F487153

General Info

Members Datasets Scaffolds Average Seq Length
972 335 972 148

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10099217|Ga0265760_100992172
Length 152
Sequence MTGKESGHVDHAAAQTVPHINPDSLEVAPGTAHENLEGWIPALASVSEIHEALEKAFDYRGDLTITLKSGQKIEGYIFDRKIKGPTLSDCFIRVMPKDEPGKLTIPYSDIAALAFTGRDTAAGKSFAAWVKKYNEKKAAGEKNIGIDAEPLD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
134 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
142 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
208 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
214 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
229 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 4.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.35
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10165024 2162886012 Bacteria 3089
2 MBSR1b_contig_10507888 2162886012 Bacteria 3491
3 LJNas_1004583 3300000546 Bacteria 1530
4 JGI24752J21851_1011902 3300001976 Bacteria 1138
5 JGI24737J22298_10037023 3300001990 Bacteria 1505
6 JGI24034J26672_10005738 3300002239 Bacteria 1783
7 JGI24751J29686_10002022 3300002459 Bacteria 4125
8 rootL2_10312876 3300003322 Bacteria 1089
9 Ga0058863_10030681 3300004799 Unclassified 1067
10 Ga0058863_10127990 3300004799 Bacteria 5287
11 Ga0058861_10074048 3300004800 Bacteria 2493
12 Ga0058862_10062502 3300004803 Unclassified 877
13 Ga0058862_10211683 3300004803 Bacteria 1136
14 Ga0065712_10139591 3300005290 Bacteria 1461
15 Ga0065715_10006051 3300005293 Bacteria 3426
16 Ga0070658_10057744 3300005327 Unclassified 3157
17 Ga0070658_10246788 3300005327 Bacteria 1514
18 Ga0070658_10510840 3300005327 Bacteria 1038
19 Ga0070676_10024794 3300005328 Bacteria 3383
20 Ga0070683_100007816 3300005329 Bacteria 9057
21 Ga0070683_100026554 3300005329 Bacteria 5216
22 Ga0070683_100249383 3300005329 Bacteria 1689
23 Ga0070690_100010254 3300005330 Bacteria 5447
24 Ga0070690_100244677 3300005330 Bacteria 1266
25 Ga0070690_100503445 3300005330 Bacteria 906
26 Ga0070670_100012670 3300005331 Bacteria 7219
27 Ga0070677_10150025 3300005333 Bacteria 1084
28 Ga0068869_100001091 3300005334 Bacteria 15829
29 Ga0068869_100107562 3300005334 Bacteria 2118
30 Ga0070666_10086109 3300005335 Bacteria 2152
31 Ga0070666_10245933 3300005335 Bacteria 1265
32 Ga0070680_100079702 3300005336 Bacteria 2699
33 Ga0070680_100135809 3300005336 Bacteria 2060
34 Ga0070680_100147717 3300005336 Bacteria 1973
35 Ga0070680_100383749 3300005336 Bacteria 1196
36 Ga0070682_100042189 3300005337 Unclassified 2815
37 Ga0070682_100180365 3300005337 Bacteria 1474
38 Ga0070682_100295611 3300005337 Bacteria 1186
39 Ga0070682_100374723 3300005337 Bacteria 1068
40 Ga0068868_100031940 3300005338 Bacteria 4047
41 Ga0068868_100041104 3300005338 Bacteria 3601
42 Ga0068868_100230334 3300005338 Bacteria 1554
43 Ga0068868_100273165 3300005338 Bacteria 1428
44 Ga0070660_100019734 3300005339 Bacteria 4944
45 Ga0070660_100027487 3300005339 Bacteria 4246
46 Ga0070660_100044512 3300005339 Bacteria 3396
47 Ga0070689_100010978 3300005340 Bacteria 6474
48 Ga0070691_10477605 3300005341 Unclassified 716
49 Ga0070687_100003669 3300005343 Bacteria 6003
50 Ga0070661_100005336 3300005344 Bacteria 8865
51 Ga0070661_100017859 3300005344 Bacteria 5036
52 Ga0070661_100308055 3300005344 Bacteria 1234
53 Ga0070692_10021641 3300005345 Bacteria 3130
54 Ga0070692_10590913 3300005345 Bacteria 733
55 Ga0070668_100018162 3300005347 Bacteria 5277
56 Ga0070668_100052416 3300005347 Unclassified 3144
57 Ga0070668_101380798 3300005347 Unclassified 642
58 Ga0070669_100103593 3300005353 Bacteria 2150
59 Ga0070669_100117210 3300005353 Bacteria 2027
60 Ga0070675_100024569 3300005354 Bacteria 4826
61 Ga0070675_100478110 3300005354 Bacteria 1120
62 Ga0070674_100086726 3300005356 Unclassified 2249
63 Ga0070673_100005154 3300005364 Bacteria 8337
64 Ga0070673_101470164 3300005364 Unclassified 642
65 Ga0070688_100020972 3300005365 Unclassified 3809
66 Ga0070688_100060749 3300005365 Unclassified 2387
67 Ga0070659_100001853 3300005366 Bacteria 15198
68 Ga0070659_100410658 3300005366 Unclassified 1144
69 Ga0070667_100134715 3300005367 Bacteria 2159
70 Ga0070667_100144270 3300005367 Unclassified 2087
71 Ga0070667_100162609 3300005367 Bacteria 1967
72 Ga0070667_100230880 3300005367 Bacteria 1650
73 Ga0070709_10093672 3300005434 Bacteria 1986
74 Ga0070709_10195615 3300005434 Bacteria 1429
75 Ga0070709_10215712 3300005434 Bacteria 1366
76 Ga0070709_11037071 3300005434 Unclassified 654
77 Ga0070714_100000111 3300005435 Bacteria 67800
78 Ga0070714_100085248 3300005435 Bacteria 2758
79 Ga0070714_100177857 3300005435 Bacteria 1934
80 Ga0070714_100224150 3300005435 Unclassified 1729
81 Ga0070714_100274857 3300005435 Bacteria 1563
82 Ga0070714_100330524 3300005435 Bacteria 1427
83 Ga0070714_100493730 3300005435 Bacteria 1167
84 Ga0070714_100633530 3300005435 Bacteria 1028
85 Ga0070714_102154378 3300005435 Unclassified 543
86 Ga0070713_100000231 3300005436 Bacteria 37112
87 Ga0070713_100004047 3300005436 Bacteria 9767
88 Ga0070713_100016019 3300005436 Bacteria 5627
89 Ga0070713_100075339 3300005436 Bacteria 2862
90 Ga0070713_100079167 3300005436 Unclassified 2799
91 Ga0070713_100369294 3300005436 Unclassified 1335
92 Ga0070713_100817667 3300005436 Bacteria 894
93 Ga0070713_100964379 3300005436 Unclassified 822
94 Ga0070710_10005065 3300005437 Bacteria 6238
95 Ga0070710_10117119 3300005437 Bacteria 1608
96 Ga0070710_10144587 3300005437 Unclassified 1461
97 Ga0070710_10186885 3300005437 Unclassified 1301
98 Ga0070701_10104756 3300005438 Bacteria 1572
99 Ga0070711_100000519 3300005439 Bacteria 19976
100 Ga0070711_100000929 3300005439 Bacteria 15465
101 Ga0070711_100039221 3300005439 Bacteria 3189
102 Ga0070711_100082975 3300005439 Bacteria 2288
103 Ga0070711_100406463 3300005439 Unclassified 1106
104 Ga0070711_100517078 3300005439 Unclassified 986
105 Ga0070711_100655150 3300005439 Bacteria 881
106 Ga0070711_101338125 3300005439 Bacteria 622
107 Ga0070711_101516647 3300005439 Bacteria 585
108 Ga0070705_100396319 3300005440 Bacteria 1021
109 Ga0070705_100673471 3300005440 Unclassified 809
110 Ga0070705_101424654 3300005440 Unclassified 578
111 Ga0070694_100308754 3300005444 Bacteria 1214
112 Ga0070694_100509637 3300005444 Unclassified 958
113 Ga0070708_100000410 3300005445 Bacteria 32257
114 Ga0070708_100014908 3300005445 Bacteria 6406
115 Ga0070708_100075059 3300005445 Unclassified 3051
116 Ga0070708_100083480 3300005445 Unclassified 2896
117 Ga0070708_100261059 3300005445 Bacteria 1628
118 Ga0070663_100003902 3300005455 Bacteria 8695
119 Ga0070663_100079392 3300005455 Bacteria 2407
120 Ga0070663_100082057 3300005455 Bacteria 2371
121 Ga0070663_100096112 3300005455 Bacteria 2203
122 Ga0070663_100284221 3300005455 Bacteria 1319
123 Ga0070678_101337073 3300005456 Unclassified 668
124 Ga0070662_100030086 3300005457 Bacteria 3795
125 Ga0070662_100169342 3300005457 Bacteria 1714
126 Ga0070662_101096647 3300005457 Bacteria 683
127 Ga0070662_101701482 3300005457 Unclassified 545
128 Ga0070681_10001954 3300005458 Bacteria 18621
129 Ga0070681_10036253 3300005458 Bacteria 4952
130 Ga0070681_10233915 3300005458 Bacteria 1752
131 Ga0070681_10415393 3300005458 Bacteria 1257
132 Ga0070681_10505284 3300005458 Bacteria 1122
133 Ga0070681_10590882 3300005458 Bacteria 1024
134 Ga0070681_10834360 3300005458 Unclassified 839
135 Ga0070681_10994218 3300005458 Unclassified 758
136 Ga0070681_11179639 3300005458 Unclassified 687
137 Ga0068867_100127797 3300005459 Bacteria 1971
138 Ga0068867_100868312 3300005459 Bacteria 809
139 Ga0070685_10000891 3300005466 Bacteria 16066
140 Ga0070706_100001099 3300005467 Bacteria 29242
141 Ga0070706_100003090 3300005467 Bacteria 16493
142 Ga0070706_100059036 3300005467 Bacteria 3540
143 Ga0070706_100574126 3300005467 Bacteria 1048
144 Ga0070706_100830338 3300005467 Bacteria 855
145 Ga0070706_101123520 3300005467 Bacteria 723
146 Ga0070707_100000229 3300005468 Bacteria 56136
147 Ga0070707_100034150 3300005468 Bacteria 4850
148 Ga0070707_100091366 3300005468 Bacteria 2947
149 Ga0070707_100099997 3300005468 Bacteria 2809
150 Ga0070707_100107375 3300005468 Bacteria 2708
151 Ga0070707_100120929 3300005468 Bacteria 2542
152 Ga0070707_100156922 3300005468 Bacteria 2217
153 Ga0070707_100653099 3300005468 Bacteria 1014
154 Ga0070698_100018118 3300005471 Bacteria 7414
155 Ga0070698_100027170 3300005471 Bacteria 5953
156 Ga0070698_100037896 3300005471 Bacteria 4969
157 Ga0070698_100048291 3300005471 Bacteria 4349
158 Ga0070698_100255932 3300005471 Bacteria 1683
159 Ga0070699_100000703 3300005518 Bacteria 30997
160 Ga0070699_100001773 3300005518 Bacteria 19653
161 Ga0070699_100036450 3300005518 Bacteria 4255
162 Ga0070699_100065354 3300005518 Bacteria 3157
163 Ga0070699_100273390 3300005518 Bacteria 1513
164 Ga0070699_100378618 3300005518 Bacteria 1277
165 Ga0070699_100880063 3300005518 Bacteria 820
166 Ga0070679_100026671 3300005530 Bacteria 5681
167 Ga0070679_100030052 3300005530 Bacteria 5362
168 Ga0070679_100065948 3300005530 Bacteria 3609
169 Ga0070679_100120123 3300005530 Bacteria 2613
170 Ga0070679_100208731 3300005530 Bacteria 1917
171 Ga0070679_101123619 3300005530 Unclassified 731
172 Ga0070684_100025735 3300005535 Bacteria 4948
173 Ga0070684_100184514 3300005535 Bacteria 1897
174 Ga0070684_100396792 3300005535 Bacteria 1272
175 Ga0070684_101036296 3300005535 Bacteria 770
176 Ga0070684_101069149 3300005535 Unclassified 758
177 Ga0070697_100000166 3300005536 Bacteria 53539
178 Ga0070697_100000673 3300005536 Bacteria 25688
179 Ga0070697_100001242 3300005536 Bacteria 19280
180 Ga0070697_100003229 3300005536 Bacteria 12506
181 Ga0070697_100009587 3300005536 Bacteria 7562
182 Ga0070697_100575543 3300005536 Unclassified 989
183 Ga0070697_101360534 3300005536 Bacteria 634
184 Ga0068853_100000064 3300005539 Bacteria 75224
185 Ga0068853_100145674 3300005539 Bacteria 2128
186 Ga0068853_100145969 3300005539 Bacteria 2126
187 Ga0070672_100078340 3300005543 Unclassified 2644
188 Ga0070672_100815998 3300005543 Bacteria 821
189 Ga0070686_100051263 3300005544 Unclassified 2626
190 Ga0070686_100101894 3300005544 Bacteria 1941
191 Ga0070686_100210482 3300005544 Bacteria 1399
192 Ga0070686_100772422 3300005544 Unclassified 772
193 Ga0070695_100134470 3300005545 Bacteria 1707
194 Ga0070695_100233972 3300005545 Bacteria 1330
195 Ga0070696_100162259 3300005546 Bacteria 1647
196 Ga0070696_100493033 3300005546 Unclassified 973
197 Ga0070693_100065727 3300005547 Bacteria 2120
198 Ga0070693_100425590 3300005547 Bacteria 926
199 Ga0070665_100045644 3300005548 Bacteria 4400
200 Ga0070665_100177480 3300005548 Bacteria 2131
201 Ga0070704_100438251 3300005549 Bacteria 1122
202 Ga0068855_100085404 3300005563 Unclassified 3651
203 Ga0068855_100363724 3300005563 Bacteria 1592
204 Ga0068855_100643803 3300005563 Bacteria 1139
205 Ga0068855_101158651 3300005563 Unclassified 805
206 Ga0068855_101230969 3300005563 Unclassified 777
207 Ga0068855_101943166 3300005563 Unclassified 595
208 Ga0068855_102334590 3300005563 Bacteria 535
209 Ga0070664_100307705 3300005564 Bacteria 1433
210 Ga0068857_100012748 3300005577 Bacteria 7327
211 Ga0068857_100027770 3300005577 Bacteria 4991
212 Ga0068857_100353009 3300005577 Bacteria 1362
213 Ga0068854_100000073 3300005578 Bacteria 72344
214 Ga0068854_100084144 3300005578 Bacteria 2353
215 Ga0068854_100247345 3300005578 Bacteria 1422
216 Ga0068854_100382191 3300005578 Unclassified 1161
217 Ga0068854_100415931 3300005578 Bacteria 1116
218 Ga0068856_100032606 3300005614 Bacteria 5100
219 Ga0068856_100038619 3300005614 Bacteria 4687
220 Ga0068856_100363545 3300005614 Bacteria 1466
221 Ga0068856_101000832 3300005614 Bacteria 854
222 Ga0070702_100018838 3300005615 Unclassified 3588
223 Ga0068852_100108429 3300005616 Bacteria 2520
224 Ga0068852_100706000 3300005616 Bacteria 1019
225 Ga0068852_101138316 3300005616 Bacteria 801
226 Ga0068859_100061883 3300005617 Bacteria 3772
227 Ga0068859_100197826 3300005617 Bacteria 2094
228 Ga0068859_100377869 3300005617 Bacteria 1512
229 Ga0068866_10069989 3300005718 Bacteria 1850
230 Ga0068866_10073008 3300005718 Unclassified 1819
231 Ga0068866_10212732 3300005718 Bacteria 1162
232 Ga0068861_100028262 3300005719 Unclassified 4092
233 Ga0068861_100054581 3300005719 Bacteria 3045
234 Ga0068861_101536641 3300005719 Unclassified 654
235 Ga0068870_10000880 3300005840 Bacteria 11745
236 Ga0068870_10904922 3300005840 Unclassified 623
237 Ga0068863_100209702 3300005841 Bacteria 1876
238 Ga0068863_100235832 3300005841 Bacteria 1765
239 Ga0068863_100292679 3300005841 Bacteria 1578
240 Ga0068858_100010651 3300005842 Bacteria 8698
241 Ga0068858_100032024 3300005842 Bacteria 4884
242 Ga0068858_100210677 3300005842 Bacteria 1839
243 Ga0068858_100522280 3300005842 Unclassified 1148
244 Ga0068860_100021654 3300005843 Bacteria 6224
245 Ga0068860_100075859 3300005843 Bacteria 3197
246 Ga0068860_100231371 3300005843 Unclassified 1796
247 Ga0068860_100660283 3300005843 Bacteria 1054
248 Ga0068862_100008118 3300005844 Bacteria 8684
249 Ga0068862_100024110 3300005844 Bacteria 5102
250 Ga0068862_100209957 3300005844 Bacteria 1759
251 Ga0068862_101164666 3300005844 Unclassified 768
252 Ga0081540_1156928 3300005983 Bacteria 889
253 Ga0070717_10008860 3300006028 Bacteria 7534
254 Ga0070717_10023401 3300006028 Bacteria 4894
255 Ga0070717_10089905 3300006028 Bacteria 2591
256 Ga0070717_10097818 3300006028 Bacteria 2487
257 Ga0070717_10173615 3300006028 Bacteria 1876
258 Ga0070717_10181039 3300006028 Bacteria 1837
