F487022

General Info

Members Datasets Scaffolds Average Seq Length
967 312 1934 150

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10343809|Ga0207646_103438092
Length 172
Sequence MNTTPIADFLNRVVAAFGITATVNVEETADGPRFNLTGEEAELLVRHRGEPLKALQHIVDSSYGRSIDGEKRVFIDALEYRKGKDIELRQMAKFLAQKAKDSGLDQQLGPLNPYERRIVHMAVAEVPGVTTESIGRLPAVTYWSWYVTAAAPGGVGTVIVVSLPPAPSRPPT

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 4.86
Rhizosphere 94.73
Stem 0
Stem Tuber 0
Unclassified 24.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10343809 3300025922 Unclassified 1348
2 Ga0065714_10020465 3300005288 Bacteria 1559
3 Ga0065704_10272398 3300005289 Bacteria 940
4 Ga0065704_10394357 3300005289 Unclassified 759
5 Ga0065712_10017326 3300005290 Unclassified 2017
6 Ga0065712_10084377 3300005290 Bacteria 2768
7 Ga0065715_10129866 3300005293 Bacteria 2028
8 Ga0065715_10457654 3300005293 Unclassified 819
9 Ga0065715_10563030 3300005293 Unclassified 732
10 Ga0065715_10597780 3300005293 Unclassified 709
11 Ga0065707_10041819 3300005295 Bacteria 882
12 Ga0065707_10055820 3300005295 Unclassified 772
13 Ga0065707_10541731 3300005295 Bacteria 727
14 Ga0070676_10003053 3300005328 Bacteria 8646
15 Ga0070676_10205622 3300005328 Bacteria 1293
16 Ga0070676_10511841 3300005328 Bacteria 854
17 Ga0070683_100024062 3300005329 Bacteria 5451
18 Ga0070683_100122832 3300005329 Bacteria 2453
19 Ga0070683_100510007 3300005329 Bacteria 1149
20 Ga0070683_101054821 3300005329 Bacteria 780
21 Ga0070690_100064683 3300005330 Bacteria 2363
22 Ga0070670_100050066 3300005331 Unclassified 3591
23 Ga0070670_100257519 3300005331 Unclassified 1521
24 Ga0070677_10400803 3300005333 Unclassified 723
25 Ga0070677_10730189 3300005333 Bacteria 560
26 Ga0068869_100068178 3300005334 Bacteria 2627
27 Ga0068869_100120659 3300005334 Bacteria 2005
28 Ga0070666_10011714 3300005335 Bacteria 5515
29 Ga0070666_10123429 3300005335 Bacteria 1797
30 Ga0070666_10186173 3300005335 Bacteria 1458
31 Ga0070666_10239099 3300005335 Bacteria 1284
32 Ga0070666_10260989 3300005335 Bacteria 1228
33 Ga0070666_10344043 3300005335 Unclassified 1066
34 Ga0070680_100290309 3300005336 Bacteria 1386
35 Ga0070682_100084121 3300005337 Unclassified 2067
36 Ga0070682_101701129 3300005337 Unclassified 548
37 Ga0068868_100016616 3300005338 Bacteria 5471
38 Ga0068868_100056104 3300005338 Bacteria 3110
39 Ga0068868_100080712 3300005338 Bacteria 2607
40 Ga0068868_100126893 3300005338 Bacteria 2085
41 Ga0068868_100550398 3300005338 Bacteria 1017
42 Ga0068868_100561918 3300005338 Bacteria 1007
43 Ga0068868_101080943 3300005338 Bacteria 737
44 Ga0070660_100360819 3300005339 Unclassified 1198
45 Ga0070660_100609604 3300005339 Unclassified 913
46 Ga0070660_100652080 3300005339 Bacteria 882
47 Ga0070689_100034783 3300005340 Bacteria 3845
48 Ga0070691_10000837 3300005341 Bacteria 12405
49 Ga0070691_10136622 3300005341 Bacteria 1246
50 Ga0070687_100091476 3300005343 Bacteria 1684
51 Ga0070687_100501226 3300005343 Bacteria 817
52 Ga0070661_100067727 3300005344 Bacteria 2624
53 Ga0070692_10107092 3300005345 Bacteria 1541
54 Ga0070692_10283596 3300005345 Bacteria 1005
55 Ga0070668_100039358 3300005347 Bacteria 3616
56 Ga0070668_100217844 3300005347 Bacteria 1573
57 Ga0070668_100457728 3300005347 Unclassified 1098
58 Ga0070668_100943149 3300005347 Unclassified 773
59 Ga0070669_100003885 3300005353 Bacteria 10808
60 Ga0070669_100040254 3300005353 Bacteria 3397
61 Ga0070669_100048756 3300005353 Bacteria 3091
62 Ga0070669_100293153 3300005353 Bacteria 1307
63 Ga0070669_100522595 3300005353 Unclassified 987
64 Ga0070669_100534725 3300005353 Unclassified 976
65 Ga0070669_100779967 3300005353 Unclassified 811
66 Ga0070669_100928899 3300005353 Bacteria 744
67 Ga0070669_100974081 3300005353 Unclassified 727
68 Ga0070675_100040576 3300005354 Bacteria 3800
69 Ga0070675_100086632 3300005354 Bacteria 2618
70 Ga0070675_100763068 3300005354 Bacteria 883
71 Ga0070671_100248401 3300005355 Bacteria 1511
72 Ga0070671_100392783 3300005355 Unclassified 1186
73 Ga0070671_100547216 3300005355 Unclassified 998
74 Ga0070671_100723640 3300005355 Unclassified 864
75 Ga0070674_100040108 3300005356 Bacteria 3165
76 Ga0070674_100067515 3300005356 Unclassified 2515
77 Ga0070674_100120391 3300005356 Bacteria 1942
78 Ga0070674_100323659 3300005356 Bacteria 1237
79 Ga0070674_100724771 3300005356 Bacteria 852
80 Ga0070673_100085114 3300005364 Bacteria 2573
81 Ga0070673_100309293 3300005364 Unclassified 1393
82 Ga0070673_100481865 3300005364 Unclassified 1120
83 Ga0070673_100517389 3300005364 Bacteria 1081
84 Ga0070673_100696635 3300005364 Unclassified 933
85 Ga0070673_100928247 3300005364 Bacteria 808
86 Ga0070673_100931106 3300005364 Bacteria 807
87 Ga0070673_101624105 3300005364 Bacteria 611
88 Ga0070688_100008134 3300005365 Bacteria 5684
89 Ga0070688_100235611 3300005365 Bacteria 1297
90 Ga0070688_100268753 3300005365 Bacteria 1221
91 Ga0070659_100081018 3300005366 Bacteria 2592
92 Ga0070659_100694767 3300005366 Bacteria 879
93 Ga0070667_100113102 3300005367 Bacteria 2356
94 Ga0070667_100156808 3300005367 Bacteria 2003
95 Ga0070667_100819007 3300005367 Unclassified 865
96 Ga0070667_100820662 3300005367 Bacteria 864
97 Ga0070667_101305036 3300005367 Unclassified 680
98 Ga0070667_101533926 3300005367 Unclassified 626
99 Ga0070703_10172188 3300005406 Bacteria 830
100 Ga0070709_10489398 3300005434 Bacteria 933
101 Ga0070709_10663068 3300005434 Bacteria 809
102 Ga0070713_100006500 3300005436 Bacteria 8110
103 Ga0070713_100257050 3300005436 Bacteria 1595
104 Ga0070713_100676781 3300005436 Unclassified 984
105 Ga0070701_10002538 3300005438 Bacteria 7064
106 Ga0070701_10156121 3300005438 Bacteria 1318
107 Ga0070701_10156996 3300005438 Bacteria 1315
108 Ga0070711_100143115 3300005439 Unclassified 1795
109 Ga0070705_100016534 3300005440 Bacteria 3834
110 Ga0070705_100043461 3300005440 Bacteria 2575
111 Ga0070705_100659089 3300005440 Unclassified 817
112 Ga0070700_100003531 3300005441 Bacteria 8066
113 Ga0070700_100048849 3300005441 Bacteria 2624
114 Ga0070700_100110280 3300005441 Bacteria 1828
115 Ga0070700_100152006 3300005441 Bacteria 1584
116 Ga0070694_100070470 3300005444 Bacteria 2407
117 Ga0070694_100088514 3300005444 Bacteria 2168
118 Ga0070694_100292694 3300005444 Bacteria 1245
119 Ga0070708_100019093 3300005445 Bacteria 5751
120 Ga0070708_100079497 3300005445 Bacteria 2967
121 Ga0070708_100801691 3300005445 Unclassified 885
122 Ga0070663_101179535 3300005455 Bacteria 672
123 Ga0070678_100290004 3300005456 Unclassified 1387
124 Ga0070678_100359848 3300005456 Bacteria 1253
125 Ga0070662_100036801 3300005457 Bacteria 3466
126 Ga0070662_100216098 3300005457 Bacteria 1528
127 Ga0070662_100241777 3300005457 Bacteria 1448
128 Ga0070662_100361696 3300005457 Bacteria 1191
129 Ga0070681_10003654 3300005458 Bacteria 14438
130 Ga0070681_10222506 3300005458 Bacteria 1802
131 Ga0070681_10461162 3300005458 Bacteria 1183
132 Ga0070681_11025984 3300005458 Bacteria 745
133 Ga0070681_11750172 3300005458 Unclassified 548
134 Ga0068867_100100070 3300005459 Bacteria 2213
135 Ga0068867_100147144 3300005459 Bacteria 1847
136 Ga0068867_100153682 3300005459 Bacteria 1809
137 Ga0068867_100442656 3300005459 Bacteria 1105
138 Ga0068867_101451460 3300005459 Unclassified 638
139 Ga0070685_10240297 3300005466 Bacteria 1195
140 Ga0070706_100187714 3300005467 Bacteria 1932
141 Ga0070706_100518351 3300005467 Bacteria 1109
142 Ga0070706_101019020 3300005467 Bacteria 763
143 Ga0070707_100872399 3300005468 Bacteria 864
144 Ga0070707_101434051 3300005468 Unclassified 657
145 Ga0070698_100012233 3300005471 Bacteria 9091
146 Ga0070698_100082559 3300005471 Bacteria 3205
147 Ga0070698_100179129 3300005471 Bacteria 2058
148 Ga0070698_100206950 3300005471 Bacteria 1897
149 Ga0070698_101354951 3300005471 Bacteria 662
150 Ga0070699_100023159 3300005518 Bacteria 5351
151 Ga0070679_100060903 3300005530 Bacteria 3762
152 Ga0070679_100406580 3300005530 Bacteria 1307
153 Ga0070684_100083898 3300005535 Unclassified 2824
154 Ga0070684_100136628 3300005535 Bacteria 2215
155 Ga0070684_100363773 3300005535 Bacteria 1331
156 Ga0070684_100653905 3300005535 Bacteria 978
157 Ga0070697_100062033 3300005536 Bacteria 3050
158 Ga0068853_100324878 3300005539 Bacteria 1427
159 Ga0068853_100581578 3300005539 Bacteria 1063
160 Ga0068853_100975850 3300005539 Bacteria 815
161 Ga0068853_101486371 3300005539 Bacteria 656
162 Ga0070672_100036518 3300005543 Bacteria 3743
163 Ga0070672_100276554 3300005543 Bacteria 1419
164 Ga0070672_100668885 3300005543 Unclassified 908
165 Ga0070672_100740916 3300005543 Bacteria 862
166 Ga0070672_100944782 3300005543 Unclassified 763
167 Ga0070672_101218867 3300005543 Unclassified 671
168 Ga0070686_100000153 3300005544 Bacteria 47434
169 Ga0070686_100570675 3300005544 Bacteria 888
170 Ga0070686_100590751 3300005544 Bacteria 874
171 Ga0070686_100636622 3300005544 Unclassified 844
172 Ga0070686_100872571 3300005544 Bacteria 730
