F487092

General Info

Members Datasets Scaffolds Average Seq Length
970 373 1940 186

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10062400|Ga0105241_100624002
Length 220
Sequence MVHATVQSTTAKPPRKISAGYGHEANVKLVEEVRSMKSKSMLTIATIPLLLAVLGGVAVSAQDKYTLKVPGGLAFSEFRGYETWETISVSHNGQALAVILGNRAMIDAFKAGIPGNGKPFPDGAKMAKIHWKQKTAETFPGQPFVPDTQHDADFMVKDSKRFADSGGWGYAAFNYDAATDTFTPGTMADEAPQGNDAKCGFACHTVVKARDYVFTDYQHK

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
261 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
366 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 2643221695 Lysobacter sp. Root494 Isolate Unclassified
373 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 4.33
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 4.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10062400 3300009174 Bacteria 2873
2 JGI24737J22298_10017577 3300001990 Bacteria 2302
3 JGI24743J22301_10019109 3300001991 Bacteria 1300
4 JGI24750J21931_1027043 3300002070 Bacteria 828
5 JGI24034J26672_10037348 3300002239 Bacteria 808
6 JGI24751J29686_10028324 3300002459 Bacteria 1163
7 JGI25406J46586_10011067 3300003203 Bacteria 3966
8 rootH1_10376900 3300003323 Bacteria 1304
9 JGI25404J52841_10001063 3300003659 Bacteria 4588
10 Ga0065704_10017714 3300005289 Bacteria 2086
11 Ga0065712_10089323 3300005290 Bacteria 2476
12 Ga0065712_10129824 3300005290 Bacteria 1563
13 Ga0065712_10143883 3300005290 Bacteria 1426
14 Ga0065712_10161294 3300005290 Bacteria 1300
15 Ga0065715_10066319 3300005293 Bacteria 742
16 Ga0065715_10089287 3300005293 Bacteria 11507
17 Ga0065715_10095205 3300005293 Bacteria 4118
18 Ga0065715_10152809 3300005293 Bacteria 1709
19 Ga0065715_10273524 3300005293 Bacteria 1100
20 Ga0065715_10321175 3300005293 Bacteria 1002
21 Ga0065707_10001343 3300005295 Bacteria 10274
22 Ga0070676_10003798 3300005328 Bacteria 7922
23 Ga0070676_10005577 3300005328 Bacteria 6702
24 Ga0070683_100052166 3300005329 Bacteria 3788
25 Ga0070690_100000759 3300005330 Bacteria 16515
26 Ga0070690_100028261 3300005330 Bacteria 3473
27 Ga0070690_100182693 3300005330 Bacteria 1450
28 Ga0070670_100002271 3300005331 Bacteria 15814
29 Ga0070670_100017650 3300005331 Bacteria 6124
30 Ga0070670_100265663 3300005331 Bacteria 1496
31 Ga0070670_100319126 3300005331 Bacteria 1361
32 Ga0070670_100813923 3300005331 Bacteria 844
33 Ga0070677_10021202 3300005333 Bacteria 2381
34 Ga0070677_10051241 3300005333 Bacteria 1670
35 Ga0070677_10074195 3300005333 Bacteria 1438
36 Ga0068869_100017160 3300005334 Bacteria 4900
37 Ga0070666_10011928 3300005335 Bacteria 5467
38 Ga0070666_10064813 3300005335 Bacteria 2478
39 Ga0070666_10067478 3300005335 Bacteria 2429
40 Ga0070666_10257685 3300005335 Bacteria 1236
41 Ga0070666_10382811 3300005335 Bacteria 1010
42 Ga0070666_10443257 3300005335 Bacteria 937
43 Ga0070680_100005862 3300005336 Bacteria 9321
44 Ga0070682_100262284 3300005337 Bacteria 1251
45 Ga0068868_100032256 3300005338 Bacteria 4029
46 Ga0068868_100044837 3300005338 Bacteria 3458
47 Ga0068868_100167150 3300005338 Bacteria 1820
48 Ga0070660_100006491 3300005339 Bacteria 8113
49 Ga0070660_100082141 3300005339 Bacteria 2530
50 Ga0070660_100131763 3300005339 Bacteria 2001
51 Ga0070689_100003033 3300005340 Bacteria 11060
52 Ga0070689_100042405 3300005340 Bacteria 3494
53 Ga0070689_100404433 3300005340 Bacteria 1155
54 Ga0070689_100687740 3300005340 Bacteria 892
55 Ga0070691_10046890 3300005341 Bacteria 2054
56 Ga0070687_100010522 3300005343 Bacteria 4005
57 Ga0070687_100032198 3300005343 Bacteria 2578
58 Ga0070661_100006049 3300005344 Bacteria 8324
59 Ga0070661_100040217 3300005344 Bacteria 3410
60 Ga0070661_100051905 3300005344 Bacteria 3001
61 Ga0070692_10000246 3300005345 Bacteria 14932
62 Ga0070668_100006432 3300005347 Bacteria 8710
63 Ga0070668_100281432 3300005347 Bacteria 1389
64 Ga0070668_101337528 3300005347 Bacteria 652
65 Ga0070669_100006457 3300005353 Bacteria 8445
66 Ga0070669_100136849 3300005353 Bacteria 1885
67 Ga0070669_100233795 3300005353 Bacteria 1458
68 Ga0070675_100046594 3300005354 Bacteria 3550
69 Ga0070675_100079336 3300005354 Bacteria 2735
70 Ga0070675_100098304 3300005354 Bacteria 2462
71 Ga0070675_100104756 3300005354 Bacteria 2386
72 Ga0070675_100153028 3300005354 Bacteria 1979
73 Ga0070675_100184090 3300005354 Bacteria 1807
74 Ga0070675_100228161 3300005354 Bacteria 1624
75 Ga0070675_100485344 3300005354 Bacteria 1112
76 Ga0070675_100803972 3300005354 Bacteria 859
77 Ga0070675_100951069 3300005354 Bacteria 788
78 Ga0070671_100019240 3300005355 Bacteria 5555
79 Ga0070671_100281750 3300005355 Bacteria 1414
80 Ga0070671_100354181 3300005355 Bacteria 1253
81 Ga0070671_100637349 3300005355 Unclassified 922
82 Ga0070671_100797826 3300005355 Bacteria 822
83 Ga0070674_100000267 3300005356 Bacteria 25728
84 Ga0070674_100030736 3300005356 Bacteria 3552
85 Ga0070674_100033386 3300005356 Bacteria 3425
86 Ga0070674_100114418 3300005356 Bacteria 1987
87 Ga0070674_100541869 3300005356 Bacteria 975
88 Ga0070673_100028985 3300005364 Bacteria 4123
89 Ga0070673_100135958 3300005364 Bacteria 2069
90 Ga0070673_100243731 3300005364 Bacteria 1564
91 Ga0070673_100263812 3300005364 Bacteria 1505
92 Ga0070688_100031601 3300005365 Bacteria 3186
93 Ga0070688_100152213 3300005365 Bacteria 1582
94 Ga0070688_100364155 3300005365 Bacteria 1062
95 Ga0070688_100438770 3300005365 Bacteria 974
96 Ga0070659_100000570 3300005366 Bacteria 26983
97 Ga0070659_100022801 3300005366 Bacteria 4783
98 Ga0070659_100022876 3300005366 Bacteria 4776
99 Ga0070659_100026094 3300005366 Unclassified 4494
100 Ga0070667_100004812 3300005367 Bacteria 11311
101 Ga0070667_100019143 3300005367 Bacteria 5677
102 Ga0070667_100262332 3300005367 Unclassified 1547
103 Ga0070703_10058093 3300005406 Bacteria 1258
104 Ga0070709_10000170 3300005434 Bacteria 41030
105 Ga0070709_10066612 3300005434 Bacteria 2311
106 Ga0070714_100024930 3300005435 Bacteria 4931
107 Ga0070713_100032039 3300005436 Bacteria 4194
108 Ga0070713_100218075 3300005436 Bacteria 1730
109 Ga0070713_100353420 3300005436 Bacteria 1364
110 Ga0070710_10006480 3300005437 Bacteria 5625
111 Ga0070701_10043205 3300005438 Bacteria 2304
112 Ga0070711_100001036 3300005439 Bacteria 14798
113 Ga0070711_100005184 3300005439 Bacteria 7770
114 Ga0070705_100000350 3300005440 Bacteria 27237
115 Ga0070700_100001474 3300005441 Bacteria 11710
116 Ga0070700_100089879 3300005441 Bacteria 2002
117 Ga0070700_100118544 3300005441 Bacteria 1770
118 Ga0070700_100349200 3300005441 Unclassified 1096
119 Ga0070700_100567786 3300005441 Bacteria 884
120 Ga0070694_100001109 3300005444 Bacteria 15410
121 Ga0070708_100126301 3300005445 Bacteria 2364
122 Ga0070708_100189242 3300005445 Bacteria 1925
123 Ga0070663_100001350 3300005455 Bacteria 13414
124 Ga0070663_100418263 3300005455 Bacteria 1099
125 Ga0070663_101001212 3300005455 Unclassified 727
126 Ga0070678_100023979 3300005456 Bacteria 4076
127 Ga0070678_100059284 3300005456 Bacteria 2813
128 Ga0070678_100059869 3300005456 Bacteria 2800
129 Ga0070678_100153084 3300005456 Bacteria 1860
130 Ga0070678_100317193 3300005456 Bacteria 1330
131 Ga0070678_100397266 3300005456 Bacteria 1197
132 Ga0070662_100034058 3300005457 Bacteria 3590
133 Ga0070662_100079006 3300005457 Bacteria 2445
134 Ga0070662_100539148 3300005457 Bacteria 977
135 Ga0070681_10014476 3300005458 Bacteria 7849
136 Ga0070681_10048169 3300005458 Bacteria 4259
137 Ga0068867_100027850 3300005459 Bacteria 4065
138 Ga0068867_100119961 3300005459 Bacteria 2031
139 Ga0068867_100158770 3300005459 Bacteria 1782
140 Ga0068867_100273848 3300005459 Bacteria 1381
141 Ga0070685_10025709 3300005466 Bacteria 3242
142 Ga0070685_10232074 3300005466 Bacteria 1214
143 Ga0070685_10297230 3300005466 Bacteria 1087
144 Ga0070706_100317247 3300005467 Bacteria 1454
145 Ga0070707_100388380 3300005468 Unclassified 1355
146 Ga0070698_101122943 3300005471 Bacteria 735
147 Ga0070699_100169114 3300005518 Unclassified 1936
148 Ga0070679_100042361 3300005530 Bacteria 4534
149 Ga0070679_100063525 3300005530 Unclassified 3680
150 Ga0070679_100149303 3300005530 Bacteria 2315
151 Ga0070679_101133095 3300005530 Unclassified 727
152 Ga0070684_100110888 3300005535 Bacteria 2460
153 Ga0070684_100151019 3300005535 Bacteria 2104
154 Ga0070684_100285027 3300005535 Bacteria 1514
155 Ga0070697_100012900 3300005536 Bacteria 6548
156 Ga0070697_100866441 3300005536 Unclassified 800
157 Ga0068853_100009714 3300005539 Bacteria 7759
158 Ga0068853_100019919 3300005539 Bacteria 5572
159 Ga0070672_100085406 3300005543 Unclassified 2536
160 Ga0070672_100086652 3300005543 Bacteria 2519
161 Ga0070672_100160626 3300005543 Bacteria 1864
162 Ga0070672_100178881 3300005543 Bacteria 1767
163 Ga0070672_100337918 3300005543 Bacteria 1282
164 Ga0070672_100354540 3300005543 Bacteria 1251
165 Ga0070672_100442685 3300005543 Bacteria 1118
166 Ga0070686_100003548 3300005544 Bacteria 8557
167 Ga0070686_100022959 3300005544 Bacteria 3722
168 Ga0070695_100099823 3300005545 Bacteria 1953
169 Ga0070696_100020813 3300005546 Bacteria 4445
170 Ga0070696_100696381 3300005546 Bacteria 828
