |||
| 1369 | Ga0207702_10641392 | |||
| 1370 | Ga0207641_10114966 | |||
| 1371 | Ga0207641_11093053 | |||
| 1372 | Ga0207648_10144659 | |||
| 1373 | Ga0207648_10334755 | |||
| 1374 | Ga0207676_10257714 | |||
| 1375 | Ga0207676_11109715 | |||
| 1376 | Ga0207676_11681696 | |||
| 1377 | Ga0207674_10639890 | |||
| 1378 | Ga0207674_10753766 | |||
| 1379 | Ga0207675_100180021 | |||
| 1380 | Ga0207675_100790960 | |||
| 1381 | Ga0207675_101993647 | |||
| 1382 | Ga0207683_10132131 | |||
| 1383 | Ga0207683_10756772 | |||
| 1384 | Ga0207698_10020684 | |||
| 1385 | Ga0207698_10733625 | |||
| 1386 | Ga0207698_10953073 | |||
| 1387 | Ga0207698_11201516 | |||
| 1388 | Ga0207698_11829983 | |||
| 1389 | Ga0207698_11942224 | |||
| 1390 | Ga0209179_1003483 | |||
| 1391 | Ga0209179_1047726 | |||
| 1392 | Ga0209813_10017710 | |||
| 1393 | Ga0207428_10100503 | |||
| 1394 | Ga0268266_11422845 | |||
| 1395 | Ga0268265_11597985 | |||
| 1396 | Ga0268264_10000051 | |||
| 1397 | Ga0268264_10376459 | |||
| 1398 | Ga0268264_12421685 | |||
| 1399 | Ga0265334_10061058 | |||
| 1400 | Ga0307517_10219501 | |||
| 1401 | Ga0307511_10068005 | |||
| 1402 | Ga0265330_10019295 | |||
| 1403 | Ga0265330_10057988 | |||
| 1404 | Ga0265332_10018917 | |||
| 1405 | Ga0265328_10019996 | |||
| 1406 | Ga0265328_10299135 | |||
| 1407 | Ga0265325_10031254 | |||
| 1408 | Ga0265340_10007086 | |||
| 1409 | Ga0265339_10451679 | |||
| 1410 | Ga0265331_10044539 | |||
| 1411 | Ga0265331_10045923 | |||
| 1412 | Ga0265331_10222993 | |||
| 1413 | Ga0265331_10329848 | |||
| 1414 | Ga0265316_10579648 | |||
| 1415 | Ga0265316_10597677 | |||
| 1416 | Ga0265316_10608495 | |||
| 1417 | Ga0307509_10050156 | |||
| 1418 | Ga0307509_10104557 | |||
| 1419 | Ga0307509_10329994 | |||
| 1420 | Ga0307509_10795664 | |||
| 1421 | Ga0307509_10883068 | |||
| 1422 | Ga0307508_10090477 | |||
| 1423 | Ga0307508_10201686 | |||
| 1424 | Ga0307508_10821670 | |||
| 1425 | Ga0265314_10100428 | |||
| 1426 | Ga0265342_10047587 | |||
| 1427 | Ga0265342_10084101 | |||
| 1428 | Ga0307516_10113627 | |||
| 1429 | Ga0307516_10343129 | |||
| 1430 | Ga0307516_10482551 | |||
| 1431 | Ga0307507_10035688 | |||
| 1432 | Ga0307510_10070832 | |||
| 1433 | Ga0307510_10153880 | |||
| 1434 | Ga0307510_10346328 | |||
| 1435 | Ga0373958_0025359 | |||
| 1436 | Ga0373938_0115955 | |||
| 1437 | Ga0373926_0143317 | |||
| 1438 | Ga0373928_0072665 | |||
| 1439 | Ga0373928_0077986 | |||
| 1440 | Ga0373929_0051221 | |||
| 1441 | Ga0373934_0009884 | |||
| 1442 | Ga0373940_0267369 | |||
| 1443 | Ga0373949_0037641 | |||
| 1444 | Ga0373923_0029194 | |||
| 1445 | Ga0373932_0026950 | |||
| 1446 | Ga0373936_0167631 | |||
| 1447 | Ga0373936_0608680 | |||
| 1448 | Ga0373941_0023970 | |||
| 1449 | Ga0373941_0156602 | |||
| 1450 | Ga0373945_0075540 | |||