259 Ga0070717_10490030 3300006028 Bacteria 1110
260 Ga0070717_10547684 3300006028 Bacteria 1047
261 Ga0070717_10607901 3300006028 Bacteria 992
262 Ga0070717_10671886 3300006028 Unclassified 941
263 Ga0070717_10697941 3300006028 Bacteria 922
264 Ga0070717_10740594 3300006028 Unclassified 893
265 Ga0070717_11123531 3300006028 Bacteria 716
266 Ga0070715_10013418 3300006163 Bacteria 3009
267 Ga0070715_10135758 3300006163 Unclassified 1189
268 Ga0070715_10142113 3300006163 Bacteria 1167
269 Ga0070715_10189289 3300006163 Unclassified 1038
270 Ga0070716_100019448 3300006173 Bacteria 3550
271 Ga0070716_100036790 3300006173 Bacteria 2700
272 Ga0070716_100074262 3300006173 Bacteria 2008
273 Ga0070716_100134428 3300006173 Bacteria 1568
274 Ga0070716_100153955 3300006173 Unclassified 1482
275 Ga0070716_100227152 3300006173 Bacteria 1258
276 Ga0070716_100259291 3300006173 Unclassified 1189
277 Ga0070716_100259949 3300006173 Unclassified 1187
278 Ga0070716_100400203 3300006173 Bacteria 987
279 Ga0070712_100000120 3300006175 Bacteria 40974
280 Ga0070712_100001238 3300006175 Bacteria 15427
281 Ga0070712_100002759 3300006175 Bacteria 10854
282 Ga0070712_100036247 3300006175 Unclassified 3355
283 Ga0070712_100379410 3300006175 Unclassified 1163
284 Ga0070712_100456828 3300006175 Bacteria 1064
285 Ga0070712_100708235 3300006175 Bacteria 859
286 Ga0097621_100023588 3300006237 Bacteria 4792
287 Ga0097621_100051309 3300006237 Bacteria 3357
288 Ga0097621_100078156 3300006237 Bacteria 2748
289 Ga0097621_100088932 3300006237 Bacteria 2581
290 Ga0097621_100655281 3300006237 Bacteria 964
291 Ga0097621_100904805 3300006237 Unclassified 822
292 Ga0068871_100001112 3300006358 Bacteria 18041
293 Ga0068871_100177023 3300006358 Bacteria 1831
294 Ga0068871_100780774 3300006358 Bacteria 879
295 Ga0068871_100984760 3300006358 Unclassified 785
296 Ga0068871_101387326 3300006358 Unclassified 662
297 Ga0075433_10025151 3300006852 Bacteria 5033
298 Ga0075433_10163964 3300006852 Bacteria 1978
299 Ga0075433_10490906 3300006852 Bacteria 1081
300 Ga0075434_100013738 3300006871 Bacteria 7721
301 Ga0075434_100084208 3300006871 Bacteria 3178
302 Ga0075434_100710685 3300006871 Bacteria 1022
303 Ga0068865_100029249 3300006881 Bacteria 3653
304 Ga0068865_100653927 3300006881 Unclassified 894
305 Ga0075436_100045891 3300006914 Bacteria 3014
306 Ga0075436_100257051 3300006914 Bacteria 1245
307 Ga0097620_100061878 3300006931 Bacteria 3772
308 Ga0097620_100197825 3300006931 Bacteria 2094
309 Ga0097620_100377864 3300006931 Bacteria 1512
310 Ga0075435_100000173 3300007076 Bacteria 37964
311 Ga0075435_101534756 3300007076 Unclassified 584
312 Ga0099794_10035084 3300007265 Bacteria 2366
313 Ga0105251_10256404 3300009011 Bacteria 789
314 Ga0105240_10028577 3300009093 Bacteria 7280
315 Ga0105240_10066209 3300009093 Bacteria 4483
316 Ga0105240_10173504 3300009093 Bacteria 2551
317 Ga0105240_10220098 3300009093 Bacteria 2212
318 Ga0105240_10224354 3300009093 Bacteria 2187
319 Ga0105240_10262295 3300009093 Bacteria 1992
320 Ga0105240_10283714 3300009093 Bacteria 1901
321 Ga0111539_10808465 3300009094 Bacteria 1091
322 Ga0105245_10008119 3300009098 Bacteria 9185
323 Ga0105245_10021602 3300009098 Bacteria 5648
324 Ga0105245_10059022 3300009098 Unclassified 3454
325 Ga0105245_10128920 3300009098 Bacteria 2371
326 Ga0105245_10258397 3300009098 Bacteria 1694
327 Ga0105245_10303548 3300009098 Bacteria 1567
328 Ga0105245_10904532 3300009098 Bacteria 924
329 Ga0105247_10075990 3300009101 Bacteria 2109
330 Ga0105247_10103890 3300009101 Bacteria 1820
331 Ga0105247_10121730 3300009101 Unclassified 1691
332 Ga0114129_10662456 3300009147 Bacteria 1346
333 Ga0105243_10390461 3300009148 Bacteria 1290
334 Ga0105241_10006954 3300009174 Bacteria 8326
335 Ga0105241_10098600 3300009174 Bacteria 2319
336 Ga0105241_10169505 3300009174 Bacteria 1802
337 Ga0105241_10320186 3300009174 Bacteria 1337
338 Ga0105241_10354255 3300009174 Bacteria 1275
339 Ga0105241_10802635 3300009174 Bacteria 867
340 Ga0105241_11708493 3300009174 Bacteria 612
341 Ga0105241_12314488 3300009174 Bacteria 535
342 Ga0105242_10025538 3300009176 Bacteria 4676
343 Ga0105242_10067160 3300009176 Bacteria 2963
344 Ga0105242_10196828 3300009176 Bacteria 1788
345 Ga0105242_12553589 3300009176 Unclassified 559
346 Ga0105248_10056683 3300009177 Bacteria 4396
347 Ga0105248_10151081 3300009177 Bacteria 2620
348 Ga0105248_10166343 3300009177 Bacteria 2486
349 Ga0105248_10940186 3300009177 Bacteria 976
350 Ga0105237_10076830 3300009545 Bacteria 3329
351 Ga0105237_10167400 3300009545 Bacteria 2197
352 Ga0105237_10229794 3300009545 Bacteria 1856
353 Ga0105237_10233508 3300009545 Bacteria 1840
354 Ga0105237_10293118 3300009545 Bacteria 1630
355 Ga0105237_10372210 3300009545 Bacteria 1433
356 Ga0105237_10548272 3300009545 Bacteria 1163
357 Ga0105238_10149171 3300009551 Bacteria 2314
358 Ga0105238_10184851 3300009551 Bacteria 2060
359 Ga0105238_10285001 3300009551 Bacteria 1634
360 Ga0105249_10020124 3300009553 Bacteria 5961
361 Ga0105249_10041458 3300009553 Bacteria 4185
362 Ga0105249_10062042 3300009553 Bacteria 3431
363 Ga0105249_10079956 3300009553 Unclassified 3036
364 Ga0099796_10123497 3300010159 Bacteria 997
365 Ga0105239_10033112 3300010375 Bacteria 5676
366 Ga0105239_10169686 3300010375 Bacteria 2439
367 Ga0105239_10356404 3300010375 Bacteria 1652
368 Ga0105239_10469018 3300010375 Bacteria 1429
369 Ga0105239_11650745 3300010375 Bacteria 741
370 Ga0105246_10017813 3300011119 Bacteria 4517
371 Ga0105246_10195957 3300011119 Bacteria 1567
372 Ga0105246_12010072 3300011119 Unclassified 558
373 Ga0157373_10004365 3300013100 Bacteria 10654
374 Ga0157373_10011522 3300013100 Bacteria 6497
375 Ga0157373_10094317 3300013100 Bacteria 2107
376 Ga0157373_10166246 3300013100 Unclassified 1552
377 Ga0157371_10001874 3300013102 Bacteria 21041
378 Ga0157371_10208260 3300013102 Bacteria 1403
379 Ga0157371_10465920 3300013102 Unclassified 930
380 Ga0157371_10566166 3300013102 Bacteria 843
381 Ga0157370_10028414 3300013104 Bacteria 5501
382 Ga0157370_10060172 3300013104 Bacteria 3607
383 Ga0157370_10118275 3300013104 Bacteria 2475
384 Ga0157370_10221891 3300013104 Bacteria 1751
385 Ga0157369_10043736 3300013105 Bacteria 4881
386 Ga0157369_10046631 3300013105 Bacteria 4709
387 Ga0157369_10124073 3300013105 Bacteria 2739
388 Ga0157369_10125246 3300013105 Bacteria 2725
389 Ga0157369_10132681 3300013105 Bacteria 2638
390 Ga0157369_10146034 3300013105 Bacteria 2501
391 Ga0157369_10235144 3300013105 Unclassified 1915
392 Ga0157369_10473017 3300013105 Bacteria 1297
393 Ga0157369_10594901 3300013105 Bacteria 1142
394 Ga0157374_10019511 3300013296 Bacteria 6001
395 Ga0157374_10022249 3300013296 Bacteria 5654
396 Ga0157374_10033622 3300013296 Bacteria 4680
397 Ga0157374_10064959 3300013296 Bacteria 3426
398 Ga0157374_10443072 3300013296 Bacteria 1299
399 Ga0157374_10720541 3300013296 Bacteria 1011
400 Ga0157374_10759293 3300013296 Bacteria 985
401 Ga0157374_11150755 3300013296 Unclassified 797
402 Ga0157374_11601229 3300013296 Unclassified 675
403 Ga0157378_10000080 3300013297 Bacteria 88903
404 Ga0157378_10111486 3300013297 Bacteria 2509
405 Ga0157378_10361976 3300013297 Bacteria 1420
406 Ga0157378_10443252 3300013297 Unclassified 1287
407 Ga0157378_11263202 3300013297 Bacteria 779
408 Ga0157378_12277191 3300013297 Bacteria 593
409 Ga0163162_10002825 3300013306 Bacteria 16516
410 Ga0163162_10008701 3300013306 Bacteria 9880
411 Ga0163162_10081086 3300013306 Unclassified 3314
412 Ga0163162_13259215 3300013306 Unclassified 520
413 Ga0157372_10007870 3300013307 Bacteria 11329
414 Ga0157372_10056045 3300013307 Bacteria 4404
415 Ga0157372_10066678 3300013307 Bacteria 4044
416 Ga0157372_10075172 3300013307 Bacteria 3811
417 Ga0157372_10102361 3300013307 Bacteria 3272
418 Ga0157372_10168758 3300013307 Bacteria 2531
419 Ga0157372_10270722 3300013307 Bacteria 1973
420 Ga0157372_10291043 3300013307 Bacteria 1899
421 Ga0157372_10776359 3300013307 Bacteria 1114
422 Ga0157375_10048295 3300013308 Bacteria 4162
423 Ga0157375_10281354 3300013308 Bacteria 1826
424 Ga0157375_10489877 3300013308 Bacteria 1394
425 Ga0157375_10516078 3300013308 Bacteria 1358
426 Ga0157375_10908356 3300013308 Bacteria 1024
427 Ga0163163_10007748 3300014325 Bacteria 9491
428 Ga0163163_10099513 3300014325 Bacteria 2929
429 Ga0163163_10150928 3300014325 Bacteria 2367
430 Ga0163163_10275599 3300014325 Bacteria 1733
431 Ga0157380_10201360 3300014326 Bacteria 1767
432 Ga0182008_10018152 3300014497 Bacteria 3644
433 Ga0157377_10003870 3300014745 Bacteria 6818
434 Ga0157377_10086320 3300014745 Bacteria 1844
435 Ga0157377_10390755 3300014745 Bacteria 945
436 Ga0157377_10814391 3300014745 Bacteria 690
437 Ga0157379_10009000 3300014968 Bacteria 8702
438 Ga0157379_10100665 3300014968 Bacteria 2594
439 Ga0157379_10145073 3300014968 Unclassified 2140
440 Ga0157379_10160330 3300014968 Unclassified 2030
441 Ga0157379_10409558 3300014968 Bacteria 1247
442 Ga0157376_10005415 3300014969 Bacteria 8926
443 Ga0157376_10051361 3300014969 Bacteria 3424
444 Ga0157376_10189494 3300014969 Unclassified 1885
445 Ga0157376_10312876 3300014969 Bacteria 1490
446 Ga0157376_10523718 3300014969 Bacteria 1169
447 Ga0157376_10975534 3300014969 Bacteria 869
448 Ga0157376_11194216 3300014969 Bacteria 789
449 Ga0182007_10025964 3300015262 Bacteria 2035
450 Ga0163161_10033798 3300017792 Unclassified 3655
451 Ga0197907_10558217 3300020069 Bacteria 917
452 Ga0197907_11041484 3300020069 Bacteria 1243
453 Ga0206356_11447340 3300020070 Bacteria 1364
454 Ga0206356_11591461 3300020070 Bacteria 750
455 Ga0206349_1169383 3300020075 Bacteria 1322
456 Ga0206349_1838695 3300020075 Bacteria 841
457 Ga0206355_1093249 3300020076 Bacteria 2057
458 Ga0206351_10454637 3300020077 Bacteria 1231
459 Ga0206351_10924681 3300020077 Bacteria 971
460 Ga0206352_10096670 3300020078 Bacteria 756
461 Ga0206352_10855043 3300020078 Bacteria 1979
462 Ga0206352_11260177 3300020078 Bacteria 949
463 Ga0206350_10127627 3300020080 Bacteria 1799
464 Ga0206350_10163719 3300020080 Bacteria 4592
465 Ga0206350_10834542 3300020080 Unclassified 733
466 Ga0206350_11365607 3300020080 Bacteria 1116
467 Ga0206354_10640681 3300020081 Unclassified 1424
468 Ga0206353_10792725 3300020082 Bacteria 895
469 Ga0154015_1103445 3300020610 Bacteria 5206
470 Ga0224712_10000977 3300022467 Bacteria 6217
471 Ga0224712_10010981 3300022467 Bacteria 2790
472 Ga0224712_10034546 3300022467 Bacteria 1860
473 Ga0224712_10035179 3300022467 Bacteria 1847
474 Ga0224712_10109093 3300022467 Bacteria 1185
475 Ga0224572_1001294 3300024225 Bacteria 3617
476 Ga0224572_1007760 3300024225 Unclassified 1973
477 Ga0224572_1055539 3300024225 Unclassified 735
478 Ga0228598_1001027 3300024227 Bacteria 6134
479 Ga0228598_1003872 3300024227 Bacteria 3192
480 Ga0228598_1051058 3300024227 Bacteria 820
481 Ga0207697_10024533 3300025315 Bacteria 2468
482 Ga0207682_10045324 3300025893 Bacteria 1805
483 Ga0207692_10054102 3300025898 Bacteria 2047
484 Ga0207692_10058514 3300025898 Bacteria 1986
485 Ga0207692_10135886 3300025898 Unclassified 1394
486 Ga0207642_10186015 3300025899 Bacteria 1136
487 Ga0207642_10996495 3300025899 Bacteria 539
488 Ga0207710_10066155 3300025900 Bacteria 1649
489 Ga0207688_10065973 3300025901 Unclassified 2046
490 Ga0207680_10173866 3300025903 Bacteria 1452
491 Ga0207647_10003789 3300025904 Bacteria 11305
492 Ga0207647_10007432 3300025904 Bacteria 7916
493 Ga0207647_10027290 3300025904 Unclassified 3723
494 Ga0207647_10157480 3300025904 Bacteria 1326
495 Ga0207685_10005205 3300025905 Bacteria 3407
496 Ga0207685_10017481 3300025905 Bacteria 2320
497 Ga0207685_10110844 3300025905 Unclassified 1189
498 Ga0207699_10125381 3300025906 Bacteria 1667
499 Ga0207699_10384781 3300025906 Unclassified 996
500 Ga0207699_10478003 3300025906 Bacteria 897
501 Ga0207699_10645037 3300025906 Bacteria 773
502 Ga0207699_10971116 3300025906 Bacteria 628
503 Ga0207645_10000338 3300025907 Bacteria 39162
504 Ga0207645_10013932 3300025907 Bacteria 5392
505 Ga0207643_10000614 3300025908 Bacteria 22493
506 Ga0207643_10017869 3300025908 Bacteria 3883
507 Ga0207705_10001035 3300025909 Bacteria 22631
508 Ga0207705_10017201 3300025909 Bacteria 5178
509 Ga0207705_10679055 3300025909 Bacteria 801
510 Ga0207684_10012987 3300025910 Bacteria 7211
511 Ga0207684_10014429 3300025910 Bacteria 6811
512 Ga0207684_10014612 3300025910 Bacteria 6765
513 Ga0207684_10135410 3300025910 Bacteria 2115
514 Ga0207684_10772045 3300025910 Unclassified 814
515 Ga0207684_10774697 3300025910 Bacteria 812
516 Ga0207684_10875784 3300025910 Bacteria 756
517 Ga0207684_11108364 3300025910 Bacteria 658
518 Ga0207654_10003614 3300025911 Bacteria 7801
519 Ga0207654_10041563 3300025911 Bacteria 2596
520 Ga0207654_10112878 3300025911 Bacteria 1694
521 Ga0207654_10835798 3300025911 Unclassified 666
522 Ga0207707_10000757 3300025912 Bacteria 31814
523 Ga0207707_10336979 3300025912 Bacteria 1301
524 Ga0207707_10667432 3300025912 Bacteria 875
525 Ga0207707_10854928 3300025912 Unclassified 755
526 Ga0207707_11132574 3300025912 Bacteria 636
527 Ga0207695_10033293 3300025913 Bacteria 5623
528 Ga0207695_10178746 3300025913 Bacteria 2044
529 Ga0207695_10206483 3300025913 Bacteria 1877
530 Ga0207695_10238796 3300025913 Bacteria 1719
531 Ga0207695_10455281 3300025913 Bacteria 1163
532 Ga0207671_10049110 3300025914 Bacteria 3123
533 Ga0207671_10177968 3300025914 Bacteria 1654
534 Ga0207671_10803895 3300025914 Unclassified 746
535 Ga0207693_10000005 3300025915 Bacteria 186314
