F487257

General Info

Members Datasets Scaffolds Average Seq Length
976 426 1952 65

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0587823|Ga0373923_0587823_132_368
Length 78
Sequence MDMMSMVTGMLAAQAGNTQMQVAATIMKSNADAEKSTVLTLLGAGQPSLANVGAGIGGNLNIAAYWFRARRPPGSSPP

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
233 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
236 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
242 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
245 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
246 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
247 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
374 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
378 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
379 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
380 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
381 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
382 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
383 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
384 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
385 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
386 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
387 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
388 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
389 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
390 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
391 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
392 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
395 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
396 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
399 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
402 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
403 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
406 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
409 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
410 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
411 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
412 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
416 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
417 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
418 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
421 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
422 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
423 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
424 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
425 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
426 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.1
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 0.1
Rhizoplane 10.76
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0587823 3300035111 Bacteria 548
2 LJQas_1005052 3300000549 Bacteria 1687
3 JGI24737J22298_10154785 3300001990 Bacteria 676
4 JGI24738J21930_10039787 3300002075 Bacteria 955
5 JGI25165J46597_1004162 3300003214 Bacteria 3207
6 Ga0055525_1012404 3300003759 Bacteria 718
7 Ga0055543_1046618 3300004625 Bacteria 719
8 Ga0065165_1000370 3300005262 Bacteria 73604
9 Ga0065165_1042886 3300005262 Bacteria 1332
10 Ga0065712_10158205 3300005290 Bacteria 1320
11 Ga0065715_10703381 3300005293 Bacteria 652
12 Ga0070658_10388586 3300005327 Bacteria 1198
13 Ga0070658_10499356 3300005327 Bacteria 1051
14 Ga0070683_101724312 3300005329 Bacteria 602
15 Ga0070690_100254481 3300005330 Bacteria 1243
16 Ga0070690_100573102 3300005330 Bacteria 854
17 Ga0070670_100849970 3300005331 Bacteria 826
18 Ga0070670_102113444 3300005331 Bacteria 519
19 Ga0068869_101603191 3300005334 Bacteria 580
20 Ga0068869_101677555 3300005334 Bacteria 567
21 Ga0070666_10355521 3300005335 Bacteria 1049
22 Ga0070680_100022477 3300005336 Bacteria 5024
23 Ga0070680_100106831 3300005336 Bacteria 2328
24 Ga0070680_100388993 3300005336 Bacteria 1188
25 Ga0070680_101413457 3300005336 Bacteria 602
26 Ga0070682_100199594 3300005337 Bacteria 1410
27 Ga0070682_100503951 3300005337 Bacteria 938
28 Ga0068868_100551958 3300005338 Bacteria 1015
29 Ga0068868_100672152 3300005338 Bacteria 924
30 Ga0068868_101189057 3300005338 Bacteria 705
31 Ga0068868_101198812 3300005338 Bacteria 702
32 Ga0068868_102406546 3300005338 Bacteria 503
33 Ga0070660_100012916 3300005339 Bacteria 5976
34 Ga0070660_100853127 3300005339 Bacteria 767
35 Ga0070661_100633583 3300005344 Bacteria 867
36 Ga0070661_100823520 3300005344 Bacteria 763
37 Ga0070692_10581513 3300005345 Bacteria 738
38 Ga0070668_101293542 3300005347 Bacteria 663
39 Ga0070669_100718132 3300005353 Bacteria 845
40 Ga0070671_100083780 3300005355 Bacteria 2666
41 Ga0070671_100575104 3300005355 Bacteria 973
42 Ga0070671_101631769 3300005355 Bacteria 572
43 Ga0070688_100487581 3300005365 Bacteria 928
44 Ga0070659_100060570 3300005366 Bacteria 2990
45 Ga0070659_100372381 3300005366 Bacteria 1202
46 Ga0070659_100906759 3300005366 Bacteria 770
47 Ga0070659_101649241 3300005366 Bacteria 573
48 Ga0070667_100407242 3300005367 Bacteria 1238
49 Ga0070714_100070500 3300005435 Bacteria 3021
50 Ga0070714_100573686 3300005435 Bacteria 1082
51 Ga0070713_100002110 3300005436 Bacteria 12858
52 Ga0070713_100073819 3300005436 Bacteria 2889
53 Ga0070713_101688549 3300005436 Bacteria 615
54 Ga0070710_10003024 3300005437 Bacteria 7997
55 Ga0070710_10005145 3300005437 Bacteria 6191
56 Ga0070711_100007448 3300005439 Bacteria 6657
57 Ga0070711_100065325 3300005439 Bacteria 2544
58 Ga0070711_101015093 3300005439 Unclassified 712
59 Ga0070711_101638382 3300005439 Unclassified 563
60 Ga0070705_101164137 3300005440 Unclassified 634
61 Ga0070663_100152426 3300005455 Bacteria 1773
62 Ga0070663_100221250 3300005455 Bacteria 1486
63 Ga0070663_100232099 3300005455 Bacteria 1453
64 Ga0070678_100256779 3300005456 Bacteria 1468
65 Ga0070678_100581793 3300005456 Bacteria 997
66 Ga0070662_100815495 3300005457 Bacteria 794
67 Ga0070662_101110959 3300005457 Bacteria 678
68 Ga0070681_10513928 3300005458 Bacteria 1111
69 Ga0070681_10721582 3300005458 Bacteria 913
70 Ga0070707_100030468 3300005468 Bacteria 5137
71 Ga0070698_100678742 3300005471 Bacteria 972
72 Ga0070699_100870551 3300005518 Bacteria 825
73 Ga0070699_100992317 3300005518 Bacteria 770
74 Ga0070679_100441747 3300005530 Bacteria 1246
75 Ga0070679_100571162 3300005530 Bacteria 1074
76 Ga0070679_100726725 3300005530 Bacteria 936
77 Ga0070684_100012882 3300005535 Bacteria 6721
78 Ga0070684_101203589 3300005535 Bacteria 712
79 Ga0070697_100088553 3300005536 Bacteria 2557
80 Ga0070697_100111993 3300005536 Bacteria 2275
81 Ga0068853_100006064 3300005539 Bacteria 9566
82 Ga0068853_100267430 3300005539 Bacteria 1573
83 Ga0068853_100601071 3300005539 Bacteria 1045
84 Ga0068853_100638940 3300005539 Bacteria 1012
85 Ga0068853_101803423 3300005539 Bacteria 593
86 Ga0070672_100595373 3300005543 Bacteria 963
87 Ga0070686_100207708 3300005544 Bacteria 1408
88 Ga0070695_100558851 3300005545 Bacteria 893
89 Ga0070695_101529865 3300005545 Bacteria 556
90 Ga0070693_100038550 3300005547 Bacteria 2671
91 Ga0070693_100462484 3300005547 Bacteria 893
92 Ga0070665_100077316 3300005548 Bacteria 3334
93 Ga0070665_101862103 3300005548 Bacteria 608
94 Ga0070665_102416959 3300005548 Bacteria 528
95 Ga0068855_100036277 3300005563 Bacteria 5870
96 Ga0068855_102256571 3300005563 Bacteria 545
97 Ga0068855_102260236 3300005563 Bacteria 545
98 Ga0068855_102284708 3300005563 Bacteria 542
99 Ga0070664_102336172 3300005564 Unclassified 507
100 Ga0068857_100637013 3300005577 Bacteria 1010
101 Ga0068857_101229818 3300005577 Bacteria 726
102 Ga0068857_101732034 3300005577 Unclassified 611
103 Ga0068857_102442697 3300005577 Bacteria 513
104 Ga0068854_100120969 3300005578 Bacteria 1987
105 Ga0068854_101695852 3300005578 Bacteria 578
106 Ga0068854_102117469 3300005578 Bacteria 520
107 Ga0068856_100083698 3300005614 Bacteria 3168
108 Ga0068856_100127315 3300005614 Bacteria 2550
109 Ga0068856_100429315 3300005614 Bacteria 1342
110 Ga0068856_100755112 3300005614 Bacteria 993
111 Ga0068856_102407592 3300005614 Unclassified 534
112 Ga0068852_100029813 3300005616 Bacteria 4484
113 Ga0068852_100155718 3300005616 Bacteria 2129
114 Ga0068852_100270359 3300005616 Bacteria 1635
115 Ga0068852_100421421 3300005616 Bacteria 1317
116 Ga0068852_100576660 3300005616 Bacteria 1127
117 Ga0068852_100589922 3300005616 Bacteria 1115
118 Ga0068852_101399237 3300005616 Bacteria 721
119 Ga0068859_100903678 3300005617 Bacteria 968
120 Ga0068859_102794208 3300005617 Bacteria 536
121 Ga0068864_100311213 3300005618 Bacteria 1476
122 Ga0068864_100815565 3300005618 Bacteria 918
123 Ga0068864_101018497 3300005618 Bacteria 822
124 Ga0068864_101300939 3300005618 Bacteria 727
125 Ga0068864_102528288 3300005618 Bacteria 519
126 Ga0068861_100732763 3300005719 Bacteria 922
127 Ga0068861_101137799 3300005719 Bacteria 752
128 Ga0068851_10004403 3300005834 Bacteria 6348
129 Ga0068851_10285575 3300005834 Bacteria 945