| 1451 | Ga0373945_0560706 | |||
| 1452 | Ga0373953_0114672 | |||
| 1453 | Ga0373954_0023495 | |||
| 1454 | Ga0373956_0003314 | |||
| 1455 | Ga0373957_0004032 | |||
| 1456 | Ga0373957_0484708 | |||
| 1457 | Ga0373960_0176040 | |||
| 1458 | Ga0373943_0022410 | |||
| 1459 | Ga0373943_0169974 | |||
| 1460 | Ga0373943_0369118 | |||
| 1461 | Ga0373946_0297386 | |||
| 1462 | Ga0373946_0543606 | |||
| 1463 | Ga0373955_0002545 | |||
| 1464 | Ga0373942_0066210 | |||
| 1465 | Ga0373961_0081783 | |||
| 1466 | Ga0373961_0390696 | |||
| 1467 | Ga0373962_0265568 | |||
| 1468 | Ga0373924_0005363 | |||
| 1469 | Ga0373931_0003348 | |||
| 1470 | Ga0373931_0003381 | |||
| 1471 | Ga0373931_0091706 | |||
| 1472 | Ga0373935_0066250 | |||
| 1473 | Ga0373935_0091991 | |||
| 1474 | Ga0373935_0214787 | |||
| 1475 | Ga0373935_0895863 | |||
| 1476 | Ga0373927_0001975 | |||
| 1477 | Ga0373927_0012306 | |||
| 1478 | Ga0373927_0033149 | |||
| 1479 | Ga0373933_0004241 | |||
| 1480 | Ga0373947_0011731 | |||
| 1481 | Ga0373947_0311329 | |||
| 1482 | Ga0373947_0361666 | |||
| 1483 | Ga0373937_0037309 | |||
| 1484 | Ga0373925_0045130 | |||
| 1485 | Ga0373925_0057487 | |||
| 1486 | Ga0373925_0094759 | |||
| 1487 | Ga0373925_0991858 | |||
| 1488 | Ga0373925_1217463 | |||
| 1489 | Ga0373925_1346045 | |||
| 1490 | Ga0395898_0264748 | |||
| 1491 | Ga0436360_0773285 | |||
| 1492 | Ga0436363_1526908 | |||
| 1493 | Ga0451789_1275308 | |||
| 1494 | Ga0451791_0807056 | |||
| 1495 | Ga0451791_1818816 | |||
| 1496 | Ga0451793_0560032 | |||
| 1497 | Ga0451797_0544067 | |||
| 1498 | Ga0451795_1486397 | |||
| 1499 | Ga0451795_1697835 | |||
| 1500 | Ga0451800_1024483 | |||
| 1501 | Ga0451800_1187149 | |||
| 1502 | Ga0451802_0663882 | |||
| 1503 | Ga0451804_1072820 | |||
| 1504 | Ga0451807_0961669 | |||
| 1505 | Ga0451807_1572561 | |||
| 1506 | Ga0451833_1407648 | |||
| 1507 | Ga0451835_1187017 | |||
| 1508 | Ga0451837_0193938 | |||
| 1509 | Ga0451839_0507174 | |||
| 1510 | Ga0451841_1267011 | |||
| 1511 | Ga0451849_0002782 | |||
| 1512 | Ga0451849_0494380 | |||
| 1513 | Ga0451851_0166502 | |||
| 1514 | Ga0451853_1365813 | |||
| 1515 | Ga0466968_0287594 | |||
| 1516 | Ga0495617_191825 | |||
| 1517 | Ga0495592_0008547 | |||
| 1518 | Ga0495592_0097532 | |||
| 1519 | Ga0495592_0646140 | |||
| 1520 | Ga0495629_0000905 | |||
| 1521 | Ga0495629_0002614 | |||
| 1522 | Ga0495629_0601026 | |||
| 1523 | Ga0495629_0890183 | |||
| 1524 | Ga0495638_0006758 | |||
| 1525 | Ga0495638_0277112 | |||
| 1526 | Ga0495641_0582456 | |||
| 1527 | Ga0495651_0040294 | |||
| 1528 | Ga0495651_0178045 | |||
| 1529 | Ga0495651_0200110 | |||
| 1530 | Ga0495651_0304696 | |||
| 1531 | Ga0495653_0006522 | |||
| 1532 | Ga0495653_0047464 | |||
| 1533 | Ga0495580_0280970 | |||