536 Ga0207693_10000091 3300025915 Bacteria 80207
537 Ga0207693_10000823 3300025915 Bacteria 27648
538 Ga0207693_10011174 3300025915 Bacteria 7269
539 Ga0207693_10035451 3300025915 Unclassified 3933
540 Ga0207693_10268678 3300025915 Unclassified 1336
541 Ga0207663_10002535 3300025916 Bacteria 8787
542 Ga0207663_10020722 3300025916 Bacteria 3728
543 Ga0207663_10033645 3300025916 Bacteria 3056
544 Ga0207663_10151298 3300025916 Bacteria 1628
545 Ga0207663_10287327 3300025916 Bacteria 1224
546 Ga0207663_10333218 3300025916 Unclassified 1144
547 Ga0207660_10052485 3300025917 Bacteria 2903
548 Ga0207660_10309865 3300025917 Bacteria 1259
549 Ga0207660_10659111 3300025917 Bacteria 853
550 Ga0207660_11303255 3300025917 Bacteria 590
551 Ga0207662_10031871 3300025918 Bacteria 3064
552 Ga0207657_10006741 3300025919 Bacteria 11860
553 Ga0207657_10009792 3300025919 Bacteria 9608
554 Ga0207657_10081330 3300025919 Bacteria 2721
555 Ga0207649_10009112 3300025920 Bacteria 5427
556 Ga0207649_10091507 3300025920 Bacteria 1992
557 Ga0207652_10030679 3300025921 Bacteria 4504
558 Ga0207652_10078926 3300025921 Bacteria 2875
559 Ga0207652_10137311 3300025921 Bacteria 2184
560 Ga0207652_10165089 3300025921 Bacteria 1985
561 Ga0207652_10212674 3300025921 Bacteria 1741
562 Ga0207652_10214213 3300025921 Bacteria 1735
563 Ga0207652_10344821 3300025921 Bacteria 1345
564 Ga0207646_10010241 3300025922 Bacteria 9179
565 Ga0207646_10029495 3300025922 Bacteria 4984
566 Ga0207646_10155520 3300025922 Bacteria 2062
567 Ga0207646_10328755 3300025922 Bacteria 1381
568 Ga0207646_11044664 3300025922 Unclassified 721
569 Ga0207681_10095819 3300025923 Bacteria 2129
570 Ga0207694_10025905 3300025924 Bacteria 4458
571 Ga0207694_10136780 3300025924 Bacteria 1968
572 Ga0207694_10694243 3300025924 Bacteria 858
573 Ga0207650_10000380 3300025925 Bacteria 41633
574 Ga0207650_10911037 3300025925 Bacteria 747
575 Ga0207687_10017987 3300025927 Bacteria 4663
576 Ga0207687_10061324 3300025927 Bacteria 2656
577 Ga0207687_11174707 3300025927 Bacteria 659
578 Ga0207700_10001542 3300025928 Bacteria 13052
579 Ga0207700_10001979 3300025928 Bacteria 11667
580 Ga0207700_10005278 3300025928 Bacteria 7706
581 Ga0207700_10074775 3300025928 Bacteria 2622
582 Ga0207700_10078293 3300025928 Bacteria 2571
583 Ga0207700_10098368 3300025928 Bacteria 2327
584 Ga0207700_10397117 3300025928 Unclassified 1208
585 Ga0207700_10482314 3300025928 Unclassified 1096
586 Ga0207700_10525267 3300025928 Bacteria 1049
587 Ga0207700_10787280 3300025928 Bacteria 850
588 Ga0207664_10000127 3300025929 Bacteria 66344
589 Ga0207664_10029379 3300025929 Bacteria 4186
590 Ga0207664_10069940 3300025929 Bacteria 2823
591 Ga0207664_10106048 3300025929 Bacteria 2330
592 Ga0207664_10125480 3300025929 Bacteria 2154
593 Ga0207664_10129037 3300025929 Bacteria 2126
594 Ga0207664_10195134 3300025929 Unclassified 1745
595 Ga0207664_10599754 3300025929 Bacteria 989
596 Ga0207664_11736818 3300025929 Unclassified 546
597 Ga0207644_10042612 3300025931 Bacteria 3217
598 Ga0207644_10839162 3300025931 Bacteria 769
599 Ga0207690_10049747 3300025932 Unclassified 2795
600 Ga0207690_10072707 3300025932 Bacteria 2375
601 Ga0207690_10477091 3300025932 Bacteria 1006
602 Ga0207706_10019832 3300025933 Bacteria 6044
603 Ga0207706_10029071 3300025933 Bacteria 4935
604 Ga0207706_11214510 3300025933 Unclassified 626
605 Ga0207706_11717576 3300025933 Unclassified 505
606 Ga0207686_10146561 3300025934 Bacteria 1638
607 Ga0207686_11159781 3300025934 Unclassified 631
608 Ga0207669_10041135 3300025937 Bacteria 2688
609 Ga0207669_10337827 3300025937 Bacteria 1159
610 Ga0207704_10307910 3300025938 Bacteria 1216
611 Ga0207704_10597121 3300025938 Unclassified 903
612 Ga0207665_10000034 3300025939 Bacteria 88735
613 Ga0207665_10008083 3300025939 Bacteria 6943
614 Ga0207665_10017320 3300025939 Bacteria 4734
615 Ga0207665_10019102 3300025939 Unclassified 4503
616 Ga0207665_10040271 3300025939 Bacteria 3117
617 Ga0207665_10098805 3300025939 Bacteria 2034
618 Ga0207665_10115258 3300025939 Bacteria 1893
619 Ga0207665_10265692 3300025939 Unclassified 1272
620 Ga0207665_10415139 3300025939 Unclassified 1027
621 Ga0207665_10527390 3300025939 Bacteria 915
622 Ga0207691_10011784 3300025940 Bacteria 8391
623 Ga0207691_10670928 3300025940 Bacteria 875
624 Ga0207711_10006633 3300025941 Bacteria 9752
625 Ga0207711_10663543 3300025941 Bacteria 973
626 Ga0207711_11360936 3300025941 Unclassified 652
627 Ga0207689_10000505 3300025942 Bacteria 36866
628 Ga0207689_10001408 3300025942 Bacteria 22963
629 Ga0207689_10080741 3300025942 Bacteria 2673
630 Ga0207689_10116883 3300025942 Bacteria 2193
631 Ga0207661_10000101 3300025944 Bacteria 54454
632 Ga0207661_10057309 3300025944 Bacteria 3132
633 Ga0207661_10170335 3300025944 Bacteria 1895
634 Ga0207679_10000079 3300025945 Bacteria 85462
635 Ga0207679_10198193 3300025945 Bacteria 1675
636 Ga0207667_10051169 3300025949 Bacteria 4356
637 Ga0207667_10157463 3300025949 Bacteria 2337
638 Ga0207667_10163278 3300025949 Bacteria 2290
639 Ga0207667_10276567 3300025949 Bacteria 1716
640 Ga0207667_10381196 3300025949 Bacteria 1437
641 Ga0207667_10383368 3300025949 Bacteria 1432
642 Ga0207667_11677261 3300025949 Unclassified 603
643 Ga0207667_12005103 3300025949 Bacteria 539
644 Ga0207651_10053780 3300025960 Unclassified 2754
645 Ga0207712_10020472 3300025961 Bacteria 4332
646 Ga0207712_10166549 3300025961 Bacteria 1718
647 Ga0207712_10226480 3300025961 Bacteria 1498
648 Ga0207668_10004801 3300025972 Bacteria 7957
649 Ga0207640_10000033 3300025981 Bacteria 115787
650 Ga0207640_10010538 3300025981 Bacteria 5212
651 Ga0207640_10039077 3300025981 Bacteria 3000
652 Ga0207658_10154867 3300025986 Unclassified 1872
653 Ga0207658_10273759 3300025986 Bacteria 1444
654 Ga0207658_10287059 3300025986 Bacteria 1413
655 Ga0207658_10431553 3300025986 Bacteria 1164
656 Ga0207677_10035469 3300026023 Bacteria 3240
657 Ga0207677_10163975 3300026023 Bacteria 1730
658 Ga0207677_10680036 3300026023 Bacteria 911
659 Ga0207703_10018871 3300026035 Bacteria 5387
660 Ga0207703_10146584 3300026035 Bacteria 2054
661 Ga0207703_10487848 3300026035 Unclassified 1155
662 Ga0207703_10536283 3300026035 Bacteria 1102
663 Ga0207639_10000096 3300026041 Bacteria 74667
664 Ga0207639_10155689 3300026041 Bacteria 1919
665 Ga0207639_10403913 3300026041 Bacteria 1231
666 Ga0207639_10872157 3300026041 Bacteria 841
667 Ga0207678_10005015 3300026067 Bacteria 11878
668 Ga0207678_10015807 3300026067 Bacteria 6635
669 Ga0207678_10022300 3300026067 Bacteria 5548
670 Ga0207678_10054801 3300026067 Bacteria 3434
671 Ga0207678_10311055 3300026067 Bacteria 1354
672 Ga0207678_10475933 3300026067 Unclassified 1087
673 Ga0207708_10025151 3300026075 Bacteria 4502
674 Ga0207702_10280044 3300026078 Unclassified 1576
675 Ga0207702_10841186 3300026078 Bacteria 908
676 Ga0207702_10923848 3300026078 Bacteria 865
677 Ga0207641_10000009 3300026088 Bacteria 407901
678 Ga0207641_10150546 3300026088 Bacteria 2107
679 Ga0207641_10191597 3300026088 Bacteria 1879
680 Ga0207641_10395819 3300026088 Bacteria 1325
681 Ga0207648_10000496 3300026089 Bacteria 43876
682 Ga0207648_10473455 3300026089 Unclassified 1143
683 Ga0207676_10000144 3300026095 Bacteria 61909
684 Ga0207676_10500786 3300026095 Bacteria 1153
685 Ga0207674_10000988 3300026116 Bacteria 37108
686 Ga0207674_10001160 3300026116 Bacteria 34178
687 Ga0207674_10003484 3300026116 Bacteria 19219
688 Ga0207674_10127554 3300026116 Bacteria 2509
689 Ga0207675_100058175 3300026118 Unclassified 3608
690 Ga0207675_100089137 3300026118 Unclassified 2898
691 Ga0207675_100896726 3300026118 Unclassified 903
692 Ga0207683_10000869 3300026121 Bacteria 27689
693 Ga0207683_11286370 3300026121 Unclassified 677
694 Ga0207698_10022579 3300026142 Unclassified 4376
695 Ga0207698_11519730 3300026142 Bacteria 685
696 Ga0209588_1007852 3300027671 Bacteria 3153
697 Ga0209588_1040264 3300027671 Bacteria 1508
698 Ga0209588_1041388 3300027671 Bacteria 1487
699 Ga0209588_1106600 3300027671 Unclassified 901
700 Ga0265356_1000574 3300028017 Bacteria 6492
701 Ga0265357_1017819 3300028023 Unclassified 763
702 Ga0268266_10002830 3300028379 Bacteria 18089
703 Ga0268266_10276075 3300028379 Bacteria 1561
704 Ga0268265_10006045 3300028380 Bacteria 8228
705 Ga0268265_10595893 3300028380 Bacteria 1055
706 Ga0268265_11155559 3300028380 Unclassified 770
707 Ga0268264_10010221 3300028381 Bacteria 7766
708 Ga0268264_10178743 3300028381 Unclassified 1925
709 Ga0268264_10181424 3300028381 Bacteria 1912
710 Ga0268264_10235687 3300028381 Bacteria 1692
711 Ga0268264_10619536 3300028381 Bacteria 1068
712 Ga0265338_10005942 3300028800 Bacteria 15723
713 Ga0265338_10006826 3300028800 Bacteria 14382
714 Ga0265338_10052040 3300028800 Bacteria 3680
715 Ga0265338_10060152 3300028800 Bacteria 3340
716 Ga0265338_10126326 3300028800 Bacteria 2028
717 Ga0265338_10273852 3300028800 Bacteria 1236
718 Ga0265338_10363324 3300028800 Bacteria 1038
719 Ga0265324_10098197 3300029957 Unclassified 996
720 Ga0265762_1002021 3300030760 Bacteria 3697
721 Ga0265762_1002584 3300030760 Bacteria 3258
722 Ga0265762_1003378 3300030760 Unclassified 2858
723 Ga0265763_1014574 3300030763 Unclassified 772
724 Ga0265770_1055588 3300030878 Unclassified 726
725 Ga0265765_1033754 3300030879 Bacteria 661
726 Ga0265760_10002195 3300031090 Bacteria 5704
727 Ga0265760_10006343 3300031090 Unclassified 3385
728 Ga0265760_10006840 3300031090 Bacteria 3267
729 Ga0265760_10016170 3300031090 Bacteria 2140
730 Ga0265760_10018812 3300031090 Bacteria 1990
731 Ga0265760_10099217 3300031090 Unclassified 919
732 Ga0265760_10125716 3300031090 Unclassified 826
733 Ga0265328_10125846 3300031239 Bacteria 957
734 Ga0265325_10014367 3300031241 Bacteria 4477
735 Ga0265325_10113938 3300031241 Bacteria 1311
736 Ga0265325_10177103 3300031241 Unclassified 995
737 Ga0265340_10153941 3300031247 Bacteria 1047
738 Ga0265340_10201851 3300031247 Unclassified 894
739 Ga0265339_10006223 3300031249 Bacteria 7857
740 Ga0265339_10018542 3300031249 Bacteria 4100
741 Ga0265339_10030341 3300031249 Bacteria 3062
742 Ga0265339_10031897 3300031249 Bacteria 2974
743 Ga0265339_10212712 3300031249 Bacteria 949
744 Ga0265339_10476288 3300031249 Bacteria 578
745 Ga0265331_10082750 3300031250 Bacteria 1489
746 Ga0265316_10021501 3300031344 Bacteria 5463
747 Ga0265316_10069772 3300031344 Unclassified 2712
748 Ga0265316_10174395 3300031344 Bacteria 1603
749 Ga0265316_10209915 3300031344 Unclassified 1441
750 Ga0265313_10243814 3300031595 Unclassified 735
751 Ga0265314_10038422 3300031711 Bacteria 3458
752 Ga0265314_10212192 3300031711 Bacteria 1136
753 Ga0265314_10220850 3300031711 Bacteria 1106
754 Ga0265342_10096806 3300031712 Bacteria 1686
755 Ga0265342_10425544 3300031712 Unclassified 683
756 Ga0265342_10450424 3300031712 Unclassified 660
757 Ga0316214_1001111 3300033545 Bacteria 3027
758 Ga0316212_1000944 3300033547 Bacteria 3785
759 Ga0316212_1025202 3300033547 Unclassified 834
760 Ga0373926_0278338 3300035083 Bacteria 651
761 Ga0373928_0025709 3300035084 Bacteria 1271
762 Ga0373934_0000868 3300035086 Bacteria 10936
763 Ga0373934_0052108 3300035086 Bacteria 1622
764 Ga0373944_0035682 3300035089 Bacteria 1516
765 Ga0373951_0069515 3300035091 Bacteria 895
766 Ga0373923_0035547 3300035111 Bacteria 2029
767 Ga0373923_0145710 3300035111 Bacteria 1072
768 Ga0373936_0018437 3300035113 Bacteria 2696
769 Ga0373945_0066118 3300035116 Unclassified 1359
770 Ga0373945_0086323 3300035116 Bacteria 1209
771 Ga0373953_0010330 3300035117 Bacteria 3245
772 Ga0373953_0087982 3300035117 Bacteria 1297
773 Ga0373954_0000181 3300035118 Bacteria 22823
774 Ga0373954_0051805 3300035118 Bacteria 1928
775 Ga0373956_0003585 3300035119 Bacteria 6261
776 Ga0373956_0033719 3300035119 Bacteria 2252
777 Ga0373956_0422144 3300035119 Bacteria 636
778 Ga0373943_0002219 3300035170 Bacteria 8835
779 Ga0373943_0022184 3300035170 Unclassified 2939
780 Ga0373943_0064653 3300035170 Unclassified 1837
781 Ga0373946_0011012 3300035171 Bacteria 3363
782 Ga0373955_0002424 3300035172 Bacteria 8136
783 Ga0373955_0007468 3300035172 Bacteria 5025
784 Ga0373955_0051027 3300035172 Bacteria 2252
785 Ga0373955_0072154 3300035172 Bacteria 1933
786 Ga0373955_0128392 3300035172 Bacteria 1478
787 Ga0373955_0361929 3300035172 Bacteria 879
788 Ga0373961_0281753 3300035241 Unclassified 610
789 Ga0373962_0203097 3300035242 Unclassified 672
790 Ga0373924_0010524 3300035410 Bacteria 3415
791 Ga0373924_0210303 3300035410 Bacteria 859
792 Ga0373924_0394677 3300035410 Unclassified 618
793 Ga0373931_0015803 3300035691 Bacteria 3705
794 Ga0373931_1111024 3300035691 Unclassified 538
795 Ga0373935_0002028 3300035692 Bacteria 11441
796 Ga0373935_0003912 3300035692 Bacteria 8693
797 Ga0373935_0070771 3300035692 Unclassified 2249
798 Ga0373935_0357667 3300035692 Bacteria 1042
799 Ga0373927_0000180 3300035695 Bacteria 49813
800 Ga0373927_0187941 3300035695 Unclassified 1355
801 Ga0373927_0794466 3300035695 Unclassified 625
802 Ga0373933_0003327 3300035724 Bacteria 8964
803 Ga0373933_0020114 3300035724 Bacteria 3781
804 Ga0373947_0000053 3300035725 Bacteria 57813
805 Ga0373947_0018287 3300035725 Bacteria 4034
806 Ga0373947_0161884 3300035725 Bacteria 1448
807 Ga0373947_0188808 3300035725 Unclassified 1344
808 Ga0373937_0000051 3300036401 Bacteria 104818
809 Ga0373937_0002506 3300036401 Bacteria 15252
810 Ga0373937_0008779 3300036401 Bacteria 8771
811 Ga0373937_0546875 3300036401 Bacteria 1100
812 Ga0373925_0005266 3300037068 Bacteria 9656