130 Ga0068863_100181929 3300005841 Bacteria 2018
131 Ga0068863_100236108 3300005841 Bacteria 1764
132 Ga0068863_100361282 3300005841 Bacteria 1415
133 Ga0068863_101629367 3300005841 Bacteria 655
134 Ga0068863_102567320 3300005841 Bacteria 519
135 Ga0068858_100216885 3300005842 Bacteria 1811
136 Ga0068858_101132216 3300005842 Bacteria 769
137 Ga0068858_101509736 3300005842 Bacteria 663
138 Ga0068860_100000338 3300005843 Bacteria 63598
139 Ga0068860_100408819 3300005843 Bacteria 1344
140 Ga0068860_101026741 3300005843 Bacteria 843
141 Ga0068860_102511391 3300005843 Unclassified 535
142 Ga0068862_100924922 3300005844 Bacteria 859
143 Ga0081455_10025082 3300005937 Bacteria 5510
144 Ga0081540_1020732 3300005983 Bacteria 3941
145 Ga0081540_1023231 3300005983 Plasmid 3634
146 Ga0081540_1151591 3300005983 Bacteria 914
147 Ga0070717_10121294 3300006028 Bacteria 2240
148 Ga0070717_11108321 3300006028 Bacteria 721
149 Ga0075365_10150424 3300006038 Bacteria 1619
150 Ga0075368_10054498 3300006042 Bacteria 1593
151 Ga0075368_10378092 3300006042 Bacteria 620
152 Ga0075368_10479978 3300006042 Unclassified 553
153 Ga0070715_10011303 3300006163 Bacteria 3212
154 Ga0070715_10758333 3300006163 Bacteria 585
155 Ga0070716_100003075 3300006173 Bacteria 7790
156 Ga0070716_100011221 3300006173 Bacteria 4511
157 Ga0070712_100068092 3300006175 Bacteria 2535
158 Ga0070712_101352213 3300006175 Bacteria 621
159 Ga0070712_101558663 3300006175 Bacteria 578
160 Ga0075367_10814542 3300006178 Bacteria 595
161 Ga0075367_10889374 3300006178 Bacteria 568
162 Ga0075369_10058570 3300006186 Bacteria 1677
163 Ga0097621_100462465 3300006237 Bacteria 1144
164 Ga0097621_100830241 3300006237 Bacteria 858
165 Ga0097621_101196165 3300006237 Bacteria 716
166 Ga0068871_100187620 3300006358 Bacteria 1779
167 Ga0068871_100234210 3300006358 Bacteria 1595
168 Ga0068871_101043215 3300006358 Bacteria 763
169 Ga0075428_102251810 3300006844 Unclassified 561
170 Ga0075431_100214862 3300006847 Bacteria 1963
171 Ga0075433_10037545 3300006852 Bacteria 4180
172 Ga0075434_100617789 3300006871 Bacteria 1103
173 Ga0068865_100483391 3300006881 Bacteria 1030
174 Ga0068865_102080148 3300006881 Unclassified 516
175 Ga0097620_100903714 3300006931 Bacteria 968
176 Ga0097620_102792917 3300006931 Bacteria 536
177 Ga0075435_101805059 3300007076 Unclassified 537
178 Ga0099794_10095572 3300007265 Bacteria 1479
179 Ga0099794_10352659 3300007265 Bacteria 766
180 Ga0099794_10418808 3300007265 Bacteria 701
181 Ga0099795_10008545 3300007788 Bacteria 2925
182 Ga0099795_10015844 3300007788 Bacteria 2371
183 Ga0099795_10031741 3300007788 Bacteria 1821
184 Ga0099795_10054155 3300007788 Bacteria 1470
185 Ga0099795_10075854 3300007788 Bacteria 1277
186 Ga0099795_10189851 3300007788 Unclassified 862
187 Ga0105250_10525641 3300009092 Bacteria 540
188 Ga0105240_10011631 3300009093 Bacteria 12237
189 Ga0105240_10119154 3300009093 Bacteria 3180
190 Ga0105240_10612995 3300009093 Bacteria 1197
191 Ga0111539_10090244 3300009094 Bacteria 3601
192 Ga0105245_10537913 3300009098 Bacteria 1189
193 Ga0105247_10006789 3300009101 Bacteria 7058
194 Ga0105247_10195004 3300009101 Bacteria 1358
195 Ga0105247_10244745 3300009101 Bacteria 1223
196 Ga0105247_10543707 3300009101 Bacteria 853
197 Ga0105243_10274253 3300009148 Bacteria 1516
198 Ga0105243_10393801 3300009148 Bacteria 1285
199 Ga0105241_10212606 3300009174 Bacteria 1621
200 Ga0105241_10246418 3300009174 Bacteria 1513
201 Ga0105241_10410482 3300009174 Bacteria 1190
202 Ga0105241_12478115 3300009174 Bacteria 519
203 Ga0105242_10501718 3300009176 Bacteria 1154
204 Ga0105242_10614612 3300009176 Bacteria 1052
205 Ga0105248_10153524 3300009177 Bacteria 2598
206 Ga0105248_10198655 3300009177 Bacteria 2259
207 Ga0105248_10270760 3300009177 Bacteria 1912
208 Ga0105237_10028867 3300009545 Bacteria 5645
209 Ga0105237_10129523 3300009545 Bacteria 2518
210 Ga0105237_10185326 3300009545 Bacteria 2081
211 Ga0105237_10388578 3300009545 Bacteria 1400
212 Ga0105237_10448581 3300009545 Bacteria 1296
213 Ga0105237_10582942 3300009545 Bacteria 1125
214 Ga0105237_10631722 3300009545 Bacteria 1078
215 Ga0105237_11234268 3300009545 Bacteria 754
216 Ga0105237_11406540 3300009545 Bacteria 704
217 Ga0105237_11957120 3300009545 Bacteria 594
218 Ga0105237_12429049 3300009545 Bacteria 534
219 Ga0105238_10004512 3300009551 Bacteria 13800
220 Ga0105238_10238393 3300009551 Bacteria 1796
221 Ga0105238_11645552 3300009551 Bacteria 672
222 Ga0105249_10715616 3300009553 Bacteria 1062
223 Ga0105249_11011686 3300009553 Bacteria 900
224 Ga0105249_13501321 3300009553 Bacteria 505
225 Ga0099796_10204084 3300010159 Bacteria 803
226 Ga0099796_10328335 3300010159 Bacteria 654
227 Ga0099796_10395194 3300010159 Bacteria 605
228 Ga0099796_10410314 3300010159 Bacteria 595
229 Ga0105239_10069619 3300010375 Bacteria 3866
230 Ga0105239_10112815 3300010375 Bacteria 3014
231 Ga0105239_10181119 3300010375 Bacteria 2357
232 Ga0105239_10272260 3300010375 Bacteria 1905
233 Ga0105239_10278093 3300010375 Bacteria 1884
234 Ga0105239_10774240 3300010375 Bacteria 1099
235 Ga0105239_10892140 3300010375 Bacteria 1020
236 Ga0105239_10937113 3300010375 Bacteria 994
237 Ga0105239_11735329 3300010375 Bacteria 723
238 Ga0105246_10031768 3300011119 Bacteria 3496
239 Ga0105246_10338814 3300011119 Bacteria 1228
240 Ga0105246_10613230 3300011119 Bacteria 942
241 Ga0105246_11401159 3300011119 Bacteria 652
242 Ga0157313_1015837 3300012503 Bacteria 713
243 Ga0157370_10138556 3300013104 Bacteria 2267
244 Ga0157369_10189265 3300013105 Bacteria 2163
245 Ga0157369_10415885 3300013105 Bacteria 1394
246 Ga0157374_10109473 3300013296 Bacteria 2656
247 Ga0157374_10381201 3300013296 Bacteria 1405
248 Ga0157374_11281194 3300013296 Bacteria 755
249 Ga0157378_10181370 3300013297 Bacteria 1981
250 Ga0157378_10240913 3300013297 Bacteria 1727
251 Ga0157378_11001122 3300013297 Bacteria 870
252 Ga0157378_11593750 3300013297 Bacteria 699
253 Ga0163162_10114506 3300013306 Bacteria 2796
254 Ga0163162_10403333 3300013306 Bacteria 1500
255 Ga0163162_11925127 3300013306 Bacteria 677
256 Ga0163162_12609560 3300013306 Bacteria 581
257 Ga0163162_12670804 3300013306 Bacteria 575
258 Ga0157372_10131460 3300013307 Bacteria 2880
259 Ga0157372_11379364 3300013307 Bacteria 813
260 Ga0157372_12531779 3300013307 Bacteria 589
261 Ga0157375_10282303 3300013308 Bacteria 1823
262 Ga0157375_11201538 3300013308 Bacteria 889
263 Ga0157375_11754915 3300013308 Unclassified 735
264 Ga0157375_13511646 3300013308 Bacteria 522
265 Ga0163163_10117278 3300014325 Bacteria 2694
266 Ga0163163_10210261 3300014325 Bacteria 1994
267 Ga0163163_11531445 3300014325 Bacteria 728
268 Ga0163163_11544591 3300014325 Bacteria 725
269 Ga0163163_11934809 3300014325 Bacteria 650
270 Ga0163163_12508340 3300014325 Bacteria 573
271 Ga0157377_10314028 3300014745 Bacteria 1039
272 Ga0157379_10329410 3300014968 Bacteria 1395
273 Ga0157379_10556630 3300014968 Bacteria 1067
274 Ga0157379_10751606 3300014968 Bacteria 918
275 Ga0157379_11026611 3300014968 Bacteria 787
276 Ga0157379_11153457 3300014968 Bacteria 744
277 Ga0157379_11751966 3300014968 Bacteria 609
278 Ga0157376_10026265 3300014969 Bacteria 4599
279 Ga0157376_10514124 3300014969 Bacteria 1179
280 Ga0157376_11130366 3300014969 Bacteria 810
281 Ga0157376_11571115 3300014969 Bacteria 692
282 Ga0157376_11786189 3300014969 Unclassified 651
283 Ga0157376_11908035 3300014969 Bacteria 631
284 Ga0182007_10200408 3300015262 Bacteria 698
285 Ga0163161_10273386 3300017792 Bacteria 1323
286 Ga0206353_11945494 3300020082 Bacteria 1182
287 Ga0209563_100565 3300025230 Bacteria 12334
288 Ga0209677_100794 3300025253 Bacteria 15885
289 Ga0209233_1008827 3300025261 Bacteria 3093
290 Ga0209130_1027206 3300025284 Bacteria 1218
291 Ga0209758_1005254 3300025297 Bacteria 10133
292 Ga0209758_1008667 3300025297 Bacteria 6525
293 Ga0209758_1104867 3300025297 Bacteria 795
294 Ga0207426_1050719 3300025302 Bacteria 1236
295 Ga0209257_1130527 3300025304 Bacteria 576
296 Ga0207656_10001723 3300025321 Bacteria 7270
297 Ga0207692_10004179 3300025898 Bacteria 5700
298 Ga0207692_10099053 3300025898 Bacteria 1596
299 Ga0207710_10005915 3300025900 Bacteria 5247
300 Ga0207710_10264934 3300025900 Bacteria 862
301 Ga0207710_10335126 3300025900 Bacteria 769
302 Ga0207710_10523832 3300025900 Bacteria 616
303 Ga0207688_10146588 3300025901 Bacteria 1392
304 Ga0207680_10130339 3300025903 Bacteria 1657
305 Ga0207680_10390480 3300025903 Bacteria 982
306 Ga0207680_10774819 3300025903 Bacteria 688
307 Ga0207647_10112176 3300025904 Bacteria 1612
308 Ga0207685_10009623 3300025905 Bacteria 2815
309 Ga0207699_10000443 3300025906 Bacteria 21171
310 Ga0207699_10123763 3300025906 Bacteria 1676
311 Ga0207705_10999870 3300025909 Bacteria 646
312 Ga0207654_10020998 3300025911 Bacteria 3468
313 Ga0207654_10534965 3300025911 Bacteria 831
314 Ga0207707_10010412 3300025912 Bacteria 8069
315 Ga0207707_10588304 3300025912 Bacteria 943
316 Ga0207707_10771274 3300025912 Bacteria 803
317 Ga0207695_10000059 3300025913 Bacteria 363920