173 Ga0070695_100000777 3300005545 Bacteria 17162
174 Ga0070695_100043745 3300005545 Bacteria 2849
175 Ga0070695_100969182 3300005545 Bacteria 690
176 Ga0070695_101872291 3300005545 Unclassified 504
177 Ga0070696_100011456 3300005546 Bacteria 5940
178 Ga0070696_100151980 3300005546 Unclassified 1700
179 Ga0070696_100198182 3300005546 Bacteria 1498
180 Ga0070696_100265591 3300005546 Bacteria 1303
181 Ga0070696_100323910 3300005546 Bacteria 1187
182 Ga0070696_100494405 3300005546 Bacteria 972
183 Ga0070696_101106842 3300005546 Bacteria 666
184 Ga0070693_100475397 3300005547 Bacteria 882
185 Ga0070693_101509464 3300005547 Bacteria 525
186 Ga0070665_100001513 3300005548 Bacteria 26996
187 Ga0070665_100021143 3300005548 Bacteria 6541
188 Ga0070665_100263815 3300005548 Bacteria 1724
189 Ga0070665_100290957 3300005548 Bacteria 1636
190 Ga0070665_100463061 3300005548 Bacteria 1278
191 Ga0070665_100545039 3300005548 Bacteria 1172
192 Ga0070704_100002431 3300005549 Bacteria 10448
193 Ga0070704_100005299 3300005549 Bacteria 7514
194 Ga0070704_101375143 3300005549 Unclassified 647
195 Ga0068855_100019451 3300005563 Bacteria 8159
196 Ga0068855_100540126 3300005563 Bacteria 1263
197 Ga0070664_100090116 3300005564 Unclassified 2654
198 Ga0070664_100116360 3300005564 Bacteria 2338
199 Ga0068857_100544617 3300005577 Bacteria 1093
200 Ga0068854_100012660 3300005578 Bacteria 5526
201 Ga0068854_100060130 3300005578 Bacteria 2747
202 Ga0068854_100415052 3300005578 Unclassified 1117
203 Ga0068854_100509103 3300005578 Bacteria 1015
204 Ga0068854_102125927 3300005578 Unclassified 519
205 Ga0068856_100027205 3300005614 Bacteria 5579
206 Ga0070702_100003807 3300005615 Bacteria 6818
207 Ga0068852_101244275 3300005616 Unclassified 766
208 Ga0068859_100069609 3300005617 Bacteria 3554
209 Ga0068859_100100830 3300005617 Bacteria 2944
210 Ga0068859_100121750 3300005617 Bacteria 2676
211 Ga0068859_100227375 3300005617 Bacteria 1954
212 Ga0068859_100256039 3300005617 Bacteria 1841
213 Ga0068859_100369930 3300005617 Unclassified 1529
214 Ga0068859_100446991 3300005617 Bacteria 1389
215 Ga0068859_100522452 3300005617 Bacteria 1282
216 Ga0068859_100817800 3300005617 Unclassified 1019
217 Ga0068864_100013809 3300005618 Bacteria 6693
218 Ga0068864_100073303 3300005618 Bacteria 2985
219 Ga0068864_100118661 3300005618 Bacteria 2362
220 Ga0068864_100127701 3300005618 Bacteria 2280
221 Ga0068864_100139677 3300005618 Bacteria 2184
222 Ga0068864_100522129 3300005618 Unclassified 1145
223 Ga0068866_10057287 3300005718 Bacteria 2007
224 Ga0068866_10120424 3300005718 Bacteria 1478
225 Ga0068866_10361872 3300005718 Bacteria 925
226 Ga0068861_100112706 3300005719 Bacteria 2181
227 Ga0068861_100162540 3300005719 Bacteria 1843
228 Ga0068861_100221127 3300005719 Bacteria 1601
229 Ga0068861_101031634 3300005719 Unclassified 787
230 Ga0068861_101750380 3300005719 Bacteria 615
231 Ga0068851_10020478 3300005834 Bacteria 3204
232 Ga0068863_100006690 3300005841 Bacteria 11311
233 Ga0068863_100128678 3300005841 Bacteria 2417
234 Ga0068863_100180703 3300005841 Bacteria 2025
235 Ga0068863_100542513 3300005841 Unclassified 1148
236 Ga0068863_100543064 3300005841 Bacteria 1147
237 Ga0068858_100003161 3300005842 Bacteria 16485
238 Ga0068858_100005969 3300005842 Bacteria 11891
239 Ga0068858_100044461 3300005842 Unclassified 4116
240 Ga0068858_100085316 3300005842 Bacteria 2937
241 Ga0068858_100091344 3300005842 Bacteria 2834
242 Ga0068858_100127144 3300005842 Bacteria 2387
243 Ga0068858_100152671 3300005842 Bacteria 2172
244 Ga0068858_100448662 3300005842 Bacteria 1243
245 Ga0068858_100885458 3300005842 Unclassified 873
246 Ga0068860_100014590 3300005843 Bacteria 7687
247 Ga0068860_100595934 3300005843 Bacteria 1110
248 Ga0068860_101064118 3300005843 Bacteria 828
249 Ga0068860_101093678 3300005843 Unclassified 816
250 Ga0068860_101376597 3300005843 Bacteria 727
251 Ga0068860_101421588 3300005843 Bacteria 715
252 Ga0068860_101669792 3300005843 Unclassified 659
253 Ga0068862_100002661 3300005844 Bacteria 15718
254 Ga0068862_100024171 3300005844 Bacteria 5097
255 Ga0068862_100129416 3300005844 Bacteria 2232
256 Ga0068862_100275868 3300005844 Bacteria 1539
257 Ga0068862_100350572 3300005844 Bacteria 1369
258 Ga0068862_100462135 3300005844 Unclassified 1198
259 Ga0068862_100541922 3300005844 Bacteria 1110
260 Ga0068862_100984915 3300005844 Unclassified 833
261 Ga0081455_10052456 3300005937 Bacteria 3491
262 Ga0081539_10002012 3300005985 Bacteria 30795
263 Ga0070717_10324080 3300006028 Bacteria 1373
264 Ga0070712_100322187 3300006175 Bacteria 1257
265 Ga0097621_100000125 3300006237 Bacteria 44370
266 Ga0097621_100014247 3300006237 Bacteria 5947
267 Ga0097621_100017775 3300006237 Bacteria 5411
268 Ga0097621_100038740 3300006237 Bacteria 3825
269 Ga0097621_100105568 3300006237 Unclassified 2375
270 Ga0097621_100153526 3300006237 Bacteria 1975
271 Ga0097621_100154846 3300006237 Bacteria 1967
272 Ga0097621_100726154 3300006237 Bacteria 916
273 Ga0097621_100996314 3300006237 Unclassified 784
274 Ga0068871_100000134 3300006358 Bacteria 47412
275 Ga0068871_100029682 3300006358 Bacteria 4297
276 Ga0068871_100093179 3300006358 Unclassified 2513
277 Ga0068871_100133321 3300006358 Bacteria 2108
278 Ga0068871_100143254 3300006358 Bacteria 2033
279 Ga0068871_102043834 3300006358 Bacteria 545
280 Ga0075428_100088295 3300006844 Bacteria 3381
281 Ga0075428_100452689 3300006844 Bacteria 1375
282 Ga0075428_100639156 3300006844 Bacteria 1135
283 Ga0075428_101217159 3300006844 Bacteria 794
284 Ga0075431_100113206 3300006847 Unclassified 2800
285 Ga0075433_10016907 3300006852 Bacteria 6028
286 Ga0075433_10071887 3300006852 Bacteria 3041
287 Ga0075433_10443069 3300006852 Bacteria 1145
288 Ga0075433_10490849 3300006852 Bacteria 1081
289 Ga0075433_11325147 3300006852 Unclassified 623
290 Ga0075434_100001054 3300006871 Bacteria 22494
291 Ga0075434_100001202 3300006871 Bacteria 21518
292 Ga0075434_100002093 3300006871 Bacteria 17347
293 Ga0075434_100065019 3300006871 Bacteria 3633
294 Ga0075434_100073849 3300006871 Bacteria 3403
295 Ga0075434_100218129 3300006871 Bacteria 1927
296 Ga0075434_100348634 3300006871 Unclassified 1502
297 Ga0075434_100410074 3300006871 Unclassified 1376
298 Ga0075434_100893246 3300006871 Bacteria 903
299 Ga0075434_101420627 3300006871 Unclassified 704
300 Ga0075429_100200845 3300006880 Bacteria 1747
301 Ga0075429_100252537 3300006880 Bacteria 1544
302 Ga0075429_100372174 3300006880 Unclassified 1251
303 Ga0068865_100053714 3300006881 Bacteria 2796
304 Ga0068865_100083576 3300006881 Bacteria 2298
305 Ga0068865_100138493 3300006881 Bacteria 1832
306 Ga0068865_100358136 3300006881 Bacteria 1184
307 Ga0068865_100763986 3300006881 Bacteria 831
308 Ga0068865_100996900 3300006881 Bacteria 733
309 Ga0068865_101173876 3300006881 Bacteria 679
310 Ga0075436_100001908 3300006914 Bacteria 14320
311 Ga0075436_100014361 3300006914 Bacteria 5421
312 Ga0075436_100079509 3300006914 Bacteria 2271
313 Ga0075436_100189856 3300006914 Bacteria 1453
314 Ga0097620_100069610 3300006931 Bacteria 3554
315 Ga0097620_100100838 3300006931 Bacteria 2944
316 Ga0097620_100121760 3300006931 Bacteria 2676
317 Ga0097620_100227376 3300006931 Bacteria 1954
318 Ga0097620_100256046 3300006931 Bacteria 1841
319 Ga0097620_100369941 3300006931 Unclassified 1529
320 Ga0097620_100447026 3300006931 Bacteria 1389
321 Ga0097620_100522408 3300006931 Bacteria 1282
322 Ga0097620_100817802 3300006931 Unclassified 1019
323 Ga0075435_100000204 3300007076 Bacteria 35933
324 Ga0075435_100000924 3300007076 Bacteria 18527
325 Ga0075435_100001088 3300007076 Bacteria 17281
326 Ga0075435_100031162 3300007076 Bacteria 4199
327 Ga0075435_100118917 3300007076 Bacteria 2203
328 Ga0075435_100166785 3300007076 Unclassified 1857
329 Ga0075435_100374576 3300007076 Bacteria 1222
330 Ga0075435_100950628 3300007076 Bacteria 750
331 Ga0075435_101341729 3300007076 Unclassified 626
332 Ga0099794_10037690 3300007265 Bacteria 2289
333 Ga0099794_10627984 3300007265 Unclassified 570
334 Ga0105251_10302715 3300009011 Bacteria 725
335 Ga0105240_10010017 3300009093 Bacteria 13352
336 Ga0105240_10081871 3300009093 Bacteria 3965
337 Ga0105240_10111828 3300009093 Bacteria 3303
338 Ga0105240_10449709 3300009093 Bacteria 1442
339 Ga0105240_11080709 3300009093 Bacteria 854
340 Ga0105240_11459654 3300009093 Unclassified 718
341 Ga0111539_10000466 3300009094 Bacteria 50937
342 Ga0111539_10007493 3300009094 Bacteria 13970
343 Ga0111539_10029457 3300009094 Bacteria 6686
344 Ga0111539_10039828 3300009094 Bacteria 5660
345 Ga0111539_10343310 3300009094 Bacteria 1738
346 Ga0111539_10535520 3300009094 Bacteria 1364
347 Ga0111539_11913496 3300009094 Unclassified 688
348 Ga0105245_10009401 3300009098 Bacteria 8529
349 Ga0105245_10148967 3300009098 Bacteria 2211
350 Ga0105245_10167913 3300009098 Bacteria 2087
351 Ga0105245_10221039 3300009098 Bacteria 1828
352 Ga0105245_10248147 3300009098 Bacteria 1728
353 Ga0105245_10330229 3300009098 Bacteria 1505