813 Ga0373925_0008302 3300037068 Bacteria 7559
814 Ga0373925_0026298 3300037068 Bacteria 4258
815 Ga0373925_0163013 3300037068 Bacteria 1757
816 Ga0373925_0258323 3300037068 Bacteria 1399
817 Ga0373925_1576784 3300037068 Unclassified 537
818 Ga0395900_0335368 3300037418 Bacteria 1489
819 Ga0395898_1816264 3300037466 Bacteria 531
820 Ga0395905_0014958 3300037471 Bacteria 7400
821 Ga0395905_0017597 3300037471 Bacteria 6784
822 Ga0395905_0045414 3300037471 Bacteria 4120
823 Ga0395905_1114080 3300037471 Bacteria 693
824 Ga0395905_1210193 3300037471 Unclassified 659
825 Ga0395901_0186796 3300038443 Bacteria 2174
826 Ga0395901_0717626 3300038443 Bacteria 996
827 Ga0395901_0916919 3300038443 Bacteria 857
828 Ga0395901_1081839 3300038443 Bacteria 773
829 Ga0436360_1208757 3300039438 Bacteria 607
830 Ga0436363_0595174 3300039450 Bacteria 1209
831 Ga0436363_1322577 3300039450 Unclassified 595
832 Ga0451839_1217545 3300041496 Bacteria 552
833 Ga0466963_0000297 3300044694 Bacteria 22355
834 Ga0466968_0227172 3300044735 Bacteria 881
835 Ga0466959_0317760 3300045049 Bacteria 1065
836 Ga0466967_0002509 3300045976 Bacteria 11470
837 Ga0466967_0077576 3300045976 Bacteria 2991
838 Ga0495603_0283676 3300046455 Unclassified 952
839 Ga0495629_0027431 3300046459 Bacteria 4042
840 Ga0495638_0180741 3300046460 Bacteria 1204
841 Ga0495651_0060034 3300046462 Unclassified 2914
842 Ga0495651_0109502 3300046462 Unclassified 2044
843 Ga0495653_0137206 3300046463 Bacteria 1724
844 Ga0495580_0000605 3300046472 Bacteria 30320
845 Ga0495580_0047305 3300046472 Bacteria 3049
846 Ga0495580_0689071 3300046472 Unclassified 669
847 Ga0495580_0779842 3300046472 Unclassified 621
848 Ga0495580_0895953 3300046472 Unclassified 570
849 Ga0495582_0049522 3300046473 Unclassified 2313
850 Ga0495582_0146147 3300046473 Bacteria 1341
851 Ga0495664_0042075 3300046477 Bacteria 2705
852 Ga0495594_0015876 3300046499 Bacteria 3961
853 Ga0495608_0031689 3300046511 Bacteria 3573
854 Ga0495630_0036867 3300046517 Bacteria 3655
855 Ga0495630_1496311 3300046517 Bacteria 507
856 Ga0495666_0080879 3300046526 Bacteria 1537
857 Ga0495652_0376511 3300046529 Bacteria 1011
858 Ga0495652_0536900 3300046529 Unclassified 806
859 Ga0495665_0102105 3300046531 Unclassified 1505
860 Ga0495665_0245576 3300046531 Bacteria 922
861 Ga0495640_0033075 3300046533 Bacteria 3677
862 Ga0495587_0000167 3300046536 Bacteria 47833
863 Ga0495587_0035010 3300046536 Unclassified 3026
864 Ga0495656_0037725 3300046615 Unclassified 1998
865 Ga0495634_0098044 3300046642 Bacteria 1897
866 Ga0495611_0401829 3300046648 Unclassified 626
867 Ga0495657_0052261 3300046675 Bacteria 2740
868 Ga0495657_0472594 3300046675 Bacteria 733
869 Ga0495623_0011550 3300046679 Bacteria 5717
870 Ga0495647_0014985 3300046681 Bacteria 2709
871 Ga0495647_0128711 3300046681 Unclassified 1071
872 Ga0495658_0012749 3300046683 Bacteria 4266
873 Ga0495658_0068707 3300046683 Unclassified 2052
874 Ga0495613_0280180 3300046689 Unclassified 1158
875 Ga0495624_0020094 3300046690 Bacteria 4449
876 Ga0495624_0315989 3300046690 Bacteria 941
877 Ga0495670_0378449 3300046691 Unclassified 764
878 Ga0495649_0301486 3300046694 Bacteria 816
879 Ga0495581_0053556 3300047315 Unclassified 2330
880 Ga0495581_0319516 3300047315 Unclassified 907
881 Ga0495604_0004506 3300047317 Bacteria 11035
882 Ga0495674_0008460 3300047319 Bacteria 9804
883 Ga0495674_0033453 3300047319 Unclassified 4657
884 Ga0495674_0060564 3300047319 Bacteria 3302
885 Ga0495674_0073714 3300047319 Unclassified 2942
886 Ga0495676_0051601 3300047321 Bacteria 3289
887 Ga0495676_0219811 3300047321 Bacteria 1310
888 Ga0495680_0072482 3300047322 Bacteria 2620
889 Ga0495675_0001194 3300047444 Bacteria 15733
890 Ga0495684_0057638 3300047471 Bacteria 2960
891 Ga0495684_0081300 3300047471 Unclassified 2459
892 Ga0495686_0001897 3300047472 Bacteria 20884
893 Ga0495602_0000048 3300048088 Bacteria 116248
894 Ga0495602_0002959 3300048088 Bacteria 17416
895 Ga0495602_0046284 3300048088 Bacteria 3931
896 Ga0495602_0440266 3300048088 Bacteria 922
897 Ga0495614_0045562 3300048089 Bacteria 1880
898 Ga0496100_0026318 3300048903 Bacteria 3565
899 Ga0496100_0042506 3300048903 Bacteria 2903
900 Ga0496100_0116428 3300048903 Bacteria 1865
901 Ga0496100_0911684 3300048903 Bacteria 690
902 Ga0496100_1648767 3300048903 Unclassified 507
903 Ga0496101_0046527 3300048904 Bacteria 3112
904 Ga0496101_0058764 3300048904 Bacteria 2786
905 Ga0496101_0078625 3300048904 Unclassified 2434
906 Ga0496102_0004103 3300048905 Bacteria 12350
907 Ga0496102_0037200 3300048905 Bacteria 4389
908 Ga0496102_0181183 3300048905 Bacteria 1985
909 Ga0496102_0268485 3300048905 Bacteria 1608
910 Ga0496102_0373313 3300048905 Bacteria 1342
911 Ga0496102_1016957 3300048905 Bacteria 749
912 Ga0496103_0002092 3300048906 Bacteria 12758
913 Ga0496103_0014865 3300048906 Bacteria 4627
914 Ga0496103_0086595 3300048906 Unclassified 1975
915 Ga0496104_0007099 3300048907 Bacteria 9874
916 Ga0496104_0269857 3300048907 Unclassified 1614
917 Ga0496104_0339491 3300048907 Unclassified 1415
918 Ga0496104_0349726 3300048907 Bacteria 1391
919 Ga0496104_0494630 3300048907 Bacteria 1134
920 Ga0496104_0723416 3300048907 Unclassified 903
921 Ga0496104_0863090 3300048907 Unclassified 810
922 Ga0496104_1221224 3300048907 Bacteria 655
923 Ga0496104_1541235 3300048907 Unclassified 567
924 Ga0496105_0547109 3300048908 Bacteria 904
925 Ga0496105_0730149 3300048908 Bacteria 758
926 Ga0496105_0918168 3300048908 Bacteria 659
927 Ga0496106_0012306 3300048909 Bacteria 6314
928 Ga0496106_0141255 3300048909 Unclassified 1894
929 Ga0496106_0287097 3300048909 Bacteria 1319
930 Ga0496106_0406778 3300048909 Bacteria 1094
931 Ga0496106_1052212 3300048909 Bacteria 639
932 Ga0496107_0443586 3300048910 Unclassified 964
933 Ga0496108_0001332 3300048911 Bacteria 19405
934 Ga0496108_0555264 3300048911 Bacteria 1002
935 Ga0496109_0000183 3300048912 Bacteria 62532
936 Ga0496109_0140860 3300048912 Bacteria 2255
937 Ga0496110_0175254 3300048913 Bacteria 1946
938 Ga0496112_0000030 3300048915 Bacteria 120429
939 Ga0496112_0032189 3300048915 Bacteria 5091
940 Ga0496112_0050305 3300048915 Bacteria 4086
941 Ga0496112_0254126 3300048915 Bacteria 1708
942 Ga0496112_1019367 3300048915 Bacteria 747
943 Ga0496113_1310905 3300048916 Unclassified 563
944 Ga0496114_0089174 3300048917 Bacteria 2617
945 Ga0496114_0313004 3300048917 Bacteria 1387
946 Ga0496114_1039035 3300048917 Bacteria 703
947 Ga0496115_0004579 3300048918 Bacteria 10015
948 Ga0496115_0108511 3300048918 Bacteria 2279
949 Ga0496115_1374763 3300048918 Unclassified 522
950 Ga0496126_0069921 3300048929 Bacteria 3129
951 Ga0501034_0001077 3300049571 Bacteria 38646
952 Ga0501036_0448431 3300049572 Bacteria 1075
953 Ga0501038_0000357 3300049574 Bacteria 39282
954 Ga0501039_0080178 3300049575 Unclassified 2540
955 Ga0501035_0077155 3300049822 Unclassified 2945
956 Ga0501044_0828642 3300049823 Unclassified 803
957 nmdc:mga05p37_697866_c1 3300050507 Bacteria 1128
958 nmdc:mga08y16_480996_c1 3300050511 Bacteria 1263
959 nmdc:mga0n895_5280_c1 3300050512 Bacteria 10756
960 nmdc:mga0n895_632_c1 3300050512 Bacteria 24449
961 nmdc:mga0rr50_1413348_c1 3300050513 Unclassified 589
962 nmdc:mga0rr50_7460_c1 3300050513 Bacteria 6749
963 nmdc:mga08x19_59262_c1 3300050514 Bacteria 2478
964 nmdc:mga08x19_658716_c1 3300050514 Bacteria 743
965 nmdc:mga0a205_34094_c1 3300050515 Bacteria 4884
966 Ga0495601_0030015 3300053077 Unclassified 3375
967 Ga0495619_0351754 3300053085 Bacteria 1019
968 Ga0495619_0625492 3300053085 Unclassified 735
969 Ga0587066_035580 3300059490 Bacteria 912
970 Ga0587128_007638 3300059630 Bacteria 1373
971 Ga0587111_0056265 3300060346 Bacteria 882
972 Ga0501082_0203712 3300060353 Bacteria 1721

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_1816264 Ga0395898_1816264_13_390 119
2 3300038443 Ga0395901_0916919 Ga0395901_0916919_44_421 119
3 3300009098 Ga0105245_10904532 Ga0105245_109045323 120
4 3300009176 Ga0105242_12553589 Ga0105242_125535891 120
5 3300013306 Ga0163162_13259215 Ga0163162_132592152 120
6 3300025933 Ga0207706_11717576 Ga0207706_117175761 120
7 3300028800 Ga0265338_10273852 Ga0265338_102738522 125
8 3300005458 Ga0070681_10233915 Ga0070681_102339154 126
9 3300010375 Ga0105239_10356404 Ga0105239_103564043 126
10 3300013104 Ga0157370_10060172 Ga0157370_100601725 126
11 3300013105 Ga0157369_10235144 Ga0157369_102351442 126
12 3300020069 Ga0197907_10558217 Ga0197907_105582172 126
13 3300026116 Ga0207674_10003484 Ga0207674_1000348418 126
14 3300006852 Ga0075433_10163964 Ga0075433_101639642 127
15 3300006871 Ga0075434_100013738 Ga0075434_1000137382 127
16 3300028023 Ga0265357_1017819 Ga0265357_10178192 127
17 3300028800 Ga0265338_10363324 Ga0265338_103633242 127
18 3300035119 Ga0373956_0033719 Ga0373956_0033719_839_1264 127
19 3300035172 Ga0373955_0002424 Ga0373955_0002424_805_1230 127
20 3300036401 Ga0373937_0000051 Ga0373937_0000051_36010_36435 127
21 3300039450 Ga0436363_1322577 Ga0436363_1322577_74_499 127
22 3300046462 Ga0495651_0109502 Ga0495651_0109502_1426_1851 127
23 3300046536 Ga0495587_0000167 Ga0495587_0000167_23770_24195 127
24 3300047444 Ga0495675_0001194 Ga0495675_0001194_7726_8151 127
25 3300048088 Ga0495602_0000048 Ga0495602_0000048_74777_75202 127
26 3300050512 nmdc:mga0n895_5280_c1 nmdc:mga0n895_5280_c1_9195_9620 127
27 3300024225 Ga0224572_1007760 Ga0224572_10077602 128
28 3300024225 Ga0224572_1055539 Ga0224572_10555391 128
29 3300024227 Ga0228598_1001027 Ga0228598_10010276 128
30 3300024227 Ga0228598_1051058 Ga0228598_10510582 128
31 3300030760 Ga0265762_1002584 Ga0265762_10025843 128
32 3300005435 Ga0070714_102154378 Ga0070714_1021543781 129
33 3300005436 Ga0070713_100075339 Ga0070713_1000753393 129
34 3300006028 Ga0070717_10697941 Ga0070717_106979411 129
35 3300025929 Ga0207664_11736818 Ga0207664_117368181 129
36 3300031241 Ga0265325_10113938 Ga0265325_101139382 129
37 3300031247 Ga0265340_10153941 Ga0265340_101539412 129
38 3300031249 Ga0265339_10212712 Ga0265339_102127121 129
39 3300031344 Ga0265316_10174395 Ga0265316_101743951 129
40 3300031344 Ga0265316_10209915 Ga0265316_102099152 129
41 3300031595 Ga0265313_10243814 Ga0265313_102438142 129
42 3300031711 Ga0265314_10212192 Ga0265314_102121922 129
43 3300031712 Ga0265342_10096806 Ga0265342_100968062 129
44 3300005435 Ga0070714_100085248 Ga0070714_1000852481 130
45 3300005436 Ga0070713_100016019 Ga0070713_1000160192 130
46 3300005563 Ga0068855_101230969 Ga0068855_1012309692 130
47 3300006028 Ga0070717_10547684 Ga0070717_105476842 130
48 3300013296 Ga0157374_10443072 Ga0157374_104430722 130
49 3300025906 Ga0207699_10645037 Ga0207699_106450371 130
50 3300025928 Ga0207700_10098368 Ga0207700_100983682 130
51 3300025929 Ga0207664_10106048 Ga0207664_101060483 130
52 3300028800 Ga0265338_10005942 Ga0265338_100059422 130
53 3300045976 Ga0466967_0077576 Ga0466967_0077576_1053_1457 130
54 3300005436 Ga0070713_100964379 Ga0070713_1009643791 131
55 3300005336 Ga0070680_100147717 Ga0070680_1001477172 132
56 3300005435 Ga0070714_100177857 Ga0070714_1001778572 132
57 3300005439 Ga0070711_101516647 Ga0070711_1015166471 132
58 3300005530 Ga0070679_101123619 Ga0070679_1011236192 132
59 3300005535 Ga0070684_101069149 Ga0070684_1010691491 132
60 3300005563 Ga0068855_101158651 Ga0068855_1011586512 132
61 3300006028 Ga0070717_11123531 Ga0070717_111235312 132
62 3300006173 Ga0070716_100400203 Ga0070716_1004002031 132
63 3300013105 Ga0157369_10125246 Ga0157369_101252462 132
64 3300025921 Ga0207652_10137311 Ga0207652_101373111 132
65 3300025929 Ga0207664_10125480 Ga0207664_101254802 132
66 3300048907 Ga0496104_0349726 Ga0496104_0349726_867_1280 132
67 3300048916 Ga0496113_1310905 Ga0496113_1310905_27_440 132
68 3300005345 Ga0070692_10021641 Ga0070692_100216413 133
69 3300005366 Ga0070659_100410658 Ga0070659_1004106582 133
70 3300005458 Ga0070681_10834360 Ga0070681_108343602 133
71 3300005467 Ga0070706_100830338 Ga0070706_1008303381 133
72 3300005530 Ga0070679_100120123 Ga0070679_1001201232 133
73 3300005535 Ga0070684_100184514 Ga0070684_1001845142 133
74 3300005563 Ga0068855_101943166 Ga0068855_1019431661 133
75 3300005577 Ga0068857_100353009 Ga0068857_1003530092 133
76 3300013102 Ga0157371_10465920 Ga0157371_104659202 133
77 3300013105 Ga0157369_10473017 Ga0157369_104730172 133
78 3300013307 Ga0157372_10270722 Ga0157372_102707222 133
79 3300020077 Ga0206351_10924681 Ga0206351_109246812 133
80 3300020080 Ga0206350_10834542 Ga0206350_108345421 133
81 3300022467 Ga0224712_10034546 Ga0224712_100345462 133
82 3300022467 Ga0224712_10035179 Ga0224712_100351791 133
83 3300025921 Ga0207652_10344821 Ga0207652_103448212 133
84 3300025949 Ga0207667_11677261 Ga0207667_116772612 133
85 3300026067 Ga0207678_10475933 Ga0207678_104759332 133
86 3300037418 Ga0395900_0335368 Ga0395900_0335368_798_1247 133
87 3300038443 Ga0395901_0186796 Ga0395901_0186796_1604_2053 133
88 3300044735 Ga0466968_0227172 Ga0466968_0227172_369_794 133
89 3300005336 Ga0070680_100383749 Ga0070680_1003837492 134
90 3300005458 Ga0070681_10994218 Ga0070681_109942181 134
91 3300005459 Ga0068867_100868312 Ga0068867_1008683122 134
92 3300005467 Ga0070706_101123520 Ga0070706_1011235202 134
93 3300005468 Ga0070707_100091366 Ga0070707_1000913662 134
94 3300005518 Ga0070699_100036450 Ga0070699_1000364504 134
95 3300005530 Ga0070679_100208731 Ga0070679_1002087312 134
96 3300006028 Ga0070717_10490030 Ga0070717_104900301 134
97 3300006914 Ga0075436_100257051 Ga0075436_1002570512 134
98 3300009174 Ga0105241_10354255 Ga0105241_103542552 134