318 Ga0207695_10271738 3300025913 Bacteria 1590
319 Ga0207695_10515954 3300025913 Bacteria 1077
320 Ga0207671_10010861 3300025914 Bacteria 7469
321 Ga0207671_10050106 3300025914 Bacteria 3092
322 Ga0207671_10165451 3300025914 Bacteria 1715
323 Ga0207671_10356181 3300025914 Bacteria 1161
324 Ga0207671_10795010 3300025914 Bacteria 750
325 Ga0207671_10828355 3300025914 Bacteria 733
326 Ga0207671_11102496 3300025914 Bacteria 623
327 Ga0207671_11339976 3300025914 Bacteria 556
328 Ga0207693_10005369 3300025915 Bacteria 10708
329 Ga0207693_10532392 3300025915 Bacteria 917
330 Ga0207693_10924030 3300025915 Bacteria 669
331 Ga0207663_10000159 3300025916 Bacteria 31170
332 Ga0207663_10008306 3300025916 Bacteria 5420
333 Ga0207660_10062522 3300025917 Bacteria 2682
334 Ga0207660_10087813 3300025917 Bacteria 2298
335 Ga0207660_10156052 3300025917 Unclassified 1757
336 Ga0207657_10386833 3300025919 Bacteria 1101
337 Ga0207657_10723480 3300025919 Bacteria 772
338 Ga0207649_10473613 3300025920 Bacteria 949
339 Ga0207652_10007627 3300025921 Bacteria 8707
340 Ga0207681_11563343 3300025923 Bacteria 553
341 Ga0207694_10003079 3300025924 Bacteria 13349
342 Ga0207694_10221119 3300025924 Bacteria 1545
343 Ga0207694_11158802 3300025924 Bacteria 654
344 Ga0207650_10879388 3300025925 Bacteria 761
345 Ga0207687_11187462 3300025927 Bacteria 656
346 Ga0207700_10020296 3300025928 Bacteria 4509
347 Ga0207700_10078655 3300025928 Bacteria 2566
348 Ga0207700_10097767 3300025928 Bacteria 2334
349 Ga0207664_10006844 3300025929 Bacteria 7879
350 Ga0207664_10048445 3300025929 Bacteria 3341
351 Ga0207664_10381917 3300025929 Bacteria 1250
352 Ga0207644_10161681 3300025931 Bacteria 1741
353 Ga0207644_10697723 3300025931 Bacteria 846
354 Ga0207690_10018691 3300025932 Bacteria 4253
355 Ga0207690_10764397 3300025932 Bacteria 797
356 Ga0207706_10865678 3300025933 Bacteria 765
357 Ga0207686_10898827 3300025934 Bacteria 714
358 Ga0207709_10901449 3300025935 Bacteria 719
359 Ga0207704_10658807 3300025938 Bacteria 863
360 Ga0207665_10001544 3300025939 Bacteria 15491
361 Ga0207665_10351234 3300025939 Bacteria 1113
362 Ga0207691_11162346 3300025940 Bacteria 641
363 Ga0207711_10153536 3300025941 Bacteria 2079
364 Ga0207711_10487956 3300025941 Bacteria 1148
365 Ga0207711_10764331 3300025941 Bacteria 900
366 Ga0207689_10196260 3300025942 Bacteria 1666
367 Ga0207689_10815045 3300025942 Bacteria 788
368 Ga0207679_10429628 3300025945 Bacteria 1167
369 Ga0207679_10462542 3300025945 Bacteria 1127
370 Ga0207667_10017617 3300025949 Bacteria 8034
371 Ga0207712_11034372 3300025961 Bacteria 729
372 Ga0207712_11120598 3300025961 Bacteria 701
373 Ga0207668_10128780 3300025972 Bacteria 1929
374 Ga0207668_10179991 3300025972 Bacteria 1666
375 Ga0207658_10536757 3300025986 Bacteria 1045
376 Ga0207658_10648447 3300025986 Bacteria 952
377 Ga0207677_10153115 3300026023 Bacteria 1782
378 Ga0207677_11163367 3300026023 Bacteria 705
379 Ga0207703_10428887 3300026035 Bacteria 1232
380 Ga0207703_11047739 3300026035 Bacteria 783
381 Ga0207703_11066277 3300026035 Bacteria 776
382 Ga0207639_10002960 3300026041 Bacteria 11420
383 Ga0207639_10058811 3300026041 Bacteria 2958
384 Ga0207639_10562892 3300026041 Bacteria 1048
385 Ga0207639_10747020 3300026041 Bacteria 909
386 Ga0207639_11000217 3300026041 Bacteria 783
387 Ga0207678_10118720 3300026067 Bacteria 2257
388 Ga0207678_10266094 3300026067 Bacteria 1470
389 Ga0207678_10308359 3300026067 Bacteria 1361
390 Ga0207702_10166453 3300026078 Bacteria 2017
391 Ga0207702_10553278 3300026078 Bacteria 1126
392 Ga0207702_10597236 3300026078 Bacteria 1083
393 Ga0207702_10641392 3300026078 Bacteria 1044
394 Ga0207641_10114966 3300026088 Bacteria 2392
395 Ga0207641_11093053 3300026088 Bacteria 796
396 Ga0207648_10144659 3300026089 Bacteria 2097
397 Ga0207648_10334755 3300026089 Bacteria 1362
398 Ga0207676_10257714 3300026095 Bacteria 1573
399 Ga0207676_11109715 3300026095 Bacteria 782
400 Ga0207676_11681696 3300026095 Bacteria 633
401 Ga0207674_10639890 3300026116 Bacteria 1027
402 Ga0207674_10753766 3300026116 Bacteria 940
403 Ga0207675_100180021 3300026118 Bacteria 2024
404 Ga0207675_100790960 3300026118 Bacteria 961
405 Ga0207675_101993647 3300026118 Bacteria 598
406 Ga0207683_10132131 3300026121 Bacteria 2246
407 Ga0207683_10756772 3300026121 Bacteria 901
408 Ga0207698_10020684 3300026142 Bacteria 4535
409 Ga0207698_10733625 3300026142 Bacteria 985
410 Ga0207698_10953073 3300026142 Bacteria 867
411 Ga0207698_11201516 3300026142 Bacteria 772
412 Ga0207698_11829983 3300026142 Bacteria 622
413 Ga0207698_11942224 3300026142 Bacteria 603
414 Ga0209179_1003483 3300027512 Bacteria 2273
415 Ga0209179_1047726 3300027512 Bacteria 913
416 Ga0209813_10017710 3300027866 Bacteria 1959
417 Ga0207428_10100503 3300027907 Bacteria 2235
418 Ga0268266_11422845 3300028379 Bacteria 669
419 Ga0268265_11597985 3300028380 Bacteria 657
420 Ga0268264_10000051 3300028381 Bacteria 321565
421 Ga0268264_10376459 3300028381 Bacteria 1358
422 Ga0268264_12421685 3300028381 Bacteria 531
423 Ga0265334_10061058 3300028573 Bacteria 1421
424 Ga0307517_10219501 3300028786 Bacteria 1158
425 Ga0307511_10068005 3300030521 Bacteria 2636
426 Ga0265330_10019295 3300031235 Bacteria 3126
427 Ga0265330_10057988 3300031235 Bacteria 1688
428 Ga0265332_10018917 3300031238 Bacteria 3041
429 Ga0265328_10019996 3300031239 Bacteria 2566
430 Ga0265328_10299135 3300031239 Bacteria 621
431 Ga0265325_10031254 3300031241 Bacteria 2851
432 Ga0265340_10007086 3300031247 Bacteria 6111
433 Ga0265339_10451679 3300031249 Bacteria 597
434 Ga0265331_10044539 3300031250 Bacteria 2145
435 Ga0265331_10045923 3300031250 Bacteria 2107
436 Ga0265331_10222993 3300031250 Bacteria 847
437 Ga0265331_10329848 3300031250 Bacteria 683
438 Ga0265316_10579648 3300031344 Bacteria 797
439 Ga0265316_10597677 3300031344 Bacteria 783
440 Ga0265316_10608495 3300031344 Bacteria 774
441 Ga0307509_10050156 3300031507 Bacteria 4470
442 Ga0307509_10104557 3300031507 Bacteria 2856
443 Ga0307509_10329994 3300031507 Bacteria 1257
444 Ga0307509_10795664 3300031507 Bacteria 610
445 Ga0307509_10883068 3300031507 Bacteria 559
446 Ga0307508_10090477 3300031616 Bacteria 2647
447 Ga0307508_10201686 3300031616 Bacteria 1589
448 Ga0307508_10821670 3300031616 Bacteria 548
449 Ga0265314_10100428 3300031711 Bacteria 1861
450 Ga0265342_10047587 3300031712 Bacteria 2573
451 Ga0265342_10084101 3300031712 Bacteria 1833
452 Ga0307516_10113627 3300031730 Bacteria 2506
453 Ga0307516_10343129 3300031730 Bacteria 1160
454 Ga0307516_10482551 3300031730 Bacteria 894
455 Ga0307507_10035688 3300033179 Bacteria 5102
456 Ga0307510_10070832 3300033180 Bacteria 3478
457 Ga0307510_10153880 3300033180 Bacteria 1911
458 Ga0307510_10346328 3300033180 Bacteria 937
459 Ga0373958_0025359 3300034819 Bacteria 1128
460 Ga0373938_0115955 3300034957 Bacteria 686
461 Ga0373926_0143317 3300035083 Unclassified 908
462 Ga0373928_0072665 3300035084 Bacteria 854
463 Ga0373928_0077986 3300035084 Unclassified 831
464 Ga0373929_0051221 3300035085 Bacteria 944
465 Ga0373934_0009884 3300035086 Bacteria 3581
466 Ga0373940_0267369 3300035088 Bacteria 581
467 Ga0373949_0037641 3300035090 Bacteria 1178
468 Ga0373923_0029194 3300035111 Bacteria 2210
469 Ga0373932_0026950 3300035112 Bacteria 1568
470 Ga0373936_0167631 3300035113 Bacteria 959
471 Ga0373936_0608680 3300035113 Bacteria 513
472 Ga0373941_0023970 3300035115 Bacteria 1748
473 Ga0373941_0156602 3300035115 Bacteria 839
474 Ga0373945_0075540 3300035116 Bacteria 1283
475 Ga0373945_0560706 3300035116 Bacteria 513
476 Ga0373953_0114672 3300035117 Bacteria 1141
477 Ga0373954_0023495 3300035118 Bacteria 2803
478 Ga0373956_0003314 3300035119 Bacteria 6486
479 Ga0373957_0004032 3300035120 Bacteria 4423
480 Ga0373957_0484708 3300035120 Bacteria 537
481 Ga0373960_0176040 3300035121 Bacteria 744
482 Ga0373943_0022410 3300035170 Bacteria 2927
483 Ga0373943_0169974 3300035170 Bacteria 1192
484 Ga0373943_0369118 3300035170 Bacteria 825
485 Ga0373946_0297386 3300035171 Bacteria 797
486 Ga0373946_0543606 3300035171 Unclassified 599
487 Ga0373955_0002545 3300035172 Bacteria 7980
488 Ga0373942_0066210 3300035207 Unclassified 1045
489 Ga0373961_0081783 3300035241 Bacteria 1017
490 Ga0373961_0390696 3300035241 Bacteria 532
491 Ga0373962_0265568 3300035242 Bacteria 600
492 Ga0373924_0005363 3300035410 Bacteria 4535
493 Ga0373931_0003348 3300035691 Bacteria 7181
494 Ga0373931_0003381 3300035691 Bacteria 7158
495 Ga0373931_0091706 3300035691 Bacteria 1694
496 Ga0373935_0066250 3300035692 Bacteria 2319
497 Ga0373935_0091991 3300035692 Bacteria 1987
498 Ga0373935_0214787 3300035692 Bacteria 1334
499 Ga0373935_0895863 3300035692 Bacteria 657
500 Ga0373927_0001975 3300035695 Bacteria 15129
501 Ga0373927_0012306 3300035695 Bacteria 5692
502 Ga0373927_0033149 3300035695 Bacteria 3363
503 Ga0373933_0004241 3300035724 Bacteria 7898
504 Ga0373947_0011731 3300035725 Bacteria 5022
505 Ga0373947_0311329 3300035725 Bacteria 1051
506 Ga0373947_0361666 3300035725 Bacteria 975
507 Ga0373937_0037309 3300036401 Bacteria 4428