| 1534 | Ga0495580_0863409 | |||
| 1535 | Ga0495582_0513581 | |||
| 1536 | Ga0495582_0580678 | |||
| 1537 | Ga0495639_0069218 | |||
| 1538 | Ga0495639_0743898 | |||
| 1539 | Ga0495662_0472764 | |||
| 1540 | Ga0495664_0037868 | |||
| 1541 | Ga0495664_0160497 | |||
| 1542 | Ga0495664_0257102 | |||
| 1543 | Ga0495584_0011133 | |||
| 1544 | Ga0495584_0498864 | |||
| 1545 | Ga0495584_0613537 | |||
| 1546 | Ga0495585_0532994 | |||
| 1547 | Ga0495596_0171603 | |||
| 1548 | Ga0495607_0145747 | |||
| 1549 | Ga0495607_0206840 | |||
| 1550 | Ga0495583_0121654 | |||
| 1551 | Ga0495583_0169620 | |||
| 1552 | Ga0495606_0017354 | |||
| 1553 | Ga0495606_0025094 | |||
| 1554 | Ga0495606_0164446 | |||
| 1555 | Ga0495606_0183177 | |||
| 1556 | Ga0495606_0590549 | |||
| 1557 | Ga0495608_0011764 | |||
| 1558 | Ga0495608_0011932 | |||
| 1559 | Ga0495608_0138708 | |||
| 1560 | Ga0495610_0145266 | |||
| 1561 | Ga0495616_0120553 | |||
| 1562 | Ga0495618_0141527 | |||
| 1563 | Ga0495618_0185740 | |||
| 1564 | Ga0495620_0094811 | |||
| 1565 | Ga0495620_0197307 | |||
| 1566 | Ga0495628_0049172 | |||
| 1567 | Ga0495628_0327571 | |||
| 1568 | Ga0495628_0343235 | |||
| 1569 | Ga0495628_0484301 | |||
| 1570 | Ga0495628_1164407 | |||
| 1571 | Ga0495628_1259200 | |||
| 1572 | Ga0495630_0877610 | |||
| 1573 | Ga0495630_1298315 | |||
| 1574 | Ga0495631_0066644 | |||
| 1575 | Ga0495631_0250362 | |||
| 1576 | Ga0495631_0456230 | |||
| 1577 | Ga0495632_0134187 | |||
| 1578 | Ga0495632_0454932 | |||
| 1579 | Ga0495643_0010684 | |||
| 1580 | Ga0495648_0001072 | |||
| 1581 | Ga0495648_0005237 | |||
| 1582 | Ga0495648_0115674 | |||
| 1583 | Ga0495648_0191501 | |||
| 1584 | Ga0495648_0276262 | |||
| 1585 | Ga0495666_0191530 | |||
| 1586 | Ga0495642_0061562 | |||
| 1587 | Ga0495652_0009450 | |||
| 1588 | Ga0495652_0015406 | |||
| 1589 | Ga0495652_0050712 | |||
| 1590 | Ga0495652_0120797 | |||
| 1591 | Ga0495654_0140247 | |||
| 1592 | Ga0495665_0071942 | |||
| 1593 | Ga0495665_0357932 | |||
| 1594 | Ga0495640_0003997 | |||
| 1595 | Ga0495640_0005556 | |||
| 1596 | Ga0495586_0584681 | |||
| 1597 | Ga0495587_0010964 | |||
| 1598 | Ga0495587_0035730 | |||
| 1599 | Ga0495609_0254242 | |||
| 1600 | Ga0495609_0414856 | |||
| 1601 | Ga0495597_0046921 | |||
| 1602 | Ga0495597_0235765 | |||
| 1603 | Ga0495645_0025866 | |||
| 1604 | Ga0495645_0183083 | |||
| 1605 | Ga0495622_0008090 | |||
| 1606 | Ga0495622_0008469 | |||
| 1607 | Ga0495667_0011440 | |||
| 1608 | Ga0495667_0013790 | |||
| 1609 | Ga0495667_0433148 | |||
| 1610 | Ga0495656_0300291 | |||
| 1611 | Ga0495668_0085926 | |||
| 1612 | Ga0495611_0206232 | |||
| 1613 | Ga0495611_0221977 | |||
| 1614 | Ga0495611_0238612 | |||
| 1615 | Ga0495611_0339696 | |||
| 1616 | Ga0495611_0523836 | |||
| 1617 | Ga0495625_0165431 | |||