99 3300009176 Ga0105242_10196828 Ga0105242_101968282 134
100 3300013100 Ga0157373_10011522 Ga0157373_100115224 134
101 3300013297 Ga0157378_10361976 Ga0157378_103619762 134
102 3300013297 Ga0157378_12277191 Ga0157378_122771912 134
103 3300025899 Ga0207642_10996495 Ga0207642_109964951 134
104 3300025910 Ga0207684_10774697 Ga0207684_107746972 134
105 3300025911 Ga0207654_10112878 Ga0207654_101128782 134
106 3300025912 Ga0207707_11132574 Ga0207707_111325742 134
107 3300025917 Ga0207660_10052485 Ga0207660_100524851 134
108 3300025921 Ga0207652_10165089 Ga0207652_101650893 134
109 3300025922 Ga0207646_10328755 Ga0207646_103287552 134
110 3300025934 Ga0207686_11159781 Ga0207686_111597811 134
111 3300026089 Ga0207648_10473455 Ga0207648_104734552 134
112 3300035691 Ga0373931_0015803 Ga0373931_0015803_1355_1795 134
113 3300039438 Ga0436360_1208757 Ga0436360_1208757_61_501 134
114 3300048905 Ga0496102_1016957 Ga0496102_1016957_65_505 134
115 3300048915 Ga0496112_1019367 Ga0496112_1019367_180_620 134
116 3300050514 nmdc:mga08x19_658716_c1 nmdc:mga08x19_658716_c1_209_649 134
117 3300005434 Ga0070709_10215712 Ga0070709_102157122 135
118 3300005436 Ga0070713_100817667 Ga0070713_1008176672 135
119 3300005439 Ga0070711_100517078 Ga0070711_1005170781 135
120 3300005440 Ga0070705_101424654 Ga0070705_1014246541 135
121 3300005457 Ga0070662_101096647 Ga0070662_1010966472 135
122 3300005545 Ga0070695_100233972 Ga0070695_1002339722 135
123 3300005547 Ga0070693_100425590 Ga0070693_1004255901 135
124 3300005548 Ga0070665_100177480 Ga0070665_1001774802 135
125 3300005842 Ga0068858_100522280 Ga0068858_1005222801 135
126 3300006028 Ga0070717_10181039 Ga0070717_101810391 135
127 3300006173 Ga0070716_100074262 Ga0070716_1000742622 135
128 3300006237 Ga0097621_100023588 Ga0097621_1000235882 135
129 3300006358 Ga0068871_100001112 Ga0068871_10000111214 135
130 3300006358 Ga0068871_101387326 Ga0068871_1013873262 135
131 3300009098 Ga0105245_10021602 Ga0105245_100216023 135
132 3300009098 Ga0105245_10258397 Ga0105245_102583972 135
133 3300009101 Ga0105247_10075990 Ga0105247_100759902 135
134 3300009174 Ga0105241_10098600 Ga0105241_100986002 135
135 3300009174 Ga0105241_10320186 Ga0105241_103201862 135
136 3300009177 Ga0105248_10940186 Ga0105248_109401862 135
137 3300009545 Ga0105237_10293118 Ga0105237_102931182 135
138 3300009551 Ga0105238_10184851 Ga0105238_101848512 135
139 3300010375 Ga0105239_11650745 Ga0105239_116507451 135
140 3300011119 Ga0105246_12010072 Ga0105246_120100721 135
141 3300013296 Ga0157374_10019511 Ga0157374_100195115 135
142 3300013296 Ga0157374_10720541 Ga0157374_107205412 135
143 3300013297 Ga0157378_10111486 Ga0157378_101114862 135
144 3300013306 Ga0163162_10002825 Ga0163162_100028253 135
145 3300013308 Ga0157375_10908356 Ga0157375_109083562 135
146 3300014325 Ga0163163_10275599 Ga0163163_102755992 135
147 3300014968 Ga0157379_10009000 Ga0157379_100090005 135
148 3300014969 Ga0157376_10975534 Ga0157376_109755341 135
149 3300014969 Ga0157376_11194216 Ga0157376_111942162 135
150 3300025906 Ga0207699_10384781 Ga0207699_103847812 135
151 3300025911 Ga0207654_10835798 Ga0207654_108357981 135
152 3300025914 Ga0207671_10803895 Ga0207671_108038952 135
153 3300025924 Ga0207694_10136780 Ga0207694_101367802 135
154 3300025927 Ga0207687_11174707 Ga0207687_111747072 135
155 3300025928 Ga0207700_10525267 Ga0207700_105252671 135
156 3300025939 Ga0207665_10527390 Ga0207665_105273902 135
157 3300025941 Ga0207711_10663543 Ga0207711_106635431 135
158 3300025986 Ga0207658_10287059 Ga0207658_102870592 135
159 3300026035 Ga0207703_10487848 Ga0207703_104878483 135
160 3300026078 Ga0207702_10841186 Ga0207702_108411862 135
161 3300031249 Ga0265339_10476288 Ga0265339_104762881 135
162 3300035111 Ga0373923_0145710 Ga0373923_0145710_155_598 135
163 3300035172 Ga0373955_0361929 Ga0373955_0361929_110_553 135
164 3300035695 Ga0373927_0794466 Ga0373927_0794466_154_597 135
165 3300036401 Ga0373937_0546875 Ga0373937_0546875_611_1054 135
166 3300037068 Ga0373925_0258323 Ga0373925_0258323_706_1149 135
167 3300046472 Ga0495580_0047305 Ga0495580_0047305_1480_1923 135
168 3300046473 Ga0495582_0146147 Ga0495582_0146147_776_1219 135
169 3300046531 Ga0495665_0245576 Ga0495665_0245576_290_733 135
170 3300046642 Ga0495634_0098044 Ga0495634_0098044_1114_1557 135
171 3300046648 Ga0495611_0401829 Ga0495611_0401829_21_464 135
172 3300046675 Ga0495657_0472594 Ga0495657_0472594_125_568 135
173 3300047319 Ga0495674_0073714 Ga0495674_0073714_654_1097 135
174 3300048903 Ga0496100_0026318 Ga0496100_0026318_2324_2767 135
175 3300048903 Ga0496100_0116428 Ga0496100_0116428_36_479 135
176 3300048904 Ga0496101_0058764 Ga0496101_0058764_187_630 135
177 3300048905 Ga0496102_0004103 Ga0496102_0004103_1213_1656 135
178 3300048906 Ga0496103_0002092 Ga0496103_0002092_1916_2359 135
179 3300048907 Ga0496104_0007099 Ga0496104_0007099_5112_5555 135
180 3300048907 Ga0496104_0339491 Ga0496104_0339491_543_986 135
181 3300048907 Ga0496104_0723416 Ga0496104_0723416_282_725 135
182 3300048907 Ga0496104_1541235 Ga0496104_1541235_61_504 135
183 3300048908 Ga0496105_0730149 Ga0496105_0730149_82_525 135
184 3300048908 Ga0496105_0918168 Ga0496105_0918168_161_604 135
185 3300048909 Ga0496106_0012306 Ga0496106_0012306_4096_4539 135
186 3300048909 Ga0496106_1052212 Ga0496106_1052212_135_578 135
187 3300048915 Ga0496112_0032189 Ga0496112_0032189_3671_4114 135
188 3300048917 Ga0496114_1039035 Ga0496114_1039035_16_459 135
189 3300053085 Ga0495619_0351754 Ga0495619_0351754_185_628 135
190 3300000546 LJNas_1004583 LJNas_10045832 136
191 3300005327 Ga0070658_10246788 Ga0070658_102467882 136
192 3300005327 Ga0070658_10510840 Ga0070658_105108402 136
193 3300005329 Ga0070683_100007816 Ga0070683_1000078168 136
194 3300005330 Ga0070690_100503445 Ga0070690_1005034452 136
195 3300005334 Ga0068869_100107562 Ga0068869_1001075621 136
196 3300005335 Ga0070666_10086109 Ga0070666_100861093 136
197 3300005336 Ga0070680_100135809 Ga0070680_1001358093 136
198 3300005337 Ga0070682_100374723 Ga0070682_1003747231 136
199 3300005338 Ga0068868_100273165 Ga0068868_1002731652 136
200 3300005339 Ga0070660_100019734 Ga0070660_1000197344 136
201 3300005339 Ga0070660_100027487 Ga0070660_1000274872 136
202 3300005339 Ga0070660_100044512 Ga0070660_1000445123 136
203 3300005341 Ga0070691_10477605 Ga0070691_104776052 136
204 3300005344 Ga0070661_100017859 Ga0070661_1000178591 136
205 3300005344 Ga0070661_100308055 Ga0070661_1003080551 136
206 3300005345 Ga0070692_10590913 Ga0070692_105909131 136
207 3300005347 Ga0070668_100018162 Ga0070668_1000181622 136
208 3300005353 Ga0070669_100103593 Ga0070669_1001035933 136
209 3300005354 Ga0070675_100478110 Ga0070675_1004781102 136
210 3300005364 Ga0070673_101470164 Ga0070673_1014701641 136
211 3300005365 Ga0070688_100060749 Ga0070688_1000607491 136
212 3300005366 Ga0070659_100001853 Ga0070659_10000185314 136
213 3300005367 Ga0070667_100230880 Ga0070667_1002308801 136
214 3300005434 Ga0070709_11037071 Ga0070709_110370711 136
215 3300005435 Ga0070714_100224150 Ga0070714_1002241501 136
216 3300005436 Ga0070713_100000231 Ga0070713_10000023113 136
217 3300005437 Ga0070710_10117119 Ga0070710_101171194 136
218 3300005437 Ga0070710_10144587 Ga0070710_101445872 136
219 3300005439 Ga0070711_100039221 Ga0070711_1000392213 136
220 3300005439 Ga0070711_100082975 Ga0070711_1000829752 136
221 3300005455 Ga0070663_100079392 Ga0070663_1000793922 136
222 3300005455 Ga0070663_100082057 Ga0070663_1000820573 136
223 3300005455 Ga0070663_100096112 Ga0070663_1000961123 136
224 3300005455 Ga0070663_100284221 Ga0070663_1002842212 136
225 3300005456 Ga0070678_101337073 Ga0070678_1013370731 136
226 3300005457 Ga0070662_100030086 Ga0070662_1000300861 136
227 3300005458 Ga0070681_10036253 Ga0070681_100362532 136
228 3300005458 Ga0070681_10505284 Ga0070681_105052841 136
229 3300005458 Ga0070681_11179639 Ga0070681_111796391 136
230 3300005530 Ga0070679_100026671 Ga0070679_1000266712 136
231 3300005535 Ga0070684_100396792 Ga0070684_1003967922 136
232 3300005539 Ga0068853_100000064 Ga0068853_10000006431 136
233 3300005539 Ga0068853_100145674 Ga0068853_1001456742 136
234 3300005539 Ga0068853_100145969 Ga0068853_1001459693 136
235 3300005543 Ga0070672_100815998 Ga0070672_1008159981 136
236 3300005544 Ga0070686_100101894 Ga0070686_1001018942 136
237 3300005545 Ga0070695_100134470 Ga0070695_1001344701 136
238 3300005546 Ga0070696_100162259 Ga0070696_1001622592 136
239 3300005547 Ga0070693_100065727 Ga0070693_1000657272 136
240 3300005548 Ga0070665_100045644 Ga0070665_1000456441 136
241 3300005563 Ga0068855_100363724 Ga0068855_1003637242 136
242 3300005563 Ga0068855_102334590 Ga0068855_1023345901 136
243 3300005564 Ga0070664_100307705 Ga0070664_1003077052 136
244 3300005577 Ga0068857_100027770 Ga0068857_1000277702 136
245 3300005578 Ga0068854_100000073 Ga0068854_10000007331 136
246 3300005578 Ga0068854_100084144 Ga0068854_1000841442 136
247 3300005578 Ga0068854_100247345 Ga0068854_1002473451 136
248 3300005614 Ga0068856_100038619 Ga0068856_1000386195 136
249 3300005614 Ga0068856_100363545 Ga0068856_1003635451 136
250 3300005614 Ga0068856_101000832 Ga0068856_1010008321 136
251 3300005617 Ga0068859_100197826 Ga0068859_1001978263 136
252 3300005718 Ga0068866_10073008 Ga0068866_100730082 136
253 3300005719 Ga0068861_101536641 Ga0068861_1015366411 136
254 3300005840 Ga0068870_10904922 Ga0068870_109049221 136
255 3300005841 Ga0068863_100292679 Ga0068863_1002926791 136
256 3300005843 Ga0068860_100075859 Ga0068860_1000758592 136
257 3300005844 Ga0068862_100024110 Ga0068862_1000241103 136
258 3300005983 Ga0081540_1156928 Ga0081540_11569282 136
259 3300006028 Ga0070717_10089905 Ga0070717_100899052 136
260 3300006163 Ga0070715_10013418 Ga0070715_100134185 136
261 3300006163 Ga0070715_10135758 Ga0070715_101357581 136
262 3300006173 Ga0070716_100134428 Ga0070716_1001344282 136
263 3300006173 Ga0070716_100153955 Ga0070716_1001539551 136
264 3300006175 Ga0070712_100000120 Ga0070712_10000012032 136
265 3300006175 Ga0070712_100379410 Ga0070712_1003794101 136
266 3300006175 Ga0070712_100708235 Ga0070712_1007082352 136
267 3300006237 Ga0097621_100655281 Ga0097621_1006552812 136
268 3300006237 Ga0097621_100904805 Ga0097621_1009048051 136
269 3300006358 Ga0068871_100780774 Ga0068871_1007807741 136
270 3300006881 Ga0068865_100653927 Ga0068865_1006539272 136
271 3300006931 Ga0097620_100197825 Ga0097620_1001978253 136
272 3300009093 Ga0105240_10066209 Ga0105240_100662095 136
273 3300009093 Ga0105240_10173504 Ga0105240_101735042 136
274 3300009093 Ga0105240_10262295 Ga0105240_102622952 136
275 3300009093 Ga0105240_10283714 Ga0105240_102837142 136
276 3300009098 Ga0105245_10303548 Ga0105245_103035482 136
277 3300009148 Ga0105243_10390461 Ga0105243_103904611 136
278 3300009174 Ga0105241_10802635 Ga0105241_108026351 136
279 3300009174 Ga0105241_11708493 Ga0105241_117084931 136
280 3300009174 Ga0105241_12314488 Ga0105241_123144881 136
281 3300009177 Ga0105248_10166343 Ga0105248_101663432 136
282 3300009545 Ga0105237_10076830 Ga0105237_100768303 136
283 3300009545 Ga0105237_10372210 Ga0105237_103722102 136
284 3300009551 Ga0105238_10149171 Ga0105238_101491713 136
285 3300009553 Ga0105249_10041458 Ga0105249_100414581 136
286 3300010375 Ga0105239_10469018 Ga0105239_104690181 136
287 3300011119 Ga0105246_10195957 Ga0105246_101959571 136
288 3300013100 Ga0157373_10094317 Ga0157373_100943173 136
289 3300013102 Ga0157371_10208260 Ga0157371_102082602 136
290 3300013102 Ga0157371_10566166 Ga0157371_105661662 136
291 3300013104 Ga0157370_10028414 Ga0157370_100284142 136
292 3300013104 Ga0157370_10118275 Ga0157370_101182752 136
293 3300013104 Ga0157370_10221891 Ga0157370_102218912 136
294 3300013105 Ga0157369_10043736 Ga0157369_100437363 136
295 3300013105 Ga0157369_10132681 Ga0157369_101326812 136
296 3300013105 Ga0157369_10594901 Ga0157369_105949012 136
297 3300013296 Ga0157374_10033622 Ga0157374_100336223 136
298 3300013296 Ga0157374_11601229 Ga0157374_116012291 136
299 3300013297 Ga0157378_11263202 Ga0157378_112632022 136
300 3300013307 Ga0157372_10007870 Ga0157372_100078704 136
301 3300013307 Ga0157372_10291043 Ga0157372_102910432 136
302 3300013308 Ga0157375_10516078 Ga0157375_105160782 136
303 3300014325 Ga0163163_10150928 Ga0163163_101509283 136
304 3300014745 Ga0157377_10390755 Ga0157377_103907552 136
305 3300014745 Ga0157377_10814391 Ga0157377_108143911 136
306 3300014968 Ga0157379_10160330 Ga0157379_101603302 136
307 3300014968 Ga0157379_10409558 Ga0157379_104095581 136
308 3300014969 Ga0157376_10051361 Ga0157376_100513613 136
309 3300014969 Ga0157376_10523718 Ga0157376_105237182 136
310 3300025898 Ga0207692_10135886 Ga0207692_101358861 136
311 3300025904 Ga0207647_10003789 Ga0207647_100037893 136
312 3300025904 Ga0207647_10157480 Ga0207647_101574802 136
313 3300025905 Ga0207685_10017481 Ga0207685_100174812 136
314 3300025905 Ga0207685_10110844 Ga0207685_101108441 136
315 3300025907 Ga0207645_10013932 Ga0207645_100139321 136
316 3300025908 Ga0207643_10017869 Ga0207643_100178694 136
317 3300025909 Ga0207705_10001035 Ga0207705_100010359 136
318 3300025909 Ga0207705_10017201 Ga0207705_100172014 136
319 3300025909 Ga0207705_10679055 Ga0207705_106790552 136
320 3300025911 Ga0207654_10003614 Ga0207654_100036141 136
321 3300025912 Ga0207707_10336979 Ga0207707_103369791 136
322 3300025912 Ga0207707_10667432 Ga0207707_106674321 136
323 3300025913 Ga0207695_10206483 Ga0207695_102064833 136
324 3300025913 Ga0207695_10238796 Ga0207695_102387962 136