508 Ga0373925_0045130 3300037068 Bacteria 3274
509 Ga0373925_0057487 3300037068 Bacteria 2915
510 Ga0373925_0094759 3300037068 Bacteria 2286
511 Ga0373925_0991858 3300037068 Bacteria 692
512 Ga0373925_1217463 3300037068 Bacteria 619
513 Ga0373925_1346045 3300037068 Bacteria 585
514 Ga0395898_0264748 3300037466 Bacteria 1640
515 Ga0436360_0773285 3300039438 Bacteria 1479
516 Ga0436363_1526908 3300039450 Bacteria 1083
517 Ga0451789_1275308 3300041443 Bacteria 669
518 Ga0451791_0807056 3300041451 Bacteria 790
519 Ga0451791_1818816 3300041451 Bacteria 701
520 Ga0451793_0560032 3300041452 Bacteria 1244
521 Ga0451797_0544067 3300041453 Bacteria 520
522 Ga0451795_1486397 3300041456 Bacteria 761
523 Ga0451795_1697835 3300041456 Bacteria 524
524 Ga0451800_1024483 3300041459 Bacteria 731
525 Ga0451800_1187149 3300041459 Bacteria 757
526 Ga0451802_0663882 3300041460 Bacteria 963
527 Ga0451804_1072820 3300041463 Bacteria 793
528 Ga0451807_0961669 3300041486 Bacteria 596
529 Ga0451807_1572561 3300041486 Bacteria 679
530 Ga0451833_1407648 3300041491 Bacteria 673
531 Ga0451835_1187017 3300041492 Bacteria 613
532 Ga0451837_0193938 3300041494 Bacteria 503
533 Ga0451839_0507174 3300041496 Bacteria 713
534 Ga0451841_1267011 3300041498 Bacteria 870
535 Ga0451849_0002782 3300041505 Bacteria 613
536 Ga0451849_0494380 3300041505 Bacteria 1636
537 Ga0451851_0166502 3300041507 Bacteria 707
538 Ga0451853_1365813 3300041512 Bacteria 939
539 Ga0466968_0287594 3300044735 Bacteria 788
540 Ga0495617_191825 3300046452 Bacteria 641
541 Ga0495592_0008547 3300046454 Bacteria 7685
542 Ga0495592_0097532 3300046454 Bacteria 2099
543 Ga0495592_0646140 3300046454 Bacteria 641
544 Ga0495629_0000905 3300046459 Bacteria 23806
545 Ga0495629_0002614 3300046459 Bacteria 13806
546 Ga0495629_0601026 3300046459 Bacteria 736
547 Ga0495629_0890183 3300046459 Bacteria 584
548 Ga0495638_0006758 3300046460 Bacteria 8304
549 Ga0495638_0277112 3300046460 Bacteria 913
550 Ga0495641_0582456 3300046461 Bacteria 511
551 Ga0495651_0040294 3300046462 Bacteria 3633
552 Ga0495651_0178045 3300046462 Bacteria 1508
553 Ga0495651_0200110 3300046462 Bacteria 1398
554 Ga0495651_0304696 3300046462 Bacteria 1067
555 Ga0495653_0006522 3300046463 Bacteria 9575
556 Ga0495653_0047464 3300046463 Bacteria 3321
557 Ga0495580_0280970 3300046472 Bacteria 1136
558 Ga0495580_0863409 3300046472 Bacteria 583
559 Ga0495582_0513581 3300046473 Bacteria 693
560 Ga0495582_0580678 3300046473 Bacteria 648
561 Ga0495639_0069218 3300046475 Bacteria 1628
562 Ga0495639_0743898 3300046475 Bacteria 507
563 Ga0495662_0472764 3300046476 Bacteria 615
564 Ga0495664_0037868 3300046477 Bacteria 2847
565 Ga0495664_0160497 3300046477 Bacteria 1364
566 Ga0495664_0257102 3300046477 Bacteria 1056
567 Ga0495584_0011133 3300046491 Bacteria 4611
568 Ga0495584_0498864 3300046491 Bacteria 620
569 Ga0495584_0613537 3300046491 Unclassified 555
570 Ga0495585_0532994 3300046492 Bacteria 556
571 Ga0495596_0171603 3300046500 Bacteria 843
572 Ga0495607_0145747 3300046501 Bacteria 1217
573 Ga0495607_0206840 3300046501 Bacteria 968
574 Ga0495583_0121654 3300046506 Bacteria 1098
575 Ga0495583_0169620 3300046506 Bacteria 897
576 Ga0495606_0017354 3300046507 Bacteria 5444
577 Ga0495606_0025094 3300046507 Bacteria 4277
578 Ga0495606_0164446 3300046507 Bacteria 1292
579 Ga0495606_0183177 3300046507 Bacteria 1206
580 Ga0495606_0590549 3300046507 Bacteria 546
581 Ga0495608_0011764 3300046511 Bacteria 6086
582 Ga0495608_0011932 3300046511 Bacteria 6042
583 Ga0495608_0138708 3300046511 Bacteria 1553
584 Ga0495610_0145266 3300046512 Bacteria 1017
585 Ga0495616_0120553 3300046513 Bacteria 1211
586 Ga0495618_0141527 3300046514 Bacteria 1538
587 Ga0495618_0185740 3300046514 Bacteria 1320
588 Ga0495620_0094811 3300046515 Bacteria 1194
589 Ga0495620_0197307 3300046515 Bacteria 775
590 Ga0495628_0049172 3300046516 Bacteria 3339
591 Ga0495628_0327571 3300046516 Bacteria 1129
592 Ga0495628_0343235 3300046516 Bacteria 1099
593 Ga0495628_0484301 3300046516 Bacteria 895
594 Ga0495628_1164407 3300046516 Bacteria 524
595 Ga0495628_1259200 3300046516 Bacteria 500
596 Ga0495630_0877610 3300046517 Bacteria 684
597 Ga0495630_1298315 3300046517 Bacteria 549
598 Ga0495631_0066644 3300046518 Bacteria 1558
599 Ga0495631_0250362 3300046518 Bacteria 755
600 Ga0495631_0456230 3300046518 Bacteria 544
601 Ga0495632_0134187 3300046519 Bacteria 1151
602 Ga0495632_0454932 3300046519 Bacteria 555
603 Ga0495643_0010684 3300046522 Bacteria 5640
604 Ga0495648_0001072 3300046524 Bacteria 27793
605 Ga0495648_0005237 3300046524 Bacteria 10840
606 Ga0495648_0115674 3300046524 Bacteria 1450
607 Ga0495648_0191501 3300046524 Bacteria 1031
608 Ga0495648_0276262 3300046524 Bacteria 798
609 Ga0495666_0191530 3300046526 Bacteria 942
610 Ga0495642_0061562 3300046528 Bacteria 1558
611 Ga0495652_0009450 3300046529 Bacteria 8859
612 Ga0495652_0015406 3300046529 Bacteria 6847
613 Ga0495652_0050712 3300046529 Bacteria 3547
614 Ga0495652_0120797 3300046529 Bacteria 2090
615 Ga0495654_0140247 3300046530 Bacteria 1078
616 Ga0495665_0071942 3300046531 Bacteria 1821
617 Ga0495665_0357932 3300046531 Unclassified 743
618 Ga0495640_0003997 3300046533 Bacteria 11803
619 Ga0495640_0005556 3300046533 Bacteria 10025
620 Ga0495586_0584681 3300046535 Bacteria 645
621 Ga0495587_0010964 3300046536 Bacteria 5748
622 Ga0495587_0035730 3300046536 Bacteria 2992
623 Ga0495609_0254242 3300046538 Bacteria 723
624 Ga0495609_0414856 3300046538 Unclassified 538
625 Ga0495597_0046921 3300046542 Bacteria 1913
626 Ga0495597_0235765 3300046542 Bacteria 723
627 Ga0495645_0025866 3300046543 Bacteria 4261
628 Ga0495645_0183083 3300046543 Bacteria 1433
629 Ga0495622_0008090 3300046557 Bacteria 4875
630 Ga0495622_0008469 3300046557 Bacteria 4761
631 Ga0495667_0011440 3300046559 Bacteria 6004
632 Ga0495667_0013790 3300046559 Bacteria 5459
633 Ga0495667_0433148 3300046559 Bacteria 827
634 Ga0495656_0300291 3300046615 Bacteria 823
635 Ga0495668_0085926 3300046616 Bacteria 1725
636 Ga0495611_0206232 3300046648 Bacteria 916
637 Ga0495611_0221977 3300046648 Bacteria 879
638 Ga0495611_0238612 3300046648 Bacteria 844
639 Ga0495611_0339696 3300046648 Bacteria 690
640 Ga0495611_0523836 3300046648 Bacteria 538
641 Ga0495625_0165431 3300046660 Bacteria 1479
642 Ga0495625_0189269 3300046660 Bacteria 1364
643 Ga0495625_0492023 3300046660 Bacteria 751
644 Ga0495625_0601979 3300046660 Bacteria 660
645 Ga0495635_0001821 3300046663 Bacteria 14407
646 Ga0495635_0006294 3300046663 Bacteria 8269
647 Ga0495635_0090798 3300046663 Bacteria 2089
648 Ga0495635_1101818 3300046663 Bacteria 502
649 Ga0495661_0506652 3300046665 Bacteria 575
650 Ga0495588_0015739 3300046674 Bacteria 3646
651 Ga0495588_0116156 3300046674 Bacteria 1410
652 Ga0495657_0004358 3300046675 Bacteria 11297
653 Ga0495657_0026309 3300046675 Bacteria 4120
654 Ga0495657_0181727 3300046675 Bacteria 1290
655 Ga0495657_0281419 3300046675 Bacteria 995
656 Ga0495657_0688941 3300046675 Bacteria 588
657 Ga0495599_0001858 3300046678 Bacteria 12234
658 Ga0495599_0010912 3300046678 Bacteria 5570
659 Ga0495599_0307421 3300046678 Bacteria 956
660 Ga0495623_0009276 3300046679 Bacteria 6387
661 Ga0495623_0243253 3300046679 Bacteria 1015
662 Ga0495623_0455864 3300046679 Bacteria 680
663 Ga0495623_0671572 3300046679 Bacteria 533
664 Ga0495646_0017290 3300046680 Bacteria 4575
665 Ga0495646_0035715 3300046680 Bacteria 3082
666 Ga0495646_0095015 3300046680 Bacteria 1716
667 Ga0495646_0519400 3300046680 Bacteria 610
668 Ga0495658_0013070 3300046683 Bacteria 4221
669 Ga0495658_0087801 3300046683 Bacteria 1837
670 Ga0495658_0136138 3300046683 Bacteria 1499
671 Ga0495613_0004460 3300046689 Bacteria 10490
672 Ga0495613_0083933 3300046689 Bacteria 2313
673 Ga0495613_0104858 3300046689 Bacteria 2041
674 Ga0495613_0257261 3300046689 Bacteria 1217
675 Ga0495624_0028691 3300046690 Bacteria 3634
676 Ga0495671_0594345 3300046692 Unclassified 526
677 Ga0495671_0644793 3300046692 Bacteria 503
678 Ga0495649_0097731 3300046694 Bacteria 1562
679 Ga0495649_0109588 3300046694 Bacteria 1464
680 Ga0495649_0175401 3300046694 Bacteria 1120
681 Ga0495589_0334375 3300046794 Bacteria 699
682 Ga0495600_0003824 3300046809 Bacteria 8916
683 Ga0495600_0020355 3300046809 Bacteria 4244
684 Ga0495600_0035751 3300046809 Bacteria 3228
685 Ga0495600_0499696 3300046809 Bacteria 747
686 Ga0495600_0701056 3300046809 Bacteria 609
687 Ga0495581_0656050 3300047315 Bacteria 606
688 Ga0495604_0001856 3300047317 Bacteria 17220
689 Ga0495604_0022916 3300047317 Bacteria 4983
690 Ga0495604_0070858 3300047317 Bacteria 2638
691 Ga0495604_0933651 3300047317 Bacteria 540
692 Ga0495674_0027269 3300047319 Bacteria 5221
693 Ga0495674_0030306 3300047319 Bacteria 4920
694 Ga0495674_0881623 3300047319 Bacteria 692
695 Ga0495672_0067260 3300047320 Bacteria 2041
696 Ga0495676_0036000 3300047321 Bacteria 4137
697 Ga0495676_0224485 3300047321 Bacteria 1293
698 Ga0495680_0002074 3300047322 Bacteria 20875
699 Ga0495680_0019650 3300047322 Bacteria 5699