| 1618 | Ga0495625_0189269 | |||
| 1619 | Ga0495625_0492023 | |||
| 1620 | Ga0495625_0601979 | |||
| 1621 | Ga0495635_0001821 | |||
| 1622 | Ga0495635_0006294 | |||
| 1623 | Ga0495635_0090798 | |||
| 1624 | Ga0495635_1101818 | |||
| 1625 | Ga0495661_0506652 | |||
| 1626 | Ga0495588_0015739 | |||
| 1627 | Ga0495588_0116156 | |||
| 1628 | Ga0495657_0004358 | |||
| 1629 | Ga0495657_0026309 | |||
| 1630 | Ga0495657_0181727 | |||
| 1631 | Ga0495657_0281419 | |||
| 1632 | Ga0495657_0688941 | |||
| 1633 | Ga0495599_0001858 | |||
| 1634 | Ga0495599_0010912 | |||
| 1635 | Ga0495599_0307421 | |||
| 1636 | Ga0495623_0009276 | |||
| 1637 | Ga0495623_0243253 | |||
| 1638 | Ga0495623_0455864 | |||
| 1639 | Ga0495623_0671572 | |||
| 1640 | Ga0495646_0017290 | |||
| 1641 | Ga0495646_0035715 | |||
| 1642 | Ga0495646_0095015 | |||
| 1643 | Ga0495646_0519400 | |||
| 1644 | Ga0495658_0013070 | |||
| 1645 | Ga0495658_0087801 | |||
| 1646 | Ga0495658_0136138 | |||
| 1647 | Ga0495613_0004460 | |||
| 1648 | Ga0495613_0083933 | |||
| 1649 | Ga0495613_0104858 | |||
| 1650 | Ga0495613_0257261 | |||
| 1651 | Ga0495624_0028691 | |||
| 1652 | Ga0495671_0594345 | |||
| 1653 | Ga0495671_0644793 | |||
| 1654 | Ga0495649_0097731 | |||
| 1655 | Ga0495649_0109588 | |||
| 1656 | Ga0495649_0175401 | |||
| 1657 | Ga0495589_0334375 | |||
| 1658 | Ga0495600_0003824 | |||
| 1659 | Ga0495600_0020355 | |||
| 1660 | Ga0495600_0035751 | |||
| 1661 | Ga0495600_0499696 | |||
| 1662 | Ga0495600_0701056 | |||
| 1663 | Ga0495581_0656050 | |||
| 1664 | Ga0495604_0001856 | |||
| 1665 | Ga0495604_0022916 | |||
| 1666 | Ga0495604_0070858 | |||
| 1667 | Ga0495604_0933651 | |||
| 1668 | Ga0495674_0027269 | |||
| 1669 | Ga0495674_0030306 | |||
| 1670 | Ga0495674_0881623 | |||
| 1671 | Ga0495672_0067260 | |||
| 1672 | Ga0495676_0036000 | |||
| 1673 | Ga0495676_0224485 | |||
| 1674 | Ga0495680_0002074 | |||
| 1675 | Ga0495680_0019650 | |||
| 1676 | Ga0495683_0149960 | |||
| 1677 | Ga0495687_074996 | |||
| 1678 | Ga0495687_110801 | |||
| 1679 | Ga0495687_223998 | |||
| 1680 | Ga0495687_250438 | |||
| 1681 | Ga0495675_0027706 | |||
| 1682 | Ga0495675_0340354 | |||
| 1683 | Ga0495673_0110256 | |||
| 1684 | Ga0495673_0306444 | |||
| 1685 | Ga0495684_0004165 | |||
| 1686 | Ga0495684_0131796 | |||
| 1687 | Ga0495684_0464318 | |||
| 1688 | Ga0495686_0157413 | |||
| 1689 | Ga0495686_0345474 | |||
| 1690 | Ga0495686_0570260 | |||
| 1691 | Ga0495593_0005823 | |||
| 1692 | Ga0495593_0471247 | |||
| 1693 | Ga0495602_0018537 | |||
| 1694 | Ga0495602_0042386 | |||
| 1695 | Ga0495602_0247479 | |||
| 1696 | Ga0495614_0125961 | |||
| 1697 | Ga0495614_0221077 | |||
| 1698 | Ga0495626_0065119 | |||
| 1699 | Ga0496100_0058273 | |||
| 1700 | Ga0496100_0180312 | |||
| 1701 | Ga0496100_0239888 | |||