325 3300025913 Ga0207695_10455281 Ga0207695_104552811 136
326 3300025914 Ga0207671_10049110 Ga0207671_100491102 136
327 3300025915 Ga0207693_10000005 Ga0207693_1000000532 136
328 3300025915 Ga0207693_10035451 Ga0207693_100354516 136
329 3300025916 Ga0207663_10033645 Ga0207663_100336452 136
330 3300025917 Ga0207660_10309865 Ga0207660_103098652 136
331 3300025917 Ga0207660_10659111 Ga0207660_106591111 136
332 3300025917 Ga0207660_11303255 Ga0207660_113032551 136
333 3300025919 Ga0207657_10006741 Ga0207657_100067416 136
334 3300025919 Ga0207657_10009792 Ga0207657_100097925 136
335 3300025920 Ga0207649_10009112 Ga0207649_100091121 136
336 3300025920 Ga0207649_10091507 Ga0207649_100915072 136
337 3300025921 Ga0207652_10030679 Ga0207652_100306794 136
338 3300025923 Ga0207681_10095819 Ga0207681_100958191 136
339 3300025924 Ga0207694_10025905 Ga0207694_100259054 136
340 3300025924 Ga0207694_10694243 Ga0207694_106942432 136
341 3300025925 Ga0207650_10911037 Ga0207650_109110371 136
342 3300025927 Ga0207687_10017987 Ga0207687_100179871 136
343 3300025928 Ga0207700_10001542 Ga0207700_1000154214 136
344 3300025929 Ga0207664_10195134 Ga0207664_101951342 136
345 3300025931 Ga0207644_10839162 Ga0207644_108391622 136
346 3300025932 Ga0207690_10072707 Ga0207690_100727073 136
347 3300025932 Ga0207690_10477091 Ga0207690_104770912 136
348 3300025933 Ga0207706_10029071 Ga0207706_100290713 136
349 3300025934 Ga0207686_10146561 Ga0207686_101465612 136
350 3300025937 Ga0207669_10337827 Ga0207669_103378272 136
351 3300025938 Ga0207704_10597121 Ga0207704_105971212 136
352 3300025939 Ga0207665_10098805 Ga0207665_100988052 136
353 3300025940 Ga0207691_10670928 Ga0207691_106709281 136
354 3300025941 Ga0207711_10006633 Ga0207711_100066336 136
355 3300025942 Ga0207689_10080741 Ga0207689_100807413 136
356 3300025944 Ga0207661_10057309 Ga0207661_100573094 136
357 3300025944 Ga0207661_10170335 Ga0207661_101703351 136
358 3300025945 Ga0207679_10198193 Ga0207679_101981932 136
359 3300025949 Ga0207667_10051169 Ga0207667_100511693 136
360 3300025949 Ga0207667_10163278 Ga0207667_101632782 136
361 3300025949 Ga0207667_10381196 Ga0207667_103811962 136
362 3300025949 Ga0207667_10383368 Ga0207667_103833682 136
363 3300025949 Ga0207667_12005103 Ga0207667_120051031 136
364 3300025961 Ga0207712_10020472 Ga0207712_100204721 136
365 3300025972 Ga0207668_10004801 Ga0207668_100048013 136
366 3300025981 Ga0207640_10000033 Ga0207640_1000003334 136
367 3300025981 Ga0207640_10010538 Ga0207640_100105383 136
368 3300025981 Ga0207640_10039077 Ga0207640_100390773 136
369 3300025986 Ga0207658_10273759 Ga0207658_102737592 136
370 3300026023 Ga0207677_10035469 Ga0207677_100354692 136
371 3300026041 Ga0207639_10000096 Ga0207639_1000009611 136
372 3300026041 Ga0207639_10155689 Ga0207639_101556892 136
373 3300026041 Ga0207639_10403913 Ga0207639_104039131 136
374 3300026067 Ga0207678_10005015 Ga0207678_100050153 136
375 3300026067 Ga0207678_10015807 Ga0207678_100158076 136
376 3300026067 Ga0207678_10022300 Ga0207678_100223002 136
377 3300026067 Ga0207678_10311055 Ga0207678_103110552 136
378 3300026078 Ga0207702_10280044 Ga0207702_102800443 136
379 3300026078 Ga0207702_10923848 Ga0207702_109238481 136
380 3300026088 Ga0207641_10191597 Ga0207641_101915972 136
381 3300026088 Ga0207641_10395819 Ga0207641_103958192 136
382 3300026095 Ga0207676_10500786 Ga0207676_105007862 136
383 3300026116 Ga0207674_10001160 Ga0207674_100011602 136
384 3300026116 Ga0207674_10127554 Ga0207674_101275542 136
385 3300026118 Ga0207675_100896726 Ga0207675_1008967261 136
386 3300026121 Ga0207683_11286370 Ga0207683_112863701 136
387 3300026142 Ga0207698_11519730 Ga0207698_115197301 136
388 3300028379 Ga0268266_10276075 Ga0268266_102760751 136
389 3300028381 Ga0268264_10619536 Ga0268264_106195362 136
390 3300031090 Ga0265760_10006840 Ga0265760_100068401 136
391 3300031249 Ga0265339_10018542 Ga0265339_100185422 136
392 3300031711 Ga0265314_10038422 Ga0265314_100384222 136
393 3300035084 Ga0373928_0025709 Ga0373928_0025709_311_757 136
394 3300035086 Ga0373934_0000868 Ga0373934_0000868_1192_1632 136
395 3300035091 Ga0373951_0069515 Ga0373951_0069515_394_840 136
396 3300035111 Ga0373923_0035547 Ga0373923_0035547_202_642 136
397 3300035117 Ga0373953_0010330 Ga0373953_0010330_847_1287 136
398 3300035118 Ga0373954_0000181 Ga0373954_0000181_2454_2894 136
399 3300035119 Ga0373956_0003585 Ga0373956_0003585_1424_1864 136
400 3300035172 Ga0373955_0128392 Ga0373955_0128392_897_1337 136
401 3300035241 Ga0373961_0281753 Ga0373961_0281753_63_509 136
402 3300035242 Ga0373962_0203097 Ga0373962_0203097_151_597 136
403 3300035410 Ga0373924_0210303 Ga0373924_0210303_261_701 136
404 3300035691 Ga0373931_1111024 Ga0373931_1111024_28_474 136
405 3300035724 Ga0373933_0003327 Ga0373933_0003327_4605_5045 136
406 3300036401 Ga0373937_0002506 Ga0373937_0002506_2035_2475 136
407 3300046460 Ga0495638_0180741 Ga0495638_0180741_463_909 136
408 3300046462 Ga0495651_0060034 Ga0495651_0060034_109_549 136
409 3300046463 Ga0495653_0137206 Ga0495653_0137206_85_525 136
410 3300046511 Ga0495608_0031689 Ga0495608_0031689_1922_2362 136
411 3300046529 Ga0495652_0376511 Ga0495652_0376511_158_598 136
412 3300046536 Ga0495587_0035010 Ga0495587_0035010_2520_2960 136
413 3300046675 Ga0495657_0052261 Ga0495657_0052261_909_1349 136
414 3300046679 Ga0495623_0011550 Ga0495623_0011550_3933_4373 136
415 3300046694 Ga0495649_0301486 Ga0495649_0301486_149_595 136
416 3300047317 Ga0495604_0004506 Ga0495604_0004506_6664_7104 136
417 3300047471 Ga0495684_0081300 Ga0495684_0081300_2005_2445 136
418 3300047472 Ga0495686_0001897 Ga0495686_0001897_9947_10393 136
419 3300048088 Ga0495602_0002959 Ga0495602_0002959_6079_6519 136
420 3300048903 Ga0496100_0911684 Ga0496100_0911684_209_655 136
421 3300048903 Ga0496100_1648767 Ga0496100_1648767_17_466 136
422 3300048905 Ga0496102_0268485 Ga0496102_0268485_264_710 136
423 3300048906 Ga0496103_0014865 Ga0496103_0014865_3276_3722 136
424 3300048907 Ga0496104_0494630 Ga0496104_0494630_11_457 136
425 3300048911 Ga0496108_0555264 Ga0496108_0555264_470_916 136
426 3300048912 Ga0496109_0140860 Ga0496109_0140860_1073_1519 136
427 3300048917 Ga0496114_0313004 Ga0496114_0313004_274_720 136
428 3300048918 Ga0496115_0108511 Ga0496115_0108511_661_1107 136
429 3300048918 Ga0496115_1374763 Ga0496115_1374763_61_507 136
430 3300048929 Ga0496126_0069921 Ga0496126_0069921_2671_3117 136
431 3300003322 rootL2_10312876 rootL2_103128762 137
432 3300005330 Ga0070690_100244677 Ga0070690_1002446771 137
433 3300005367 Ga0070667_100144270 Ga0070667_1001442702 137
434 3300005434 Ga0070709_10195615 Ga0070709_101956151 137
435 3300005439 Ga0070711_101338125 Ga0070711_1013381252 137
436 3300005440 Ga0070705_100673471 Ga0070705_1006734712 137
437 3300005444 Ga0070694_100509637 Ga0070694_1005096372 137
438 3300005445 Ga0070708_100261059 Ga0070708_1002610592 137
439 3300005468 Ga0070707_100107375 Ga0070707_1001073752 137
440 3300005468 Ga0070707_100653099 Ga0070707_1006530992 137
441 3300005471 Ga0070698_100018118 Ga0070698_1000181186 137
442 3300005518 Ga0070699_100001773 Ga0070699_10000177316 137
443 3300005518 Ga0070699_100378618 Ga0070699_1003786182 137
444 3300005518 Ga0070699_100880063 Ga0070699_1008800631 137
445 3300005536 Ga0070697_100009587 Ga0070697_1000095872 137
446 3300005544 Ga0070686_100210482 Ga0070686_1002104822 137
447 3300005546 Ga0070696_100493033 Ga0070696_1004930332 137
448 3300005549 Ga0070704_100438251 Ga0070704_1004382511 137
449 3300005718 Ga0068866_10212732 Ga0068866_102127322 137
450 3300005842 Ga0068858_100210677 Ga0068858_1002106772 137
451 3300005843 Ga0068860_100231371 Ga0068860_1002313713 137
452 3300006028 Ga0070717_10023401 Ga0070717_100234012 137
453 3300006173 Ga0070716_100036790 Ga0070716_1000367901 137
454 3300006175 Ga0070712_100036247 Ga0070712_1000362475 137
455 3300006237 Ga0097621_100078156 Ga0097621_1000781563 137
456 3300007265 Ga0099794_10035084 Ga0099794_100350843 137
457 3300009101 Ga0105247_10121730 Ga0105247_101217302 137
458 3300009176 Ga0105242_10025538 Ga0105242_100255386 137
459 3300009177 Ga0105248_10056683 Ga0105248_100566837 137
460 3300009553 Ga0105249_10079956 Ga0105249_100799561 137
461 3300010159 Ga0099796_10123497 Ga0099796_101234972 137
462 3300013296 Ga0157374_11150755 Ga0157374_111507551 137
463 3300013297 Ga0157378_10000080 Ga0157378_100000804 137
464 3300013306 Ga0163162_10081086 Ga0163162_100810863 137
465 3300014969 Ga0157376_10005415 Ga0157376_100054156 137
466 3300024227 Ga0228598_1003872 Ga0228598_10038722 137
467 3300025898 Ga0207692_10054102 Ga0207692_100541022 137
468 3300025899 Ga0207642_10186015 Ga0207642_101860152 137
469 3300025910 Ga0207684_10135410 Ga0207684_101354102 137
470 3300025910 Ga0207684_11108364 Ga0207684_111083642 137
471 3300025915 Ga0207693_10268678 Ga0207693_102686782 137
472 3300025922 Ga0207646_10029495 Ga0207646_100294953 137
473 3300025939 Ga0207665_10019102 Ga0207665_100191023 137
474 3300025986 Ga0207658_10154867 Ga0207658_101548673 137
475 3300026035 Ga0207703_10146584 Ga0207703_101465842 137
476 3300027671 Ga0209588_1007852 Ga0209588_10078523 137
477 3300027671 Ga0209588_1041388 Ga0209588_10413881 137
478 3300028381 Ga0268264_10178743 Ga0268264_101787432 137
479 3300028800 Ga0265338_10006826 Ga0265338_100068266 137
480 3300031090 Ga0265760_10006343 Ga0265760_100063432 137
481 3300031090 Ga0265760_10016170 Ga0265760_100161702 137
482 3300031090 Ga0265760_10018812 Ga0265760_100188122 137
483 3300031249 Ga0265339_10030341 Ga0265339_100303411 137
484 3300035692 Ga0373935_0357667 Ga0373935_0357667_416_865 137
485 3300035725 Ga0373947_0161884 Ga0373947_0161884_48_494 137
486 3300037068 Ga0373925_0163013 Ga0373925_0163013_56_505 137
487 3300039450 Ga0436363_0595174 Ga0436363_0595174_229_681 137
488 3300046459 Ga0495629_0027431 Ga0495629_0027431_1308_1757 137
489 3300046472 Ga0495580_0895953 Ga0495580_0895953_30_479 137
490 3300046499 Ga0495594_0015876 Ga0495594_0015876_803_1252 137
491 3300046517 Ga0495630_0036867 Ga0495630_0036867_1096_1545 137
492 3300046526 Ga0495666_0080879 Ga0495666_0080879_103_552 137
493 3300046533 Ga0495640_0033075 Ga0495640_0033075_1177_1626 137
494 3300046681 Ga0495647_0014985 Ga0495647_0014985_1332_1781 137
495 3300046683 Ga0495658_0012749 Ga0495658_0012749_1714_2163 137
496 3300046690 Ga0495624_0315989 Ga0495624_0315989_373_822 137
497 3300047315 Ga0495581_0053556 Ga0495581_0053556_1622_2071 137
498 3300047319 Ga0495674_0060564 Ga0495674_0060564_922_1371 137
499 3300047321 Ga0495676_0051601 Ga0495676_0051601_2068_2517 137
500 3300047322 Ga0495680_0072482 Ga0495680_0072482_1531_1980 137
501 3300047471 Ga0495684_0057638 Ga0495684_0057638_745_1194 137
502 3300048089 Ga0495614_0045562 Ga0495614_0045562_161_610 137
503 3300048904 Ga0496101_0046527 Ga0496101_0046527_502_951 137
504 3300048905 Ga0496102_0037200 Ga0496102_0037200_41_487 137
505 3300048907 Ga0496104_1221224 Ga0496104_1221224_18_467 137
506 3300048908 Ga0496105_0547109 Ga0496105_0547109_167_616 137
507 3300048909 Ga0496106_0141255 Ga0496106_0141255_1309_1755 137
508 3300048909 Ga0496106_0406778 Ga0496106_0406778_17_466 137
509 3300048910 Ga0496107_0443586 Ga0496107_0443586_334_780 137
510 3300048917 Ga0496114_0089174 Ga0496114_0089174_1114_1563 137
511 3300053085 Ga0495619_0625492 Ga0495619_0625492_60_509 137
512 3300005334 Ga0068869_100001091 Ga0068869_10000109112 138
513 3300005338 Ga0068868_100031940 Ga0068868_1000319403 138
514 3300005347 Ga0070668_101380798 Ga0070668_1013807982 138
515 3300005435 Ga0070714_100330524 Ga0070714_1003305242 138
516 3300005435 Ga0070714_100493730 Ga0070714_1004937302 138
517 3300005435 Ga0070714_100633530 Ga0070714_1006335302 138
518 3300005439 Ga0070711_100655150 Ga0070711_1006551501 138
519 3300005457 Ga0070662_101701482 Ga0070662_1017014821 138
520 3300005458 Ga0070681_10415393 Ga0070681_104153932 138
521 3300005458 Ga0070681_10590882 Ga0070681_105908821 138
522 3300005530 Ga0070679_100065948 Ga0070679_1000659483 138
523 3300005544 Ga0070686_100772422 Ga0070686_1007724221 138
524 3300005578 Ga0068854_100382191 Ga0068854_1003821912 138
525 3300005616 Ga0068852_100706000 Ga0068852_1007060002 138
526 3300005617 Ga0068859_100061883 Ga0068859_1000618833 138
527 3300005719 Ga0068861_100054581 Ga0068861_1000545814 138
528 3300005841 Ga0068863_100209702 Ga0068863_1002097022 138
529 3300005842 Ga0068858_100010651 Ga0068858_1000106516 138
530 3300005844 Ga0068862_101164666 Ga0068862_1011646662 138
531 3300006028 Ga0070717_10671886 Ga0070717_106718862 138
532 3300006175 Ga0070712_100456828 Ga0070712_1004568282 138
533 3300006237 Ga0097621_100051309 Ga0097621_1000513092 138
534 3300006358 Ga0068871_100984760 Ga0068871_1009847602 138
535 3300006852 Ga0075433_10025151 Ga0075433_100251512 138
536 3300006871 Ga0075434_100084208 Ga0075434_1000842085 138
537 3300006914 Ga0075436_100045891 Ga0075436_1000458912 138
538 3300006931 Ga0097620_100061878 Ga0097620_1000618783 138
539 3300007076 Ga0075435_100000173 Ga0075435_1000001732 138
540 3300009093 Ga0105240_10028577 Ga0105240_100285777 138
541 3300009098 Ga0105245_10059022 Ga0105245_100590222 138
542 3300009147 Ga0114129_10662456 Ga0114129_106624562 138
543 3300009545 Ga0105237_10229794 Ga0105237_102297942 138
544 3300009545 Ga0105237_10233508 Ga0105237_102335082 138
545 3300010375 Ga0105239_10033112 Ga0105239_100331125 138
546 3300013105 Ga0157369_10146034 Ga0157369_101460342 138
547 3300013296 Ga0157374_10022249 Ga0157374_100222495 138
548 3300013297 Ga0157378_10443252 Ga0157378_104432522 138