354 Ga0105245_10655561 3300009098 Bacteria 1080
355 Ga0105247_10001472 3300009101 Bacteria 16957
356 Ga0105247_10013578 3300009101 Bacteria 4884
357 Ga0105247_10024096 3300009101 Unclassified 3665
358 Ga0105247_10778934 3300009101 Bacteria 728
359 Ga0114129_10000426 3300009147 Bacteria 50026
360 Ga0114129_10000876 3300009147 Bacteria 39161
361 Ga0114129_10003910 3300009147 Bacteria 21025
362 Ga0114129_10004361 3300009147 Bacteria 19964
363 Ga0114129_10008094 3300009147 Bacteria 14980
364 Ga0114129_10012966 3300009147 Bacteria 11866
365 Ga0114129_10083778 3300009147 Bacteria 4427
366 Ga0114129_10178236 3300009147 Bacteria 2893
367 Ga0114129_10213988 3300009147 Bacteria 2604
368 Ga0114129_10339302 3300009147 Bacteria 1993
369 Ga0114129_10347070 3300009147 Bacteria 1967
370 Ga0114129_10355253 3300009147 Bacteria 1940
371 Ga0114129_11691886 3300009147 Bacteria 772
372 Ga0114129_11692982 3300009147 Unclassified 772
373 Ga0114129_11945287 3300009147 Bacteria 712
374 Ga0114129_12802331 3300009147 Bacteria 579
375 Ga0105243_10029595 3300009148 Bacteria 4212
376 Ga0105243_10087732 3300009148 Bacteria 2554
377 Ga0105243_10148007 3300009148 Bacteria 2011
378 Ga0105243_10430108 3300009148 Bacteria 1234
379 Ga0105243_10904185 3300009148 Bacteria 878
380 Ga0105241_10289002 3300009174 Bacteria 1403
381 Ga0105241_10492704 3300009174 Bacteria 1091
382 Ga0105241_10843506 3300009174 Unclassified 847
383 Ga0105242_10058695 3300009176 Bacteria 3156
384 Ga0105242_10174182 3300009176 Bacteria 1893
385 Ga0105242_10208811 3300009176 Unclassified 1739
386 Ga0105242_10256614 3300009176 Bacteria 1577
387 Ga0105242_11417459 3300009176 Bacteria 723
388 Ga0105248_10002519 3300009177 Bacteria 20391
389 Ga0105248_10036746 3300009177 Bacteria 5478
390 Ga0105248_10045082 3300009177 Bacteria 4945
391 Ga0105248_10157780 3300009177 Bacteria 2560
392 Ga0105248_10180592 3300009177 Bacteria 2378
393 Ga0105248_10221025 3300009177 Bacteria 2132
394 Ga0105248_10239404 3300009177 Bacteria 2043
395 Ga0105248_10666126 3300009177 Bacteria 1174
396 Ga0105248_10859833 3300009177 Bacteria 1024
397 Ga0105248_10948005 3300009177 Bacteria 972
398 Ga0105248_11712830 3300009177 Bacteria 713
399 Ga0105237_10296246 3300009545 Unclassified 1620
400 Ga0105238_10212048 3300009551 Bacteria 1913
401 Ga0105238_10212722 3300009551 Bacteria 1910
402 Ga0105238_10403112 3300009551 Bacteria 1361
403 Ga0105249_10248805 3300009553 Bacteria 1761
404 Ga0105249_10605556 3300009553 Bacteria 1150
405 Ga0105249_11132999 3300009553 Bacteria 853
406 Ga0105249_11454211 3300009553 Bacteria 757
407 Ga0105249_12585168 3300009553 Bacteria 580
408 Ga0105239_12019841 3300010375 Unclassified 669
409 Ga0105246_10202185 3300011119 Bacteria 1545
410 Ga0105246_11518790 3300011119 Unclassified 630
411 Ga0105246_11637124 3300011119 Unclassified 609
412 Ga0157323_1005343 3300012495 Unclassified 856
413 Ga0157369_11294663 3300013105 Bacteria 743
414 Ga0157374_10037537 3300013296 Bacteria 4447
415 Ga0157374_10055503 3300013296 Unclassified 3697
416 Ga0157374_10547047 3300013296 Bacteria 1165
417 Ga0157374_10701591 3300013296 Bacteria 1025
418 Ga0157378_10005743 3300013297 Bacteria 10865
419 Ga0157378_10250526 3300013297 Bacteria 1695
420 Ga0157378_10296475 3300013297 Unclassified 1563
421 Ga0157378_10308617 3300013297 Bacteria 1534
422 Ga0157378_12127291 3300013297 Unclassified 612
423 Ga0163162_10034270 3300013306 Bacteria 5052
424 Ga0163162_10276059 3300013306 Unclassified 1813
425 Ga0163162_11143377 3300013306 Bacteria 883
426 Ga0157372_10286901 3300013307 Bacteria 1914
427 Ga0157375_10059732 3300013308 Bacteria 3778
428 Ga0157375_10172839 3300013308 Bacteria 2309
429 Ga0157375_10798370 3300013308 Unclassified 1093
430 Ga0157375_11452447 3300013308 Bacteria 809
431 Ga0157375_11825967 3300013308 Unclassified 721
432 Ga0163163_10011654 3300014325 Bacteria 7986
433 Ga0163163_10019039 3300014325 Bacteria 6441
434 Ga0163163_10661526 3300014325 Bacteria 1108
435 Ga0163163_10801737 3300014325 Unclassified 1005
436 Ga0163163_11196478 3300014325 Bacteria 823
437 Ga0163163_11403490 3300014325 Bacteria 760
438 Ga0157380_10166704 3300014326 Unclassified 1920
439 Ga0157380_10623187 3300014326 Unclassified 1071
440 Ga0157380_10803574 3300014326 Bacteria 958
441 Ga0157380_12391106 3300014326 Bacteria 593
442 Ga0157377_10258257 3300014745 Bacteria 1132
443 Ga0157377_10351327 3300014745 Bacteria 989
444 Ga0157379_10002568 3300014968 Bacteria 15239
445 Ga0157379_10003372 3300014968 Bacteria 13516
446 Ga0157379_10025073 3300014968 Bacteria 5295
447 Ga0157379_10064423 3300014968 Unclassified 3275
448 Ga0157379_10385560 3300014968 Bacteria 1286
449 Ga0157379_10843896 3300014968 Unclassified 867
450 Ga0157376_10002539 3300014969 Bacteria 12376
451 Ga0157376_10011019 3300014969 Bacteria 6644
452 Ga0157376_10024820 3300014969 Bacteria 4714
453 Ga0157376_10050013 3300014969 Bacteria 3465
454 Ga0157376_10137508 3300014969 Bacteria 2188
455 Ga0157376_10145968 3300014969 Unclassified 2128
456 Ga0157376_10297582 3300014969 Bacteria 1526
457 Ga0157376_10414484 3300014969 Bacteria 1305
458 Ga0157376_10440374 3300014969 Bacteria 1269
459 Ga0157376_11288399 3300014969 Bacteria 761
460 Ga0157376_11724519 3300014969 Unclassified 662
461 Ga0163161_10464758 3300017792 Unclassified 1025
462 Ga0213876_10077902 3300021384 Bacteria 1751
463 Ga0207697_10134709 3300025315 Bacteria 1069
464 Ga0207653_10052402 3300025885 Bacteria 1361
465 Ga0207653_10059000 3300025885 Bacteria 1291
466 Ga0207682_10270388 3300025893 Unclassified 793
467 Ga0207642_10024812 3300025899 Bacteria 2416
468 Ga0207642_10054789 3300025899 Bacteria 1820
469 Ga0207642_10344187 3300025899 Unclassified 877
470 Ga0207688_10137520 3300025901 Bacteria 1436
471 Ga0207688_10185636 3300025901 Bacteria 1242
472 Ga0207680_10033007 3300025903 Bacteria 2948
473 Ga0207680_10067592 3300025903 Bacteria 2202
474 Ga0207680_10071456 3300025903 Bacteria 2151
475 Ga0207680_10137089 3300025903 Bacteria 1619
476 Ga0207680_10683533 3300025903 Bacteria 735
477 Ga0207685_10007767 3300025905 Bacteria 3012
478 Ga0207685_10462606 3300025905 Unclassified 661
479 Ga0207645_10005648 3300025907 Bacteria 9039
480 Ga0207645_10600295 3300025907 Bacteria 747
481 Ga0207645_10658946 3300025907 Unclassified 711
482 Ga0207645_10882594 3300025907 Unclassified 608
483 Ga0207643_10223628 3300025908 Bacteria 1153
484 Ga0207643_10574663 3300025908 Bacteria 724
485 Ga0207705_10156957 3300025909 Bacteria 1707
486 Ga0207684_10369142 3300025910 Bacteria 1235
487 Ga0207654_10130226 3300025911 Unclassified 1591
488 Ga0207654_10300968 3300025911 Bacteria 1091
489 Ga0207654_10366993 3300025911 Bacteria 994
490 Ga0207707_10008859 3300025912 Bacteria 8738
491 Ga0207707_10034907 3300025912 Bacteria 4399
492 Ga0207707_10156653 3300025912 Bacteria 1992
493 Ga0207707_10195159 3300025912 Bacteria 1766
494 Ga0207707_11278914 3300025912 Unclassified 590
495 Ga0207695_10066322 3300025913 Unclassified 3708
496 Ga0207695_10202742 3300025913 Bacteria 1897
497 Ga0207695_10237457 3300025913 Bacteria 1725
498 Ga0207695_11395915 3300025913 Archaea 581
499 Ga0207671_10433322 3300025914 Unclassified 1046
500 Ga0207663_10279936 3300025916 Unclassified 1239
501 Ga0207660_10038187 3300025917 Bacteria 3351
502 Ga0207662_10057705 3300025918 Bacteria 2321
503 Ga0207662_10203639 3300025918 Bacteria 1282
504 Ga0207662_10489339 3300025918 Bacteria 846
505 Ga0207657_10000489 3300025919 Bacteria 41785
506 Ga0207649_10087098 3300025920 Bacteria 2037
507 Ga0207649_10348314 3300025920 Bacteria 1096
508 Ga0207652_10024759 3300025921 Bacteria 4981
509 Ga0207652_10187340 3300025921 Bacteria 1861
510 Ga0207646_10203816 3300025922 Unclassified 1787
511 Ga0207646_10592876 3300025922 Bacteria 995
512 Ga0207646_10802924 3300025922 Bacteria 838
513 Ga0207646_11222293 3300025922 Unclassified 658
514 Ga0207681_10057387 3300025923 Bacteria 2660
515 Ga0207681_10090798 3300025923 Bacteria 2181
516 Ga0207681_10119098 3300025923 Unclassified 1933
517 Ga0207681_10247764 3300025923 Unclassified 1390
518 Ga0207681_10281926 3300025923 Bacteria 1308
519 Ga0207681_10972118 3300025923 Unclassified 712
520 Ga0207694_10455689 3300025924 Bacteria 1068
521 Ga0207650_11019739 3300025925 Bacteria 704
522 Ga0207650_11211821 3300025925 Bacteria 643
523 Ga0207659_10157078 3300025926 Bacteria 1782
524 Ga0207659_10484111 3300025926 Bacteria 1046
525 Ga0207659_10528054 3300025926 Unclassified 1001
526 Ga0207659_10580608 3300025926 Bacteria 954
527 Ga0207659_10794357 3300025926 Unclassified 813
528 Ga0207687_10084438 3300025927 Bacteria 2301
529 Ga0207687_10164797 3300025927 Bacteria 1704
530 Ga0207687_10272219 3300025927 Bacteria 1354
531 Ga0207700_10008186 3300025928 Bacteria 6459
532 Ga0207644_10283851 3300025931 Bacteria 1330
533 Ga0207644_10334324 3300025931 Bacteria 1227
534 Ga0207690_10177567 3300025932 Bacteria 1601
535 Ga0207706_10175950 3300025933 Unclassified 1880
536 Ga0207706_10219852 3300025933 Bacteria 1663