700 Ga0495683_0149960 3300047323 Bacteria 1086
701 Ga0495687_074996 3300047443 Bacteria 1343
702 Ga0495687_110801 3300047443 Bacteria 1009
703 Ga0495687_223998 3300047443 Bacteria 579
704 Ga0495687_250438 3300047443 Bacteria 529
705 Ga0495675_0027706 3300047444 Bacteria 3611
706 Ga0495675_0340354 3300047444 Bacteria 884
707 Ga0495673_0110256 3300047469 Bacteria 1101
708 Ga0495673_0306444 3300047469 Bacteria 568
709 Ga0495684_0004165 3300047471 Bacteria 11295
710 Ga0495684_0131796 3300047471 Bacteria 1877
711 Ga0495684_0464318 3300047471 Bacteria 877
712 Ga0495686_0157413 3300047472 Bacteria 1330
713 Ga0495686_0345474 3300047472 Bacteria 810
714 Ga0495686_0570260 3300047472 Bacteria 589
715 Ga0495593_0005823 3300047673 Bacteria 7267
716 Ga0495593_0471247 3300047673 Bacteria 629
717 Ga0495602_0018537 3300048088 Bacteria 6947
718 Ga0495602_0042386 3300048088 Bacteria 4147
719 Ga0495602_0247479 3300048088 Bacteria 1330
720 Ga0495614_0125961 3300048089 Bacteria 1132
721 Ga0495614_0221077 3300048089 Bacteria 861
722 Ga0495626_0065119 3300048091 Bacteria 1650
723 Ga0496100_0058273 3300048903 Bacteria 2534
724 Ga0496100_0180312 3300048903 Bacteria 1527
725 Ga0496100_0239888 3300048903 Bacteria 1337
726 Ga0496100_1162966 3300048903 Bacteria 608
727 Ga0496100_1330518 3300048903 Bacteria 567
728 Ga0496101_0079676 3300048904 Bacteria 2418
729 Ga0496101_0102982 3300048904 Bacteria 2139
730 Ga0496101_0120475 3300048904 Bacteria 1983
731 Ga0496101_0237673 3300048904 Bacteria 1417
732 Ga0496101_0282949 3300048904 Bacteria 1296
733 Ga0496101_0474281 3300048904 Bacteria 988
734 Ga0496101_0484592 3300048904 Bacteria 977
735 Ga0496101_0595013 3300048904 Bacteria 874
736 Ga0496102_0021589 3300048905 Bacteria 5694
737 Ga0496102_0088796 3300048905 Bacteria 2858
738 Ga0496102_0187318 3300048905 Bacteria 1950
739 Ga0496102_0589020 3300048905 Bacteria 1035
740 Ga0496102_0902588 3300048905 Bacteria 805
741 Ga0496102_1251661 3300048905 Bacteria 661
742 Ga0496103_0024113 3300048906 Bacteria 3669
743 Ga0496103_0248244 3300048906 Bacteria 1145
744 Ga0496103_0341384 3300048906 Unclassified 963
745 Ga0496103_0438431 3300048906 Bacteria 838
746 Ga0496103_0562604 3300048906 Bacteria 727
747 Ga0496104_0022050 3300048907 Bacteria 5853
748 Ga0496104_0043610 3300048907 Bacteria 4212
749 Ga0496104_0049102 3300048907 Bacteria 3979
750 Ga0496104_0097805 3300048907 Bacteria 2809
751 Ga0496104_0099649 3300048907 Bacteria 2781
752 Ga0496105_0006148 3300048908 Bacteria 9202
753 Ga0496105_0034179 3300048908 Bacteria 4180
754 Ga0496105_0166665 3300048908 Bacteria 1807
755 Ga0496105_0222861 3300048908 Bacteria 1535
756 Ga0496105_0326209 3300048908 Bacteria 1229
757 Ga0496105_0869151 3300048908 Bacteria 681
758 Ga0496106_0001884 3300048909 Bacteria 15715
759 Ga0496106_0001995 3300048909 Bacteria 15358
760 Ga0496106_0036279 3300048909 Bacteria 3688
761 Ga0496106_0377985 3300048909 Bacteria 1138
762 Ga0496106_1217831 3300048909 Bacteria 587
763 Ga0496107_0041285 3300048910 Bacteria 3312
764 Ga0496107_0158585 3300048910 Bacteria 1676
765 Ga0496107_0600457 3300048910 Bacteria 813
766 Ga0496107_0758261 3300048910 Bacteria 712
767 Ga0496108_0000438 3300048911 Bacteria 33500
768 Ga0496108_0196538 3300048911 Bacteria 1749
769 Ga0496108_0419020 3300048911 Bacteria 1169
770 Ga0496108_0459384 3300048911 Bacteria 1112
771 Ga0496108_1122401 3300048911 Bacteria 667
772 Ga0496108_1576947 3300048911 Unclassified 544
773 Ga0496108_1715653 3300048911 Bacteria 516
774 Ga0496109_0000284 3300048912 Bacteria 48342
775 Ga0496109_0085155 3300048912 Bacteria 2917
776 Ga0496109_0139679 3300048912 Bacteria 2265
777 Ga0496109_1138977 3300048912 Bacteria 717
778 Ga0496109_1354772 3300048912 Bacteria 647
779 Ga0496109_1682969 3300048912 Bacteria 568
780 Ga0496109_1907366 3300048912 Bacteria 526
781 Ga0496110_0012769 3300048913 Bacteria 6917
782 Ga0496110_0052828 3300048913 Bacteria 3571
783 Ga0496110_0087441 3300048913 Bacteria 2783
784 Ga0496110_0271012 3300048913 Bacteria 1545
785 Ga0496110_0451633 3300048913 Bacteria 1171
786 Ga0496110_1020271 3300048913 Bacteria 735
787 Ga0496111_0015727 3300048914 Bacteria 5202
788 Ga0496111_0099475 3300048914 Bacteria 2136
789 Ga0496111_0128224 3300048914 Bacteria 1876
790 Ga0496111_0249384 3300048914 Bacteria 1318
791 Ga0496111_0678566 3300048914 Bacteria 750
792 Ga0496111_0827342 3300048914 Bacteria 669
793 Ga0496111_0945774 3300048914 Bacteria 619
794 Ga0496111_1162300 3300048914 Bacteria 548
795 Ga0496112_0000585 3300048915 Bacteria 24994
796 Ga0496112_0003685 3300048915 Bacteria 12775
797 Ga0496112_0050901 3300048915 Bacteria 4062
798 Ga0496112_0414428 3300048915 Bacteria 1286
799 Ga0496112_0558429 3300048915 Bacteria 1078
800 Ga0496112_0911758 3300048915 Bacteria 800
801 Ga0496113_0009649 3300048916 Bacteria 6339
802 Ga0496113_0058926 3300048916 Bacteria 2891
803 Ga0496113_0664060 3300048916 Bacteria 833
804 Ga0496113_0680963 3300048916 Bacteria 821
805 Ga0496113_0823847 3300048916 Bacteria 736
806 Ga0496113_1338140 3300048916 Bacteria 556
807 Ga0496114_0090633 3300048917 Bacteria 2596
808 Ga0496114_0189648 3300048917 Bacteria 1798
809 Ga0496114_0264124 3300048917 Bacteria 1516
810 Ga0496115_0026483 3300048918 Bacteria 4526
811 Ga0496115_0055387 3300048918 Bacteria 3185
812 Ga0496115_0300079 3300048918 Bacteria 1316
813 Ga0496115_0368588 3300048918 Bacteria 1169
814 Ga0496115_0781394 3300048918 Bacteria 744
815 Ga0496116_0186575 3300048919 Bacteria 1103
816 Ga0496116_0332685 3300048919 Bacteria 705
817 Ga0496116_0373715 3300048919 Bacteria 642
818 Ga0496117_0046794 3300048920 Bacteria 3109
819 Ga0496117_0057574 3300048920 Bacteria 2698
820 Ga0496117_0085423 3300048920 Bacteria 2054
821 Ga0496117_0193458 3300048920 Bacteria 1156
822 Ga0496117_0599508 3300048920 Bacteria 515
823 Ga0496118_0001280 3300048921 Bacteria 38482
824 Ga0496118_0118275 3300048921 Bacteria 1736
825 Ga0496118_0118420 3300048921 Bacteria 1734
826 Ga0496118_0404076 3300048921 Bacteria 708
827 Ga0496118_0404761 3300048921 Bacteria 707
828 Ga0496119_0026620 3300048922 Bacteria 4004
829 Ga0496119_0056622 3300048922 Bacteria 2375
830 Ga0496119_0125648 3300048922 Bacteria 1404
831 Ga0496119_0146044 3300048922 Bacteria 1272
832 Ga0496119_0158838 3300048922 Bacteria 1204
833 Ga0496119_0577773 3300048922 Bacteria 514
834 Ga0496120_0112819 3300048923 Bacteria 1417
835 Ga0496120_0161348 3300048923 Bacteria 1117
836 Ga0496120_0350627 3300048923 Bacteria 663
837 Ga0496121_0000571 3300048924 Bacteria 69504
838 Ga0496121_0004527 3300048924 Bacteria 18609
839 Ga0496121_0005094 3300048924 Bacteria 17131
840 Ga0496121_0060620 3300048924 Bacteria 3111
841 Ga0496121_0716947 3300048924 Bacteria 599
842 Ga0496122_0193710 3300048925 Bacteria 1197
843 Ga0496124_0000267 3300048927 Bacteria 101138
844 Ga0496124_0319932 3300048927 Bacteria 1111
845 Ga0496124_0458125 3300048927 Bacteria 867
846 Ga0496125_0023578 3300048928 Bacteria 5677
847 Ga0496125_0241321 3300048928 Bacteria 1147
848 Ga0496125_0441948 3300048928 Bacteria 747
849 Ga0496126_0011100 3300048929 Bacteria 9358
850 Ga0496126_0012973 3300048929 Bacteria 8507
851 Ga0496126_0053366 3300048929 Bacteria 3668
852 Ga0496126_0103306 3300048929 Bacteria 2490
853 Ga0496126_0338802 3300048929 Bacteria 1232
854 Ga0496126_0461891 3300048929 Bacteria 1020
855 Ga0495678_189926 3300049459 Bacteria 639
856 Ga0495682_0052951 3300049460 Bacteria 1474
857 Ga0495682_0088552 3300049460 Bacteria 1112
858 Ga0495682_0126463 3300049460 Bacteria 915
859 Ga0495682_0191079 3300049460 Bacteria 727
860 nmdc:mga0yw44_241359_c1 3300050492 Bacteria 1201
861 nmdc:mga04h51_40682_c1 3300050495 Bacteria 1516
862 nmdc:mga07m45_686971_c1 3300050496 Bacteria 589
863 nmdc:mga06r32_370599_c1 3300050510 Bacteria 1415
864 nmdc:mga08y16_164334_c1 3300050511 Bacteria 2306
865 nmdc:mga0n895_4019_c1 3300050512 Bacteria 11968
866 nmdc:mga0rr50_102773_c1 3300050513 Bacteria 2248
867 nmdc:mga0rr50_1671757_c1 3300050513 Unclassified 537
868 nmdc:mga0a205_52955_c1 3300050515 Bacteria 3917
869 nmdc:mga0sz30_199934_c1 3300050516 Bacteria 887
870 Ga0495601_0114538 3300053077 Bacteria 1748
871 Ga0495612_0183774 3300053078 Bacteria 919
872 Ga0495612_0349744 3300053078 Bacteria 667
873 Ga0495612_0595934 3300053078 Bacteria 510
874 Ga0500635_0412688 3300053080 Bacteria 535
875 Ga0495655_0015732 3300053083 Bacteria 1614
876 Ga0495655_0302824 3300053083 Bacteria 550
877 Ga0495595_0301113 3300053084 Bacteria 806
878 Ga0495619_0001862 3300053085 Bacteria 14045
879 Ga0495619_0290710 3300053085 Bacteria 1132
880 Ga0500578_0142963 3300053086 Bacteria 1495
881 Ga0500643_000028 3300053087 Bacteria 245672
882 Ga0500644_0206194 3300053088 Bacteria 815
883 Ga0500646_0047689 3300053090 Bacteria 1226
884 Ga0500647_0026988 3300053091 Bacteria 2712
885 Ga0500647_0410457 3300053091 Bacteria 546
886 Ga0500583_0022151 3300053092 Bacteria 2657
887 Ga0500651_0011770 3300053093 Bacteria 5286
888 Ga0500651_0070300 3300053093 Bacteria 2179
889 Ga0500651_0263750 3300053093 Bacteria 998
890 Ga0500651_0713650 3300053093 Bacteria 535