171 Ga0070693_100026601 3300005547 Bacteria 3125
172 Ga0070693_100095062 3300005547 Bacteria 1804
173 Ga0070665_100001266 3300005548 Bacteria 30344
174 Ga0070665_100009407 3300005548 Bacteria 9891
175 Ga0070665_100017535 3300005548 Bacteria 7190
176 Ga0070665_100152381 3300005548 Bacteria 2314
177 Ga0070665_100287340 3300005548 Bacteria 1647
178 Ga0070665_100413195 3300005548 Bacteria 1358
179 Ga0070704_100001536 3300005549 Bacteria 12460
180 Ga0068855_100006474 3300005563 Bacteria 14242
181 Ga0068855_100093830 3300005563 Bacteria 3461
182 Ga0068855_100122426 3300005563 Unclassified 2976
183 Ga0068855_100573449 3300005563 Bacteria 1219
184 Ga0070664_100004342 3300005564 Bacteria 11399
185 Ga0070664_100005930 3300005564 Bacteria 9868
186 Ga0068857_100007883 3300005577 Bacteria 9187
187 Ga0068857_100022193 3300005577 Bacteria 5584
188 Ga0068857_100093299 3300005577 Bacteria 2696
189 Ga0068857_101590188 3300005577 Bacteria 638
190 Ga0068854_100006445 3300005578 Bacteria 7464
191 Ga0068856_100003126 3300005614 Bacteria 16893
192 Ga0068856_100020887 3300005614 Bacteria 6364
193 Ga0070702_100011074 3300005615 Bacteria 4475
194 Ga0068852_100027935 3300005616 Unclassified 4608
195 Ga0068852_100656229 3300005616 Bacteria 1057
196 Ga0068859_100044382 3300005617 Bacteria 4466
197 Ga0068859_100054976 3300005617 Bacteria 4005
198 Ga0068859_100097979 3300005617 Bacteria 2986
199 Ga0068859_100222567 3300005617 Bacteria 1975
200 Ga0068859_100277656 3300005617 Bacteria 1768
201 Ga0068859_100287842 3300005617 Bacteria 1736
202 Ga0068859_100384156 3300005617 Bacteria 1500
203 Ga0068859_100938597 3300005617 Bacteria 949
204 Ga0068864_100006983 3300005618 Bacteria 9262
205 Ga0068864_100268033 3300005618 Bacteria 1590
206 Ga0068864_100746316 3300005618 Bacteria 959
207 Ga0068861_100007099 3300005719 Bacteria 7665
208 Ga0068861_100022295 3300005719 Bacteria 4561
209 Ga0068861_100197144 3300005719 Bacteria 1687
210 Ga0068861_100293680 3300005719 Unclassified 1404
211 Ga0068861_100389426 3300005719 Bacteria 1234
212 Ga0068861_100583447 3300005719 Bacteria 1023
213 Ga0068851_10023575 3300005834 Bacteria 3009
214 Ga0068851_10309671 3300005834 Bacteria 910
215 Ga0068870_10002153 3300005840 Bacteria 8155
216 Ga0068870_10008640 3300005840 Bacteria 4591
217 Ga0068870_10095390 3300005840 Bacteria 1671
218 Ga0068870_10221572 3300005840 Bacteria 1158
219 Ga0068863_100013472 3300005841 Bacteria 7887
220 Ga0068863_100014373 3300005841 Bacteria 7624
221 Ga0068863_100023149 3300005841 Bacteria 5936
222 Ga0068863_100055651 3300005841 Bacteria 3746
223 Ga0068863_100224732 3300005841 Bacteria 1809
224 Ga0068863_100554304 3300005841 Bacteria 1135
225 Ga0068863_100645970 3300005841 Bacteria 1049
226 Ga0068858_100003459 3300005842 Bacteria 15664
227 Ga0068858_100005502 3300005842 Bacteria 12401
228 Ga0068858_100082271 3300005842 Bacteria 2992
229 Ga0068858_100272780 3300005842 Bacteria 1610
230 Ga0068858_100349223 3300005842 Bacteria 1417
231 Ga0068858_100479936 3300005842 Bacteria 1200
232 Ga0068858_100493177 3300005842 Unclassified 1183
233 Ga0068858_100617202 3300005842 Bacteria 1053
234 Ga0068858_101639824 3300005842 Unclassified 635
235 Ga0068860_100000961 3300005843 Bacteria 31889
236 Ga0068862_100002496 3300005844 Bacteria 16274
237 Ga0068862_100025465 3300005844 Bacteria 4967
238 Ga0068862_100276389 3300005844 Bacteria 1538
239 Ga0068862_100361668 3300005844 Bacteria 1349
240 Ga0081540_1000011 3300005983 Bacteria 191880
241 Ga0081540_1218462 3300005983 Bacteria 680
242 Ga0081539_10000018 3300005985 Bacteria 374538
243 Ga0075368_10020680 3300006042 Bacteria 2494
244 Ga0075432_10041558 3300006058 Bacteria 1607
245 Ga0070716_100000870 3300006173 Bacteria 12997
246 Ga0070716_100032912 3300006173 Bacteria 2832
247 Ga0070716_100234387 3300006173 Bacteria 1241
248 Ga0070712_100005204 3300006175 Bacteria 8045
249 Ga0070712_100089608 3300006175 Bacteria 2250
250 Ga0070712_100160429 3300006175 Bacteria 1736
251 Ga0075367_10008084 3300006178 Bacteria 5430
252 Ga0075366_10583799 3300006195 Bacteria 692
253 Ga0097621_100026917 3300006237 Bacteria 4518
254 Ga0097621_100042837 3300006237 Bacteria 3647
255 Ga0097621_100052155 3300006237 Bacteria 3331
256 Ga0097621_100111760 3300006237 Bacteria 2309
257 Ga0097621_100122739 3300006237 Bacteria 2205
258 Ga0097621_100224362 3300006237 Bacteria 1638
259 Ga0097621_100328607 3300006237 Bacteria 1356
260 Ga0097621_100455311 3300006237 Bacteria 1153
261 Ga0075370_10063487 3300006353 Bacteria 2106
262 Ga0068871_100004543 3300006358 Bacteria 9676
263 Ga0068871_100027418 3300006358 Bacteria 4455
264 Ga0068871_100057033 3300006358 Bacteria 3176
265 Ga0068871_100070141 3300006358 Bacteria 2880
266 Ga0068871_100423731 3300006358 Bacteria 1189
267 Ga0068871_100514148 3300006358 Bacteria 1081
268 Ga0068871_100687287 3300006358 Bacteria 937
269 Ga0075428_100003103 3300006844 Bacteria 18135
270 Ga0075428_100003581 3300006844 Bacteria 17019
271 Ga0075428_100064789 3300006844 Bacteria 4002
272 Ga0075428_100462431 3300006844 Bacteria 1358
273 Ga0075428_101533681 3300006844 Bacteria 698
274 Ga0075430_100031739 3300006846 Bacteria 4483
275 Ga0075430_100071111 3300006846 Bacteria 2919
276 Ga0075430_100152221 3300006846 Bacteria 1926
277 Ga0075430_100765455 3300006846 Bacteria 796
278 Ga0075431_100115141 3300006847 Bacteria 2775
279 Ga0075431_100380444 3300006847 Bacteria 1416
280 Ga0075431_100551041 3300006847 Bacteria 1140
281 Ga0075433_10002703 3300006852 Bacteria 13537
282 Ga0075433_10007266 3300006852 Bacteria 8779
283 Ga0075433_10042702 3300006852 Bacteria 3935
284 Ga0075433_10077410 3300006852 Bacteria 2929
285 Ga0075433_10121605 3300006852 Bacteria 2318
286 Ga0075433_10222961 3300006852 Bacteria 1675
287 Ga0075433_10742133 3300006852 Bacteria 859
288 Ga0075434_100106773 3300006871 Bacteria 2810
289 Ga0075434_100125714 3300006871 Bacteria 2581
290 Ga0075434_100131442 3300006871 Bacteria 2522
291 Ga0075434_100142019 3300006871 Bacteria 2421
292 Ga0075434_100290802 3300006871 Bacteria 1654
293 Ga0075429_100009795 3300006880 Bacteria 8308
294 Ga0075429_100032263 3300006880 Bacteria 4552
295 Ga0075429_100040458 3300006880 Bacteria 4059
296 Ga0068865_100079886 3300006881 Bacteria 2344
297 Ga0068865_100186756 3300006881 Bacteria 1600
298 Ga0068865_100477237 3300006881 Bacteria 1036
299 Ga0068865_100548084 3300006881 Bacteria 971
300 Ga0075436_100021765 3300006914 Bacteria 4400
301 Ga0097620_100044382 3300006931 Bacteria 4466
302 Ga0097620_100054978 3300006931 Bacteria 4005
303 Ga0097620_100097980 3300006931 Bacteria 2986
304 Ga0097620_100222585 3300006931 Bacteria 1975
305 Ga0097620_100277660 3300006931 Bacteria 1768
306 Ga0097620_100287858 3300006931 Bacteria 1736
307 Ga0097620_100384162 3300006931 Bacteria 1500
308 Ga0097620_100938759 3300006931 Bacteria 949
309 Ga0075435_100072545 3300007076 Bacteria 2813
310 Ga0075435_100212378 3300007076 Bacteria 1642
311 Ga0105240_10009675 3300009093 Bacteria 13623
312 Ga0105240_10039670 3300009093 Bacteria 6028
313 Ga0105240_10066680 3300009093 Bacteria 4464
314 Ga0105240_10266586 3300009093 Bacteria 1974
315 Ga0111539_10020906 3300009094 Bacteria 8059
316 Ga0111539_10044775 3300009094 Bacteria 5299
317 Ga0111539_10149185 3300009094 Bacteria 2737
318 Ga0111539_10193205 3300009094 Bacteria 2375
319 Ga0111539_10243297 3300009094 Bacteria 2095
320 Ga0111539_10437842 3300009094 Bacteria 1522
321 Ga0111539_10593850 3300009094 Bacteria 1289
322 Ga0111539_10910006 3300009094 Bacteria 1023
323 Ga0105245_10004394 3300009098 Bacteria 12472
324 Ga0105245_10049283 3300009098 Bacteria 3771
325 Ga0105245_10092392 3300009098 Bacteria 2787
326 Ga0105245_10107103 3300009098 Bacteria 2595
327 Ga0105245_11315165 3300009098 Bacteria 772
328 Ga0105247_10055431 3300009101 Bacteria 2446
329 Ga0105247_10063679 3300009101 Bacteria 2289
330 Ga0105247_10101011 3300009101 Bacteria 1844
331 Ga0105247_10191802 3300009101 Bacteria 1368
332 Ga0105247_10196358 3300009101 Bacteria 1353
333 Ga0114129_10007271 3300009147 Bacteria 15759
334 Ga0114129_10042855 3300009147 Bacteria 6369
335 Ga0114129_10112175 3300009147 Bacteria 3761
336 Ga0114129_10182085 3300009147 Bacteria 2858
337 Ga0114129_10252684 3300009147 Bacteria 2366
338 Ga0105243_10003748 3300009148 Bacteria 12182
339 Ga0105243_10006455 3300009148 Bacteria 9069
340 Ga0105243_11179020 3300009148 Bacteria 778
341 Ga0105241_10017318 3300009174 Bacteria 5293
342 Ga0105241_10195013 3300009174 Bacteria 1688
343 Ga0105241_10554888 3300009174 Bacteria 1032
344 Ga0105242_10000625 3300009176 Bacteria 27767
345 Ga0105242_10016272 3300009176 Bacteria 5782
346 Ga0105242_10069800 3300009176 Bacteria 2911
347 Ga0105242_10236224 3300009176 Bacteria 1641
348 Ga0105242_10366205 3300009176 Bacteria 1335
349 Ga0105242_10463615 3300009176 Unclassified 1197
350 Ga0105242_10546276 3300009176 Bacteria 1110
351 Ga0105248_10010944 3300009177 Bacteria 10011
352 Ga0105248_10064249 3300009177 Bacteria 4121
353 Ga0105248_10183571 3300009177 Bacteria 2357
354 Ga0105248_10193568 3300009177 Bacteria 2291
355 Ga0105248_10201487 3300009177 Bacteria 2242