537 Ga0207706_10340871 3300025933 Unclassified 1304
538 Ga0207706_10529809 3300025933 Bacteria 1015
539 Ga0207686_10002741 3300025934 Bacteria 9550
540 Ga0207686_10162219 3300025934 Bacteria 1568
541 Ga0207686_10454712 3300025934 Bacteria 986
542 Ga0207686_10759403 3300025934 Bacteria 775
543 Ga0207686_11161580 3300025934 Bacteria 631
544 Ga0207709_10013009 3300025935 Bacteria 4587
545 Ga0207709_10072344 3300025935 Bacteria 2193
546 Ga0207709_10326916 3300025935 Bacteria 1150
547 Ga0207670_10079013 3300025936 Bacteria 2296
548 Ga0207670_10557166 3300025936 Unclassified 937
549 Ga0207670_10730858 3300025936 Bacteria 821
550 Ga0207670_11033327 3300025936 Bacteria 692
551 Ga0207669_10042565 3300025937 Bacteria 2652
552 Ga0207669_10060200 3300025937 Bacteria 2327
553 Ga0207669_10315587 3300025937 Unclassified 1194
554 Ga0207669_10441655 3300025937 Bacteria 1029
555 Ga0207704_10203266 3300025938 Bacteria 1452
556 Ga0207704_10230660 3300025938 Bacteria 1376
557 Ga0207704_10936278 3300025938 Bacteria 730
558 Ga0207704_11572477 3300025938 Unclassified 565
559 Ga0207665_10780964 3300025939 Bacteria 754
560 Ga0207691_10028678 3300025940 Bacteria 5209
561 Ga0207691_10254075 3300025940 Bacteria 1516
562 Ga0207691_10474046 3300025940 Bacteria 1064
563 Ga0207691_10927894 3300025940 Unclassified 728
564 Ga0207711_10027871 3300025941 Bacteria 4748
565 Ga0207711_10049925 3300025941 Bacteria 3581
566 Ga0207711_10062119 3300025941 Unclassified 3222
567 Ga0207711_10115715 3300025941 Bacteria 2390
568 Ga0207711_10164554 3300025941 Unclassified 2010
569 Ga0207711_10230211 3300025941 Bacteria 1697
570 Ga0207711_11154601 3300025941 Bacteria 716
571 Ga0207689_10033103 3300025942 Bacteria 4295
572 Ga0207689_10069887 3300025942 Bacteria 2885
573 Ga0207689_10326895 3300025942 Bacteria 1273
574 Ga0207661_10028809 3300025944 Bacteria 4258
575 Ga0207661_10589381 3300025944 Bacteria 1020
576 Ga0207661_10865976 3300025944 Bacteria 832
577 Ga0207679_10054644 3300025945 Unclassified 2941
578 Ga0207679_10063933 3300025945 Unclassified 2749
579 Ga0207679_10699364 3300025945 Unclassified 920
580 Ga0207679_10857503 3300025945 Unclassified 830
581 Ga0207667_10014648 3300025949 Bacteria 8929
582 Ga0207667_10237154 3300025949 Bacteria 1867
583 Ga0207667_10561666 3300025949 Unclassified 1153
584 Ga0207651_10259042 3300025960 Bacteria 1427
585 Ga0207651_10388758 3300025960 Unclassified 1184
586 Ga0207651_10445961 3300025960 Unclassified 1110
587 Ga0207651_11138943 3300025960 Bacteria 700
588 Ga0207712_10075629 3300025961 Bacteria 2435
589 Ga0207712_10188076 3300025961 Bacteria 1628
590 Ga0207712_10572332 3300025961 Bacteria 974
591 Ga0207712_10690276 3300025961 Unclassified 890
592 Ga0207712_10916190 3300025961 Unclassified 775
593 Ga0207668_10083109 3300025972 Bacteria 2329
594 Ga0207668_10217751 3300025972 Bacteria 1531
595 Ga0207640_10004577 3300025981 Bacteria 7500
596 Ga0207640_10010018 3300025981 Bacteria 5323
597 Ga0207640_10440786 3300025981 Unclassified 1071
598 Ga0207658_10300199 3300025986 Bacteria 1383
599 Ga0207658_10390827 3300025986 Bacteria 1220
600 Ga0207677_10051231 3300026023 Bacteria 2798
601 Ga0207677_10084337 3300026023 Bacteria 2290
602 Ga0207677_10155187 3300026023 Bacteria 1772
603 Ga0207677_10801347 3300026023 Unclassified 843
604 Ga0207677_10857256 3300026023 Bacteria 817
605 Ga0207677_11129927 3300026023 Unclassified 715
606 Ga0207677_11775481 3300026023 Bacteria 572
607 Ga0207703_10007066 3300026035 Bacteria 8933
608 Ga0207703_10020073 3300026035 Bacteria 5222
609 Ga0207703_10049524 3300026035 Unclassified 3397
610 Ga0207703_10080823 3300026035 Bacteria 2708
611 Ga0207703_10209948 3300026035 Bacteria 1735
612 Ga0207703_10281224 3300026035 Bacteria 1511
613 Ga0207703_10505504 3300026035 Bacteria 1135
614 Ga0207703_11429516 3300026035 Unclassified 665
615 Ga0207703_11512413 3300026035 Unclassified 646
616 Ga0207639_10699112 3300026041 Bacteria 941
617 Ga0207639_11253709 3300026041 Bacteria 696
618 Ga0207708_10004038 3300026075 Bacteria 10791
619 Ga0207708_10019580 3300026075 Bacteria 5102
620 Ga0207708_10071341 3300026075 Bacteria 2661
621 Ga0207708_11094444 3300026075 Unclassified 695
622 Ga0207702_10391965 3300026078 Bacteria 1337
623 Ga0207702_10651134 3300026078 Unclassified 1036
624 Ga0207641_10002698 3300026088 Bacteria 16196
625 Ga0207641_10060911 3300026088 Unclassified 3218
626 Ga0207641_10068431 3300026088 Bacteria 3045
627 Ga0207641_10150518 3300026088 Bacteria 2107
628 Ga0207641_10363313 3300026088 Bacteria 1383
629 Ga0207641_10865708 3300026088 Unclassified 896
630 Ga0207648_10012103 3300026089 Bacteria 8090
631 Ga0207648_10185956 3300026089 Bacteria 1840
632 Ga0207648_10262833 3300026089 Unclassified 1540
633 Ga0207648_10279887 3300026089 Bacteria 1492
634 Ga0207648_10661927 3300026089 Bacteria 965
635 Ga0207648_11547802 3300026089 Unclassified 623
636 Ga0207676_10006464 3300026095 Bacteria 8279
637 Ga0207676_10091796 3300026095 Bacteria 2496
638 Ga0207676_10106338 3300026095 Bacteria 2338
639 Ga0207676_10166192 3300026095 Bacteria 1917
640 Ga0207676_10208453 3300026095 Bacteria 1732
641 Ga0207674_10228166 3300026116 Bacteria 1810
642 Ga0207674_10231774 3300026116 Bacteria 1794
643 Ga0207674_10669298 3300026116 Bacteria 1002
644 Ga0207675_100020610 3300026118 Bacteria 6145
645 Ga0207675_100182632 3300026118 Bacteria 2009
646 Ga0207675_100291292 3300026118 Bacteria 1588
647 Ga0207675_100554882 3300026118 Bacteria 1148
648 Ga0207675_100642165 3300026118 Unclassified 1067
649 Ga0207675_100833424 3300026118 Bacteria 937
650 Ga0207675_101959617 3300026118 Unclassified 604
651 Ga0207675_102488125 3300026118 Bacteria 529
652 Ga0207683_10074230 3300026121 Bacteria 3009
653 Ga0207683_10077685 3300026121 Bacteria 2941
654 Ga0207683_10172836 3300026121 Unclassified 1957
655 Ga0207698_12011170 3300026142 Bacteria 592
656 Ga0207428_10020520 3300027907 Bacteria 5612
657 Ga0207428_10033173 3300027907 Bacteria 4243
658 Ga0207428_10124057 3300027907 Bacteria 1978
659 Ga0268266_10017449 3300028379 Bacteria 6121
660 Ga0268266_10155676 3300028379 Bacteria 2064
661 Ga0268266_10358039 3300028379 Bacteria 1372
662 Ga0268266_10367120 3300028379 Bacteria 1355
663 Ga0268266_10431813 3300028379 Bacteria 1250
664 Ga0268266_10766556 3300028379 Bacteria 931
665 Ga0268265_10029803 3300028380 Bacteria 3923
666 Ga0268265_10039292 3300028380 Bacteria 3487
667 Ga0268265_10150452 3300028380 Bacteria 1962
668 Ga0268265_10169551 3300028380 Unclassified 1864
669 Ga0268265_10450100 3300028380 Unclassified 1202
670 Ga0268265_10614972 3300028380 Bacteria 1040
671 Ga0268265_11458296 3300028380 Unclassified 687
672 Ga0268265_11790188 3300028380 Bacteria 620
673 Ga0268264_10010441 3300028381 Bacteria 7678
674 Ga0268264_10128496 3300028381 Bacteria 2243
675 Ga0268264_10148973 3300028381 Bacteria 2096
676 Ga0268264_10254213 3300028381 Bacteria 1634
677 Ga0268264_10842490 3300028381 Bacteria 918
678 Ga0268264_11112698 3300028381 Unclassified 798
679 Ga0268264_11831410 3300028381 Unclassified 617
680 Ga0307511_10213100 3300030521 Bacteria 983
681 Ga0265332_10177359 3300031238 Unclassified 888
682 Ga0265332_10278009 3300031238 Bacteria 692
683 Ga0265328_10103350 3300031239 Unclassified 1056
684 Ga0265328_10305414 3300031239 Bacteria 615
685 Ga0307408_101443714 3300031548 Unclassified 649
686 Ga0265314_10032705 3300031711 Bacteria 3822
687 Ga0307416_101405385 3300032002 Bacteria 804
688 Ga0373930_0003233 3300034816 Bacteria 2574
689 Ga0373958_0000583 3300034819 Bacteria 4533
690 Ga0373958_0094093 3300034819 Unclassified 695
691 Ga0373959_0003459 3300034820 Bacteria 2512
692 Ga0373938_0001307 3300034957 Bacteria 4002
693 Ga0373928_0002173 3300035084 Bacteria 3822
694 Ga0373929_0001258 3300035085 Bacteria 4892
695 Ga0373929_0037540 3300035085 Bacteria 1063
696 Ga0373934_0092016 3300035086 Bacteria 1223
697 Ga0373949_0002582 3300035090 Bacteria 4592
698 Ga0373951_0000435 3300035091 Bacteria 12218
699 Ga0373952_0001680 3300035092 Bacteria 4024
700 Ga0373952_0028051 3300035092 Bacteria 1233
701 Ga0373923_0377908 3300035111 Unclassified 679
702 Ga0373923_0657788 3300035111 Unclassified 518
703 Ga0373932_0000144 3300035112 Bacteria 20208
704 Ga0373939_0001957 3300035114 Bacteria 4925
705 Ga0373939_0238142 3300035114 Unclassified 703
706 Ga0373939_0253235 3300035114 Unclassified 686
707 Ga0373941_0001787 3300035115 Bacteria 4627
708 Ga0373941_0005149 3300035115 Unclassified 3057
709 Ga0373941_0015740 3300035115 Bacteria 2045
710 Ga0373941_0261612 3300035115 Unclassified 679
711 Ga0373945_0114571 3300035116 Unclassified 1067
712 Ga0373953_0188833 3300035117 Unclassified 890
713 Ga0373954_0097240 3300035118 Bacteria 1419
714 Ga0373954_0285217 3300035118 Bacteria 814
715 Ga0373956_0039249 3300035119 Unclassified 2098
716 Ga0373956_0058807 3300035119 Bacteria 1738
717 Ga0373960_0002303 3300035121 Bacteria 4299
718 Ga0373943_0008530 3300035170 Bacteria 4596
719 Ga0373943_0098159 3300035170 Bacteria 1528