549 3300013306 Ga0163162_10008701 Ga0163162_100087014 138
550 3300013307 Ga0157372_10056045 Ga0157372_100560452 138
551 3300013307 Ga0157372_10168758 Ga0157372_101687582 138
552 3300013307 Ga0157372_10776359 Ga0157372_107763592 138
553 3300013308 Ga0157375_10048295 Ga0157375_100482955 138
554 3300013308 Ga0157375_10489877 Ga0157375_104898772 138
555 3300014745 Ga0157377_10086320 Ga0157377_100863202 138
556 3300014968 Ga0157379_10100665 Ga0157379_101006652 138
557 3300014969 Ga0157376_10312876 Ga0157376_103128762 138
558 3300025904 Ga0207647_10007432 Ga0207647_100074323 138
559 3300025906 Ga0207699_10478003 Ga0207699_104780031 138
560 3300025912 Ga0207707_10854928 Ga0207707_108549281 138
561 3300025913 Ga0207695_10033293 Ga0207695_100332934 138
562 3300025914 Ga0207671_10177968 Ga0207671_101779682 138
563 3300025915 Ga0207693_10011174 Ga0207693_100111743 138
564 3300025921 Ga0207652_10078926 Ga0207652_100789263 138
565 3300025921 Ga0207652_10214213 Ga0207652_102142132 138
566 3300025929 Ga0207664_10129037 Ga0207664_101290372 138
567 3300025929 Ga0207664_10599754 Ga0207664_105997542 138
568 3300025933 Ga0207706_11214510 Ga0207706_112145102 138
569 3300025938 Ga0207704_10307910 Ga0207704_103079102 138
570 3300025939 Ga0207665_10115258 Ga0207665_101152582 138
571 3300025942 Ga0207689_10001408 Ga0207689_100014088 138
572 3300025986 Ga0207658_10431553 Ga0207658_104315531 138
573 3300026023 Ga0207677_10680036 Ga0207677_106800362 138
574 3300026035 Ga0207703_10018871 Ga0207703_100188715 138
575 3300026088 Ga0207641_10150546 Ga0207641_101505462 138
576 3300026118 Ga0207675_100058175 Ga0207675_1000581751 138
577 3300028380 Ga0268265_11155559 Ga0268265_111555591 138
578 3300028381 Ga0268264_10010221 Ga0268264_100102213 138
579 3300037471 Ga0395905_0014958 Ga0395905_0014958_5442_5894 138
580 3300037471 Ga0395905_0017597 Ga0395905_0017597_3356_3808 138
581 3300037471 Ga0395905_0045414 Ga0395905_0045414_215_667 138
582 3300038443 Ga0395901_0717626 Ga0395901_0717626_79_531 138
583 3300041496 Ga0451839_1217545 Ga0451839_1217545_36_488 138
584 3300046517 Ga0495630_1496311 Ga0495630_1496311_39_491 138
585 3300046691 Ga0495670_0378449 Ga0495670_0378449_97_540 138
586 3300048915 Ga0496112_0050305 Ga0496112_0050305_3011_3454 138
587 3300050507 nmdc:mga05p37_697866_c1 nmdc:mga05p37_697866_c1_354_800 138
588 3300050512 nmdc:mga0n895_632_c1 nmdc:mga0n895_632_c1_22469_22915 138
589 3300050513 nmdc:mga0rr50_7460_c1 nmdc:mga0rr50_7460_c1_3357_3803 138
590 3300050514 nmdc:mga08x19_59262_c1 nmdc:mga08x19_59262_c1_1727_2173 138
591 3300050515 nmdc:mga0a205_34094_c1 nmdc:mga0a205_34094_c1_3394_3840 138
592 3300005445 Ga0070708_100014908 Ga0070708_1000149083 139
593 3300005445 Ga0070708_100083480 Ga0070708_1000834802 139
594 3300005468 Ga0070707_100034150 Ga0070707_1000341503 139
595 3300005468 Ga0070707_100099997 Ga0070707_1000999972 139
596 3300005471 Ga0070698_100037896 Ga0070698_1000378967 139
597 3300005518 Ga0070699_100065354 Ga0070699_1000653543 139
598 3300005518 Ga0070699_100273390 Ga0070699_1002733902 139
599 3300005536 Ga0070697_100003229 Ga0070697_1000032294 139
600 3300006028 Ga0070717_10607901 Ga0070717_106079012 139
601 3300006852 Ga0075433_10490906 Ga0075433_104909062 139
602 3300025939 Ga0207665_10017320 Ga0207665_100173205 139
603 3300031090 Ga0265760_10099217 Ga0265760_100992172 139
604 3300038443 Ga0395901_1081839 Ga0395901_1081839_46_501 139
605 3300059490 Ga0587066_035580 Ga0587066_035580_439_894 139
606 3300059630 Ga0587128_007638 Ga0587128_007638_595_1050 139
607 3300060346 Ga0587111_0056265 Ga0587111_0056265_287_742 139
608 3300004799 Ga0058863_10030681 Ga0058863_100306812 140
609 3300004799 Ga0058863_10127990 Ga0058863_101279902 140
610 3300004800 Ga0058861_10074048 Ga0058861_100740483 140
611 3300004803 Ga0058862_10062502 Ga0058862_100625022 140
612 3300004803 Ga0058862_10211683 Ga0058862_102116832 140
613 3300005329 Ga0070683_100249383 Ga0070683_1002493832 140
614 3300005336 Ga0070680_100079702 Ga0070680_1000797022 140
615 3300005337 Ga0070682_100180365 Ga0070682_1001803654 140
616 3300005337 Ga0070682_100295611 Ga0070682_1002956112 140
617 3300005434 Ga0070709_10093672 Ga0070709_100936721 140
618 3300005436 Ga0070713_100079167 Ga0070713_1000791671 140
619 3300005437 Ga0070710_10186885 Ga0070710_101868852 140
620 3300005439 Ga0070711_100000519 Ga0070711_10000051913 140
621 3300005445 Ga0070708_100075059 Ga0070708_1000750595 140
622 3300005458 Ga0070681_10001954 Ga0070681_100019548 140
623 3300005467 Ga0070706_100574126 Ga0070706_1005741262 140
624 3300005468 Ga0070707_100156922 Ga0070707_1001569222 140
625 3300005471 Ga0070698_100255932 Ga0070698_1002559322 140
626 3300005530 Ga0070679_100030052 Ga0070679_1000300523 140
627 3300005535 Ga0070684_101036296 Ga0070684_1010362962 140
628 3300005536 Ga0070697_100000166 Ga0070697_10000016615 140
629 3300005536 Ga0070697_100575543 Ga0070697_1005755432 140
630 3300005563 Ga0068855_100643803 Ga0068855_1006438032 140
631 3300006028 Ga0070717_10008860 Ga0070717_100088605 140
632 3300006163 Ga0070715_10189289 Ga0070715_101892892 140
633 3300006173 Ga0070716_100227152 Ga0070716_1002271522 140
634 3300006173 Ga0070716_100259949 Ga0070716_1002599491 140
635 3300006175 Ga0070712_100001238 Ga0070712_1000012384 140
636 3300007076 Ga0075435_101534756 Ga0075435_1015347561 140
637 3300009093 Ga0105240_10220098 Ga0105240_102200984 140
638 3300009093 Ga0105240_10224354 Ga0105240_102243542 140
639 3300009174 Ga0105241_10169505 Ga0105241_101695054 140
640 3300009545 Ga0105237_10167400 Ga0105237_101674002 140
641 3300013100 Ga0157373_10166246 Ga0157373_101662464 140
642 3300013105 Ga0157369_10124073 Ga0157369_101240732 140
643 3300013307 Ga0157372_10102361 Ga0157372_101023613 140
644 3300020069 Ga0197907_11041484 Ga0197907_110414842 140
645 3300020070 Ga0206356_11447340 Ga0206356_114473402 140
646 3300020070 Ga0206356_11591461 Ga0206356_115914611 140
647 3300020075 Ga0206349_1169383 Ga0206349_11693832 140
648 3300020075 Ga0206349_1838695 Ga0206349_18386952 140
649 3300020076 Ga0206355_1093249 Ga0206355_10932491 140
650 3300020077 Ga0206351_10454637 Ga0206351_104546372 140
651 3300020078 Ga0206352_10096670 Ga0206352_100966702 140
652 3300020078 Ga0206352_10855043 Ga0206352_108550432 140
653 3300020078 Ga0206352_11260177 Ga0206352_112601772 140
654 3300020080 Ga0206350_10127627 Ga0206350_101276272 140
655 3300020080 Ga0206350_10163719 Ga0206350_101637193 140
656 3300020080 Ga0206350_11365607 Ga0206350_113656072 140
657 3300020081 Ga0206354_10640681 Ga0206354_106406811 140
658 3300020082 Ga0206353_10792725 Ga0206353_107927252 140
659 3300020610 Ga0154015_1103445 Ga0154015_11034454 140
660 3300022467 Ga0224712_10000977 Ga0224712_100009773 140
661 3300022467 Ga0224712_10010981 Ga0224712_100109812 140
662 3300022467 Ga0224712_10109093 Ga0224712_101090931 140
663 3300025898 Ga0207692_10058514 Ga0207692_100585142 140
664 3300025905 Ga0207685_10005205 Ga0207685_100052052 140
665 3300025910 Ga0207684_10875784 Ga0207684_108757841 140
666 3300025912 Ga0207707_10000757 Ga0207707_100007577 140
667 3300025913 Ga0207695_10178746 Ga0207695_101787462 140
668 3300025915 Ga0207693_10000823 Ga0207693_1000082322 140
669 3300025916 Ga0207663_10020722 Ga0207663_100207224 140
670 3300025921 Ga0207652_10212674 Ga0207652_102126742 140
671 3300025922 Ga0207646_10155520 Ga0207646_101555202 140
672 3300025922 Ga0207646_11044664 Ga0207646_110446642 140
673 3300025928 Ga0207700_10397117 Ga0207700_103971172 140
674 3300025939 Ga0207665_10000034 Ga0207665_1000003421 140
675 3300025939 Ga0207665_10008083 Ga0207665_100080832 140
676 3300025939 Ga0207665_10265692 Ga0207665_102656921 140
677 3300025949 Ga0207667_10276567 Ga0207667_102765671 140
678 3300026041 Ga0207639_10872157 Ga0207639_108721571 140
679 3300027671 Ga0209588_1040264 Ga0209588_10402643 140
680 3300027671 Ga0209588_1106600 Ga0209588_11066002 140
681 3300028800 Ga0265338_10052040 Ga0265338_100520402 140
682 3300029957 Ga0265324_10098197 Ga0265324_100981972 140
683 3300030760 Ga0265762_1002021 Ga0265762_10020213 140
684 3300031090 Ga0265760_10125716 Ga0265760_101257162 140
685 3300031239 Ga0265328_10125846 Ga0265328_101258462 140
686 3300031241 Ga0265325_10177103 Ga0265325_101771032 140
687 3300031249 Ga0265339_10006223 Ga0265339_100062237 140
688 3300031250 Ga0265331_10082750 Ga0265331_100827502 140
689 3300031344 Ga0265316_10069772 Ga0265316_100697722 140
690 3300033545 Ga0316214_1001111 Ga0316214_10011112 140
691 3300033547 Ga0316212_1000944 Ga0316212_10009443 140
692 3300035172 Ga0373955_0007468 Ga0373955_0007468_1302_1772 140
693 3300036401 Ga0373937_0008779 Ga0373937_0008779_4087_4557 140
694 3300037471 Ga0395905_1114080 Ga0395905_1114080_15_473 140
695 3300044694 Ga0466963_0000297 Ga0466963_0000297_20914_21363 140
696 3300045976 Ga0466967_0002509 Ga0466967_0002509_10364_10813 140
697 3300046472 Ga0495580_0689071 Ga0495580_0689071_86_562 140
698 3300049571 Ga0501034_0001077 Ga0501034_0001077_16640_17074 140
699 3300049572 Ga0501036_0448431 Ga0501036_0448431_419_853 140
700 3300049574 Ga0501038_0000357 Ga0501038_0000357_28701_29135 140
701 3300049575 Ga0501039_0080178 Ga0501039_0080178_1851_2285 140
702 3300049822 Ga0501035_0077155 Ga0501035_0077155_2076_2510 140
703 3300049823 Ga0501044_0828642 Ga0501044_0828642_144_578 140
704 3300050513 nmdc:mga0rr50_1413348_c1 nmdc:mga0rr50_1413348_c1_93_548 140
705 3300060353 Ga0501082_0203712 Ga0501082_0203712_77_511 140
706 3300005435 Ga0070714_100000111 Ga0070714_10000011143 141
707 3300005436 Ga0070713_100004047 Ga0070713_1000040474 141
708 3300005437 Ga0070710_10005065 Ga0070710_100050658 141
709 3300005439 Ga0070711_100000929 Ga0070711_1000009294 141
710 3300005439 Ga0070711_100406463 Ga0070711_1004064632 141
711 3300005445 Ga0070708_100000410 Ga0070708_10000041024 141
712 3300005467 Ga0070706_100001099 Ga0070706_10000109916 141
713 3300005467 Ga0070706_100003090 Ga0070706_1000030904 141
714 3300005467 Ga0070706_100059036 Ga0070706_1000590366 141
715 3300005468 Ga0070707_100000229 Ga0070707_10000022917 141
716 3300005471 Ga0070698_100027170 Ga0070698_1000271701 141
717 3300005471 Ga0070698_100048291 Ga0070698_1000482913 141
718 3300005518 Ga0070699_100000703 Ga0070699_1000007032 141
719 3300005536 Ga0070697_100000673 Ga0070697_1000006733 141
720 3300005536 Ga0070697_100001242 Ga0070697_10000124215 141
721 3300006028 Ga0070717_10097818 Ga0070717_100978183 141
722 3300006028 Ga0070717_10173615 Ga0070717_101736152 141
723 3300006028 Ga0070717_10740594 Ga0070717_107405942 141
724 3300006173 Ga0070716_100019448 Ga0070716_1000194484 141
725 3300006173 Ga0070716_100259291 Ga0070716_1002592912 141
726 3300006175 Ga0070712_100002759 Ga0070712_1000027597 141
727 3300024225 Ga0224572_1001294 Ga0224572_10012943 141
728 3300025906 Ga0207699_10125381 Ga0207699_101253811 141
729 3300025910 Ga0207684_10012987 Ga0207684_100129872 141
730 3300025910 Ga0207684_10014429 Ga0207684_100144292 141
731 3300025910 Ga0207684_10014612 Ga0207684_100146124 141
732 3300025915 Ga0207693_10000091 Ga0207693_1000009167 141
733 3300025916 Ga0207663_10002535 Ga0207663_100025359 141
734 3300025916 Ga0207663_10287327 Ga0207663_102873272 141
735 3300025916 Ga0207663_10333218 Ga0207663_103332182 141
736 3300025922 Ga0207646_10010241 Ga0207646_100102414 141
737 3300025928 Ga0207700_10001979 Ga0207700_100019793 141
738 3300025928 Ga0207700_10005278 Ga0207700_100052785 141
739 3300025928 Ga0207700_10078293 Ga0207700_100782932 141
740 3300025928 Ga0207700_10787280 Ga0207700_107872802 141
741 3300025929 Ga0207664_10000127 Ga0207664_1000012737 141
742 3300025929 Ga0207664_10029379 Ga0207664_100293796 141
743 3300025939 Ga0207665_10040271 Ga0207665_100402713 141
744 3300025939 Ga0207665_10415139 Ga0207665_104151391 141
745 3300028017 Ga0265356_1000574 Ga0265356_10005743 141
746 3300028800 Ga0265338_10060152 Ga0265338_100601522 141
747 3300028800 Ga0265338_10126326 Ga0265338_101263261 141
748 3300030760 Ga0265762_1003378 Ga0265762_10033783 141
749 3300030763 Ga0265763_1014574 Ga0265763_10145742 141
750 3300030878 Ga0265770_1055588 Ga0265770_10555881 141
751 3300030879 Ga0265765_1033754 Ga0265765_10337542 141
752 3300031090 Ga0265760_10002195 Ga0265760_100021954 141
753 3300031344 Ga0265316_10021501 Ga0265316_100215016 141
754 3300031711 Ga0265314_10220850 Ga0265314_102208501 141
755 3300033547 Ga0316212_1025202 Ga0316212_10252021 141
756 3300035083 Ga0373926_0278338 Ga0373926_0278338_70_537 141
757 3300035086 Ga0373934_0052108 Ga0373934_0052108_333_800 141
758 3300035089 Ga0373944_0035682 Ga0373944_0035682_897_1364 141
759 3300035113 Ga0373936_0018437 Ga0373936_0018437_137_604 141
760 3300035116 Ga0373945_0066118 Ga0373945_0066118_27_494 141
761 3300035116 Ga0373945_0086323 Ga0373945_0086323_34_501 141
762 3300035117 Ga0373953_0087982 Ga0373953_0087982_64_531 141
763 3300035118 Ga0373954_0051805 Ga0373954_0051805_885_1352 141
764 3300035119 Ga0373956_0422144 Ga0373956_0422144_22_489 141
765 3300035170 Ga0373943_0002219 Ga0373943_0002219_2411_2878 141
766 3300035170 Ga0373943_0022184 Ga0373943_0022184_488_955 141
767 3300035170 Ga0373943_0064653 Ga0373943_0064653_845_1312 141
768 3300035171 Ga0373946_0011012 Ga0373946_0011012_2563_3030 141
769 3300035172 Ga0373955_0051027 Ga0373955_0051027_175_642 141
770 3300035172 Ga0373955_0072154 Ga0373955_0072154_263_730 141
771 3300035410 Ga0373924_0010524 Ga0373924_0010524_2305_2772 141
772 3300035410 Ga0373924_0394677 Ga0373924_0394677_121_588 141
773 3300035692 Ga0373935_0002028 Ga0373935_0002028_668_1135 141