356 Ga0105248_10201627 3300009177 Bacteria 2242
357 Ga0105248_10480509 3300009177 Bacteria 1400
358 Ga0105248_10508658 3300009177 Bacteria 1358
359 Ga0105248_10545290 3300009177 Bacteria 1308
360 Ga0105248_10897639 3300009177 Bacteria 1001
361 Ga0105248_11025688 3300009177 Unclassified 932
362 Ga0105237_10007932 3300009545 Bacteria 11569
363 Ga0105237_10063844 3300009545 Bacteria 3680
364 Ga0105237_10121841 3300009545 Bacteria 2602
365 Ga0105237_10641395 3300009545 Bacteria 1069
366 Ga0105237_11203104 3300009545 Bacteria 764
367 Ga0105238_10008287 3300009551 Bacteria 10395
368 Ga0105238_10009669 3300009551 Bacteria 9651
369 Ga0105238_10020506 3300009551 Bacteria 6730
370 Ga0105238_10057306 3300009551 Bacteria 3907
371 Ga0105238_10290633 3300009551 Bacteria 1617
372 Ga0105238_10796392 3300009551 Bacteria 961
373 Ga0105249_10005370 3300009553 Bacteria 11055
374 Ga0105249_10011309 3300009553 Bacteria 7834
375 Ga0105249_10127639 3300009553 Bacteria 2424
376 Ga0105249_11762940 3300009553 Bacteria 692
377 Ga0105249_12449632 3300009553 Bacteria 594
378 Ga0105239_10009648 3300010375 Bacteria 10856
379 Ga0105239_10032268 3300010375 Bacteria 5756
380 Ga0105239_10039386 3300010375 Bacteria 5179
381 Ga0105239_11042257 3300010375 Bacteria 941
382 Ga0105239_11772693 3300010375 Bacteria 715
383 Ga0105246_10020108 3300011119 Bacteria 4279
384 Ga0105246_10103741 3300011119 Bacteria 2075
385 Ga0157373_10113903 3300013100 Bacteria 1901
386 Ga0157371_10001397 3300013102 Bacteria 25234
387 Ga0157371_10223080 3300013102 Bacteria 1354
388 Ga0157370_10500923 3300013104 Bacteria 1115
389 Ga0157369_10003921 3300013105 Bacteria 17645
390 Ga0157369_10024215 3300013105 Bacteria 6756
391 Ga0157374_10002701 3300013296 Bacteria 14918
392 Ga0157374_10022714 3300013296 Bacteria 5600
393 Ga0157374_10339190 3300013296 Unclassified 1492
394 Ga0157374_10522993 3300013296 Bacteria 1192
395 Ga0157374_10562354 3300013296 Bacteria 1149
396 Ga0157378_10000883 3300013297 Bacteria 27658
397 Ga0157378_10191973 3300013297 Bacteria 1927
398 Ga0157378_10398718 3300013297 Bacteria 1355
399 Ga0157378_10439583 3300013297 Bacteria 1293
400 Ga0157378_10594990 3300013297 Unclassified 1117
401 Ga0157378_11386424 3300013297 Bacteria 746
402 Ga0163162_10028285 3300013306 Bacteria 5546
403 Ga0163162_10068705 3300013306 Bacteria 3595
404 Ga0163162_10094827 3300013306 Bacteria 3071
405 Ga0163162_10138974 3300013306 Bacteria 2541
406 Ga0163162_10341282 3300013306 Bacteria 1630
407 Ga0163162_10565663 3300013306 Bacteria 1264
408 Ga0163162_10662471 3300013306 Bacteria 1167
409 Ga0157372_10026677 3300013307 Bacteria 6287
410 Ga0157372_10190754 3300013307 Bacteria 2374
411 Ga0157372_10513383 3300013307 Bacteria 1397
412 Ga0157375_10029464 3300013308 Bacteria 5162
413 Ga0157375_10046103 3300013308 Bacteria 4247
414 Ga0157375_10073608 3300013308 Bacteria 3436
415 Ga0157375_10217326 3300013308 Bacteria 2069
416 Ga0157375_10217514 3300013308 Unclassified 2068
417 Ga0157375_10237277 3300013308 Bacteria 1983
418 Ga0157375_10282234 3300013308 Unclassified 1824
419 Ga0157375_10659296 3300013308 Bacteria 1202
420 Ga0157375_10660415 3300013308 Bacteria 1201
421 Ga0157375_11405152 3300013308 Unclassified 822
422 Ga0163163_10010355 3300014325 Bacteria 8378
423 Ga0163163_10010833 3300014325 Bacteria 8233
424 Ga0163163_10015048 3300014325 Bacteria 7135
425 Ga0163163_10068733 3300014325 Bacteria 3525
426 Ga0163163_10126847 3300014325 Bacteria 2590
427 Ga0163163_10156008 3300014325 Bacteria 2327
428 Ga0163163_10171334 3300014325 Bacteria 2217
429 Ga0163163_11157448 3300014325 Bacteria 836
430 Ga0157380_10001092 3300014326 Bacteria 17458
431 Ga0157380_10002804 3300014326 Bacteria 11852
432 Ga0157380_10009280 3300014326 Bacteria 7041
433 Ga0157380_10023078 3300014326 Bacteria 4692
434 Ga0157380_10024170 3300014326 Bacteria 4595
435 Ga0157380_10046199 3300014326 Bacteria 3419
436 Ga0157380_10210961 3300014326 Bacteria 1730
437 Ga0182008_10438669 3300014497 Bacteria 708
438 Ga0157377_10005858 3300014745 Bacteria 5813
439 Ga0157377_10005921 3300014745 Bacteria 5786
440 Ga0157379_10007907 3300014968 Bacteria 9218
441 Ga0157379_10077358 3300014968 Bacteria 2979
442 Ga0157379_10078363 3300014968 Bacteria 2959
443 Ga0157379_10317531 3300014968 Bacteria 1422
444 Ga0157376_10003812 3300014969 Bacteria 10428
445 Ga0157376_10169407 3300014969 Bacteria 1987
446 Ga0157376_10182151 3300014969 Unclassified 1921
447 Ga0157376_10911235 3300014969 Bacteria 898
448 Ga0163161_10007774 3300017792 Bacteria 7416
449 Ga0163161_10083472 3300017792 Bacteria 2355
450 Ga0163161_10721808 3300017792 Bacteria 831
451 Ga0163161_11232302 3300017792 Bacteria 648
452 Ga0213875_10119446 3300021388 Bacteria 1232
453 Ga0209233_1010598 3300025261 Bacteria 2752
454 Ga0207666_1008363 3300025271 Bacteria 1381
455 Ga0207697_10004353 3300025315 Bacteria 6776
456 Ga0207697_10212691 3300025315 Bacteria 852
457 Ga0207697_10293586 3300025315 Bacteria 721
458 Ga0207656_10014137 3300025321 Unclassified 3068
459 Ga0207656_10215720 3300025321 Bacteria 931
460 Ga0207653_10053536 3300025885 Bacteria 1348
461 Ga0207682_10004378 3300025893 Bacteria 5919
462 Ga0207682_10023195 3300025893 Bacteria 2450
463 Ga0207682_10063310 3300025893 Bacteria 1552
464 Ga0207692_10019729 3300025898 Bacteria 3052
465 Ga0207642_10063195 3300025899 Bacteria 1731
466 Ga0207710_10006721 3300025900 Bacteria 4902
467 Ga0207710_10184087 3300025900 Bacteria 1026
468 Ga0207688_10001861 3300025901 Bacteria 11294
469 Ga0207688_10004685 3300025901 Bacteria 7455
470 Ga0207688_10075313 3300025901 Bacteria 1920
471 Ga0207680_10025799 3300025903 Bacteria 3247
472 Ga0207680_10050163 3300025903 Bacteria 2488
473 Ga0207680_10113380 3300025903 Bacteria 1762
474 Ga0207647_10001143 3300025904 Bacteria 20401
475 Ga0207647_10002513 3300025904 Bacteria 13884
476 Ga0207647_10291093 3300025904 Bacteria 931
477 Ga0207685_10001153 3300025905 Bacteria 5291
478 Ga0207699_10000023 3300025906 Bacteria 172262
479 Ga0207699_10002922 3300025906 Bacteria 8125
480 Ga0207699_10016771 3300025906 Bacteria 3840
481 Ga0207645_10001886 3300025907 Bacteria 16931
482 Ga0207645_10013795 3300025907 Bacteria 5423
483 Ga0207645_10065537 3300025907 Bacteria 2322
484 Ga0207643_10001606 3300025908 Bacteria 12771
485 Ga0207643_10076094 3300025908 Bacteria 1938
486 Ga0207643_10193412 3300025908 Bacteria 1236
487 Ga0207643_10412426 3300025908 Bacteria 855
488 Ga0207705_10004816 3300025909 Bacteria 10159
489 Ga0207684_10097720 3300025910 Bacteria 2507
490 Ga0207654_10034722 3300025911 Bacteria 2804
491 Ga0207654_10132678 3300025911 Bacteria 1578
492 Ga0207654_10284018 3300025911 Bacteria 1120
493 Ga0207707_10018330 3300025912 Bacteria 6101
494 Ga0207695_10111984 3300025913 Bacteria 2708
495 Ga0207671_10080008 3300025914 Bacteria 2449
496 Ga0207693_10000062 3300025915 Bacteria 92689
497 Ga0207693_10054271 3300025915 Bacteria 3144
498 Ga0207663_10287503 3300025916 Bacteria 1223
499 Ga0207660_10006205 3300025917 Bacteria 7763
500 Ga0207660_10301396 3300025917 Bacteria 1276
501 Ga0207662_10011936 3300025918 Bacteria 4832
502 Ga0207662_10044572 3300025918 Bacteria 2619
503 Ga0207662_10194844 3300025918 Bacteria 1309
504 Ga0207657_10000023 3300025919 Bacteria 152701
505 Ga0207657_10066336 3300025919 Bacteria 3073
506 Ga0207657_10341299 3300025919 Bacteria 1182
507 Ga0207649_10007494 3300025920 Bacteria 5932
508 Ga0207649_10011110 3300025920 Unclassified 4956
509 Ga0207649_10061760 3300025920 Bacteria 2360
510 Ga0207652_10074063 3300025921 Bacteria 2964
511 Ga0207652_10103590 3300025921 Bacteria 2516
512 Ga0207652_10147888 3300025921 Bacteria 2103
513 Ga0207652_10162998 3300025921 Bacteria 1999
514 Ga0207681_10098499 3300025923 Bacteria 2103
515 Ga0207681_10104127 3300025923 Bacteria 2052
516 Ga0207681_10174711 3300025923 Bacteria 1631
517 Ga0207694_10052676 3300025924 Bacteria 3154
518 Ga0207694_10080466 3300025924 Archaea 2557
519 Ga0207694_10108667 3300025924 Bacteria 2204
520 Ga0207694_10173659 3300025924 Bacteria 1746
521 Ga0207694_10237719 3300025924 Bacteria 1488
522 Ga0207694_10334667 3300025924 Bacteria 1251
523 Ga0207650_10028583 3300025925 Bacteria 4000
524 Ga0207650_10084576 3300025925 Bacteria 2412
525 Ga0207650_10953285 3300025925 Bacteria 729
526 Ga0207659_10034244 3300025926 Bacteria 3500
527 Ga0207659_10059751 3300025926 Bacteria 2741
528 Ga0207659_10070159 3300025926 Bacteria 2555
529 Ga0207659_10096594 3300025926 Unclassified 2218
530 Ga0207659_10109477 3300025926 Bacteria 2097
531 Ga0207659_10266375 3300025926 Bacteria 1396
532 Ga0207659_10293698 3300025926 Bacteria 1332
533 Ga0207659_10767777 3300025926 Bacteria 827
534 Ga0207687_10035473 3300025927 Bacteria 3392
535 Ga0207687_10050816 3300025927 Bacteria 2887
536 Ga0207687_10089575 3300025927 Bacteria 2240
537 Ga0207687_10175618 3300025927 Bacteria 1656
538 Ga0207687_10178665 3300025927 Bacteria 1643
539 Ga0207687_10471611 3300025927 Bacteria 1044
540 Ga0207687_10667397 3300025927 Bacteria 880
541 Ga0207700_10054283 3300025928 Bacteria 3007
542 Ga0207700_10194257 3300025928 Bacteria 1707
543 Ga0207700_10348509 3300025928 Bacteria 1289