720 Ga0373943_0830832 3300035170 Unclassified 550
721 Ga0373946_0002505 3300035171 Bacteria 6487
722 Ga0373946_0278500 3300035171 Bacteria 822
723 Ga0373955_0097915 3300035172 Unclassified 1680
724 Ga0373955_0107349 3300035172 Bacteria 1611
725 Ga0373955_0585100 3300035172 Unclassified 683
726 Ga0373942_0000163 3300035207 Bacteria 16262
727 Ga0373961_0000863 3300035241 Bacteria 10204
728 Ga0373961_0072398 3300035241 Bacteria 1068
729 Ga0373961_0131173 3300035241 Bacteria 839
730 Ga0373962_0000442 3300035242 Bacteria 9068
731 Ga0373962_0231084 3300035242 Unclassified 636
732 Ga0373924_0067235 3300035410 Bacteria 1507
733 Ga0373931_0771369 3300035691 Unclassified 639
734 Ga0373935_0031073 3300035692 Unclassified 3312
735 Ga0373935_0666785 3300035692 Bacteria 764
736 Ga0373927_0102927 3300035695 Bacteria 1858
737 Ga0373927_0150646 3300035695 Bacteria 1523
738 Ga0373927_0327787 3300035695 Bacteria 1009
739 Ga0373933_0046024 3300035724 Unclassified 2589
740 Ga0373933_0233783 3300035724 Bacteria 1181
741 Ga0373947_0003502 3300035725 Bacteria 9274
742 Ga0373947_0092719 3300035725 Unclassified 1887
743 Ga0373947_0283973 3300035725 Unclassified 1101
744 Ga0373947_0286830 3300035725 Bacteria 1095
745 Ga0373947_0395764 3300035725 Bacteria 931
746 Ga0373947_0635555 3300035725 Unclassified 728
747 Ga0373937_0062556 3300036401 Bacteria 3422
748 Ga0373937_0110117 3300036401 Unclassified 2561
749 Ga0373937_0121942 3300036401 Bacteria 2430
750 Ga0373937_0236123 3300036401 Unclassified 1722
751 Ga0373937_0338010 3300036401 Bacteria 1426
752 Ga0373937_0595180 3300036401 Unclassified 1050
753 Ga0373937_1343281 3300036401 Unclassified 663
754 Ga0373925_0066673 3300037068 Bacteria 2714
755 Ga0373925_0132539 3300037068 Bacteria 1944
756 Ga0373925_0318550 3300037068 Bacteria 1258
757 Ga0373925_0380091 3300037068 Unclassified 1150
758 Ga0373925_0564668 3300037068 Bacteria 936
759 Ga0373925_1349197 3300037068 Unclassified 585
760 Ga0395898_1544047 3300037466 Bacteria 589
761 Ga0395905_1767868 3300037471 Bacteria 524
762 Ga0436365_1388943 3300039437 Bacteria 1849
763 Ga0451802_0423297 3300041460 Bacteria 505
764 Ga0439441_111997 3300042001 Unclassified 620
765 Ga0439435_0012171 3300042436 Unclassified 2078
766 Ga0466963_0218031 3300044694 Bacteria 1336
767 Ga0466957_0822769 3300044842 Unclassified 661
768 Ga0451576_0680206 3300045051 Unclassified 1081
769 Ga0451576_0810082 3300045051 Bacteria 983
770 Ga0451576_0820265 3300045051 Bacteria 977
771 Ga0466967_0342134 3300045976 Bacteria 1447
772 Ga0466967_1656042 3300045976 Bacteria 637
773 Ga0495592_0024179 3300046454 Bacteria 4618
774 Ga0495592_0552214 3300046454 Bacteria 708
775 Ga0495603_0086791 3300046455 Bacteria 1831
776 Ga0495629_0411940 3300046459 Unclassified 918
777 Ga0495651_0209551 3300046462 Unclassified 1358
778 Ga0495580_0084286 3300046472 Unclassified 2214
779 Ga0495580_0316371 3300046472 Bacteria 1061
780 Ga0495582_0095492 3300046473 Bacteria 1661
781 Ga0495582_0154950 3300046473 Bacteria 1302
782 Ga0495582_0470316 3300046473 Unclassified 726
783 Ga0495664_0060668 3300046477 Bacteria 2252
784 Ga0495664_0141489 3300046477 Bacteria 1459
785 Ga0495608_0004074 3300046511 Bacteria 10481
786 Ga0495618_0152429 3300046514 Bacteria 1476
787 Ga0495618_0492678 3300046514 Unclassified 740
788 Ga0495628_0051306 3300046516 Bacteria 3262
789 Ga0495628_0501915 3300046516 Unclassified 876
790 Ga0495628_0741532 3300046516 Bacteria 691
791 Ga0495630_0018154 3300046517 Bacteria 5165
792 Ga0495630_0316431 3300046517 Bacteria 1193
793 Ga0495642_0209817 3300046528 Bacteria 850
794 Ga0495640_0497111 3300046533 Bacteria 742
795 Ga0495586_0094488 3300046535 Unclassified 1654
796 Ga0495587_0023908 3300046536 Unclassified 3751
797 Ga0495598_0091370 3300046537 Bacteria 993
798 Ga0495645_0003196 3300046543 Bacteria 11105
799 Ga0495645_0499485 3300046543 Bacteria 760
800 Ga0495622_0374412 3300046557 Unclassified 615
801 Ga0495667_0043893 3300046559 Bacteria 2961
802 Ga0495667_0450479 3300046559 Bacteria 809
803 Ga0495656_0172590 3300046615 Bacteria 1058
804 Ga0495634_0067477 3300046642 Bacteria 2366
805 Ga0495635_0214989 3300046663 Bacteria 1301
806 Ga0495659_0077888 3300046664 Bacteria 1253
807 Ga0495599_0206004 3300046678 Bacteria 1207
808 Ga0495623_0199003 3300046679 Bacteria 1153
809 Ga0495646_0326599 3300046680 Unclassified 807
810 Ga0495647_0139147 3300046681 Unclassified 1034
811 Ga0495647_0491750 3300046681 Bacteria 570
812 Ga0495658_0061316 3300046683 Bacteria 2159
813 Ga0495658_0063577 3300046683 Unclassified 2124
814 Ga0495658_0127132 3300046683 Bacteria 1548
815 Ga0495658_0153629 3300046683 Bacteria 1415
816 Ga0495658_0251480 3300046683 Unclassified 1112
817 Ga0495669_0011196 3300046684 Bacteria 3804
818 Ga0495669_0103501 3300046684 Bacteria 1324
819 Ga0495613_0004189 3300046689 Bacteria 10793
820 Ga0495613_0317750 3300046689 Bacteria 1075
821 Ga0495600_0037792 3300046809 Bacteria 3140
822 Ga0495600_0175680 3300046809 Unclassified 1381
823 Ga0495604_0043852 3300047317 Bacteria 3498
824 Ga0495636_0353230 3300047318 Unclassified 694
825 Ga0495674_0017759 3300047319 Bacteria 6623
826 Ga0495674_0479677 3300047319 Unclassified 997
827 Ga0495680_0141393 3300047322 Unclassified 1761
828 Ga0495680_0470694 3300047322 Bacteria 857
829 Ga0495680_0796297 3300047322 Bacteria 618
830 Ga0495677_0324851 3300047445 Bacteria 606
831 Ga0495684_0016032 3300047471 Bacteria 5769
832 Ga0495684_0278933 3300047471 Bacteria 1206
833 Ga0495684_0573315 3300047471 Unclassified 765
834 Ga0495602_0488060 3300048088 Unclassified 863
835 Ga0495615_0239296 3300048090 Bacteria 572
836 Ga0496100_0069575 3300048903 Unclassified 2344
837 Ga0496100_0222789 3300048903 Bacteria 1385
838 Ga0496101_0000830 3300048904 Bacteria 18197
839 Ga0496102_0230493 3300048905 Bacteria 1746
840 Ga0496102_0295365 3300048905 Bacteria 1527
841 Ga0496102_0849409 3300048905 Bacteria 835
842 Ga0496102_1157241 3300048905 Bacteria 693
843 Ga0496102_1559372 3300048905 Bacteria 579
844 Ga0496104_0006932 3300048907 Bacteria 9996
845 Ga0496104_0041811 3300048907 Bacteria 4299
846 Ga0496104_0067011 3300048907 Unclassified 3410
847 Ga0496104_0076320 3300048907 Unclassified 3192
848 Ga0496104_0167975 3300048907 Bacteria 2104
849 Ga0496104_0277524 3300048907 Unclassified 1589
850 Ga0496104_0425838 3300048907 Bacteria 1239
851 Ga0496104_0855719 3300048907 Unclassified 815
852 Ga0496104_0882001 3300048907 Unclassified 800
853 Ga0496104_1701338 3300048907 Unclassified 533
854 Ga0496106_0117938 3300048909 Unclassified 2072
855 Ga0496106_0197281 3300048909 Bacteria 1601
856 Ga0496106_0312867 3300048909 Unclassified 1260
857 Ga0496107_0290486 3300048910 Bacteria 1217
858 Ga0496108_0036029 3300048911 Bacteria 4115
859 Ga0496108_0304210 3300048911 Unclassified 1389
860 Ga0496108_0326505 3300048911 Bacteria 1338
861 Ga0496108_1207854 3300048911 Unclassified 639
862 Ga0496109_0397924 3300048912 Unclassified 1301
863 Ga0496110_0040200 3300048913 Bacteria 4076
864 Ga0496110_0111618 3300048913 Bacteria 2458
865 Ga0496111_0047559 3300048914 Bacteria 3090
866 Ga0496111_0932724 3300048914 Unclassified 624
867 Ga0496111_1206471 3300048914 Unclassified 536
868 Ga0496112_0006817 3300048915 Bacteria 10070
869 Ga0496112_0055550 3300048915 Bacteria 3894
870 Ga0496112_0175963 3300048915 Unclassified 2105
871 Ga0496112_0223638 3300048915 Bacteria 1838
872 Ga0496112_0548100 3300048915 Bacteria 1090
873 Ga0496112_1308332 3300048915 Unclassified 640
874 Ga0496113_0002074 3300048916 Bacteria 11532
875 Ga0496113_0288905 3300048916 Bacteria 1312
876 Ga0496114_0028582 3300048917 Bacteria 4576
877 Ga0496114_0035672 3300048917 Bacteria 4108
878 Ga0496114_0468282 3300048917 Bacteria 1115
879 Ga0496114_0653409 3300048917 Unclassified 925
880 Ga0496114_1494799 3300048917 Bacteria 563
881 Ga0496115_0079979 3300048918 Bacteria 2661
882 Ga0501033_0587576 3300049570 Bacteria 765
883 Ga0501034_0105145 3300049571 Bacteria 2816
884 Ga0501040_0194504 3300049576 Bacteria 1440
885 Ga0501043_0067616 3300049579 Bacteria 2806
886 Ga0501047_0025626 3300049581 Bacteria 5670
887 Ga0501047_0147278 3300049581 Bacteria 2231
888 Ga0501048_0655712 3300049582 Unclassified 754
889 Ga0501073_0203228 3300049589 Bacteria 1370
890 Ga0501079_0612018 3300049741 Bacteria 857
891 Ga0501083_0169387 3300049744 Bacteria 1428
892 Ga0501083_0251005 3300049744 Unclassified 1152
893 Ga0501044_0017983 3300049823 Bacteria 7579
894 nmdc:mga05p37_1026191_c1 3300050507 Bacteria 873
895 nmdc:mga05p37_104043_c2 3300050507 Unclassified 2963
896 nmdc:mga05p37_141928_c1 3300050507 Bacteria 2942
897 nmdc:mga05p37_15195_c1 3300050507 Bacteria 9245
898 nmdc:mga05p37_212237_c1 3300050507 Bacteria 2340
899 nmdc:mga05p37_22345_c1 3300050507 Bacteria 7673
900 nmdc:mga05p37_2445_c1 3300050507 Bacteria 21611
901 nmdc:mga05p37_26793_c1 3300050507 Bacteria 7010
902 nmdc:mga05p37_300236_c1 3300050507 Bacteria 1908
903 nmdc:mga05p37_55115_c2 3300050507 Bacteria 2350
904 nmdc:mga05p37_70171_c1 3300050507 Bacteria 4310