| 1702 | Ga0496100_1162966 | |||
| 1703 | Ga0496100_1330518 | |||
| 1704 | Ga0496101_0079676 | |||
| 1705 | Ga0496101_0102982 | |||
| 1706 | Ga0496101_0120475 | |||
| 1707 | Ga0496101_0237673 | |||
| 1708 | Ga0496101_0282949 | |||
| 1709 | Ga0496101_0474281 | |||
| 1710 | Ga0496101_0484592 | |||
| 1711 | Ga0496101_0595013 | |||
| 1712 | Ga0496102_0021589 | |||
| 1713 | Ga0496102_0088796 | |||
| 1714 | Ga0496102_0187318 | |||
| 1715 | Ga0496102_0589020 | |||
| 1716 | Ga0496102_0902588 | |||
| 1717 | Ga0496102_1251661 | |||
| 1718 | Ga0496103_0024113 | |||
| 1719 | Ga0496103_0248244 | |||
| 1720 | Ga0496103_0341384 | |||
| 1721 | Ga0496103_0438431 | |||
| 1722 | Ga0496103_0562604 | |||
| 1723 | Ga0496104_0022050 | |||
| 1724 | Ga0496104_0043610 | |||
| 1725 | Ga0496104_0049102 | |||
| 1726 | Ga0496104_0097805 | |||
| 1727 | Ga0496104_0099649 | |||
| 1728 | Ga0496105_0006148 | |||
| 1729 | Ga0496105_0034179 | |||
| 1730 | Ga0496105_0166665 | |||
| 1731 | Ga0496105_0222861 | |||
| 1732 | Ga0496105_0326209 | |||
| 1733 | Ga0496105_0869151 | |||
| 1734 | Ga0496106_0001884 | |||
| 1735 | Ga0496106_0001995 | |||
| 1736 | Ga0496106_0036279 | |||
| 1737 | Ga0496106_0377985 | |||
| 1738 | Ga0496106_1217831 | |||
| 1739 | Ga0496107_0041285 | |||
| 1740 | Ga0496107_0158585 | |||
| 1741 | Ga0496107_0600457 | |||
| 1742 | Ga0496107_0758261 | |||
| 1743 | Ga0496108_0000438 | |||
| 1744 | Ga0496108_0196538 | |||
| 1745 | Ga0496108_0419020 | |||
| 1746 | Ga0496108_0459384 | |||
| 1747 | Ga0496108_1122401 | |||
| 1748 | Ga0496108_1576947 | |||
| 1749 | Ga0496108_1715653 | |||
| 1750 | Ga0496109_0000284 | |||
| 1751 | Ga0496109_0085155 | |||
| 1752 | Ga0496109_0139679 | |||
| 1753 | Ga0496109_1138977 | |||
| 1754 | Ga0496109_1354772 | |||
| 1755 | Ga0496109_1682969 | |||
| 1756 | Ga0496109_1907366 | |||
| 1757 | Ga0496110_0012769 | |||
| 1758 | Ga0496110_0052828 | |||
| 1759 | Ga0496110_0087441 | |||
| 1760 | Ga0496110_0271012 | |||
| 1761 | Ga0496110_0451633 | |||
| 1762 | Ga0496110_1020271 | |||
| 1763 | Ga0496111_0015727 | |||
| 1764 | Ga0496111_0099475 | |||
| 1765 | Ga0496111_0128224 | |||
| 1766 | Ga0496111_0249384 | |||
| 1767 | Ga0496111_0678566 | |||
| 1768 | Ga0496111_0827342 | |||
| 1769 | Ga0496111_0945774 | |||
| 1770 | Ga0496111_1162300 | |||
| 1771 | Ga0496112_0000585 | |||
| 1772 | Ga0496112_0003685 | |||
| 1773 | Ga0496112_0050901 | |||
| 1774 | Ga0496112_0414428 | |||
| 1775 | Ga0496112_0558429 | |||
| 1776 | Ga0496112_0911758 | |||
| 1777 | Ga0496113_0009649 | |||
| 1778 | Ga0496113_0058926 | |||
| 1779 | Ga0496113_0664060 | |||
| 1780 | Ga0496113_0680963 | |||
| 1781 | Ga0496113_0823847 | |||
| 1782 | Ga0496113_1338140 | |||
| 1783 | Ga0496114_0090633 | |||
| 1784 | Ga0496114_0189648 | |||