544 Ga0207700_10492153 3300025928 Bacteria 1084
545 Ga0207664_10064715 3300025929 Bacteria 2925
546 Ga0207664_10070151 3300025929 Bacteria 2820
547 Ga0207644_10007715 3300025931 Bacteria 7022
548 Ga0207644_10071237 3300025931 Bacteria 2543
549 Ga0207644_10242625 3300025931 Bacteria 1435
550 Ga0207644_10258653 3300025931 Bacteria 1391
551 Ga0207644_10278335 3300025931 Bacteria 1343
552 Ga0207644_10368656 3300025931 Bacteria 1169
553 Ga0207644_10688171 3300025931 Bacteria 852
554 Ga0207690_10001570 3300025932 Bacteria 14298
555 Ga0207690_10108578 3300025932 Bacteria 1994
556 Ga0207690_10227945 3300025932 Bacteria 1429
557 Ga0207706_10000019 3300025933 Bacteria 167592
558 Ga0207706_10013547 3300025933 Bacteria 7410
559 Ga0207706_10110288 3300025933 Bacteria 2421
560 Ga0207706_10145157 3300025933 Bacteria 2087
561 Ga0207706_10179547 3300025933 Bacteria 1859
562 Ga0207706_10505488 3300025933 Bacteria 1043
563 Ga0207706_10924000 3300025933 Bacteria 736
564 Ga0207686_10003964 3300025934 Bacteria 7944
565 Ga0207686_10020702 3300025934 Bacteria 3762
566 Ga0207686_10499393 3300025934 Unclassified 944
567 Ga0207709_10041407 3300025935 Bacteria 2764
568 Ga0207670_10164225 3300025936 Bacteria 1660
569 Ga0207670_10325420 3300025936 Unclassified 1211
570 Ga0207669_10001163 3300025937 Bacteria 11204
571 Ga0207669_10090611 3300025937 Bacteria 1989
572 Ga0207669_10126618 3300025937 Bacteria 1746
573 Ga0207704_10128267 3300025938 Bacteria 1751
574 Ga0207704_10166029 3300025938 Bacteria 1577
575 Ga0207704_10694996 3300025938 Bacteria 842
576 Ga0207704_11036018 3300025938 Bacteria 695
577 Ga0207665_10011412 3300025939 Bacteria 5835
578 Ga0207665_10074221 3300025939 Bacteria 2328
579 Ga0207665_10204761 3300025939 Bacteria 1439
580 Ga0207691_10005730 3300025940 Bacteria 12011
581 Ga0207691_10032348 3300025940 Bacteria 4877
582 Ga0207691_10200283 3300025940 Bacteria 1738
583 Ga0207691_10283656 3300025940 Bacteria 1425
584 Ga0207691_10299234 3300025940 Bacteria 1382
585 Ga0207691_10319261 3300025940 Bacteria 1332
586 Ga0207691_10687090 3300025940 Bacteria 863
587 Ga0207711_10050407 3300025941 Bacteria 3564
588 Ga0207711_10084899 3300025941 Bacteria 2772
589 Ga0207711_10110486 3300025941 Bacteria 2444
590 Ga0207711_10136550 3300025941 Bacteria 2203
591 Ga0207711_10173193 3300025941 Bacteria 1959
592 Ga0207711_10247665 3300025941 Bacteria 1635
593 Ga0207711_10314397 3300025941 Bacteria 1446
594 Ga0207711_10462272 3300025941 Bacteria 1182
595 Ga0207689_10007881 3300025942 Bacteria 9303
596 Ga0207689_10021954 3300025942 Bacteria 5368
597 Ga0207689_10096152 3300025942 Bacteria 2433
598 Ga0207661_10161349 3300025944 Bacteria 1945
599 Ga0207679_10009243 3300025945 Bacteria 6303
600 Ga0207679_10091636 3300025945 Bacteria 2353
601 Ga0207679_10214584 3300025945 Bacteria 1616
602 Ga0207679_10661966 3300025945 Bacteria 945
603 Ga0207667_10031979 3300025949 Bacteria 5675
604 Ga0207667_10087973 3300025949 Bacteria 3213
605 Ga0207667_10226245 3300025949 Bacteria 1916
606 Ga0207667_10335387 3300025949 Bacteria 1544
607 Ga0207651_10002030 3300025960 Bacteria 9514
608 Ga0207651_10035540 3300025960 Bacteria 3242
609 Ga0207712_10060935 3300025961 Bacteria 2677
610 Ga0207712_10340471 3300025961 Bacteria 1243
611 Ga0207668_10328687 3300025972 Bacteria 1271
612 Ga0207668_10742477 3300025972 Bacteria 865
613 Ga0207668_11255798 3300025972 Bacteria 666
614 Ga0207640_10082434 3300025981 Bacteria 2202
615 Ga0207658_10009595 3300025986 Bacteria 6567
616 Ga0207658_10184965 3300025986 Bacteria 1727
617 Ga0207658_11606704 3300025986 Bacteria 594
618 Ga0207677_10043216 3300026023 Bacteria 2994
619 Ga0207677_10096052 3300026023 Bacteria 2167
620 Ga0207677_10211793 3300026023 Bacteria 1548
621 Ga0207677_10747402 3300026023 Bacteria 871
622 Ga0207703_10016015 3300026035 Bacteria 5847
623 Ga0207703_10109299 3300026035 Bacteria 2356
624 Ga0207703_10127589 3300026035 Bacteria 2192
625 Ga0207703_10211651 3300026035 Bacteria 1729
626 Ga0207703_10282013 3300026035 Bacteria 1509
627 Ga0207703_10448159 3300026035 Bacteria 1205
628 Ga0207703_10584508 3300026035 Bacteria 1055
629 Ga0207639_10011869 3300026041 Bacteria 6059
630 Ga0207678_10000017 3300026067 Bacteria 135871
631 Ga0207678_10063470 3300026067 Bacteria 3174
632 Ga0207678_10073781 3300026067 Bacteria 2924
633 Ga0207708_10152409 3300026075 Bacteria 1821
634 Ga0207708_10204404 3300026075 Unclassified 1577
635 Ga0207708_10831816 3300026075 Bacteria 796
636 Ga0207708_11177029 3300026075 Bacteria 670
637 Ga0207702_10004333 3300026078 Bacteria 12660
638 Ga0207702_10062092 3300026078 Bacteria 3189
639 Ga0207702_10105748 3300026078 Bacteria 2493
640 Ga0207702_11143314 3300026078 Bacteria 773
641 Ga0207641_10059746 3300026088 Bacteria 3247
642 Ga0207641_10107016 3300026088 Bacteria 2473
643 Ga0207641_10129420 3300026088 Bacteria 2265
644 Ga0207641_10590048 3300026088 Bacteria 1087
645 Ga0207641_10672803 3300026088 Bacteria 1018
646 Ga0207641_11063129 3300026088 Bacteria 807
647 Ga0207641_11341288 3300026088 Bacteria 716
648 Ga0207648_10013217 3300026089 Bacteria 7692
649 Ga0207648_10016982 3300026089 Bacteria 6633
650 Ga0207648_10046692 3300026089 Bacteria 3797
651 Ga0207648_10105837 3300026089 Bacteria 2468
652 Ga0207648_10196574 3300026089 Bacteria 1788
653 Ga0207648_10272125 3300026089 Bacteria 1513
654 Ga0207648_11073953 3300026089 Bacteria 755
655 Ga0207676_10088033 3300026095 Bacteria 2541
656 Ga0207676_10090797 3300026095 Bacteria 2508
657 Ga0207676_10254733 3300026095 Bacteria 1582
658 Ga0207676_10287212 3300026095 Bacteria 1496
659 Ga0207676_10302199 3300026095 Bacteria 1462
660 Ga0207676_10405238 3300026095 Bacteria 1275
661 Ga0207676_10777047 3300026095 Bacteria 933
662 Ga0207674_10002409 3300026116 Bacteria 23603
663 Ga0207674_10040702 3300026116 Bacteria 4812
664 Ga0207674_10053376 3300026116 Bacteria 4120
665 Ga0207675_100001862 3300026118 Bacteria 21118
666 Ga0207675_100008725 3300026118 Bacteria 9524
667 Ga0207675_100012999 3300026118 Bacteria 7771
668 Ga0207675_100024698 3300026118 Bacteria 5589
669 Ga0207675_100081043 3300026118 Bacteria 3043
670 Ga0207675_100361629 3300026118 Bacteria 1424
671 Ga0207675_101473660 3300026118 Bacteria 701
672 Ga0207683_10000030 3300026121 Bacteria 109087
673 Ga0207683_10016973 3300026121 Bacteria 6196
674 Ga0207683_10040252 3300026121 Bacteria 4077
675 Ga0207683_10066384 3300026121 Bacteria 3181
676 Ga0207683_10252929 3300026121 Bacteria 1608
677 Ga0207683_10388072 3300026121 Bacteria 1284
678 Ga0207683_10599122 3300026121 Bacteria 1020
679 Ga0207698_10036649 3300026142 Unclassified 3603
680 Ga0209998_10003783 3300027717 Bacteria 3269
681 Ga0207428_10018650 3300027907 Bacteria 5923
682 Ga0207428_10030434 3300027907 Bacteria 4462
683 Ga0207428_10176531 3300027907 Bacteria 1615
684 Ga0207428_10291340 3300027907 Bacteria 1210
685 Ga0268266_10003760 3300028379 Bacteria 14894
686 Ga0268266_10110669 3300028379 Bacteria 2433
687 Ga0268266_10140552 3300028379 Bacteria 2167
688 Ga0268266_10547478 3300028379 Bacteria 1108
689 Ga0268265_10034946 3300028380 Bacteria 3668
690 Ga0268265_10041217 3300028380 Bacteria 3415
691 Ga0268265_10116542 3300028380 Bacteria 2192
692 Ga0268265_10262454 3300028380 Bacteria 1536
693 Ga0268265_10650021 3300028380 Bacteria 1013
694 Ga0268264_10135133 3300028381 Bacteria 2191
695 Ga0268264_10144467 3300028381 Bacteria 2125
696 Ga0268264_10186447 3300028381 Bacteria 1888
697 Ga0265318_10000028 3300028577 Bacteria 149330
698 Ga0307515_10024150 3300028794 Bacteria 10608
699 Ga0265330_10000021 3300031235 Bacteria 154495
700 Ga0265332_10000109 3300031238 Bacteria 70186
701 Ga0265328_10006140 3300031239 Bacteria 5110
702 Ga0265328_10028334 3300031239 Bacteria 2095
703 Ga0265320_10000033 3300031240 Bacteria 141362
704 Ga0265329_10005186 3300031242 Bacteria 5300
705 Ga0265339_10007818 3300031249 Bacteria 6865
706 Ga0265339_10155181 3300031249 Bacteria 1155
707 Ga0265331_10000269 3300031250 Bacteria 58263
708 Ga0265316_10004308 3300031344 Bacteria 14215
709 Ga0307408_100544119 3300031548 Bacteria 1023
710 Ga0265313_10000243 3300031595 Bacteria 59382
711 Ga0265314_10000407 3300031711 Bacteria 58254
712 Ga0265342_10056617 3300031712 Bacteria 2323
713 Ga0265342_10139042 3300031712 Bacteria 1356
714 Ga0307406_10447565 3300031901 Bacteria 1035
715 Ga0307406_10550548 3300031901 Bacteria 944
716 Ga0307409_100944809 3300031995 Bacteria 878
717 Ga0307415_100673749 3300032126 Bacteria 930
718 Ga0373959_0013533 3300034820 Bacteria 1473
719 Ga0373929_0031666 3300035085 Bacteria 1134
720 Ga0373934_0009692 3300035086 Bacteria 3611
721 Ga0373944_0163859 3300035089 Bacteria 790
722 Ga0373949_0067469 3300035090 Bacteria 931
723 Ga0373952_0018926 3300035092 Bacteria 1428
724 Ga0373941_0075864 3300035115 Bacteria 1126
725 Ga0373954_0084958 3300035118 Bacteria 1515
726 Ga0373956_0407604 3300035119 Bacteria 649
727 Ga0373957_0043134 3300035120 Bacteria 1704
728 Ga0373957_0080490 3300035120 Bacteria 1286
729 Ga0373957_0184144 3300035120 Unclassified 866
730 Ga0373960_0002714 3300035121 Bacteria 4002
731 Ga0373960_0219653 3300035121 Bacteria 679