905 nmdc:mga05p37_79243_c1 3300050507 Bacteria 4045
906 nmdc:mga05p37_8679_c1 3300050507 Bacteria 12009
907 nmdc:mga09592_1061329_c1 3300050508 Bacteria 675
908 nmdc:mga09592_57903_c1 3300050508 Bacteria 3276
909 nmdc:mga09592_720733_c1 3300050508 Bacteria 848
910 nmdc:mga09592_803475_c1 3300050508 Bacteria 795
911 nmdc:mga09592_846854_c1 3300050508 Bacteria 771
912 nmdc:mga06r32_353903_c1 3300050510 Unclassified 1453
913 nmdc:mga08y16_10551_c1 3300050511 Bacteria 9696
914 nmdc:mga08y16_179180_c1 3300050511 Bacteria 2200
915 nmdc:mga08y16_18326_c1 3300050511 Bacteria 7377
916 nmdc:mga08y16_19245_c1 3300050511 Bacteria 7196
917 nmdc:mga0n895_12013_c1 3300050512 Bacteria 7750
918 nmdc:mga0n895_131955_c1 3300050512 Bacteria 2523
919 nmdc:mga0n895_141_c1 3300050512 Bacteria 43611
920 nmdc:mga0n895_220120_c1 3300050512 Bacteria 1928
921 nmdc:mga0n895_2213967_c1 3300050512 Unclassified 505
922 nmdc:mga0n895_484250_c1 3300050512 Unclassified 1247
923 nmdc:mga0n895_7789_c1 3300050512 Bacteria 9229
924 nmdc:mga0n895_880199_c1 3300050512 Bacteria 882
925 nmdc:mga0rr50_13152_c1 3300050513 Bacteria 5377
926 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
927 nmdc:mga0rr50_54258_c1 3300050513 Bacteria 2985
928 nmdc:mga0rr50_67237_c1 3300050513 Bacteria 2722
929 nmdc:mga0rr50_743880_c1 3300050513 Bacteria 837
930 nmdc:mga0rr50_91466_c1 3300050513 Unclassified 2370
931 nmdc:mga0rr50_9174_c1 3300050513 Bacteria 6202
932 nmdc:mga0rr50_94174_c2 3300050513 Unclassified 1938
933 nmdc:mga08x19_13318_c1 3300050514 Bacteria 4969
934 nmdc:mga08x19_133546_c1 3300050514 Bacteria 1671
935 nmdc:mga08x19_234209_c1 3300050514 Bacteria 1265
936 nmdc:mga08x19_47168_c1 3300050514 Bacteria 2757
937 nmdc:mga08x19_507845_c1 3300050514 Unclassified 851
938 nmdc:mga08x19_61999_c1 3300050514 Bacteria 2424
939 nmdc:mga08x19_8030_c1 3300050514 Bacteria 6272
940 nmdc:mga08x19_88190_c1 3300050514 Bacteria 2045
941 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
942 nmdc:mga0a205_132096_c1 3300050515 Bacteria 2397
943 nmdc:mga0a205_1463535_c1 3300050515 Unclassified 531
944 nmdc:mga0a205_147006_c1 3300050515 Bacteria 2257
945 nmdc:mga0a205_148542_c1 3300050515 Bacteria 2244
946 nmdc:mga0a205_463756_c1 3300050515 Bacteria 1126
947 nmdc:mga0a205_489849_c1 3300050515 Bacteria 1087
948 nmdc:mga0a205_84754_c1 3300050515 Bacteria 3061
949 Ga0495601_0003358 3300053077 Bacteria 9163
950 Ga0495601_0034147 3300053077 Bacteria 3172
951 Ga0495601_0090234 3300053077 Bacteria 1971
952 Ga0495601_0216205 3300053077 Bacteria 1252
953 Ga0495595_0014239 3300053084 Unclassified 3371
954 Ga0495595_0054476 3300053084 Bacteria 1860
955 Ga0495619_0003172 3300053085 Bacteria 10651
956 Ga0495619_0132127 3300053085 Unclassified 1716
957 Ga0495619_0166321 3300053085 Unclassified 1524
958 Ga0495619_0173344 3300053085 Bacteria 1492
959 Ga0495619_0737235 3300053085 Unclassified 669
960 Ga0495619_0863685 3300053085 Bacteria 610
961 Ga0500658_0027878 3300053134 Bacteria 2188
962 Ga0501084_0357429 3300054114 Bacteria 1234
963 Ga0501082_0038319 3300060353 Bacteria 4135
964 Ga0501082_0515728 3300060353 Bacteria 1045
965 Ga0501082_0771975 3300060353 Bacteria 841
966 Ga0501082_1108991 3300060353 Bacteria 692
967 Ga0530510_0792266 3300061734 Bacteria 723
968 Ga0207646_10343809
969 Ga0065714_10020465
970 Ga0065704_10272398
971 Ga0065704_10394357
972 Ga0065712_10017326
973 Ga0065712_10084377
974 Ga0065715_10129866
975 Ga0065715_10457654
976 Ga0065715_10563030
977 Ga0065715_10597780
978 Ga0065707_10041819
979 Ga0065707_10055820
980 Ga0065707_10541731
981 Ga0070676_10003053
982 Ga0070676_10205622
983 Ga0070676_10511841
984 Ga0070683_100024062
985 Ga0070683_100122832
986 Ga0070683_100510007
987 Ga0070683_101054821
988 Ga0070690_100064683
989 Ga0070670_100050066
990 Ga0070670_100257519
991 Ga0070677_10400803
992 Ga0070677_10730189
993 Ga0068869_100068178
994 Ga0068869_100120659
995 Ga0070666_10011714
996 Ga0070666_10123429
997 Ga0070666_10186173
998 Ga0070666_10239099
999 Ga0070666_10260989
1000 Ga0070666_10344043
1001 Ga0070680_100290309
1002 Ga0070682_100084121
1003 Ga0070682_101701129
1004 Ga0068868_100016616
1005 Ga0068868_100056104
1006 Ga0068868_100080712
1007 Ga0068868_100126893
1008 Ga0068868_100550398
1009 Ga0068868_100561918
1010 Ga0068868_101080943
1011 Ga0070660_100360819
1012 Ga0070660_100609604
1013 Ga0070660_100652080
1014 Ga0070689_100034783
1015 Ga0070691_10000837
1016 Ga0070691_10136622
1017 Ga0070687_100091476
1018 Ga0070687_100501226
1019 Ga0070661_100067727
1020 Ga0070692_10107092
1021 Ga0070692_10283596
1022 Ga0070668_100039358
1023 Ga0070668_100217844
1024 Ga0070668_100457728
1025 Ga0070668_100943149
1026 Ga0070669_100003885
1027 Ga0070669_100040254
1028 Ga0070669_100048756
1029 Ga0070669_100293153
1030 Ga0070669_100522595
1031 Ga0070669_100534725
1032 Ga0070669_100779967
1033 Ga0070669_100928899
1034 Ga0070669_100974081
1035 Ga0070675_100040576
1036 Ga0070675_100086632
1037 Ga0070675_100763068
1038 Ga0070671_100248401
1039 Ga0070671_100392783
1040 Ga0070671_100547216
1041 Ga0070671_100723640
1042 Ga0070674_100040108
1043 Ga0070674_100067515
1044 Ga0070674_100120391
1045 Ga0070674_100323659
1046 Ga0070674_100724771
1047 Ga0070673_100085114
1048 Ga0070673_100309293
1049 Ga0070673_100481865
1050 Ga0070673_100517389
1051 Ga0070673_100696635
1052 Ga0070673_100928247
1053 Ga0070673_100931106
1054 Ga0070673_101624105
1055 Ga0070688_100008134
1056 Ga0070688_100235611
1057 Ga0070688_100268753
1058 Ga0070659_100081018
1059 Ga0070659_100694767
1060 Ga0070667_100113102
1061 Ga0070667_100156808
1062 Ga0070667_100819007
1063 Ga0070667_100820662
1064 Ga0070667_101305036
1065 Ga0070667_101533926
1066 Ga0070703_10172188
1067 Ga0070709_10489398
1068 Ga0070709_10663068
1069 Ga0070713_100006500
1070 Ga0070713_100257050
1071 Ga0070713_100676781
1072 Ga0070701_10002538
1073 Ga0070701_10156121
1074 Ga0070701_10156996
1075 Ga0070711_100143115
1076 Ga0070705_100016534
1077 Ga0070705_100043461
1078 Ga0070705_100659089
1079 Ga0070700_100003531
1080 Ga0070700_100048849
1081 Ga0070700_100110280
1082 Ga0070700_100152006
1083 Ga0070694_100070470
1084 Ga0070694_100088514
1085 Ga0070694_100292694
1086 Ga0070708_100019093
1087 Ga0070708_100079497
1088 Ga0070708_100801691
1089 Ga0070663_101179535
1090 Ga0070678_100290004
1091 Ga0070678_100359848
1092 Ga0070662_100036801
1093 Ga0070662_100216098
1094 Ga0070662_100241777
1095 Ga0070662_100361696
1096 Ga0070681_10003654
1097 Ga0070681_10222506
1098 Ga0070681_10461162
1099 Ga0070681_11025984
1100 Ga0070681_11750172
1101 Ga0068867_100100070
1102 Ga0068867_100147144
1103 Ga0068867_100153682
1104 Ga0068867_100442656
1105 Ga0068867_101451460
1106 Ga0070685_10240297
1107 Ga0070706_100187714
1108 Ga0070706_100518351
1109 Ga0070706_101019020
1110 Ga0070707_100872399
1111 Ga0070707_101434051
1112 Ga0070698_100012233
1113 Ga0070698_100082559
1114 Ga0070698_100179129
1115 Ga0070698_100206950
1116 Ga0070698_101354951
1117 Ga0070699_100023159
1118 Ga0070679_100060903
1119 Ga0070679_100406580
1120 Ga0070684_100083898
1121 Ga0070684_100136628
1122 Ga0070684_100363773
1123 Ga0070684_100653905
1124 Ga0070697_100062033
1125 Ga0068853_100324878
1126 Ga0068853_100581578
1127 Ga0068853_100975850
1128 Ga0068853_101486371
1129 Ga0070672_100036518
1130 Ga0070672_100276554
1131 Ga0070672_100668885
1132 Ga0070672_100740916
1133 Ga0070672_100944782
1134 Ga0070672_101218867
1135 Ga0070686_100000153
1136 Ga0070686_100570675
1137 Ga0070686_100590751
1138 Ga0070686_100636622
1139 Ga0070686_100872571
1140 Ga0070695_100000777
1141 Ga0070695_100043745
1142 Ga0070695_100969182
1143 Ga0070695_101872291
1144 Ga0070696_100011456
1145 Ga0070696_100151980
1146 Ga0070696_100198182
1147 Ga0070696_100265591
1148 Ga0070696_100323910
1149 Ga0070696_100494405
1150 Ga0070696_101106842
1151 Ga0070693_100475397
1152 Ga0070693_101509464
1153 Ga0070665_100001513
1154 Ga0070665_100021143
1155 Ga0070665_100263815
1156 Ga0070665_100290957
1157 Ga0070665_100463061
1158 Ga0070665_100545039
1159 Ga0070704_100002431
1160 Ga0070704_100005299
1161 Ga0070704_101375143
1162 Ga0068855_100019451
1163 Ga0068855_100540126
1164 Ga0070664_100090116
1165 Ga0070664_100116360
1166 Ga0068857_100544617
1167 Ga0068854_100012660
1168 Ga0068854_100060130
1169 Ga0068854_100415052
1170 Ga0068854_100509103
1171 Ga0068854_102125927
1172 Ga0068856_100027205
1173 Ga0070702_100003807
1174 Ga0068852_101244275
1175 Ga0068859_100069609
1176 Ga0068859_100100830
1177 Ga0068859_100121750
1178 Ga0068859_100227375
1179 Ga0068859_100256039
1180 Ga0068859_100369930
1181 Ga0068859_100446991
1182 Ga0068859_100522452
1183 Ga0068859_100817800
1184 Ga0068864_100013809
1185 Ga0068864_100073303
1186 Ga0068864_100118661
1187 Ga0068864_100127701
1188 Ga0068864_100139677
1189 Ga0068864_100522129
1190 Ga0068866_10057287
1191 Ga0068866_10120424
1192 Ga0068866_10361872
1193 Ga0068861_100112706
1194 Ga0068861_100162540
1195 Ga0068861_100221127
1196 Ga0068861_101031634
1197 Ga0068861_101750380