774 3300035692 Ga0373935_0003912 Ga0373935_0003912_4322_4789 141
775 3300035692 Ga0373935_0070771 Ga0373935_0070771_1080_1547 141
776 3300035695 Ga0373927_0000180 Ga0373927_0000180_41545_42012 141
777 3300035695 Ga0373927_0187941 Ga0373927_0187941_776_1243 141
778 3300035724 Ga0373933_0020114 Ga0373933_0020114_2161_2628 141
779 3300035725 Ga0373947_0000053 Ga0373947_0000053_15923_16390 141
780 3300035725 Ga0373947_0018287 Ga0373947_0018287_756_1223 141
781 3300035725 Ga0373947_0188808 Ga0373947_0188808_437_904 141
782 3300037068 Ga0373925_0005266 Ga0373925_0005266_2108_2575 141
783 3300037068 Ga0373925_0008302 Ga0373925_0008302_3317_3784 141
784 3300037068 Ga0373925_0026298 Ga0373925_0026298_2362_2829 141
785 3300037068 Ga0373925_1576784 Ga0373925_1576784_19_486 141
786 3300046455 Ga0495603_0283676 Ga0495603_0283676_82_549 141
787 3300046472 Ga0495580_0000605 Ga0495580_0000605_13211_13678 141
788 3300046472 Ga0495580_0779842 Ga0495580_0779842_91_558 141
789 3300046473 Ga0495582_0049522 Ga0495582_0049522_776_1243 141
790 3300046477 Ga0495664_0042075 Ga0495664_0042075_536_1003 141
791 3300046529 Ga0495652_0536900 Ga0495652_0536900_22_489 141
792 3300046531 Ga0495665_0102105 Ga0495665_0102105_597_1064 141
793 3300046615 Ga0495656_0037725 Ga0495656_0037725_1323_1778 141
794 3300046681 Ga0495647_0128711 Ga0495647_0128711_298_765 141
795 3300046683 Ga0495658_0068707 Ga0495658_0068707_868_1335 141
796 3300046689 Ga0495613_0280180 Ga0495613_0280180_533_1000 141
797 3300046690 Ga0495624_0020094 Ga0495624_0020094_593_1060 141
798 3300047315 Ga0495581_0319516 Ga0495581_0319516_62_529 141
799 3300047319 Ga0495674_0008460 Ga0495674_0008460_1140_1607 141
800 3300047319 Ga0495674_0033453 Ga0495674_0033453_4017_4484 141
801 3300047321 Ga0495676_0219811 Ga0495676_0219811_700_1167 141
802 3300048088 Ga0495602_0046284 Ga0495602_0046284_2424_2891 141
803 3300048088 Ga0495602_0440266 Ga0495602_0440266_436_903 141
804 3300048903 Ga0496100_0042506 Ga0496100_0042506_1218_1685 141
805 3300048907 Ga0496104_0863090 Ga0496104_0863090_185_652 141
806 3300048918 Ga0496115_0004579 Ga0496115_0004579_3113_3580 141
807 3300053077 Ga0495601_0030015 Ga0495601_0030015_1067_1534 141
808 3300005468 Ga0070707_100120929 Ga0070707_1001209291 142
809 3300005536 Ga0070697_101360534 Ga0070697_1013605341 142
810 3300006163 Ga0070715_10142113 Ga0070715_101421131 142
811 3300025910 Ga0207684_10772045 Ga0207684_107720452 142
812 3300025916 Ga0207663_10151298 Ga0207663_101512982 142
813 3300025928 Ga0207700_10074775 Ga0207700_100747753 142
814 3300037471 Ga0395905_1210193 Ga0395905_1210193_64_510 142
815 3300014497 Ga0182008_10018152 Ga0182008_100181522 143
816 3300015262 Ga0182007_10025964 Ga0182007_100259642 143
817 3300005367 Ga0070667_100162609 Ga0070667_1001626092 144
818 3300005435 Ga0070714_100274857 Ga0070714_1002748572 144
819 3300005436 Ga0070713_100369294 Ga0070713_1003692942 144
820 3300005616 Ga0068852_101138316 Ga0068852_1011383161 144
821 3300005843 Ga0068860_100660283 Ga0068860_1006602832 144
822 3300005844 Ga0068862_100209957 Ga0068862_1002099572 144
823 3300009553 Ga0105249_10020124 Ga0105249_100201242 144
824 3300013307 Ga0157372_10075172 Ga0157372_100751723 144
825 3300025906 Ga0207699_10971116 Ga0207699_109711162 144
826 3300025928 Ga0207700_10482314 Ga0207700_104823142 144
827 3300025929 Ga0207664_10069940 Ga0207664_100699402 144
828 3300025961 Ga0207712_10226480 Ga0207712_102264802 144
829 3300028380 Ga0268265_10595893 Ga0268265_105958932 144
830 3300028381 Ga0268264_10235687 Ga0268264_102356872 144
831 3300031241 Ga0265325_10014367 Ga0265325_100143676 144
832 3300031247 Ga0265340_10201851 Ga0265340_102018512 144
833 3300031249 Ga0265339_10031897 Ga0265339_100318976 144
834 3300031712 Ga0265342_10425544 Ga0265342_104255442 144
835 3300031712 Ga0265342_10450424 Ga0265342_104504241 144
836 3300045049 Ga0466959_0317760 Ga0466959_0317760_273_722 144
837 2162886012 MBSR1b_contig_10165024 MBSR1b_0093.00005940 145
838 2162886012 MBSR1b_contig_10507888 MBSR1b_0176.00003220 145
839 3300001976 JGI24752J21851_1011902 JGI24752J21851_10119022 145
840 3300001990 JGI24737J22298_10037023 JGI24737J22298_100370232 145
841 3300002239 JGI24034J26672_10005738 JGI24034J26672_100057383 145
842 3300002459 JGI24751J29686_10002022 JGI24751J29686_100020226 145
843 3300005290 Ga0065712_10139591 Ga0065712_101395912 145
844 3300005293 Ga0065715_10006051 Ga0065715_100060513 145
845 3300005327 Ga0070658_10057744 Ga0070658_100577443 145
846 3300005328 Ga0070676_10024794 Ga0070676_100247946 145
847 3300005329 Ga0070683_100026554 Ga0070683_1000265547 145
848 3300005330 Ga0070690_100010254 Ga0070690_1000102546 145
849 3300005331 Ga0070670_100012670 Ga0070670_10001267010 145
850 3300005333 Ga0070677_10150025 Ga0070677_101500252 145
851 3300005335 Ga0070666_10245933 Ga0070666_102459332 145
852 3300005337 Ga0070682_100042189 Ga0070682_1000421892 145
853 3300005338 Ga0068868_100041104 Ga0068868_1000411046 145
854 3300005338 Ga0068868_100230334 Ga0068868_1002303342 145
855 3300005340 Ga0070689_100010978 Ga0070689_1000109789 145
856 3300005343 Ga0070687_100003669 Ga0070687_1000036698 145
857 3300005344 Ga0070661_100005336 Ga0070661_10000533612 145
858 3300005347 Ga0070668_100052416 Ga0070668_1000524162 145
859 3300005353 Ga0070669_100117210 Ga0070669_1001172102 145
860 3300005354 Ga0070675_100024569 Ga0070675_1000245692 145
861 3300005356 Ga0070674_100086726 Ga0070674_1000867262 145
862 3300005364 Ga0070673_100005154 Ga0070673_1000051543 145
863 3300005365 Ga0070688_100020972 Ga0070688_1000209724 145
864 3300005367 Ga0070667_100134715 Ga0070667_1001347152 145
865 3300005438 Ga0070701_10104756 Ga0070701_101047562 145
866 3300005440 Ga0070705_100396319 Ga0070705_1003963192 145
867 3300005444 Ga0070694_100308754 Ga0070694_1003087542 145
868 3300005455 Ga0070663_100003902 Ga0070663_1000039023 145
869 3300005457 Ga0070662_100169342 Ga0070662_1001693422 145
870 3300005459 Ga0068867_100127797 Ga0068867_1001277972 145
871 3300005466 Ga0070685_10000891 Ga0070685_100008912 145
872 3300005535 Ga0070684_100025735 Ga0070684_1000257353 145
873 3300005543 Ga0070672_100078340 Ga0070672_1000783403 145
874 3300005544 Ga0070686_100051263 Ga0070686_1000512635 145
875 3300005563 Ga0068855_100085404 Ga0068855_1000854043 145
876 3300005577 Ga0068857_100012748 Ga0068857_10001274810 145
877 3300005578 Ga0068854_100415931 Ga0068854_1004159311 145
878 3300005614 Ga0068856_100032606 Ga0068856_1000326063 145
879 3300005615 Ga0070702_100018838 Ga0070702_1000188382 145
880 3300005616 Ga0068852_100108429 Ga0068852_1001084292 145
881 3300005617 Ga0068859_100377869 Ga0068859_1003778692 145
882 3300005718 Ga0068866_10069989 Ga0068866_100699892 145
883 3300005719 Ga0068861_100028262 Ga0068861_1000282623 145
884 3300005840 Ga0068870_10000880 Ga0068870_100008806 145
885 3300005841 Ga0068863_100235832 Ga0068863_1002358322 145
886 3300005842 Ga0068858_100032024 Ga0068858_1000320245 145
887 3300005843 Ga0068860_100021654 Ga0068860_1000216549 145
888 3300005844 Ga0068862_100008118 Ga0068862_1000081186 145
889 3300006237 Ga0097621_100088932 Ga0097621_1000889326 145
890 3300006358 Ga0068871_100177023 Ga0068871_1001770232 145
891 3300006871 Ga0075434_100710685 Ga0075434_1007106852 145
892 3300006881 Ga0068865_100029249 Ga0068865_1000292492 145
893 3300006931 Ga0097620_100377864 Ga0097620_1003778642 145
894 3300009011 Ga0105251_10256404 Ga0105251_102564041 145
895 3300009094 Ga0111539_10808465 Ga0111539_108084652 145
896 3300009098 Ga0105245_10008119 Ga0105245_1000811910 145
897 3300009098 Ga0105245_10128920 Ga0105245_101289202 145
898 3300009101 Ga0105247_10103890 Ga0105247_101038902 145
899 3300009174 Ga0105241_10006954 Ga0105241_100069546 145
900 3300009176 Ga0105242_10067160 Ga0105242_100671606 145
901 3300009177 Ga0105248_10151081 Ga0105248_101510811 145
902 3300009545 Ga0105237_10548272 Ga0105237_105482722 145
903 3300009551 Ga0105238_10285001 Ga0105238_102850012 145
904 3300009553 Ga0105249_10062042 Ga0105249_100620422 145
905 3300010375 Ga0105239_10169686 Ga0105239_101696864 145
906 3300011119 Ga0105246_10017813 Ga0105246_100178132 145
907 3300013100 Ga0157373_10004365 Ga0157373_1000436512 145
908 3300013102 Ga0157371_10001874 Ga0157371_1000187423 145
909 3300013105 Ga0157369_10046631 Ga0157369_100466313 145
910 3300013296 Ga0157374_10064959 Ga0157374_100649594 145
911 3300013296 Ga0157374_10759293 Ga0157374_107592932 145
912 3300013307 Ga0157372_10066678 Ga0157372_100666788 145
913 3300013308 Ga0157375_10281354 Ga0157375_102813541 145
914 3300014325 Ga0163163_10007748 Ga0163163_100077483 145
915 3300014325 Ga0163163_10099513 Ga0163163_100995132 145
916 3300014326 Ga0157380_10201360 Ga0157380_102013602 145
917 3300014745 Ga0157377_10003870 Ga0157377_1000387010 145
918 3300014968 Ga0157379_10145073 Ga0157379_101450732 145
919 3300014969 Ga0157376_10189494 Ga0157376_101894943 145
920 3300017792 Ga0163161_10033798 Ga0163161_100337982 145
921 3300025315 Ga0207697_10024533 Ga0207697_100245332 145
922 3300025893 Ga0207682_10045324 Ga0207682_100453241 145
923 3300025900 Ga0207710_10066155 Ga0207710_100661552 145
924 3300025901 Ga0207688_10065973 Ga0207688_100659731 145
925 3300025903 Ga0207680_10173866 Ga0207680_101738662 145
926 3300025904 Ga0207647_10027290 Ga0207647_100272904 145
927 3300025907 Ga0207645_10000338 Ga0207645_1000033835 145
928 3300025908 Ga0207643_10000614 Ga0207643_1000061423 145
929 3300025911 Ga0207654_10041563 Ga0207654_100415631 145
930 3300025918 Ga0207662_10031871 Ga0207662_100318712 145
931 3300025919 Ga0207657_10081330 Ga0207657_100813302 145
932 3300025925 Ga0207650_10000380 Ga0207650_100003805 145
933 3300025927 Ga0207687_10061324 Ga0207687_100613242 145
934 3300025931 Ga0207644_10042612 Ga0207644_100426122 145
935 3300025932 Ga0207690_10049747 Ga0207690_100497474 145
936 3300025933 Ga0207706_10019832 Ga0207706_100198327 145
937 3300025937 Ga0207669_10041135 Ga0207669_100411352 145
938 3300025940 Ga0207691_10011784 Ga0207691_1001178413 145
939 3300025941 Ga0207711_11360936 Ga0207711_113609362 145
940 3300025942 Ga0207689_10000505 Ga0207689_100005055 145
941 3300025942 Ga0207689_10116883 Ga0207689_101168832 145
942 3300025944 Ga0207661_10000101 Ga0207661_1000010122 145
943 3300025945 Ga0207679_10000079 Ga0207679_1000007910 145
944 3300025949 Ga0207667_10157463 Ga0207667_101574632 145
945 3300025960 Ga0207651_10053780 Ga0207651_100537802 145
946 3300025961 Ga0207712_10166549 Ga0207712_101665492 145
947 3300026023 Ga0207677_10163975 Ga0207677_101639752 145
948 3300026035 Ga0207703_10536283 Ga0207703_105362832 145
949 3300026067 Ga0207678_10054801 Ga0207678_100548012 145
950 3300026075 Ga0207708_10025151 Ga0207708_100251515 145
951 3300026088 Ga0207641_10000009 Ga0207641_10000009142 145
952 3300026089 Ga0207648_10000496 Ga0207648_100004967 145
953 3300026095 Ga0207676_10000144 Ga0207676_1000014426 145
954 3300026116 Ga0207674_10000988 Ga0207674_100009884 145
955 3300026118 Ga0207675_100089137 Ga0207675_1000891371 145
956 3300026121 Ga0207683_10000869 Ga0207683_1000086928 145
957 3300026142 Ga0207698_10022579 Ga0207698_100225795 145
958 3300028379 Ga0268266_10002830 Ga0268266_1000283019 145
959 3300028380 Ga0268265_10006045 Ga0268265_1000604513 145
960 3300028381 Ga0268264_10181424 Ga0268264_101814242 145
961 3300048904 Ga0496101_0078625 Ga0496101_0078625_1859_2296 145
962 3300048905 Ga0496102_0181183 Ga0496102_0181183_860_1297 145
963 3300048905 Ga0496102_0373313 Ga0496102_0373313_423_863 145
964 3300048906 Ga0496103_0086595 Ga0496103_0086595_1216_1653 145
965 3300048907 Ga0496104_0269857 Ga0496104_0269857_1106_1543 145
966 3300048909 Ga0496106_0287097 Ga0496106_0287097_44_481 145
967 3300048911 Ga0496108_0001332 Ga0496108_0001332_17533_17970 145
968 3300048912 Ga0496109_0000183 Ga0496109_0000183_42091_42528 145
969 3300048913 Ga0496110_0175254 Ga0496110_0175254_685_1122 145
970 3300048915 Ga0496112_0000030 Ga0496112_0000030_49492_49929 145
971 3300048915 Ga0496112_0254126 Ga0496112_0254126_297_737 145
972 3300050511 nmdc:mga08y16_480996_c1 nmdc:mga08y16_480996_c1_556_993 145

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nl3-assembly1.cif.gz_D crystal structure of listeria monocytogenes hfq in complex with u6 rna 0.8249 47 109
8p91-assembly1.cif.gz_A hfq from chromobacterium haemolyticum; a p6 space group monomer 0.824 47 109
7oh8-assembly1.cif.gz_B r17a mutant of hfq protein from neisseria meningitidis 0.8161 47 109
4noy-assembly1.cif.gz_A crystal structure of listeria monocytogenes hfq f43w 0.8151 44 109
4a53-assembly1.cif.gz_A structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6 0.8104 50 108
ID Description Score Start End Superfamily
af_Q2FYW7_1_63_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8421 52 109 2.30.30.100
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.8391 47 109 2.30.30.100
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8328 54 106 2.30.30.100
4a53A01 Mainly Beta;Roll;SH3 type barrels.; 0.8136 50 109 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.7898 44 107 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A350UNM5-F1-model_v4 Uncharacterized protein 0.8395 39 145
AF-A0A350UNM5-F1-model_v4 Uncharacterized protein 0.8258 39 145
AF-A0A1L8MKA6-F1-model_v4 LSM domain protein 0.818 49 109
AF-A0A371IQ45-F1-model_v4 Uncharacterized protein 0.8172 52 109
AF-A0A840DR02-F1-model_v4 LSM domain protein 0.8157 49 108

Feature Viewer

pLDDT pTM Quality
69.77 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map