732 Ga0373946_0232500 3300035171 Bacteria 894
733 Ga0373946_0292154 3300035171 Bacteria 804
734 Ga0373955_0014740 3300035172 Bacteria 3812
735 Ga0373955_0021914 3300035172 Bacteria 3232
736 Ga0373942_0038264 3300035207 Bacteria 1300
737 Ga0373961_0017692 3300035241 Bacteria 1853
738 Ga0373961_0053038 3300035241 Bacteria 1209
739 Ga0373924_0156831 3300035410 Bacteria 997
740 Ga0373931_0071222 3300035691 Bacteria 1898
741 Ga0373935_0007410 3300035692 Bacteria 6567
742 Ga0373927_0612800 3300035695 Bacteria 720
743 Ga0373933_0070566 3300035724 Bacteria 2125
744 Ga0373933_0196342 3300035724 Bacteria 1290
745 Ga0373933_0439377 3300035724 Unclassified 853
746 Ga0373947_0096490 3300035725 Bacteria 1851
747 Ga0373947_0233360 3300035725 Bacteria 1212
748 Ga0373947_0864854 3300035725 Bacteria 617
749 Ga0373937_0021712 3300036401 Bacteria 5762
750 Ga0373937_0029968 3300036401 Bacteria 4928
751 Ga0373937_0069721 3300036401 Bacteria 3241
752 Ga0373937_0406121 3300036401 Bacteria 1292
753 Ga0373937_0446274 3300036401 Unclassified 1228
754 Ga0373925_0008746 3300037068 Bacteria 7375
755 Ga0373925_0211832 3300037068 Bacteria 1544
756 Ga0373925_1070894 3300037068 Bacteria 663
757 Ga0395900_0010443 3300037418 Bacteria 9498
758 Ga0395898_0005102 3300037466 Bacteria 14228
759 Ga0395905_0001187 3300037471 Bacteria 32583
760 Ga0436364_0161511 3300037853 Bacteria 1309
761 Ga0395901_0004977 3300038443 Bacteria 13412
762 Ga0436365_1205066 3300039437 Bacteria 1130
763 Ga0436363_0472001 3300039450 Bacteria 1459
764 Ga0436363_0635467 3300039450 Bacteria 753
765 Ga0451791_0425912 3300041451 Bacteria 7355
766 Ga0451793_1168330 3300041452 Bacteria 2048
767 Ga0451807_0390813 3300041486 Bacteria 949
768 Ga0451835_1164105 3300041492 Bacteria 737
769 Ga0451837_1730596 3300041494 Bacteria 3305
770 Ga0451853_2006785 3300041512 Bacteria 1078
771 Ga0439450_012171 3300042008 Bacteria 1702
772 Ga0439460_0189755 3300042461 Bacteria 697
773 Ga0466965_0112024 3300044683 Bacteria 1403
774 Ga0451576_0176041 3300045051 Bacteria 2233
775 Ga0451576_0880679 3300045051 Bacteria 940
776 Ga0495592_0023234 3300046454 Bacteria 4716
777 Ga0495603_0032826 3300046455 Bacteria 3123
778 Ga0495603_0058322 3300046455 Bacteria 2283
779 Ga0495629_0002336 3300046459 Bacteria 14611
780 Ga0495629_0020109 3300046459 Bacteria 4767
781 Ga0495638_0007555 3300046460 Bacteria 7776
782 Ga0495651_0088045 3300046462 Bacteria 2334
783 Ga0495653_0160614 3300046463 Bacteria 1560
784 Ga0495580_0012220 3300046472 Bacteria 6596
785 Ga0495580_0029386 3300046472 Bacteria 3990
786 Ga0495580_0202065 3300046472 Bacteria 1369
787 Ga0495580_0340609 3300046472 Unclassified 1017
788 Ga0495580_0472184 3300046472 Bacteria 840
789 Ga0495582_0004953 3300046473 Bacteria 7461
790 Ga0495582_0017511 3300046473 Bacteria 3920
791 Ga0495582_0046403 3300046473 Bacteria 2393
792 Ga0495639_0014053 3300046475 Bacteria 3463
793 Ga0495639_0014419 3300046475 Bacteria 3422
794 Ga0495662_0054701 3300046476 Bacteria 1928
795 Ga0495664_0000333 3300046477 Bacteria 22748
796 Ga0495584_0367880 3300046491 Bacteria 730
797 Ga0495594_0003018 3300046499 Bacteria 8723
798 Ga0495594_0102268 3300046499 Bacteria 1612
799 Ga0495608_0030718 3300046511 Bacteria 3635
800 Ga0495608_0241904 3300046511 Bacteria 1127
801 Ga0495616_0329362 3300046513 Bacteria 640
802 Ga0495628_0030816 3300046516 Bacteria 4341
803 Ga0495628_0654922 3300046516 Bacteria 745
804 Ga0495663_0087726 3300046525 Bacteria 1010
805 Ga0495652_0098192 3300046529 Bacteria 2381
806 Ga0495665_0004188 3300046531 Bacteria 7783
807 Ga0495665_0385811 3300046531 Bacteria 711
808 Ga0495640_0159002 3300046533 Bacteria 1449
809 Ga0495586_0359069 3300046535 Bacteria 837
810 Ga0495587_0434919 3300046536 Bacteria 727
811 Ga0495645_0002274 3300046543 Bacteria 13070
812 Ga0495645_0392139 3300046543 Bacteria 886
813 Ga0495633_0029603 3300046558 Bacteria 2664
814 Ga0495667_0016689 3300046559 Bacteria 4957
815 Ga0495667_0397307 3300046559 Bacteria 868
816 Ga0495656_0255110 3300046615 Unclassified 887
817 Ga0495634_0085252 3300046642 Bacteria 2059
818 Ga0495635_0974506 3300046663 Bacteria 540
819 Ga0495659_0022207 3300046664 Bacteria 2145
820 Ga0495659_0199160 3300046664 Bacteria 821
821 Ga0495588_0006683 3300046674 Bacteria 5210
822 Ga0495588_0047773 3300046674 Bacteria 2198
823 Ga0495657_0580465 3300046675 Bacteria 649
824 Ga0495623_0052720 3300046679 Bacteria 2570
825 Ga0495623_0087191 3300046679 Bacteria 1923
826 Ga0495647_0050838 3300046681 Bacteria 1609
827 Ga0495658_0002334 3300046683 Bacteria 9581
828 Ga0495658_0056456 3300046683 Bacteria 2239
829 Ga0495658_0176673 3300046683 Bacteria 1323
830 Ga0495658_0345499 3300046683 Unclassified 945
831 Ga0495613_0007152 3300046689 Bacteria 8310
832 Ga0495613_0008513 3300046689 Bacteria 7614
833 Ga0495613_0173742 3300046689 Bacteria 1528
834 Ga0495613_0309324 3300046689 Bacteria 1092
835 Ga0495670_0105669 3300046691 Bacteria 1454
836 Ga0495600_0122339 3300046809 Bacteria 1692
837 Ga0495581_0002779 3300047315 Bacteria 9977
838 Ga0495581_0296110 3300047315 Bacteria 946
839 Ga0495604_0120194 3300047317 Bacteria 1903
840 Ga0495636_0110617 3300047318 Bacteria 1209
841 Ga0495636_0170225 3300047318 Unclassified 985
842 Ga0495674_0046938 3300047319 Bacteria 3832
843 Ga0495680_0327790 3300047322 Bacteria 1070
844 Ga0495680_0499827 3300047322 Bacteria 825
845 Ga0495675_0010924 3300047444 Bacteria 5691
846 Ga0495675_0109521 3300047444 Bacteria 1725
847 Ga0495684_0006352 3300047471 Bacteria 9185
848 Ga0495684_0336797 3300047471 Bacteria 1075
849 Ga0495602_0037692 3300048088 Bacteria 4481
850 Ga0495615_0006971 3300048090 Bacteria 2123
851 Ga0496100_0046285 3300048903 Bacteria 2796
852 Ga0496100_0340515 3300048903 Bacteria 1131
853 Ga0496100_0485896 3300048903 Bacteria 950
854 Ga0496101_0036985 3300048904 Bacteria 3460
855 Ga0496101_0370739 3300048904 Bacteria 1126
856 Ga0496101_0867947 3300048904 Unclassified 711
857 Ga0496102_0016084 3300048905 Bacteria 6531
858 Ga0496102_0049330 3300048905 Bacteria 3829
859 Ga0496103_0061681 3300048906 Bacteria 2332
860 Ga0496103_0382799 3300048906 Bacteria 904
861 Ga0496104_0145003 3300048907 Bacteria 2280
862 Ga0496105_0012056 3300048908 Bacteria 6842
863 Ga0496105_0123938 3300048908 Bacteria 2130
864 Ga0496106_0090070 3300048909 Bacteria 2367
865 Ga0496106_1250844 3300048909 Bacteria 578
866 Ga0496106_1429891 3300048909 Bacteria 534
867 Ga0496107_0078396 3300048910 Bacteria 2407
868 Ga0496108_0009744 3300048911 Bacteria 7782
869 Ga0496108_0078797 3300048911 Bacteria 2789
870 Ga0496108_0178294 3300048911 Bacteria 1840
871 Ga0496108_0426824 3300048911 Bacteria 1158
872 Ga0496109_0390710 3300048912 Bacteria 1314
873 Ga0496109_0634996 3300048912 Bacteria 1005
874 Ga0496110_0033401 3300048913 Bacteria 4451
875 Ga0496110_0068171 3300048913 Bacteria 3148
876 Ga0496110_0155147 3300048913 Bacteria 2074
877 Ga0496111_0006483 3300048914 Bacteria 7602
878 Ga0496111_0119431 3300048914 Bacteria 1947
879 Ga0496111_0122354 3300048914 Bacteria 1922
880 Ga0496112_0017078 3300048915 Bacteria 6812
881 Ga0496112_0315973 3300048915 Bacteria 1507
882 Ga0496113_0055899 3300048916 Bacteria 2961
883 Ga0496113_0092509 3300048916 Bacteria 2332
884 Ga0496113_0552337 3300048916 Bacteria 924
885 Ga0496114_0034580 3300048917 Bacteria 4170
886 Ga0496114_0057292 3300048917 Bacteria 3253
887 Ga0496114_0728052 3300048917 Bacteria 868
888 Ga0496114_0798141 3300048917 Bacteria 823
889 Ga0496115_0185867 3300048918 Bacteria 1717
890 Ga0496124_0260749 3300048927 Bacteria 1276
891 Ga0501033_0379260 3300049570 Bacteria 988
892 Ga0501039_0046589 3300049575 Bacteria 3350
893 Ga0501040_0544773 3300049576 Bacteria 837
894 Ga0501046_0017726 3300049580 Bacteria 5940
895 Ga0501046_0146541 3300049580 Bacteria 1783
896 Ga0501047_0100701 3300049581 Bacteria 2769
897 Ga0501047_0555275 3300049581 Unclassified 972
898 Ga0501048_0162999 3300049582 Bacteria 1578
899 Ga0501068_0000034 3300049584 Bacteria 50744
900 Ga0501070_0026357 3300049586 Bacteria 4878
901 Ga0501073_0000917 3300049589 Bacteria 21211
902 Ga0501074_0061973 3300049590 Bacteria 2695
903 Ga0501075_0173901 3300049591 Bacteria 1643
904 Ga0501208_096142 3300049655 Bacteria 629
905 Ga0501079_0022279 3300049741 Bacteria 4857
906 Ga0501080_0001918 3300049742 Bacteria 17932
907 Ga0501081_0032439 3300049743 Bacteria 3543
908 Ga0501083_0303037 3300049744 Bacteria 1039
909 Ga0501035_0439320 3300049822 Unclassified 1081
910 Ga0501035_0790061 3300049822 Bacteria 759
911 nmdc:mga0k408_392182_c1 3300050493 Bacteria 827
912 nmdc:mga06z11_26892_c1 3300050494 Bacteria 1572
913 nmdc:mga04h51_213660_c1 3300050495 Bacteria 762
914 nmdc:mga07m45_473908_c1 3300050496 Bacteria 725
915 nmdc:mga05p37_206_c1 3300050507 Bacteria 59272
916 nmdc:mga05p37_2898_c1 3300050507 Bacteria 19902
917 nmdc:mga05p37_36389_c1 3300050507 Bacteria 6039
918 nmdc:mga05p37_398050_c1 3300050507 Bacteria 1609
919 nmdc:mga05p37_458769_c1 3300050507 Bacteria 1473
920 nmdc:mga09592_18451_c1 3300050508 Bacteria 5723
921 nmdc:mga09592_69610_c1 3300050508 Bacteria 2985
922 nmdc:mga0qj67_11157_c1 3300050509 Bacteria 6727