1198 Ga0068851_10020478
1199 Ga0068863_100006690
1200 Ga0068863_100128678
1201 Ga0068863_100180703
1202 Ga0068863_100542513
1203 Ga0068863_100543064
1204 Ga0068858_100003161
1205 Ga0068858_100005969
1206 Ga0068858_100044461
1207 Ga0068858_100085316
1208 Ga0068858_100091344
1209 Ga0068858_100127144
1210 Ga0068858_100152671
1211 Ga0068858_100448662
1212 Ga0068858_100885458
1213 Ga0068860_100014590
1214 Ga0068860_100595934
1215 Ga0068860_101064118
1216 Ga0068860_101093678
1217 Ga0068860_101376597
1218 Ga0068860_101421588
1219 Ga0068860_101669792
1220 Ga0068862_100002661
1221 Ga0068862_100024171
1222 Ga0068862_100129416
1223 Ga0068862_100275868
1224 Ga0068862_100350572
1225 Ga0068862_100462135
1226 Ga0068862_100541922
1227 Ga0068862_100984915
1228 Ga0081455_10052456
1229 Ga0081539_10002012
1230 Ga0070717_10324080
1231 Ga0070712_100322187
1232 Ga0097621_100000125
1233 Ga0097621_100014247
1234 Ga0097621_100017775
1235 Ga0097621_100038740
1236 Ga0097621_100105568
1237 Ga0097621_100153526
1238 Ga0097621_100154846
1239 Ga0097621_100726154
1240 Ga0097621_100996314
1241 Ga0068871_100000134
1242 Ga0068871_100029682
1243 Ga0068871_100093179
1244 Ga0068871_100133321
1245 Ga0068871_100143254
1246 Ga0068871_102043834
1247 Ga0075428_100088295
1248 Ga0075428_100452689
1249 Ga0075428_100639156
1250 Ga0075428_101217159
1251 Ga0075431_100113206
1252 Ga0075433_10016907
1253 Ga0075433_10071887
1254 Ga0075433_10443069
1255 Ga0075433_10490849
1256 Ga0075433_11325147
1257 Ga0075434_100001054
1258 Ga0075434_100001202
1259 Ga0075434_100002093
1260 Ga0075434_100065019
1261 Ga0075434_100073849
1262 Ga0075434_100218129
1263 Ga0075434_100348634
1264 Ga0075434_100410074
1265 Ga0075434_100893246
1266 Ga0075434_101420627
1267 Ga0075429_100200845
1268 Ga0075429_100252537
1269 Ga0075429_100372174
1270 Ga0068865_100053714
1271 Ga0068865_100083576
1272 Ga0068865_100138493
1273 Ga0068865_100358136
1274 Ga0068865_100763986
1275 Ga0068865_100996900
1276 Ga0068865_101173876
1277 Ga0075436_100001908
1278 Ga0075436_100014361
1279 Ga0075436_100079509
1280 Ga0075436_100189856
1281 Ga0097620_100069610
1282 Ga0097620_100100838
1283 Ga0097620_100121760
1284 Ga0097620_100227376
1285 Ga0097620_100256046
1286 Ga0097620_100369941
1287 Ga0097620_100447026
1288 Ga0097620_100522408
1289 Ga0097620_100817802
1290 Ga0075435_100000204
1291 Ga0075435_100000924
1292 Ga0075435_100001088
1293 Ga0075435_100031162
1294 Ga0075435_100118917
1295 Ga0075435_100166785
1296 Ga0075435_100374576
1297 Ga0075435_100950628
1298 Ga0075435_101341729
1299 Ga0099794_10037690
1300 Ga0099794_10627984
1301 Ga0105251_10302715
1302 Ga0105240_10010017
1303 Ga0105240_10081871
1304 Ga0105240_10111828
1305 Ga0105240_10449709
1306 Ga0105240_11080709
1307 Ga0105240_11459654
1308 Ga0111539_10000466
1309 Ga0111539_10007493
1310 Ga0111539_10029457
1311 Ga0111539_10039828
1312 Ga0111539_10343310
1313 Ga0111539_10535520
1314 Ga0111539_11913496
1315 Ga0105245_10009401
1316 Ga0105245_10148967
1317 Ga0105245_10167913
1318 Ga0105245_10221039
1319 Ga0105245_10248147
1320 Ga0105245_10330229
1321 Ga0105245_10655561
1322 Ga0105247_10001472
1323 Ga0105247_10013578
1324 Ga0105247_10024096
1325 Ga0105247_10778934
1326 Ga0114129_10000426
1327 Ga0114129_10000876
1328 Ga0114129_10003910
1329 Ga0114129_10004361
1330 Ga0114129_10008094
1331 Ga0114129_10012966
1332 Ga0114129_10083778
1333 Ga0114129_10178236
1334 Ga0114129_10213988
1335 Ga0114129_10339302
1336 Ga0114129_10347070
1337 Ga0114129_10355253
1338 Ga0114129_11691886
1339 Ga0114129_11692982
1340 Ga0114129_11945287
1341 Ga0114129_12802331
1342 Ga0105243_10029595
1343 Ga0105243_10087732
1344 Ga0105243_10148007
1345 Ga0105243_10430108
1346 Ga0105243_10904185
1347 Ga0105241_10289002
1348 Ga0105241_10492704
1349 Ga0105241_10843506
1350 Ga0105242_10058695
1351 Ga0105242_10174182
1352 Ga0105242_10208811
1353 Ga0105242_10256614
1354 Ga0105242_11417459
1355 Ga0105248_10002519
1356 Ga0105248_10036746
1357 Ga0105248_10045082
1358 Ga0105248_10157780
1359 Ga0105248_10180592
1360 Ga0105248_10221025
1361 Ga0105248_10239404
1362 Ga0105248_10666126
1363 Ga0105248_10859833
1364 Ga0105248_10948005
1365 Ga0105248_11712830
1366 Ga0105237_10296246
1367 Ga0105238_10212048
1368 Ga0105238_10212722
1369 Ga0105238_10403112
1370 Ga0105249_10248805
1371 Ga0105249_10605556
1372 Ga0105249_11132999
1373 Ga0105249_11454211
1374 Ga0105249_12585168
1375 Ga0105239_12019841
1376 Ga0105246_10202185
1377 Ga0105246_11518790
1378 Ga0105246_11637124
1379 Ga0157323_1005343
1380 Ga0157369_11294663
1381 Ga0157374_10037537
1382 Ga0157374_10055503
1383 Ga0157374_10547047
1384 Ga0157374_10701591
1385 Ga0157378_10005743
1386 Ga0157378_10250526
1387 Ga0157378_10296475
1388 Ga0157378_10308617
1389 Ga0157378_12127291
1390 Ga0163162_10034270
1391 Ga0163162_10276059
1392 Ga0163162_11143377
1393 Ga0157372_10286901
1394 Ga0157375_10059732
1395 Ga0157375_10172839
1396 Ga0157375_10798370
1397 Ga0157375_11452447
1398 Ga0157375_11825967
1399 Ga0163163_10011654
1400 Ga0163163_10019039
1401 Ga0163163_10661526
1402 Ga0163163_10801737
1403 Ga0163163_11196478
1404 Ga0163163_11403490
1405 Ga0157380_10166704
1406 Ga0157380_10623187
1407 Ga0157380_10803574
1408 Ga0157380_12391106
1409 Ga0157377_10258257
1410 Ga0157377_10351327
1411 Ga0157379_10002568
1412 Ga0157379_10003372
1413 Ga0157379_10025073
1414 Ga0157379_10064423
1415 Ga0157379_10385560
1416 Ga0157379_10843896
1417 Ga0157376_10002539
1418 Ga0157376_10011019
1419 Ga0157376_10024820
1420 Ga0157376_10050013
1421 Ga0157376_10137508
1422 Ga0157376_10145968
1423 Ga0157376_10297582
1424 Ga0157376_10414484
1425 Ga0157376_10440374
1426 Ga0157376_11288399
1427 Ga0157376_11724519
1428 Ga0163161_10464758
1429 Ga0213876_10077902
1430 Ga0207697_10134709
1431 Ga0207653_10052402
1432 Ga0207653_10059000
1433 Ga0207682_10270388
1434 Ga0207642_10024812
1435 Ga0207642_10054789
1436 Ga0207642_10344187
1437 Ga0207688_10137520
1438 Ga0207688_10185636
1439 Ga0207680_10033007
1440 Ga0207680_10067592
1441 Ga0207680_10071456
1442 Ga0207680_10137089
1443 Ga0207680_10683533
1444 Ga0207685_10007767
1445 Ga0207685_10462606
1446 Ga0207645_10005648
1447 Ga0207645_10600295
1448 Ga0207645_10658946
1449 Ga0207645_10882594
1450 Ga0207643_10223628
1451 Ga0207643_10574663
1452 Ga0207705_10156957
1453 Ga0207684_10369142
1454 Ga0207654_10130226
1455 Ga0207654_10300968
1456 Ga0207654_10366993
1457 Ga0207707_10008859
1458 Ga0207707_10034907
1459 Ga0207707_10156653
1460 Ga0207707_10195159
1461 Ga0207707_11278914
1462 Ga0207695_10066322
1463 Ga0207695_10202742
1464 Ga0207695_10237457
1465 Ga0207695_11395915
1466 Ga0207671_10433322
1467 Ga0207663_10279936
1468 Ga0207660_10038187
1469 Ga0207662_10057705
1470 Ga0207662_10203639
1471 Ga0207662_10489339
1472 Ga0207657_10000489
1473 Ga0207649_10087098
1474 Ga0207649_10348314
1475 Ga0207652_10024759
1476 Ga0207652_10187340
1477 Ga0207646_10203816
1478 Ga0207646_10592876
1479 Ga0207646_10802924
1480 Ga0207646_11222293
1481 Ga0207681_10057387
1482 Ga0207681_10090798
1483 Ga0207681_10119098
1484 Ga0207681_10247764
1485 Ga0207681_10281926
1486 Ga0207681_10972118
1487 Ga0207694_10455689
1488 Ga0207650_11019739
1489 Ga0207650_11211821
1490 Ga0207659_10157078
1491 Ga0207659_10484111
1492 Ga0207659_10528054
1493 Ga0207659_10580608
1494 Ga0207659_10794357
1495 Ga0207687_10084438
1496 Ga0207687_10164797
1497 Ga0207687_10272219
1498 Ga0207700_10008186
1499 Ga0207644_10283851
1500 Ga0207644_10334324
1501 Ga0207690_10177567
1502 Ga0207706_10175950
1503 Ga0207706_10219852
1504 Ga0207706_10340871
1505 Ga0207706_10529809
1506 Ga0207686_10002741
1507 Ga0207686_10162219
1508 Ga0207686_10454712
1509 Ga0207686_10759403
1510 Ga0207686_11161580
1511 Ga0207709_10013009
1512 Ga0207709_10072344
1513 Ga0207709_10326916
1514 Ga0207670_10079013
1515 Ga0207670_10557166
1516 Ga0207670_10730858
1517 Ga0207670_11033327
1518 Ga0207669_10042565
1519 Ga0207669_10060200
1520 Ga0207669_10315587
1521 Ga0207669_10441655
1522 Ga0207704_10203266
1523 Ga0207704_10230660
1524 Ga0207704_10936278
1525 Ga0207704_11572477
1526 Ga0207665_10780964
1527 Ga0207691_10028678
1528 Ga0207691_10254075
1529 Ga0207691_10474046
1530 Ga0207691_10927894
1531 Ga0207711_10027871
1532 Ga0207711_10049925
1533 Ga0207711_10062119
1534 Ga0207711_10115715
1535 Ga0207711_10164554
1536 Ga0207711_10230211
1537 Ga0207711_11154601
1538 Ga0207689_10033103
1539 Ga0207689_10069887
1540 Ga0207689_10326895
1541 Ga0207661_10028809
1542 Ga0207661_10589381
1543 Ga0207661_10865976
1544 Ga0207679_10054644
1545 Ga0207679_10063933
1546 Ga0207679_10699364
1547 Ga0207679_10857503
1548 Ga0207667_10014648
1549 Ga0207667_10237154
1550 Ga0207667_10561666
1551 Ga0207651_10259042
1552 Ga0207651_10388758
1553 Ga0207651_10445961
1554 Ga0207651_11138943
1555 Ga0207712_10075629
1556 Ga0207712_10188076
1557 Ga0207712_10572332
1558 Ga0207712_10690276
1559 Ga0207712_10916190
1560 Ga0207668_10083109
1561 Ga0207668_10217751
1562 Ga0207640_10004577
1563 Ga0207640_10010018
1564 Ga0207640_10440786
1565 Ga0207658_10300199