891 Ga0500566_0010631 3300053094 Bacteria 5421
892 Ga0500566_0391926 3300053094 Bacteria 624
893 Ga0500566_0409747 3300053094 Bacteria 604
894 Ga0500640_114969 3300053095 Bacteria 1088
895 Ga0500648_254773 3300053097 Bacteria 821
896 Ga0500650_0369910 3300053098 Bacteria 624
897 Ga0500650_0405440 3300053098 Bacteria 589
898 Ga0500650_0478442 3300053098 Bacteria 531
899 Ga0500555_002004 3300053103 Bacteria 6008
900 Ga0500556_0051487 3300053104 Bacteria 1492
901 Ga0500556_0423424 3300053104 Bacteria 508
902 Ga0500557_000150 3300053105 Bacteria 16181
903 Ga0500562_036026 3300053108 Bacteria 1311
904 Ga0500569_008126 3300053109 Bacteria 2388
905 Ga0500572_007916 3300053111 Bacteria 2471
906 Ga0500594_0118910 3300053118 Bacteria 828
907 Ga0500595_002912 3300053119 Bacteria 8189
908 Ga0500595_015775 3300053119 Bacteria 2829
909 Ga0500595_021236 3300053119 Bacteria 2321
910 Ga0500595_033233 3300053119 Bacteria 1713
911 Ga0500595_107255 3300053119 Bacteria 796
912 Ga0500595_126936 3300053119 Bacteria 719
913 Ga0500597_125837 3300053120 Bacteria 1109
914 Ga0500597_238649 3300053120 Bacteria 749
915 Ga0500607_030317 3300053121 Bacteria 2982
916 Ga0500608_059072 3300053122 Bacteria 1835
917 Ga0500608_074760 3300053122 Bacteria 1607
918 Ga0500608_191480 3300053122 Bacteria 855
919 Ga0500614_243929 3300053123 Bacteria 559
920 Ga0500618_143448 3300053125 Bacteria 544
921 Ga0500618_147358 3300053125 Bacteria 537
922 Ga0500642_0000319 3300053130 Bacteria 16783
923 Ga0500642_0000744 3300053130 Bacteria 9560
924 Ga0500642_0354373 3300053130 Bacteria 650
925 Ga0500642_0426861 3300053130 Bacteria 573
926 Ga0500655_027656 3300053133 Bacteria 1083
927 Ga0500559_0126507 3300053136 Bacteria 1191
928 Ga0500564_135492 3300053138 Bacteria 1062
929 Ga0500568_0041701 3300053139 Bacteria 1843
930 Ga0500568_0089469 3300053139 Bacteria 1162
931 Ga0500568_0097936 3300053139 Bacteria 1102
932 Ga0500568_0236400 3300053139 Bacteria 666
933 Ga0500573_0084912 3300053140 Bacteria 1795
934 Ga0500577_0487456 3300053142 Bacteria 538
935 Ga0500588_0094221 3300053146 Bacteria 1022
936 Ga0500588_0228384 3300053146 Bacteria 695
937 Ga0500588_0243205 3300053146 Bacteria 674
938 Ga0500589_084436 3300053147 Bacteria 1412
939 Ga0500590_165249 3300053148 Bacteria 980
940 Ga0500590_167171 3300053148 Bacteria 972
941 Ga0500590_216543 3300053148 Bacteria 794
942 Ga0500604_0130312 3300053151 Bacteria 845
943 Ga0500616_0008142 3300053153 Bacteria 6550
944 Ga0500619_184968 3300053154 Bacteria 702
945 Ga0500620_244986 3300053155 Bacteria 598
946 Ga0500622_0028909 3300053156 Bacteria 2917
947 Ga0500622_0057579 3300053156 Bacteria 1988
948 Ga0500624_019238 3300053157 Bacteria 1083
949 Ga0500627_0025901 3300053158 Bacteria 2416
950 Ga0500627_0156366 3300053158 Bacteria 1029
951 Ga0500633_0301954 3300053160 Bacteria 589
952 Ga0500634_0205400 3300053161 Bacteria 861
953 Ga0500639_042674 3300053163 Bacteria 2380
954 Ga0500639_055223 3300053163 Bacteria 2060
955 Ga0500636_0000335 3300053177 Bacteria 26103
956 Ga0500636_0134018 3300053177 Bacteria 1377
957 Ga0500636_0156489 3300053177 Bacteria 1247
958 Ga0500636_0533613 3300053177 Bacteria 511
959 Ga0500636_0541247 3300053177 Bacteria 506
960 Ga0500637_0270137 3300053178 Bacteria 941
961 Ga0500649_175803 3300053722 Bacteria 731
962 Ga0500570_096368 3300053724 Bacteria 1264
963 Ga0500657_163425 3300053728 Bacteria 803
964 Ga0500625_005839 3300053729 Bacteria 5186
965 Ga0500645_042085 3300053730 Bacteria 1348
966 Ga0500645_094392 3300053730 Bacteria 847
967 Ga0500645_132080 3300053730 Bacteria 693
968 Ga0500552_005516 3300053733 Bacteria 1382
969 Ga0500596_019377 3300053735 Bacteria 1022
970 Ga0500599_000638 3300053736 Bacteria 3740
971 Ga0500601_003226 3300053737 Bacteria 1767
972 Ga0500601_043352 3300053737 Bacteria 550
973 Ga0500613_059047 3300053738 Bacteria 615
974 Ga0500661_008314 3300055283 Bacteria 1908
975 Ga0500661_017485 3300055283 Bacteria 1281
976 2509146373 2508501128 Bacteria 8613869
977 Ga0373923_0587823
978 LJQas_1005052
979 JGI24737J22298_10154785
980 JGI24738J21930_10039787
981 JGI25165J46597_1004162
982 Ga0055525_1012404
983 Ga0055543_1046618
984 Ga0065165_1000370
985 Ga0065165_1042886
986 Ga0065712_10158205
987 Ga0065715_10703381
988 Ga0070658_10388586
989 Ga0070658_10499356
990 Ga0070683_101724312
991 Ga0070690_100254481
992 Ga0070690_100573102
993 Ga0070670_100849970
994 Ga0070670_102113444
995 Ga0068869_101603191
996 Ga0068869_101677555
997 Ga0070666_10355521
998 Ga0070680_100022477
999 Ga0070680_100106831
1000 Ga0070680_100388993
1001 Ga0070680_101413457
1002 Ga0070682_100199594
1003 Ga0070682_100503951
1004 Ga0068868_100551958
1005 Ga0068868_100672152
1006 Ga0068868_101189057
1007 Ga0068868_101198812
1008 Ga0068868_102406546
1009 Ga0070660_100012916
1010 Ga0070660_100853127
1011 Ga0070661_100633583
1012 Ga0070661_100823520
1013 Ga0070692_10581513
1014 Ga0070668_101293542
1015 Ga0070669_100718132
1016 Ga0070671_100083780
1017 Ga0070671_100575104
1018 Ga0070671_101631769
1019 Ga0070688_100487581
1020 Ga0070659_100060570
1021 Ga0070659_100372381
1022 Ga0070659_100906759
1023 Ga0070659_101649241
1024 Ga0070667_100407242
1025 Ga0070714_100070500
1026 Ga0070714_100573686
1027 Ga0070713_100002110
1028 Ga0070713_100073819
1029 Ga0070713_101688549
1030 Ga0070710_10003024
1031 Ga0070710_10005145
1032 Ga0070711_100007448
1033 Ga0070711_100065325
1034 Ga0070711_101015093
1035 Ga0070711_101638382
1036 Ga0070705_101164137
1037 Ga0070663_100152426
1038 Ga0070663_100221250
1039 Ga0070663_100232099
1040 Ga0070678_100256779
1041 Ga0070678_100581793
1042 Ga0070662_100815495
1043 Ga0070662_101110959
1044 Ga0070681_10513928
1045 Ga0070681_10721582
1046 Ga0070707_100030468
1047 Ga0070698_100678742
1048 Ga0070699_100870551
1049 Ga0070699_100992317
1050 Ga0070679_100441747
1051 Ga0070679_100571162
1052 Ga0070679_100726725
1053 Ga0070684_100012882
1054 Ga0070684_101203589
1055 Ga0070697_100088553
1056 Ga0070697_100111993
1057 Ga0068853_100006064
1058 Ga0068853_100267430
1059 Ga0068853_100601071
1060 Ga0068853_100638940
1061 Ga0068853_101803423
1062 Ga0070672_100595373
1063 Ga0070686_100207708
1064 Ga0070695_100558851
1065 Ga0070695_101529865
1066 Ga0070693_100038550
1067 Ga0070693_100462484
1068 Ga0070665_100077316
1069 Ga0070665_101862103
1070 Ga0070665_102416959
1071 Ga0068855_100036277
1072 Ga0068855_102256571
1073 Ga0068855_102260236
1074 Ga0068855_102284708
1075 Ga0070664_102336172
1076 Ga0068857_100637013
1077 Ga0068857_101229818
1078 Ga0068857_101732034
1079 Ga0068857_102442697
1080 Ga0068854_100120969
1081 Ga0068854_101695852
1082 Ga0068854_102117469
1083 Ga0068856_100083698
1084 Ga0068856_100127315
1085 Ga0068856_100429315
1086 Ga0068856_100755112
1087 Ga0068856_102407592
1088 Ga0068852_100029813
1089 Ga0068852_100155718
1090 Ga0068852_100270359
1091 Ga0068852_100421421
1092 Ga0068852_100576660
1093 Ga0068852_100589922
1094 Ga0068852_101399237
1095 Ga0068859_100903678
1096 Ga0068859_102794208
1097 Ga0068864_100311213
1098 Ga0068864_100815565
1099 Ga0068864_101018497
1100 Ga0068864_101300939
1101 Ga0068864_102528288
1102 Ga0068861_100732763
1103 Ga0068861_101137799
1104 Ga0068851_10004403
1105 Ga0068851_10285575
1106 Ga0068863_100181929
1107 Ga0068863_100236108
1108 Ga0068863_100361282
1109 Ga0068863_101629367
1110 Ga0068863_102567320
1111 Ga0068858_100216885
1112 Ga0068858_101132216
1113 Ga0068858_101509736
1114 Ga0068860_100000338
1115 Ga0068860_100408819
1116 Ga0068860_101026741
1117 Ga0068860_102511391
1118 Ga0068862_100924922
1119 Ga0081455_10025082
1120 Ga0081540_1020732
1121 Ga0081540_1023231
1122 Ga0081540_1151591
1123 Ga0070717_10121294
1124 Ga0070717_11108321
1125 Ga0075365_10150424
1126 Ga0075368_10054498
1127 Ga0075368_10378092
1128 Ga0075368_10479978
1129 Ga0070715_10011303
1130 Ga0070715_10758333
1131 Ga0070716_100003075
1132 Ga0070716_100011221
1133 Ga0070712_100068092
1134 Ga0070712_101352213
1135 Ga0070712_101558663
1136 Ga0075367_10814542
1137 Ga0075367_10889374
1138 Ga0075369_10058570
1139 Ga0097621_100462465
1140 Ga0097621_100830241
1141 Ga0097621_101196165
1142 Ga0068871_100187620
1143 Ga0068871_100234210
1144 Ga0068871_101043215
1145 Ga0075428_102251810
1146 Ga0075431_100214862
1147 Ga0075433_10037545
1148 Ga0075434_100617789
1149 Ga0068865_100483391
1150 Ga0068865_102080148
1151 Ga0097620_100903714
1152 Ga0097620_102792917
1153 Ga0075435_101805059
1154 Ga0099794_10095572
1155 Ga0099794_10352659
1156 Ga0099794_10418808
1157 Ga0099795_10008545
1158 Ga0099795_10015844
1159 Ga0099795_10031741
1160 Ga0099795_10054155
1161 Ga0099795_10075854
1162 Ga0099795_10189851
1163 Ga0105250_10525641
1164 Ga0105240_10011631
1165 Ga0105240_10119154
1166 Ga0105240_10612995
1167 Ga0111539_10090244
1168 Ga0105245_10537913
1169 Ga0105247_10006789
1170 Ga0105247_10195004
1171 Ga0105247_10244745
1172 Ga0105247_10543707
1173 Ga0105243_10274253
1174 Ga0105243_10393801
1175 Ga0105241_10212606
1176 Ga0105241_10246418
1177 Ga0105241_10410482
1178 Ga0105241_12478115
1179 Ga0105242_10501718
1180 Ga0105242_10614612
1181 Ga0105248_10153524
1182 Ga0105248_10198655