923 nmdc:mga0qj67_171677_c1 3300050509 Bacteria 1761
924 nmdc:mga0qj67_551861_c1 3300050509 Bacteria 924
925 nmdc:mga0qj67_617945_c1 3300050509 Bacteria 866
926 nmdc:mga06r32_458590_c1 3300050510 Bacteria 1254
927 nmdc:mga06r32_799_c1 3300050510 Bacteria 27881
928 nmdc:mga06r32_980126_c1 3300050510 Bacteria 799
929 nmdc:mga08y16_114982_c1 3300050511 Bacteria 2801
930 nmdc:mga08y16_139483_c1 3300050511 Bacteria 2520
931 nmdc:mga08y16_1538294_c1 3300050511 Bacteria 625
932 nmdc:mga08y16_301164_c1 3300050511 Bacteria 1653
933 nmdc:mga08y16_447495_c1 3300050511 Bacteria 1318
934 nmdc:mga08y16_582_c1 3300050511 Bacteria 33956
935 nmdc:mga08y16_65120_c1 3300050511 Bacteria 3805
936 nmdc:mga08y16_75983_c1 3300050511 Bacteria 3501
937 nmdc:mga0n895_34673_c1 3300050512 Bacteria 4860
938 nmdc:mga0n895_5597_c1 3300050512 Bacteria 10517
939 nmdc:mga0n895_567815_c1 3300050512 Bacteria 1139
940 nmdc:mga0n895_5837_c1 3300050512 Bacteria 10348
941 nmdc:mga0rr50_174897_c1 3300050513 Bacteria 1752
942 nmdc:mga0rr50_257591_c1 3300050513 Unclassified 1451
943 nmdc:mga0rr50_265839_c1 3300050513 Bacteria 1428
944 nmdc:mga0a205_107507_c1 3300050515 Bacteria 2688
945 nmdc:mga0a205_125177_c1 3300050515 Bacteria 2470
946 nmdc:mga0a205_128765_c1 3300050515 Unclassified 2432
947 nmdc:mga0a205_143542_c1 3300050515 Bacteria 2287
948 nmdc:mga0a205_145383_c1 3300050515 Bacteria 2271
949 nmdc:mga0a205_187937_c1 3300050515 Bacteria 1958
950 nmdc:mga0a205_322269_c1 3300050515 Bacteria 1416
951 nmdc:mga0a205_870631_c1 3300050515 Bacteria 748
952 Ga0495601_0000594 3300053077 Bacteria 19263
953 Ga0495612_0006686 3300053078 Bacteria 4728
954 Ga0495595_0158647 3300053084 Bacteria 1115
955 Ga0495595_0178727 3300053084 Bacteria 1052
956 Ga0495619_0008571 3300053085 Bacteria 6472
957 Ga0495619_0030525 3300053085 Bacteria 3489
958 Ga0495619_0412267 3300053085 Bacteria 932
959 Ga0495619_1024858 3300053085 Bacteria 551
960 Ga0500646_0096956 3300053090 Bacteria 921
961 Ga0500650_0150811 3300053098 Bacteria 1075
962 Ga0500652_038333 3300053131 Unclassified 1917
963 Ga0500616_0046141 3300053153 Bacteria 2317
964 Ga0500622_0001491 3300053156 Bacteria 18620
965 Ga0501084_0010489 3300054114 Bacteria 7659
966 Ga0501084_0379848 3300054114 Bacteria 1194
967 Ga0501084_0661208 3300054114 Bacteria 882
968 Ga0501082_0028189 3300060353 Bacteria 4839
969 2644529097 2643221695 Bacteria 3441323
970 2906651648 2906643746 Bacteria 8722424
971 Ga0105241_10062400
972 JGI24737J22298_10017577
973 JGI24743J22301_10019109
974 JGI24750J21931_1027043
975 JGI24034J26672_10037348
976 JGI24751J29686_10028324
977 JGI25406J46586_10011067
978 rootH1_10376900
979 JGI25404J52841_10001063
980 Ga0065704_10017714
981 Ga0065712_10089323
982 Ga0065712_10129824
983 Ga0065712_10143883
984 Ga0065712_10161294
985 Ga0065715_10066319
986 Ga0065715_10089287
987 Ga0065715_10095205
988 Ga0065715_10152809
989 Ga0065715_10273524
990 Ga0065715_10321175
991 Ga0065707_10001343
992 Ga0070676_10003798
993 Ga0070676_10005577
994 Ga0070683_100052166
995 Ga0070690_100000759
996 Ga0070690_100028261
997 Ga0070690_100182693
998 Ga0070670_100002271
999 Ga0070670_100017650
1000 Ga0070670_100265663
1001 Ga0070670_100319126
1002 Ga0070670_100813923
1003 Ga0070677_10021202
1004 Ga0070677_10051241
1005 Ga0070677_10074195
1006 Ga0068869_100017160
1007 Ga0070666_10011928
1008 Ga0070666_10064813
1009 Ga0070666_10067478
1010 Ga0070666_10257685
1011 Ga0070666_10382811
1012 Ga0070666_10443257
1013 Ga0070680_100005862
1014 Ga0070682_100262284
1015 Ga0068868_100032256
1016 Ga0068868_100044837
1017 Ga0068868_100167150
1018 Ga0070660_100006491
1019 Ga0070660_100082141
1020 Ga0070660_100131763
1021 Ga0070689_100003033
1022 Ga0070689_100042405
1023 Ga0070689_100404433
1024 Ga0070689_100687740
1025 Ga0070691_10046890
1026 Ga0070687_100010522
1027 Ga0070687_100032198
1028 Ga0070661_100006049
1029 Ga0070661_100040217
1030 Ga0070661_100051905
1031 Ga0070692_10000246
1032 Ga0070668_100006432
1033 Ga0070668_100281432
1034 Ga0070668_101337528
1035 Ga0070669_100006457
1036 Ga0070669_100136849
1037 Ga0070669_100233795
1038 Ga0070675_100046594
1039 Ga0070675_100079336
1040 Ga0070675_100098304
1041 Ga0070675_100104756
1042 Ga0070675_100153028
1043 Ga0070675_100184090
1044 Ga0070675_100228161
1045 Ga0070675_100485344
1046 Ga0070675_100803972
1047 Ga0070675_100951069
1048 Ga0070671_100019240
1049 Ga0070671_100281750
1050 Ga0070671_100354181
1051 Ga0070671_100637349
1052 Ga0070671_100797826
1053 Ga0070674_100000267
1054 Ga0070674_100030736
1055 Ga0070674_100033386
1056 Ga0070674_100114418
1057 Ga0070674_100541869
1058 Ga0070673_100028985
1059 Ga0070673_100135958
1060 Ga0070673_100243731
1061 Ga0070673_100263812
1062 Ga0070688_100031601
1063 Ga0070688_100152213
1064 Ga0070688_100364155
1065 Ga0070688_100438770
1066 Ga0070659_100000570
1067 Ga0070659_100022801
1068 Ga0070659_100022876
1069 Ga0070659_100026094
1070 Ga0070667_100004812
1071 Ga0070667_100019143
1072 Ga0070667_100262332
1073 Ga0070703_10058093
1074 Ga0070709_10000170
1075 Ga0070709_10066612
1076 Ga0070714_100024930
1077 Ga0070713_100032039
1078 Ga0070713_100218075
1079 Ga0070713_100353420
1080 Ga0070710_10006480
1081 Ga0070701_10043205
1082 Ga0070711_100001036
1083 Ga0070711_100005184
1084 Ga0070705_100000350
1085 Ga0070700_100001474
1086 Ga0070700_100089879
1087 Ga0070700_100118544
1088 Ga0070700_100349200
1089 Ga0070700_100567786
1090 Ga0070694_100001109
1091 Ga0070708_100126301
1092 Ga0070708_100189242
1093 Ga0070663_100001350
1094 Ga0070663_100418263
1095 Ga0070663_101001212
1096 Ga0070678_100023979
1097 Ga0070678_100059284
1098 Ga0070678_100059869
1099 Ga0070678_100153084
1100 Ga0070678_100317193
1101 Ga0070678_100397266
1102 Ga0070662_100034058
1103 Ga0070662_100079006
1104 Ga0070662_100539148
1105 Ga0070681_10014476
1106 Ga0070681_10048169
1107 Ga0068867_100027850
1108 Ga0068867_100119961
1109 Ga0068867_100158770
1110 Ga0068867_100273848
1111 Ga0070685_10025709
1112 Ga0070685_10232074
1113 Ga0070685_10297230
1114 Ga0070706_100317247
1115 Ga0070707_100388380
1116 Ga0070698_101122943
1117 Ga0070699_100169114
1118 Ga0070679_100042361
1119 Ga0070679_100063525
1120 Ga0070679_100149303
1121 Ga0070679_101133095
1122 Ga0070684_100110888
1123 Ga0070684_100151019
1124 Ga0070684_100285027
1125 Ga0070697_100012900
1126 Ga0070697_100866441
1127 Ga0068853_100009714
1128 Ga0068853_100019919
1129 Ga0070672_100085406
1130 Ga0070672_100086652
1131 Ga0070672_100160626
1132 Ga0070672_100178881
1133 Ga0070672_100337918
1134 Ga0070672_100354540
1135 Ga0070672_100442685
1136 Ga0070686_100003548
1137 Ga0070686_100022959
1138 Ga0070695_100099823
1139 Ga0070696_100020813
1140 Ga0070696_100696381
1141 Ga0070693_100026601
1142 Ga0070693_100095062
1143 Ga0070665_100001266
1144 Ga0070665_100009407
1145 Ga0070665_100017535
1146 Ga0070665_100152381
1147 Ga0070665_100287340
1148 Ga0070665_100413195
1149 Ga0070704_100001536
1150 Ga0068855_100006474
1151 Ga0068855_100093830
1152 Ga0068855_100122426
1153 Ga0068855_100573449
1154 Ga0070664_100004342
1155 Ga0070664_100005930
1156 Ga0068857_100007883
1157 Ga0068857_100022193
1158 Ga0068857_100093299
1159 Ga0068857_101590188
1160 Ga0068854_100006445
1161 Ga0068856_100003126
1162 Ga0068856_100020887
1163 Ga0070702_100011074
1164 Ga0068852_100027935
1165 Ga0068852_100656229
1166 Ga0068859_100044382
1167 Ga0068859_100054976
1168 Ga0068859_100097979
1169 Ga0068859_100222567
1170 Ga0068859_100277656
1171 Ga0068859_100287842
1172 Ga0068859_100384156
1173 Ga0068859_100938597
1174 Ga0068864_100006983
1175 Ga0068864_100268033
1176 Ga0068864_100746316
1177 Ga0068861_100007099
1178 Ga0068861_100022295
1179 Ga0068861_100197144
1180 Ga0068861_100293680
1181 Ga0068861_100389426
1182 Ga0068861_100583447
1183 Ga0068851_10023575
1184 Ga0068851_10309671
1185 Ga0068870_10002153
1186 Ga0068870_10008640
1187 Ga0068870_10095390
1188 Ga0068870_10221572
1189 Ga0068863_100013472
1190 Ga0068863_100014373
1191 Ga0068863_100023149
1192 Ga0068863_100055651
1193 Ga0068863_100224732
1194 Ga0068863_100554304
1195 Ga0068863_100645970
1196 Ga0068858_100003459
1197 Ga0068858_100005502
1198 Ga0068858_100082271
1199 Ga0068858_100272780
1200 Ga0068858_100349223
1201 Ga0068858_100479936
1202 Ga0068858_100493177
1203 Ga0068858_100617202
1204 Ga0068858_101639824
1205 Ga0068860_100000961
1206 Ga0068862_100002496
1207 Ga0068862_100025465
1208 Ga0068862_100276389
1209 Ga0068862_100361668
1210 Ga0081540_1000011
1211 Ga0081540_1218462
1212 Ga0081539_10000018
1213 Ga0075368_10020680
1214 Ga0075432_10041558
1215 Ga0070716_100000870
1216 Ga0070716_100032912
1217 Ga0070716_100234387
1218 Ga0070712_100005204
1219 Ga0070712_100089608
1220 Ga0070712_100160429
1221 Ga0075367_10008084
1222 Ga0075366_10583799
1223 Ga0097621_100026917
1224 Ga0097621_100042837
1225 Ga0097621_100052155
1226 Ga0097621_100111760
1227 Ga0097621_100122739
1228 Ga0097621_100224362
1229 Ga0097621_100328607
1230 Ga0097621_100455311
1231 Ga0075370_10063487
1232 Ga0068871_100004543
1233 Ga0068871_100027418
1234 Ga0068871_100057033
1235 Ga0068871_100070141
1236 Ga0068871_100423731
1237 Ga0068871_100514148
1238 Ga0068871_100687287