| 1785 | Ga0496114_0264124 | |||
| 1786 | Ga0496115_0026483 | |||
| 1787 | Ga0496115_0055387 | |||
| 1788 | Ga0496115_0300079 | |||
| 1789 | Ga0496115_0368588 | |||
| 1790 | Ga0496115_0781394 | |||
| 1791 | Ga0496116_0186575 | |||
| 1792 | Ga0496116_0332685 | |||
| 1793 | Ga0496116_0373715 | |||
| 1794 | Ga0496117_0046794 | |||
| 1795 | Ga0496117_0057574 | |||
| 1796 | Ga0496117_0085423 | |||
| 1797 | Ga0496117_0193458 | |||
| 1798 | Ga0496117_0599508 | |||
| 1799 | Ga0496118_0001280 | |||
| 1800 | Ga0496118_0118275 | |||
| 1801 | Ga0496118_0118420 | |||
| 1802 | Ga0496118_0404076 | |||
| 1803 | Ga0496118_0404761 | |||
| 1804 | Ga0496119_0026620 | |||
| 1805 | Ga0496119_0056622 | |||
| 1806 | Ga0496119_0125648 | |||
| 1807 | Ga0496119_0146044 | |||
| 1808 | Ga0496119_0158838 | |||
| 1809 | Ga0496119_0577773 | |||
| 1810 | Ga0496120_0112819 | |||
| 1811 | Ga0496120_0161348 | |||
| 1812 | Ga0496120_0350627 | |||
| 1813 | Ga0496121_0000571 | |||
| 1814 | Ga0496121_0004527 | |||
| 1815 | Ga0496121_0005094 | |||
| 1816 | Ga0496121_0060620 | |||
| 1817 | Ga0496121_0716947 | |||
| 1818 | Ga0496122_0193710 | |||
| 1819 | Ga0496124_0000267 | |||
| 1820 | Ga0496124_0319932 | |||
| 1821 | Ga0496124_0458125 | |||
| 1822 | Ga0496125_0023578 | |||
| 1823 | Ga0496125_0241321 | |||
| 1824 | Ga0496125_0441948 | |||
| 1825 | Ga0496126_0011100 | |||
| 1826 | Ga0496126_0012973 | |||
| 1827 | Ga0496126_0053366 | |||
| 1828 | Ga0496126_0103306 | |||
| 1829 | Ga0496126_0338802 | |||
| 1830 | Ga0496126_0461891 | |||
| 1831 | Ga0495678_189926 | |||
| 1832 | Ga0495682_0052951 | |||
| 1833 | Ga0495682_0088552 | |||
| 1834 | Ga0495682_0126463 | |||
| 1835 | Ga0495682_0191079 | |||
| 1836 | nmdc:mga0yw44_241359_c1 | |||
| 1837 | nmdc:mga04h51_40682_c1 | |||
| 1838 | nmdc:mga07m45_686971_c1 | |||
| 1839 | nmdc:mga06r32_370599_c1 | |||
| 1840 | nmdc:mga08y16_164334_c1 | |||
| 1841 | nmdc:mga0n895_4019_c1 | |||
| 1842 | nmdc:mga0rr50_102773_c1 | |||
| 1843 | nmdc:mga0rr50_1671757_c1 | |||
| 1844 | nmdc:mga0a205_52955_c1 | |||
| 1845 | nmdc:mga0sz30_199934_c1 | |||
| 1846 | Ga0495601_0114538 | |||
| 1847 | Ga0495612_0183774 | |||
| 1848 | Ga0495612_0349744 | |||
| 1849 | Ga0495612_0595934 | |||
| 1850 | Ga0500635_0412688 | |||
| 1851 | Ga0495655_0015732 | |||
| 1852 | Ga0495655_0302824 | |||
| 1853 | Ga0495595_0301113 | |||
| 1854 | Ga0495619_0001862 | |||
| 1855 | Ga0495619_0290710 | |||
| 1856 | Ga0500578_0142963 | |||
| 1857 | Ga0500643_000028 | |||
| 1858 | Ga0500644_0206194 | |||
| 1859 | Ga0500646_0047689 | |||
| 1860 | Ga0500647_0026988 | |||
| 1861 | Ga0500647_0410457 | |||
| 1862 | Ga0500583_0022151 | |||
| 1863 | Ga0500651_0011770 | |||
| 1864 | Ga0500651_0070300 | |||
| 1865 | Ga0500651_0263750 | |||
| 1866 | Ga0500651_0713650 | |||