1183 Ga0105248_10270760
1184 Ga0105237_10028867
1185 Ga0105237_10129523
1186 Ga0105237_10185326
1187 Ga0105237_10388578
1188 Ga0105237_10448581
1189 Ga0105237_10582942
1190 Ga0105237_10631722
1191 Ga0105237_11234268
1192 Ga0105237_11406540
1193 Ga0105237_11957120
1194 Ga0105237_12429049
1195 Ga0105238_10004512
1196 Ga0105238_10238393
1197 Ga0105238_11645552
1198 Ga0105249_10715616
1199 Ga0105249_11011686
1200 Ga0105249_13501321
1201 Ga0099796_10204084
1202 Ga0099796_10328335
1203 Ga0099796_10395194
1204 Ga0099796_10410314
1205 Ga0105239_10069619
1206 Ga0105239_10112815
1207 Ga0105239_10181119
1208 Ga0105239_10272260
1209 Ga0105239_10278093
1210 Ga0105239_10774240
1211 Ga0105239_10892140
1212 Ga0105239_10937113
1213 Ga0105239_11735329
1214 Ga0105246_10031768
1215 Ga0105246_10338814
1216 Ga0105246_10613230
1217 Ga0105246_11401159
1218 Ga0157313_1015837
1219 Ga0157370_10138556
1220 Ga0157369_10189265
1221 Ga0157369_10415885
1222 Ga0157374_10109473
1223 Ga0157374_10381201
1224 Ga0157374_11281194
1225 Ga0157378_10181370
1226 Ga0157378_10240913
1227 Ga0157378_11001122
1228 Ga0157378_11593750
1229 Ga0163162_10114506
1230 Ga0163162_10403333
1231 Ga0163162_11925127
1232 Ga0163162_12609560
1233 Ga0163162_12670804
1234 Ga0157372_10131460
1235 Ga0157372_11379364
1236 Ga0157372_12531779
1237 Ga0157375_10282303
1238 Ga0157375_11201538
1239 Ga0157375_11754915
1240 Ga0157375_13511646
1241 Ga0163163_10117278
1242 Ga0163163_10210261
1243 Ga0163163_11531445
1244 Ga0163163_11544591
1245 Ga0163163_11934809
1246 Ga0163163_12508340
1247 Ga0157377_10314028
1248 Ga0157379_10329410
1249 Ga0157379_10556630
1250 Ga0157379_10751606
1251 Ga0157379_11026611
1252 Ga0157379_11153457
1253 Ga0157379_11751966
1254 Ga0157376_10026265
1255 Ga0157376_10514124
1256 Ga0157376_11130366
1257 Ga0157376_11571115
1258 Ga0157376_11786189
1259 Ga0157376_11908035
1260 Ga0182007_10200408
1261 Ga0163161_10273386
1262 Ga0206353_11945494
1263 Ga0209563_100565
1264 Ga0209677_100794
1265 Ga0209233_1008827
1266 Ga0209130_1027206
1267 Ga0209758_1005254
1268 Ga0209758_1008667
1269 Ga0209758_1104867
1270 Ga0207426_1050719
1271 Ga0209257_1130527
1272 Ga0207656_10001723
1273 Ga0207692_10004179
1274 Ga0207692_10099053
1275 Ga0207710_10005915
1276 Ga0207710_10264934
1277 Ga0207710_10335126
1278 Ga0207710_10523832
1279 Ga0207688_10146588
1280 Ga0207680_10130339
1281 Ga0207680_10390480
1282 Ga0207680_10774819
1283 Ga0207647_10112176
1284 Ga0207685_10009623
1285 Ga0207699_10000443
1286 Ga0207699_10123763
1287 Ga0207705_10999870
1288 Ga0207654_10020998
1289 Ga0207654_10534965
1290 Ga0207707_10010412
1291 Ga0207707_10588304
1292 Ga0207707_10771274
1293 Ga0207695_10000059
1294 Ga0207695_10271738
1295 Ga0207695_10515954
1296 Ga0207671_10010861
1297 Ga0207671_10050106
1298 Ga0207671_10165451
1299 Ga0207671_10356181
1300 Ga0207671_10795010
1301 Ga0207671_10828355
1302 Ga0207671_11102496
1303 Ga0207671_11339976
1304 Ga0207693_10005369
1305 Ga0207693_10532392
1306 Ga0207693_10924030
1307 Ga0207663_10000159
1308 Ga0207663_10008306
1309 Ga0207660_10062522
1310 Ga0207660_10087813
1311 Ga0207660_10156052
1312 Ga0207657_10386833
1313 Ga0207657_10723480
1314 Ga0207649_10473613
1315 Ga0207652_10007627
1316 Ga0207681_11563343
1317 Ga0207694_10003079
1318 Ga0207694_10221119
1319 Ga0207694_11158802
1320 Ga0207650_10879388
1321 Ga0207687_11187462
1322 Ga0207700_10020296
1323 Ga0207700_10078655
1324 Ga0207700_10097767
1325 Ga0207664_10006844
1326 Ga0207664_10048445
1327 Ga0207664_10381917
1328 Ga0207644_10161681
1329 Ga0207644_10697723
1330 Ga0207690_10018691
1331 Ga0207690_10764397
1332 Ga0207706_10865678
1333 Ga0207686_10898827
1334 Ga0207709_10901449
1335 Ga0207704_10658807
1336 Ga0207665_10001544
1337 Ga0207665_10351234
1338 Ga0207691_11162346
1339 Ga0207711_10153536
1340 Ga0207711_10487956
1341 Ga0207711_10764331
1342 Ga0207689_10196260
1343 Ga0207689_10815045
1344 Ga0207679_10429628
1345 Ga0207679_10462542
1346 Ga0207667_10017617
1347 Ga0207712_11034372
1348 Ga0207712_11120598
1349 Ga0207668_10128780
1350 Ga0207668_10179991
1351 Ga0207658_10536757
1352 Ga0207658_10648447
1353 Ga0207677_10153115
1354 Ga0207677_11163367
1355 Ga0207703_10428887
1356 Ga0207703_11047739
1357 Ga0207703_11066277
1358 Ga0207639_10002960
1359 Ga0207639_10058811
1360 Ga0207639_10562892
1361 Ga0207639_10747020
1362 Ga0207639_11000217
1363 Ga0207678_10118720
1364 Ga0207678_10266094
1365 Ga0207678_10308359
1366 Ga0207702_10166453
1367 Ga0207702_10553278
1368 Ga0207702_10597236
1369 Ga0207702_10641392
1370 Ga0207641_10114966
1371 Ga0207641_11093053
1372 Ga0207648_10144659
1373 Ga0207648_10334755
1374 Ga0207676_10257714
1375 Ga0207676_11109715
1376 Ga0207676_11681696
1377 Ga0207674_10639890
1378 Ga0207674_10753766
1379 Ga0207675_100180021
1380 Ga0207675_100790960
1381 Ga0207675_101993647
1382 Ga0207683_10132131
1383 Ga0207683_10756772
1384 Ga0207698_10020684
1385 Ga0207698_10733625
1386 Ga0207698_10953073
1387 Ga0207698_11201516
1388 Ga0207698_11829983
1389 Ga0207698_11942224
1390 Ga0209179_1003483
1391 Ga0209179_1047726
1392 Ga0209813_10017710
1393 Ga0207428_10100503
1394 Ga0268266_11422845
1395 Ga0268265_11597985
1396 Ga0268264_10000051
1397 Ga0268264_10376459
1398 Ga0268264_12421685
1399 Ga0265334_10061058
1400 Ga0307517_10219501
1401 Ga0307511_10068005
1402 Ga0265330_10019295
1403 Ga0265330_10057988
1404 Ga0265332_10018917
1405 Ga0265328_10019996
1406 Ga0265328_10299135
1407 Ga0265325_10031254
1408 Ga0265340_10007086
1409 Ga0265339_10451679
1410 Ga0265331_10044539
1411 Ga0265331_10045923
1412 Ga0265331_10222993
1413 Ga0265331_10329848
1414 Ga0265316_10579648
1415 Ga0265316_10597677
1416 Ga0265316_10608495
1417 Ga0307509_10050156
1418 Ga0307509_10104557
1419 Ga0307509_10329994
1420 Ga0307509_10795664
1421 Ga0307509_10883068
1422 Ga0307508_10090477
1423 Ga0307508_10201686
1424 Ga0307508_10821670
1425 Ga0265314_10100428
1426 Ga0265342_10047587
1427 Ga0265342_10084101
1428 Ga0307516_10113627
1429 Ga0307516_10343129
1430 Ga0307516_10482551
1431 Ga0307507_10035688
1432 Ga0307510_10070832
1433 Ga0307510_10153880
1434 Ga0307510_10346328
1435 Ga0373958_0025359
1436 Ga0373938_0115955
1437 Ga0373926_0143317
1438 Ga0373928_0072665
1439 Ga0373928_0077986
1440 Ga0373929_0051221
1441 Ga0373934_0009884
1442 Ga0373940_0267369
1443 Ga0373949_0037641
1444 Ga0373923_0029194
1445 Ga0373932_0026950
1446 Ga0373936_0167631
1447 Ga0373936_0608680
1448 Ga0373941_0023970
1449 Ga0373941_0156602
1450 Ga0373945_0075540
1451 Ga0373945_0560706
1452 Ga0373953_0114672
1453 Ga0373954_0023495
1454 Ga0373956_0003314
1455 Ga0373957_0004032
1456 Ga0373957_0484708
1457 Ga0373960_0176040
1458 Ga0373943_0022410
1459 Ga0373943_0169974
1460 Ga0373943_0369118
1461 Ga0373946_0297386
1462 Ga0373946_0543606
1463 Ga0373955_0002545
1464 Ga0373942_0066210
1465 Ga0373961_0081783
1466 Ga0373961_0390696
1467 Ga0373962_0265568
1468 Ga0373924_0005363
1469 Ga0373931_0003348
1470 Ga0373931_0003381
1471 Ga0373931_0091706
1472 Ga0373935_0066250
1473 Ga0373935_0091991
1474 Ga0373935_0214787
1475 Ga0373935_0895863
1476 Ga0373927_0001975
1477 Ga0373927_0012306
1478 Ga0373927_0033149
1479 Ga0373933_0004241
1480 Ga0373947_0011731
1481 Ga0373947_0311329
1482 Ga0373947_0361666
1483 Ga0373937_0037309
1484 Ga0373925_0045130
1485 Ga0373925_0057487
1486 Ga0373925_0094759
1487 Ga0373925_0991858
1488 Ga0373925_1217463
1489 Ga0373925_1346045
1490 Ga0395898_0264748
1491 Ga0436360_0773285
1492 Ga0436363_1526908
1493 Ga0451789_1275308
1494 Ga0451791_0807056
1495 Ga0451791_1818816
1496 Ga0451793_0560032
1497 Ga0451797_0544067
1498 Ga0451795_1486397
1499 Ga0451795_1697835
1500 Ga0451800_1024483
1501 Ga0451800_1187149
1502 Ga0451802_0663882
1503 Ga0451804_1072820
1504 Ga0451807_0961669
1505 Ga0451807_1572561
1506 Ga0451833_1407648
1507 Ga0451835_1187017
1508 Ga0451837_0193938
1509 Ga0451839_0507174
1510 Ga0451841_1267011
1511 Ga0451849_0002782
1512 Ga0451849_0494380
1513 Ga0451851_0166502
1514 Ga0451853_1365813
1515 Ga0466968_0287594
1516 Ga0495617_191825
1517 Ga0495592_0008547
1518 Ga0495592_0097532
1519 Ga0495592_0646140
1520 Ga0495629_0000905
1521 Ga0495629_0002614
1522 Ga0495629_0601026
1523 Ga0495629_0890183
1524 Ga0495638_0006758
1525 Ga0495638_0277112
1526 Ga0495641_0582456
1527 Ga0495651_0040294
1528 Ga0495651_0178045
1529 Ga0495651_0200110
1530 Ga0495651_0304696
1531 Ga0495653_0006522
1532 Ga0495653_0047464
1533 Ga0495580_0280970
1534 Ga0495580_0863409
1535 Ga0495582_0513581
1536 Ga0495582_0580678
1537 Ga0495639_0069218
1538 Ga0495639_0743898
1539 Ga0495662_0472764
1540 Ga0495664_0037868
1541 Ga0495664_0160497
1542 Ga0495664_0257102
1543 Ga0495584_0011133
1544 Ga0495584_0498864
1545 Ga0495584_0613537
1546 Ga0495585_0532994
1547 Ga0495596_0171603
1548 Ga0495607_0145747
1549 Ga0495607_0206840
1550 Ga0495583_0121654
1551 Ga0495583_0169620
1552 Ga0495606_0017354
1553 Ga0495606_0025094
1554 Ga0495606_0164446
1555 Ga0495606_0183177
1556 Ga0495606_0590549
1557 Ga0495608_0011764
1558 Ga0495608_0011932
1559 Ga0495608_0138708
1560 Ga0495610_0145266
1561 Ga0495616_0120553
1562 Ga0495618_0141527