1239 Ga0075428_100003103
1240 Ga0075428_100003581
1241 Ga0075428_100064789
1242 Ga0075428_100462431
1243 Ga0075428_101533681
1244 Ga0075430_100031739
1245 Ga0075430_100071111
1246 Ga0075430_100152221
1247 Ga0075430_100765455
1248 Ga0075431_100115141
1249 Ga0075431_100380444
1250 Ga0075431_100551041
1251 Ga0075433_10002703
1252 Ga0075433_10007266
1253 Ga0075433_10042702
1254 Ga0075433_10077410
1255 Ga0075433_10121605
1256 Ga0075433_10222961
1257 Ga0075433_10742133
1258 Ga0075434_100106773
1259 Ga0075434_100125714
1260 Ga0075434_100131442
1261 Ga0075434_100142019
1262 Ga0075434_100290802
1263 Ga0075429_100009795
1264 Ga0075429_100032263
1265 Ga0075429_100040458
1266 Ga0068865_100079886
1267 Ga0068865_100186756
1268 Ga0068865_100477237
1269 Ga0068865_100548084
1270 Ga0075436_100021765
1271 Ga0097620_100044382
1272 Ga0097620_100054978
1273 Ga0097620_100097980
1274 Ga0097620_100222585
1275 Ga0097620_100277660
1276 Ga0097620_100287858
1277 Ga0097620_100384162
1278 Ga0097620_100938759
1279 Ga0075435_100072545
1280 Ga0075435_100212378
1281 Ga0105240_10009675
1282 Ga0105240_10039670
1283 Ga0105240_10066680
1284 Ga0105240_10266586
1285 Ga0111539_10020906
1286 Ga0111539_10044775
1287 Ga0111539_10149185
1288 Ga0111539_10193205
1289 Ga0111539_10243297
1290 Ga0111539_10437842
1291 Ga0111539_10593850
1292 Ga0111539_10910006
1293 Ga0105245_10004394
1294 Ga0105245_10049283
1295 Ga0105245_10092392
1296 Ga0105245_10107103
1297 Ga0105245_11315165
1298 Ga0105247_10055431
1299 Ga0105247_10063679
1300 Ga0105247_10101011
1301 Ga0105247_10191802
1302 Ga0105247_10196358
1303 Ga0114129_10007271
1304 Ga0114129_10042855
1305 Ga0114129_10112175
1306 Ga0114129_10182085
1307 Ga0114129_10252684
1308 Ga0105243_10003748
1309 Ga0105243_10006455
1310 Ga0105243_11179020
1311 Ga0105241_10017318
1312 Ga0105241_10195013
1313 Ga0105241_10554888
1314 Ga0105242_10000625
1315 Ga0105242_10016272
1316 Ga0105242_10069800
1317 Ga0105242_10236224
1318 Ga0105242_10366205
1319 Ga0105242_10463615
1320 Ga0105242_10546276
1321 Ga0105248_10010944
1322 Ga0105248_10064249
1323 Ga0105248_10183571
1324 Ga0105248_10193568
1325 Ga0105248_10201487
1326 Ga0105248_10201627
1327 Ga0105248_10480509
1328 Ga0105248_10508658
1329 Ga0105248_10545290
1330 Ga0105248_10897639
1331 Ga0105248_11025688
1332 Ga0105237_10007932
1333 Ga0105237_10063844
1334 Ga0105237_10121841
1335 Ga0105237_10641395
1336 Ga0105237_11203104
1337 Ga0105238_10008287
1338 Ga0105238_10009669
1339 Ga0105238_10020506
1340 Ga0105238_10057306
1341 Ga0105238_10290633
1342 Ga0105238_10796392
1343 Ga0105249_10005370
1344 Ga0105249_10011309
1345 Ga0105249_10127639
1346 Ga0105249_11762940
1347 Ga0105249_12449632
1348 Ga0105239_10009648
1349 Ga0105239_10032268
1350 Ga0105239_10039386
1351 Ga0105239_11042257
1352 Ga0105239_11772693
1353 Ga0105246_10020108
1354 Ga0105246_10103741
1355 Ga0157373_10113903
1356 Ga0157371_10001397
1357 Ga0157371_10223080
1358 Ga0157370_10500923
1359 Ga0157369_10003921
1360 Ga0157369_10024215
1361 Ga0157374_10002701
1362 Ga0157374_10022714
1363 Ga0157374_10339190
1364 Ga0157374_10522993
1365 Ga0157374_10562354
1366 Ga0157378_10000883
1367 Ga0157378_10191973
1368 Ga0157378_10398718
1369 Ga0157378_10439583
1370 Ga0157378_10594990
1371 Ga0157378_11386424
1372 Ga0163162_10028285
1373 Ga0163162_10068705
1374 Ga0163162_10094827
1375 Ga0163162_10138974
1376 Ga0163162_10341282
1377 Ga0163162_10565663
1378 Ga0163162_10662471
1379 Ga0157372_10026677
1380 Ga0157372_10190754
1381 Ga0157372_10513383
1382 Ga0157375_10029464
1383 Ga0157375_10046103
1384 Ga0157375_10073608
1385 Ga0157375_10217326
1386 Ga0157375_10217514
1387 Ga0157375_10237277
1388 Ga0157375_10282234
1389 Ga0157375_10659296
1390 Ga0157375_10660415
1391 Ga0157375_11405152
1392 Ga0163163_10010355
1393 Ga0163163_10010833
1394 Ga0163163_10015048
1395 Ga0163163_10068733
1396 Ga0163163_10126847
1397 Ga0163163_10156008
1398 Ga0163163_10171334
1399 Ga0163163_11157448
1400 Ga0157380_10001092
1401 Ga0157380_10002804
1402 Ga0157380_10009280
1403 Ga0157380_10023078
1404 Ga0157380_10024170
1405 Ga0157380_10046199
1406 Ga0157380_10210961
1407 Ga0182008_10438669
1408 Ga0157377_10005858
1409 Ga0157377_10005921
1410 Ga0157379_10007907
1411 Ga0157379_10077358
1412 Ga0157379_10078363
1413 Ga0157379_10317531
1414 Ga0157376_10003812
1415 Ga0157376_10169407
1416 Ga0157376_10182151
1417 Ga0157376_10911235
1418 Ga0163161_10007774
1419 Ga0163161_10083472
1420 Ga0163161_10721808
1421 Ga0163161_11232302
1422 Ga0213875_10119446
1423 Ga0209233_1010598
1424 Ga0207666_1008363
1425 Ga0207697_10004353
1426 Ga0207697_10212691
1427 Ga0207697_10293586
1428 Ga0207656_10014137
1429 Ga0207656_10215720
1430 Ga0207653_10053536
1431 Ga0207682_10004378
1432 Ga0207682_10023195
1433 Ga0207682_10063310
1434 Ga0207692_10019729
1435 Ga0207642_10063195
1436 Ga0207710_10006721
1437 Ga0207710_10184087
1438 Ga0207688_10001861
1439 Ga0207688_10004685
1440 Ga0207688_10075313
1441 Ga0207680_10025799
1442 Ga0207680_10050163
1443 Ga0207680_10113380
1444 Ga0207647_10001143
1445 Ga0207647_10002513
1446 Ga0207647_10291093
1447 Ga0207685_10001153
1448 Ga0207699_10000023
1449 Ga0207699_10002922
1450 Ga0207699_10016771
1451 Ga0207645_10001886
1452 Ga0207645_10013795
1453 Ga0207645_10065537
1454 Ga0207643_10001606
1455 Ga0207643_10076094
1456 Ga0207643_10193412
1457 Ga0207643_10412426
1458 Ga0207705_10004816
1459 Ga0207684_10097720
1460 Ga0207654_10034722
1461 Ga0207654_10132678
1462 Ga0207654_10284018
1463 Ga0207707_10018330
1464 Ga0207695_10111984
1465 Ga0207671_10080008
1466 Ga0207693_10000062
1467 Ga0207693_10054271
1468 Ga0207663_10287503
1469 Ga0207660_10006205
1470 Ga0207660_10301396
1471 Ga0207662_10011936
1472 Ga0207662_10044572
1473 Ga0207662_10194844
1474 Ga0207657_10000023
1475 Ga0207657_10066336
1476 Ga0207657_10341299
1477 Ga0207649_10007494
1478 Ga0207649_10011110
1479 Ga0207649_10061760
1480 Ga0207652_10074063
1481 Ga0207652_10103590
1482 Ga0207652_10147888
1483 Ga0207652_10162998
1484 Ga0207681_10098499
1485 Ga0207681_10104127
1486 Ga0207681_10174711
1487 Ga0207694_10052676
1488 Ga0207694_10080466
1489 Ga0207694_10108667
1490 Ga0207694_10173659
1491 Ga0207694_10237719
1492 Ga0207694_10334667
1493 Ga0207650_10028583
1494 Ga0207650_10084576
1495 Ga0207650_10953285
1496 Ga0207659_10034244
1497 Ga0207659_10059751
1498 Ga0207659_10070159
1499 Ga0207659_10096594
1500 Ga0207659_10109477
1501 Ga0207659_10266375
1502 Ga0207659_10293698
1503 Ga0207659_10767777
1504 Ga0207687_10035473
1505 Ga0207687_10050816
1506 Ga0207687_10089575
1507 Ga0207687_10175618
1508 Ga0207687_10178665
1509 Ga0207687_10471611
1510 Ga0207687_10667397
1511 Ga0207700_10054283
1512 Ga0207700_10194257
1513 Ga0207700_10348509
1514 Ga0207700_10492153
1515 Ga0207664_10064715
1516 Ga0207664_10070151
1517 Ga0207644_10007715
1518 Ga0207644_10071237
1519 Ga0207644_10242625
1520 Ga0207644_10258653
1521 Ga0207644_10278335
1522 Ga0207644_10368656
1523 Ga0207644_10688171
1524 Ga0207690_10001570
1525 Ga0207690_10108578
1526 Ga0207690_10227945
1527 Ga0207706_10000019
1528 Ga0207706_10013547
1529 Ga0207706_10110288
1530 Ga0207706_10145157
1531 Ga0207706_10179547
1532 Ga0207706_10505488
1533 Ga0207706_10924000
1534 Ga0207686_10003964
1535 Ga0207686_10020702
1536 Ga0207686_10499393
1537 Ga0207709_10041407
1538 Ga0207670_10164225
1539 Ga0207670_10325420
1540 Ga0207669_10001163
1541 Ga0207669_10090611
1542 Ga0207669_10126618
1543 Ga0207704_10128267
1544 Ga0207704_10166029
1545 Ga0207704_10694996
1546 Ga0207704_11036018
1547 Ga0207665_10011412
1548 Ga0207665_10074221
1549 Ga0207665_10204761
1550 Ga0207691_10005730
1551 Ga0207691_10032348
1552 Ga0207691_10200283
1553 Ga0207691_10283656
1554 Ga0207691_10299234
1555 Ga0207691_10319261
1556 Ga0207691_10687090
1557 Ga0207711_10050407
1558 Ga0207711_10084899
1559 Ga0207711_10110486
1560 Ga0207711_10136550
1561 Ga0207711_10173193
1562 Ga0207711_10247665
1563 Ga0207711_10314397
1564 Ga0207711_10462272
1565 Ga0207689_10007881
1566 Ga0207689_10021954
1567 Ga0207689_10096152
1568 Ga0207661_10161349
1569 Ga0207679_10009243
1570 Ga0207679_10091636
1571 Ga0207679_10214584
1572 Ga0207679_10661966
1573 Ga0207667_10031979
1574 Ga0207667_10087973
1575 Ga0207667_10226245
1576 Ga0207667_10335387
1577 Ga0207651_10002030
1578 Ga0207651_10035540
1579 Ga0207712_10060935
1580 Ga0207712_10340471
1581 Ga0207668_10328687
1582 Ga0207668_10742477
1583 Ga0207668_11255798
1584 Ga0207640_10082434
1585 Ga0207658_10009595
1586 Ga0207658_10184965
1587 Ga0207658_11606704
1588 Ga0207677_10043216
1589 Ga0207677_10096052
1590 Ga0207677_10211793
1591 Ga0207677_10747402
1592 Ga0207703_10016015
1593 Ga0207703_10109299
1594 Ga0207703_10127589
1595 Ga0207703_10211651
1596 Ga0207703_10282013
1597 Ga0207703_10448159
1598 Ga0207703_10584508
1599 Ga0207639_10011869
1600 Ga0207678_10000017
1601 Ga0207678_10063470
1602 Ga0207678_10073781
1603 Ga0207708_10152409
1604 Ga0207708_10204404
1605 Ga0207708_10831816
1606 Ga0207708_11177029
1607 Ga0207702_10004333
1608 Ga0207702_10062092
1609 Ga0207702_10105748
1610 Ga0207702_11143314
1611 Ga0207641_10059746
1612 Ga0207641_10107016
1613 Ga0207641_10129420
1614 Ga0207641_10590048