| 1867 | Ga0500566_0010631 | |||
| 1868 | Ga0500566_0391926 | |||
| 1869 | Ga0500566_0409747 | |||
| 1870 | Ga0500640_114969 | |||
| 1871 | Ga0500648_254773 | |||
| 1872 | Ga0500650_0369910 | |||
| 1873 | Ga0500650_0405440 | |||
| 1874 | Ga0500650_0478442 | |||
| 1875 | Ga0500555_002004 | |||
| 1876 | Ga0500556_0051487 | |||
| 1877 | Ga0500556_0423424 | |||
| 1878 | Ga0500557_000150 | |||
| 1879 | Ga0500562_036026 | |||
| 1880 | Ga0500569_008126 | |||
| 1881 | Ga0500572_007916 | |||
| 1882 | Ga0500594_0118910 | |||
| 1883 | Ga0500595_002912 | |||
| 1884 | Ga0500595_015775 | |||
| 1885 | Ga0500595_021236 | |||
| 1886 | Ga0500595_033233 | |||
| 1887 | Ga0500595_107255 | |||
| 1888 | Ga0500595_126936 | |||
| 1889 | Ga0500597_125837 | |||
| 1890 | Ga0500597_238649 | |||
| 1891 | Ga0500607_030317 | |||
| 1892 | Ga0500608_059072 | |||
| 1893 | Ga0500608_074760 | |||
| 1894 | Ga0500608_191480 | |||
| 1895 | Ga0500614_243929 | |||
| 1896 | Ga0500618_143448 | |||
| 1897 | Ga0500618_147358 | |||
| 1898 | Ga0500642_0000319 | |||
| 1899 | Ga0500642_0000744 | |||
| 1900 | Ga0500642_0354373 | |||
| 1901 | Ga0500642_0426861 | |||
| 1902 | Ga0500655_027656 | |||
| 1903 | Ga0500559_0126507 | |||
| 1904 | Ga0500564_135492 | |||
| 1905 | Ga0500568_0041701 | |||
| 1906 | Ga0500568_0089469 | |||
| 1907 | Ga0500568_0097936 | |||
| 1908 | Ga0500568_0236400 | |||
| 1909 | Ga0500573_0084912 | |||
| 1910 | Ga0500577_0487456 | |||
| 1911 | Ga0500588_0094221 | |||
| 1912 | Ga0500588_0228384 | |||
| 1913 | Ga0500588_0243205 | |||
| 1914 | Ga0500589_084436 | |||
| 1915 | Ga0500590_165249 | |||
| 1916 | Ga0500590_167171 | |||
| 1917 | Ga0500590_216543 | |||
| 1918 | Ga0500604_0130312 | |||
| 1919 | Ga0500616_0008142 | |||
| 1920 | Ga0500619_184968 | |||
| 1921 | Ga0500620_244986 | |||
| 1922 | Ga0500622_0028909 | |||
| 1923 | Ga0500622_0057579 | |||
| 1924 | Ga0500624_019238 | |||
| 1925 | Ga0500627_0025901 | |||
| 1926 | Ga0500627_0156366 | |||
| 1927 | Ga0500633_0301954 | |||
| 1928 | Ga0500634_0205400 | |||
| 1929 | Ga0500639_042674 | |||
| 1930 | Ga0500639_055223 | |||
| 1931 | Ga0500636_0000335 | |||
| 1932 | Ga0500636_0134018 | |||
| 1933 | Ga0500636_0156489 | |||
| 1934 | Ga0500636_0533613 | |||
| 1935 | Ga0500636_0541247 | |||
| 1936 | Ga0500637_0270137 | |||
| 1937 | Ga0500649_175803 | |||
| 1938 | Ga0500570_096368 | |||
| 1939 | Ga0500657_163425 | |||
| 1940 | Ga0500625_005839 | |||
| 1941 | Ga0500645_042085 | |||
| 1942 | Ga0500645_094392 | |||
| 1943 | Ga0500645_132080 | |||
| 1944 | Ga0500552_005516 | |||
| 1945 | Ga0500596_019377 | |||
| 1946 | Ga0500599_000638 | |||
| 1947 | Ga0500601_003226 | |||
| 1948 | Ga0500601_043352 | |||
| 1949 | Ga0500613_059047 | |||
| 1950 | Ga0500661_008314 | |||
| 1951 | Ga0500661_017485 | |||
| 1952 | 2509146373 |