1563 Ga0495618_0185740
1564 Ga0495620_0094811
1565 Ga0495620_0197307
1566 Ga0495628_0049172
1567 Ga0495628_0327571
1568 Ga0495628_0343235
1569 Ga0495628_0484301
1570 Ga0495628_1164407
1571 Ga0495628_1259200
1572 Ga0495630_0877610
1573 Ga0495630_1298315
1574 Ga0495631_0066644
1575 Ga0495631_0250362
1576 Ga0495631_0456230
1577 Ga0495632_0134187
1578 Ga0495632_0454932
1579 Ga0495643_0010684
1580 Ga0495648_0001072
1581 Ga0495648_0005237
1582 Ga0495648_0115674
1583 Ga0495648_0191501
1584 Ga0495648_0276262
1585 Ga0495666_0191530
1586 Ga0495642_0061562
1587 Ga0495652_0009450
1588 Ga0495652_0015406
1589 Ga0495652_0050712
1590 Ga0495652_0120797
1591 Ga0495654_0140247
1592 Ga0495665_0071942
1593 Ga0495665_0357932
1594 Ga0495640_0003997
1595 Ga0495640_0005556
1596 Ga0495586_0584681
1597 Ga0495587_0010964
1598 Ga0495587_0035730
1599 Ga0495609_0254242
1600 Ga0495609_0414856
1601 Ga0495597_0046921
1602 Ga0495597_0235765
1603 Ga0495645_0025866
1604 Ga0495645_0183083
1605 Ga0495622_0008090
1606 Ga0495622_0008469
1607 Ga0495667_0011440
1608 Ga0495667_0013790
1609 Ga0495667_0433148
1610 Ga0495656_0300291
1611 Ga0495668_0085926
1612 Ga0495611_0206232
1613 Ga0495611_0221977
1614 Ga0495611_0238612
1615 Ga0495611_0339696
1616 Ga0495611_0523836
1617 Ga0495625_0165431
1618 Ga0495625_0189269
1619 Ga0495625_0492023
1620 Ga0495625_0601979
1621 Ga0495635_0001821
1622 Ga0495635_0006294
1623 Ga0495635_0090798
1624 Ga0495635_1101818
1625 Ga0495661_0506652
1626 Ga0495588_0015739
1627 Ga0495588_0116156
1628 Ga0495657_0004358
1629 Ga0495657_0026309
1630 Ga0495657_0181727
1631 Ga0495657_0281419
1632 Ga0495657_0688941
1633 Ga0495599_0001858
1634 Ga0495599_0010912
1635 Ga0495599_0307421
1636 Ga0495623_0009276
1637 Ga0495623_0243253
1638 Ga0495623_0455864
1639 Ga0495623_0671572
1640 Ga0495646_0017290
1641 Ga0495646_0035715
1642 Ga0495646_0095015
1643 Ga0495646_0519400
1644 Ga0495658_0013070
1645 Ga0495658_0087801
1646 Ga0495658_0136138
1647 Ga0495613_0004460
1648 Ga0495613_0083933
1649 Ga0495613_0104858
1650 Ga0495613_0257261
1651 Ga0495624_0028691
1652 Ga0495671_0594345
1653 Ga0495671_0644793
1654 Ga0495649_0097731
1655 Ga0495649_0109588
1656 Ga0495649_0175401
1657 Ga0495589_0334375
1658 Ga0495600_0003824
1659 Ga0495600_0020355
1660 Ga0495600_0035751
1661 Ga0495600_0499696
1662 Ga0495600_0701056
1663 Ga0495581_0656050
1664 Ga0495604_0001856
1665 Ga0495604_0022916
1666 Ga0495604_0070858
1667 Ga0495604_0933651
1668 Ga0495674_0027269
1669 Ga0495674_0030306
1670 Ga0495674_0881623
1671 Ga0495672_0067260
1672 Ga0495676_0036000
1673 Ga0495676_0224485
1674 Ga0495680_0002074
1675 Ga0495680_0019650
1676 Ga0495683_0149960
1677 Ga0495687_074996
1678 Ga0495687_110801
1679 Ga0495687_223998
1680 Ga0495687_250438
1681 Ga0495675_0027706
1682 Ga0495675_0340354
1683 Ga0495673_0110256
1684 Ga0495673_0306444
1685 Ga0495684_0004165
1686 Ga0495684_0131796
1687 Ga0495684_0464318
1688 Ga0495686_0157413
1689 Ga0495686_0345474
1690 Ga0495686_0570260
1691 Ga0495593_0005823
1692 Ga0495593_0471247
1693 Ga0495602_0018537
1694 Ga0495602_0042386
1695 Ga0495602_0247479
1696 Ga0495614_0125961
1697 Ga0495614_0221077
1698 Ga0495626_0065119
1699 Ga0496100_0058273
1700 Ga0496100_0180312
1701 Ga0496100_0239888
1702 Ga0496100_1162966
1703 Ga0496100_1330518
1704 Ga0496101_0079676
1705 Ga0496101_0102982
1706 Ga0496101_0120475
1707 Ga0496101_0237673
1708 Ga0496101_0282949
1709 Ga0496101_0474281
1710 Ga0496101_0484592
1711 Ga0496101_0595013
1712 Ga0496102_0021589
1713 Ga0496102_0088796
1714 Ga0496102_0187318
1715 Ga0496102_0589020
1716 Ga0496102_0902588
1717 Ga0496102_1251661
1718 Ga0496103_0024113
1719 Ga0496103_0248244
1720 Ga0496103_0341384
1721 Ga0496103_0438431
1722 Ga0496103_0562604
1723 Ga0496104_0022050
1724 Ga0496104_0043610
1725 Ga0496104_0049102
1726 Ga0496104_0097805
1727 Ga0496104_0099649
1728 Ga0496105_0006148
1729 Ga0496105_0034179
1730 Ga0496105_0166665
1731 Ga0496105_0222861
1732 Ga0496105_0326209
1733 Ga0496105_0869151
1734 Ga0496106_0001884
1735 Ga0496106_0001995
1736 Ga0496106_0036279
1737 Ga0496106_0377985
1738 Ga0496106_1217831
1739 Ga0496107_0041285
1740 Ga0496107_0158585
1741 Ga0496107_0600457
1742 Ga0496107_0758261
1743 Ga0496108_0000438
1744 Ga0496108_0196538
1745 Ga0496108_0419020
1746 Ga0496108_0459384
1747 Ga0496108_1122401
1748 Ga0496108_1576947
1749 Ga0496108_1715653
1750 Ga0496109_0000284
1751 Ga0496109_0085155
1752 Ga0496109_0139679
1753 Ga0496109_1138977
1754 Ga0496109_1354772
1755 Ga0496109_1682969
1756 Ga0496109_1907366
1757 Ga0496110_0012769
1758 Ga0496110_0052828
1759 Ga0496110_0087441
1760 Ga0496110_0271012
1761 Ga0496110_0451633
1762 Ga0496110_1020271
1763 Ga0496111_0015727
1764 Ga0496111_0099475
1765 Ga0496111_0128224
1766 Ga0496111_0249384
1767 Ga0496111_0678566
1768 Ga0496111_0827342
1769 Ga0496111_0945774
1770 Ga0496111_1162300
1771 Ga0496112_0000585
1772 Ga0496112_0003685
1773 Ga0496112_0050901
1774 Ga0496112_0414428
1775 Ga0496112_0558429
1776 Ga0496112_0911758
1777 Ga0496113_0009649
1778 Ga0496113_0058926
1779 Ga0496113_0664060
1780 Ga0496113_0680963
1781 Ga0496113_0823847
1782 Ga0496113_1338140
1783 Ga0496114_0090633
1784 Ga0496114_0189648
1785 Ga0496114_0264124
1786 Ga0496115_0026483
1787 Ga0496115_0055387
1788 Ga0496115_0300079
1789 Ga0496115_0368588
1790 Ga0496115_0781394
1791 Ga0496116_0186575
1792 Ga0496116_0332685
1793 Ga0496116_0373715
1794 Ga0496117_0046794
1795 Ga0496117_0057574
1796 Ga0496117_0085423
1797 Ga0496117_0193458
1798 Ga0496117_0599508
1799 Ga0496118_0001280
1800 Ga0496118_0118275
1801 Ga0496118_0118420
1802 Ga0496118_0404076
1803 Ga0496118_0404761
1804 Ga0496119_0026620
1805 Ga0496119_0056622
1806 Ga0496119_0125648
1807 Ga0496119_0146044
1808 Ga0496119_0158838
1809 Ga0496119_0577773
1810 Ga0496120_0112819
1811 Ga0496120_0161348
1812 Ga0496120_0350627
1813 Ga0496121_0000571
1814 Ga0496121_0004527
1815 Ga0496121_0005094
1816 Ga0496121_0060620
1817 Ga0496121_0716947
1818 Ga0496122_0193710
1819 Ga0496124_0000267
1820 Ga0496124_0319932
1821 Ga0496124_0458125
1822 Ga0496125_0023578
1823 Ga0496125_0241321
1824 Ga0496125_0441948
1825 Ga0496126_0011100
1826 Ga0496126_0012973
1827 Ga0496126_0053366
1828 Ga0496126_0103306
1829 Ga0496126_0338802
1830 Ga0496126_0461891
1831 Ga0495678_189926
1832 Ga0495682_0052951
1833 Ga0495682_0088552
1834 Ga0495682_0126463
1835 Ga0495682_0191079
1836 nmdc:mga0yw44_241359_c1
1837 nmdc:mga04h51_40682_c1
1838 nmdc:mga07m45_686971_c1
1839 nmdc:mga06r32_370599_c1
1840 nmdc:mga08y16_164334_c1
1841 nmdc:mga0n895_4019_c1
1842 nmdc:mga0rr50_102773_c1
1843 nmdc:mga0rr50_1671757_c1
1844 nmdc:mga0a205_52955_c1
1845 nmdc:mga0sz30_199934_c1
1846 Ga0495601_0114538
1847 Ga0495612_0183774
1848 Ga0495612_0349744
1849 Ga0495612_0595934
1850 Ga0500635_0412688
1851 Ga0495655_0015732
1852 Ga0495655_0302824
1853 Ga0495595_0301113
1854 Ga0495619_0001862
1855 Ga0495619_0290710
1856 Ga0500578_0142963
1857 Ga0500643_000028
1858 Ga0500644_0206194
1859 Ga0500646_0047689
1860 Ga0500647_0026988
1861 Ga0500647_0410457
1862 Ga0500583_0022151
1863 Ga0500651_0011770
1864 Ga0500651_0070300
1865 Ga0500651_0263750
1866 Ga0500651_0713650
1867 Ga0500566_0010631
1868 Ga0500566_0391926
1869 Ga0500566_0409747
1870 Ga0500640_114969
1871 Ga0500648_254773
1872 Ga0500650_0369910
1873 Ga0500650_0405440
1874 Ga0500650_0478442
1875 Ga0500555_002004
1876 Ga0500556_0051487
1877 Ga0500556_0423424
1878 Ga0500557_000150
1879 Ga0500562_036026
1880 Ga0500569_008126
1881 Ga0500572_007916
1882 Ga0500594_0118910
1883 Ga0500595_002912
1884 Ga0500595_015775
1885 Ga0500595_021236
1886 Ga0500595_033233
1887 Ga0500595_107255
1888 Ga0500595_126936
1889 Ga0500597_125837
1890 Ga0500597_238649
1891 Ga0500607_030317
1892 Ga0500608_059072
1893 Ga0500608_074760
1894 Ga0500608_191480
1895 Ga0500614_243929
1896 Ga0500618_143448
1897 Ga0500618_147358
1898 Ga0500642_0000319
1899 Ga0500642_0000744
1900 Ga0500642_0354373
1901 Ga0500642_0426861
1902 Ga0500655_027656
1903 Ga0500559_0126507
1904 Ga0500564_135492
1905 Ga0500568_0041701
1906 Ga0500568_0089469
1907 Ga0500568_0097936
1908 Ga0500568_0236400
1909 Ga0500573_0084912
1910 Ga0500577_0487456
1911 Ga0500588_0094221
1912 Ga0500588_0228384
1913 Ga0500588_0243205
1914 Ga0500589_084436
1915 Ga0500590_165249
1916 Ga0500590_167171
1917 Ga0500590_216543
1918 Ga0500604_0130312
1919 Ga0500616_0008142
1920 Ga0500619_184968
1921 Ga0500620_244986
1922 Ga0500622_0028909
1923 Ga0500622_0057579
1924 Ga0500624_019238
1925 Ga0500627_0025901
1926 Ga0500627_0156366
1927 Ga0500633_0301954
1928 Ga0500634_0205400
1929 Ga0500639_042674
1930 Ga0500639_055223
1931 Ga0500636_0000335
1932 Ga0500636_0134018
1933 Ga0500636_0156489
1934 Ga0500636_0533613
1935 Ga0500636_0541247
1936 Ga0500637_0270137
1937 Ga0500649_175803
1938 Ga0500570_096368
1939 Ga0500657_163425
1940 Ga0500625_005839
1941 Ga0500645_042085
1942 Ga0500645_094392
1943 Ga0500645_132080
1944 Ga0500552_005516
1945 Ga0500596_019377
1946 Ga0500599_000638
1947 Ga0500601_003226
1948 Ga0500601_043352
1949 Ga0500613_059047
1950 Ga0500661_008314
1951 Ga0500661_017485
1952 2509146373

MSA Aligner

Family Sequences

Map