1615 Ga0207641_10672803
1616 Ga0207641_11063129
1617 Ga0207641_11341288
1618 Ga0207648_10013217
1619 Ga0207648_10016982
1620 Ga0207648_10046692
1621 Ga0207648_10105837
1622 Ga0207648_10196574
1623 Ga0207648_10272125
1624 Ga0207648_11073953
1625 Ga0207676_10088033
1626 Ga0207676_10090797
1627 Ga0207676_10254733
1628 Ga0207676_10287212
1629 Ga0207676_10302199
1630 Ga0207676_10405238
1631 Ga0207676_10777047
1632 Ga0207674_10002409
1633 Ga0207674_10040702
1634 Ga0207674_10053376
1635 Ga0207675_100001862
1636 Ga0207675_100008725
1637 Ga0207675_100012999
1638 Ga0207675_100024698
1639 Ga0207675_100081043
1640 Ga0207675_100361629
1641 Ga0207675_101473660
1642 Ga0207683_10000030
1643 Ga0207683_10016973
1644 Ga0207683_10040252
1645 Ga0207683_10066384
1646 Ga0207683_10252929
1647 Ga0207683_10388072
1648 Ga0207683_10599122
1649 Ga0207698_10036649
1650 Ga0209998_10003783
1651 Ga0207428_10018650
1652 Ga0207428_10030434
1653 Ga0207428_10176531
1654 Ga0207428_10291340
1655 Ga0268266_10003760
1656 Ga0268266_10110669
1657 Ga0268266_10140552
1658 Ga0268266_10547478
1659 Ga0268265_10034946
1660 Ga0268265_10041217
1661 Ga0268265_10116542
1662 Ga0268265_10262454
1663 Ga0268265_10650021
1664 Ga0268264_10135133
1665 Ga0268264_10144467
1666 Ga0268264_10186447
1667 Ga0265318_10000028
1668 Ga0307515_10024150
1669 Ga0265330_10000021
1670 Ga0265332_10000109
1671 Ga0265328_10006140
1672 Ga0265328_10028334
1673 Ga0265320_10000033
1674 Ga0265329_10005186
1675 Ga0265339_10007818
1676 Ga0265339_10155181
1677 Ga0265331_10000269
1678 Ga0265316_10004308
1679 Ga0307408_100544119
1680 Ga0265313_10000243
1681 Ga0265314_10000407
1682 Ga0265342_10056617
1683 Ga0265342_10139042
1684 Ga0307406_10447565
1685 Ga0307406_10550548
1686 Ga0307409_100944809
1687 Ga0307415_100673749
1688 Ga0373959_0013533
1689 Ga0373929_0031666
1690 Ga0373934_0009692
1691 Ga0373944_0163859
1692 Ga0373949_0067469
1693 Ga0373952_0018926
1694 Ga0373941_0075864
1695 Ga0373954_0084958
1696 Ga0373956_0407604
1697 Ga0373957_0043134
1698 Ga0373957_0080490
1699 Ga0373957_0184144
1700 Ga0373960_0002714
1701 Ga0373960_0219653
1702 Ga0373946_0232500
1703 Ga0373946_0292154
1704 Ga0373955_0014740
1705 Ga0373955_0021914
1706 Ga0373942_0038264
1707 Ga0373961_0017692
1708 Ga0373961_0053038
1709 Ga0373924_0156831
1710 Ga0373931_0071222
1711 Ga0373935_0007410
1712 Ga0373927_0612800
1713 Ga0373933_0070566
1714 Ga0373933_0196342
1715 Ga0373933_0439377
1716 Ga0373947_0096490
1717 Ga0373947_0233360
1718 Ga0373947_0864854
1719 Ga0373937_0021712
1720 Ga0373937_0029968
1721 Ga0373937_0069721
1722 Ga0373937_0406121
1723 Ga0373937_0446274
1724 Ga0373925_0008746
1725 Ga0373925_0211832
1726 Ga0373925_1070894
1727 Ga0395900_0010443
1728 Ga0395898_0005102
1729 Ga0395905_0001187
1730 Ga0436364_0161511
1731 Ga0395901_0004977
1732 Ga0436365_1205066
1733 Ga0436363_0472001
1734 Ga0436363_0635467
1735 Ga0451791_0425912
1736 Ga0451793_1168330
1737 Ga0451807_0390813
1738 Ga0451835_1164105
1739 Ga0451837_1730596
1740 Ga0451853_2006785
1741 Ga0439450_012171
1742 Ga0439460_0189755
1743 Ga0466965_0112024
1744 Ga0451576_0176041
1745 Ga0451576_0880679
1746 Ga0495592_0023234
1747 Ga0495603_0032826
1748 Ga0495603_0058322
1749 Ga0495629_0002336
1750 Ga0495629_0020109
1751 Ga0495638_0007555
1752 Ga0495651_0088045
1753 Ga0495653_0160614
1754 Ga0495580_0012220
1755 Ga0495580_0029386
1756 Ga0495580_0202065
1757 Ga0495580_0340609
1758 Ga0495580_0472184
1759 Ga0495582_0004953
1760 Ga0495582_0017511
1761 Ga0495582_0046403
1762 Ga0495639_0014053
1763 Ga0495639_0014419
1764 Ga0495662_0054701
1765 Ga0495664_0000333
1766 Ga0495584_0367880
1767 Ga0495594_0003018
1768 Ga0495594_0102268
1769 Ga0495608_0030718
1770 Ga0495608_0241904
1771 Ga0495616_0329362
1772 Ga0495628_0030816
1773 Ga0495628_0654922
1774 Ga0495663_0087726
1775 Ga0495652_0098192
1776 Ga0495665_0004188
1777 Ga0495665_0385811
1778 Ga0495640_0159002
1779 Ga0495586_0359069
1780 Ga0495587_0434919
1781 Ga0495645_0002274
1782 Ga0495645_0392139
1783 Ga0495633_0029603
1784 Ga0495667_0016689
1785 Ga0495667_0397307
1786 Ga0495656_0255110
1787 Ga0495634_0085252
1788 Ga0495635_0974506
1789 Ga0495659_0022207
1790 Ga0495659_0199160
1791 Ga0495588_0006683
1792 Ga0495588_0047773
1793 Ga0495657_0580465
1794 Ga0495623_0052720
1795 Ga0495623_0087191
1796 Ga0495647_0050838
1797 Ga0495658_0002334
1798 Ga0495658_0056456
1799 Ga0495658_0176673
1800 Ga0495658_0345499
1801 Ga0495613_0007152
1802 Ga0495613_0008513
1803 Ga0495613_0173742
1804 Ga0495613_0309324
1805 Ga0495670_0105669
1806 Ga0495600_0122339
1807 Ga0495581_0002779
1808 Ga0495581_0296110
1809 Ga0495604_0120194
1810 Ga0495636_0110617
1811 Ga0495636_0170225
1812 Ga0495674_0046938
1813 Ga0495680_0327790
1814 Ga0495680_0499827
1815 Ga0495675_0010924
1816 Ga0495675_0109521
1817 Ga0495684_0006352
1818 Ga0495684_0336797
1819 Ga0495602_0037692
1820 Ga0495615_0006971
1821 Ga0496100_0046285
1822 Ga0496100_0340515
1823 Ga0496100_0485896
1824 Ga0496101_0036985
1825 Ga0496101_0370739
1826 Ga0496101_0867947
1827 Ga0496102_0016084
1828 Ga0496102_0049330
1829 Ga0496103_0061681
1830 Ga0496103_0382799
1831 Ga0496104_0145003
1832 Ga0496105_0012056
1833 Ga0496105_0123938
1834 Ga0496106_0090070
1835 Ga0496106_1250844
1836 Ga0496106_1429891
1837 Ga0496107_0078396
1838 Ga0496108_0009744
1839 Ga0496108_0078797
1840 Ga0496108_0178294
1841 Ga0496108_0426824
1842 Ga0496109_0390710
1843 Ga0496109_0634996
1844 Ga0496110_0033401
1845 Ga0496110_0068171
1846 Ga0496110_0155147
1847 Ga0496111_0006483
1848 Ga0496111_0119431
1849 Ga0496111_0122354
1850 Ga0496112_0017078
1851 Ga0496112_0315973
1852 Ga0496113_0055899
1853 Ga0496113_0092509
1854 Ga0496113_0552337
1855 Ga0496114_0034580
1856 Ga0496114_0057292
1857 Ga0496114_0728052
1858 Ga0496114_0798141
1859 Ga0496115_0185867
1860 Ga0496124_0260749
1861 Ga0501033_0379260
1862 Ga0501039_0046589
1863 Ga0501040_0544773
1864 Ga0501046_0017726
1865 Ga0501046_0146541
1866 Ga0501047_0100701
1867 Ga0501047_0555275
1868 Ga0501048_0162999
1869 Ga0501068_0000034
1870 Ga0501070_0026357
1871 Ga0501073_0000917
1872 Ga0501074_0061973
1873 Ga0501075_0173901
1874 Ga0501208_096142
1875 Ga0501079_0022279
1876 Ga0501080_0001918
1877 Ga0501081_0032439
1878 Ga0501083_0303037
1879 Ga0501035_0439320
1880 Ga0501035_0790061
1881 nmdc:mga0k408_392182_c1
1882 nmdc:mga06z11_26892_c1
1883 nmdc:mga04h51_213660_c1
1884 nmdc:mga07m45_473908_c1
1885 nmdc:mga05p37_206_c1
1886 nmdc:mga05p37_2898_c1
1887 nmdc:mga05p37_36389_c1
1888 nmdc:mga05p37_398050_c1
1889 nmdc:mga05p37_458769_c1
1890 nmdc:mga09592_18451_c1
1891 nmdc:mga09592_69610_c1
1892 nmdc:mga0qj67_11157_c1
1893 nmdc:mga0qj67_171677_c1
1894 nmdc:mga0qj67_551861_c1
1895 nmdc:mga0qj67_617945_c1
1896 nmdc:mga06r32_458590_c1
1897 nmdc:mga06r32_799_c1
1898 nmdc:mga06r32_980126_c1
1899 nmdc:mga08y16_114982_c1
1900 nmdc:mga08y16_139483_c1
1901 nmdc:mga08y16_1538294_c1
1902 nmdc:mga08y16_301164_c1
1903 nmdc:mga08y16_447495_c1
1904 nmdc:mga08y16_582_c1
1905 nmdc:mga08y16_65120_c1
1906 nmdc:mga08y16_75983_c1
1907 nmdc:mga0n895_34673_c1
1908 nmdc:mga0n895_5597_c1
1909 nmdc:mga0n895_567815_c1
1910 nmdc:mga0n895_5837_c1
1911 nmdc:mga0rr50_174897_c1
1912 nmdc:mga0rr50_257591_c1
1913 nmdc:mga0rr50_265839_c1
1914 nmdc:mga0a205_107507_c1
1915 nmdc:mga0a205_125177_c1
1916 nmdc:mga0a205_128765_c1
1917 nmdc:mga0a205_143542_c1
1918 nmdc:mga0a205_145383_c1
1919 nmdc:mga0a205_187937_c1
1920 nmdc:mga0a205_322269_c1
1921 nmdc:mga0a205_870631_c1
1922 Ga0495601_0000594
1923 Ga0495612_0006686
1924 Ga0495595_0158647
1925 Ga0495595_0178727
1926 Ga0495619_0008571
1927 Ga0495619_0030525
1928 Ga0495619_0412267
1929 Ga0495619_1024858
1930 Ga0500646_0096956
1931 Ga0500650_0150811
1932 Ga0500652_038333
1933 Ga0500616_0046141
1934 Ga0500622_0001491
1935 Ga0501084_0010489
1936 Ga0501084_0379848
1937 Ga0501084_0661208
1938 Ga0501082_0028189
1939 2644529097
1940 2906651648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

78

215

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.8221 45 194
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7804 45 194
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7737 57 196
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7488 55 193
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7326 57 196
ID Description Score Start End Superfamily
af_Q9FKW3_7_181_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.6871 62 110 3.50.70.10
af_K7MX43_1_114_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6292 60 78 3.60.10.10
af_Q8IQI5_15_479_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6097 63 110 3.40.50.1820
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.5872 57 188 3.50.70.20
af_Q4V7A8_16_457_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5845 63 115 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A147GMS0-F1-model_v4 deleted 0.9611 33 186
AF-A0A6B9YVF0-F1-model_v4 C-type cytochrome 0.9337 36 196 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V2R107-F1-model_v4 deleted 0.9295 33 199
AF-A0A7Y5RHC4-F1-model_v4 Cytochrome P460 family protein 0.9284 33 196
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.9252 41 196

Map