1566 Ga0207658_10390827
1567 Ga0207677_10051231
1568 Ga0207677_10084337
1569 Ga0207677_10155187
1570 Ga0207677_10801347
1571 Ga0207677_10857256
1572 Ga0207677_11129927
1573 Ga0207677_11775481
1574 Ga0207703_10007066
1575 Ga0207703_10020073
1576 Ga0207703_10049524
1577 Ga0207703_10080823
1578 Ga0207703_10209948
1579 Ga0207703_10281224
1580 Ga0207703_10505504
1581 Ga0207703_11429516
1582 Ga0207703_11512413
1583 Ga0207639_10699112
1584 Ga0207639_11253709
1585 Ga0207708_10004038
1586 Ga0207708_10019580
1587 Ga0207708_10071341
1588 Ga0207708_11094444
1589 Ga0207702_10391965
1590 Ga0207702_10651134
1591 Ga0207641_10002698
1592 Ga0207641_10060911
1593 Ga0207641_10068431
1594 Ga0207641_10150518
1595 Ga0207641_10363313
1596 Ga0207641_10865708
1597 Ga0207648_10012103
1598 Ga0207648_10185956
1599 Ga0207648_10262833
1600 Ga0207648_10279887
1601 Ga0207648_10661927
1602 Ga0207648_11547802
1603 Ga0207676_10006464
1604 Ga0207676_10091796
1605 Ga0207676_10106338
1606 Ga0207676_10166192
1607 Ga0207676_10208453
1608 Ga0207674_10228166
1609 Ga0207674_10231774
1610 Ga0207674_10669298
1611 Ga0207675_100020610
1612 Ga0207675_100182632
1613 Ga0207675_100291292
1614 Ga0207675_100554882
1615 Ga0207675_100642165
1616 Ga0207675_100833424
1617 Ga0207675_101959617
1618 Ga0207675_102488125
1619 Ga0207683_10074230
1620 Ga0207683_10077685
1621 Ga0207683_10172836
1622 Ga0207698_12011170
1623 Ga0207428_10020520
1624 Ga0207428_10033173
1625 Ga0207428_10124057
1626 Ga0268266_10017449
1627 Ga0268266_10155676
1628 Ga0268266_10358039
1629 Ga0268266_10367120
1630 Ga0268266_10431813
1631 Ga0268266_10766556
1632 Ga0268265_10029803
1633 Ga0268265_10039292
1634 Ga0268265_10150452
1635 Ga0268265_10169551
1636 Ga0268265_10450100
1637 Ga0268265_10614972
1638 Ga0268265_11458296
1639 Ga0268265_11790188
1640 Ga0268264_10010441
1641 Ga0268264_10128496
1642 Ga0268264_10148973
1643 Ga0268264_10254213
1644 Ga0268264_10842490
1645 Ga0268264_11112698
1646 Ga0268264_11831410
1647 Ga0307511_10213100
1648 Ga0265332_10177359
1649 Ga0265332_10278009
1650 Ga0265328_10103350
1651 Ga0265328_10305414
1652 Ga0307408_101443714
1653 Ga0265314_10032705
1654 Ga0307416_101405385
1655 Ga0373930_0003233
1656 Ga0373958_0000583
1657 Ga0373958_0094093
1658 Ga0373959_0003459
1659 Ga0373938_0001307
1660 Ga0373928_0002173
1661 Ga0373929_0001258
1662 Ga0373929_0037540
1663 Ga0373934_0092016
1664 Ga0373949_0002582
1665 Ga0373951_0000435
1666 Ga0373952_0001680
1667 Ga0373952_0028051
1668 Ga0373923_0377908
1669 Ga0373923_0657788
1670 Ga0373932_0000144
1671 Ga0373939_0001957
1672 Ga0373939_0238142
1673 Ga0373939_0253235
1674 Ga0373941_0001787
1675 Ga0373941_0005149
1676 Ga0373941_0015740
1677 Ga0373941_0261612
1678 Ga0373945_0114571
1679 Ga0373953_0188833
1680 Ga0373954_0097240
1681 Ga0373954_0285217
1682 Ga0373956_0039249
1683 Ga0373956_0058807
1684 Ga0373960_0002303
1685 Ga0373943_0008530
1686 Ga0373943_0098159
1687 Ga0373943_0830832
1688 Ga0373946_0002505
1689 Ga0373946_0278500
1690 Ga0373955_0097915
1691 Ga0373955_0107349
1692 Ga0373955_0585100
1693 Ga0373942_0000163
1694 Ga0373961_0000863
1695 Ga0373961_0072398
1696 Ga0373961_0131173
1697 Ga0373962_0000442
1698 Ga0373962_0231084
1699 Ga0373924_0067235
1700 Ga0373931_0771369
1701 Ga0373935_0031073
1702 Ga0373935_0666785
1703 Ga0373927_0102927
1704 Ga0373927_0150646
1705 Ga0373927_0327787
1706 Ga0373933_0046024
1707 Ga0373933_0233783
1708 Ga0373947_0003502
1709 Ga0373947_0092719
1710 Ga0373947_0283973
1711 Ga0373947_0286830
1712 Ga0373947_0395764
1713 Ga0373947_0635555
1714 Ga0373937_0062556
1715 Ga0373937_0110117
1716 Ga0373937_0121942
1717 Ga0373937_0236123
1718 Ga0373937_0338010
1719 Ga0373937_0595180
1720 Ga0373937_1343281
1721 Ga0373925_0066673
1722 Ga0373925_0132539
1723 Ga0373925_0318550
1724 Ga0373925_0380091
1725 Ga0373925_0564668
1726 Ga0373925_1349197
1727 Ga0395898_1544047
1728 Ga0395905_1767868
1729 Ga0436365_1388943
1730 Ga0451802_0423297
1731 Ga0439441_111997
1732 Ga0439435_0012171
1733 Ga0466963_0218031
1734 Ga0466957_0822769
1735 Ga0451576_0680206
1736 Ga0451576_0810082
1737 Ga0451576_0820265
1738 Ga0466967_0342134
1739 Ga0466967_1656042
1740 Ga0495592_0024179
1741 Ga0495592_0552214
1742 Ga0495603_0086791
1743 Ga0495629_0411940
1744 Ga0495651_0209551
1745 Ga0495580_0084286
1746 Ga0495580_0316371
1747 Ga0495582_0095492
1748 Ga0495582_0154950
1749 Ga0495582_0470316
1750 Ga0495664_0060668
1751 Ga0495664_0141489
1752 Ga0495608_0004074
1753 Ga0495618_0152429
1754 Ga0495618_0492678
1755 Ga0495628_0051306
1756 Ga0495628_0501915
1757 Ga0495628_0741532
1758 Ga0495630_0018154
1759 Ga0495630_0316431
1760 Ga0495642_0209817
1761 Ga0495640_0497111
1762 Ga0495586_0094488
1763 Ga0495587_0023908
1764 Ga0495598_0091370
1765 Ga0495645_0003196
1766 Ga0495645_0499485
1767 Ga0495622_0374412
1768 Ga0495667_0043893
1769 Ga0495667_0450479
1770 Ga0495656_0172590
1771 Ga0495634_0067477
1772 Ga0495635_0214989
1773 Ga0495659_0077888
1774 Ga0495599_0206004
1775 Ga0495623_0199003
1776 Ga0495646_0326599
1777 Ga0495647_0139147
1778 Ga0495647_0491750
1779 Ga0495658_0061316
1780 Ga0495658_0063577
1781 Ga0495658_0127132
1782 Ga0495658_0153629
1783 Ga0495658_0251480
1784 Ga0495669_0011196
1785 Ga0495669_0103501
1786 Ga0495613_0004189
1787 Ga0495613_0317750
1788 Ga0495600_0037792
1789 Ga0495600_0175680
1790 Ga0495604_0043852
1791 Ga0495636_0353230
1792 Ga0495674_0017759
1793 Ga0495674_0479677
1794 Ga0495680_0141393
1795 Ga0495680_0470694
1796 Ga0495680_0796297
1797 Ga0495677_0324851
1798 Ga0495684_0016032
1799 Ga0495684_0278933
1800 Ga0495684_0573315
1801 Ga0495602_0488060
1802 Ga0495615_0239296
1803 Ga0496100_0069575
1804 Ga0496100_0222789
1805 Ga0496101_0000830
1806 Ga0496102_0230493
1807 Ga0496102_0295365
1808 Ga0496102_0849409
1809 Ga0496102_1157241
1810 Ga0496102_1559372
1811 Ga0496104_0006932
1812 Ga0496104_0041811
1813 Ga0496104_0067011
1814 Ga0496104_0076320
1815 Ga0496104_0167975
1816 Ga0496104_0277524
1817 Ga0496104_0425838
1818 Ga0496104_0855719
1819 Ga0496104_0882001
1820 Ga0496104_1701338
1821 Ga0496106_0117938
1822 Ga0496106_0197281
1823 Ga0496106_0312867
1824 Ga0496107_0290486
1825 Ga0496108_0036029
1826 Ga0496108_0304210
1827 Ga0496108_0326505
1828 Ga0496108_1207854
1829 Ga0496109_0397924
1830 Ga0496110_0040200
1831 Ga0496110_0111618
1832 Ga0496111_0047559
1833 Ga0496111_0932724
1834 Ga0496111_1206471
1835 Ga0496112_0006817
1836 Ga0496112_0055550
1837 Ga0496112_0175963
1838 Ga0496112_0223638
1839 Ga0496112_0548100
1840 Ga0496112_1308332
1841 Ga0496113_0002074
1842 Ga0496113_0288905
1843 Ga0496114_0028582
1844 Ga0496114_0035672
1845 Ga0496114_0468282
1846 Ga0496114_0653409
1847 Ga0496114_1494799
1848 Ga0496115_0079979
1849 Ga0501033_0587576
1850 Ga0501034_0105145
1851 Ga0501040_0194504
1852 Ga0501043_0067616
1853 Ga0501047_0025626
1854 Ga0501047_0147278
1855 Ga0501048_0655712
1856 Ga0501073_0203228
1857 Ga0501079_0612018
1858 Ga0501083_0169387
1859 Ga0501083_0251005
1860 Ga0501044_0017983
1861 nmdc:mga05p37_1026191_c1
1862 nmdc:mga05p37_104043_c2
1863 nmdc:mga05p37_141928_c1
1864 nmdc:mga05p37_15195_c1
1865 nmdc:mga05p37_212237_c1
1866 nmdc:mga05p37_22345_c1
1867 nmdc:mga05p37_2445_c1
1868 nmdc:mga05p37_26793_c1
1869 nmdc:mga05p37_300236_c1
1870 nmdc:mga05p37_55115_c2
1871 nmdc:mga05p37_70171_c1
1872 nmdc:mga05p37_79243_c1
1873 nmdc:mga05p37_8679_c1
1874 nmdc:mga09592_1061329_c1
1875 nmdc:mga09592_57903_c1
1876 nmdc:mga09592_720733_c1
1877 nmdc:mga09592_803475_c1
1878 nmdc:mga09592_846854_c1
1879 nmdc:mga06r32_353903_c1
1880 nmdc:mga08y16_10551_c1
1881 nmdc:mga08y16_179180_c1
1882 nmdc:mga08y16_18326_c1
1883 nmdc:mga08y16_19245_c1
1884 nmdc:mga0n895_12013_c1
1885 nmdc:mga0n895_131955_c1
1886 nmdc:mga0n895_141_c1
1887 nmdc:mga0n895_220120_c1
1888 nmdc:mga0n895_2213967_c1
1889 nmdc:mga0n895_484250_c1
1890 nmdc:mga0n895_7789_c1
1891 nmdc:mga0n895_880199_c1
1892 nmdc:mga0rr50_13152_c1
1893 nmdc:mga0rr50_1_c1
1894 nmdc:mga0rr50_54258_c1
1895 nmdc:mga0rr50_67237_c1
1896 nmdc:mga0rr50_743880_c1
1897 nmdc:mga0rr50_91466_c1
1898 nmdc:mga0rr50_9174_c1
1899 nmdc:mga0rr50_94174_c2
1900 nmdc:mga08x19_13318_c1
1901 nmdc:mga08x19_133546_c1
1902 nmdc:mga08x19_234209_c1
1903 nmdc:mga08x19_47168_c1
1904 nmdc:mga08x19_507845_c1
1905 nmdc:mga08x19_61999_c1
1906 nmdc:mga08x19_8030_c1
1907 nmdc:mga08x19_88190_c1
1908 nmdc:mga08x19_92_c1
1909 nmdc:mga0a205_132096_c1
1910 nmdc:mga0a205_1463535_c1
1911 nmdc:mga0a205_147006_c1
1912 nmdc:mga0a205_148542_c1
1913 nmdc:mga0a205_463756_c1
1914 nmdc:mga0a205_489849_c1
1915 nmdc:mga0a205_84754_c1
1916 Ga0495601_0003358
1917 Ga0495601_0034147
1918 Ga0495601_0090234
1919 Ga0495601_0216205
1920 Ga0495595_0014239
1921 Ga0495595_0054476
1922 Ga0495619_0003172
1923 Ga0495619_0132127
1924 Ga0495619_0166321
1925 Ga0495619_0173344
1926 Ga0495619_0737235
1927 Ga0495619_0863685
1928 Ga0500658_0027878
1929 Ga0501084_0357429
1930 Ga0501082_0038319
1931 Ga0501082_0515728
1932 Ga0501082_0771975
1933 Ga0501082_1108991
1934 Ga0530510_0792266

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

86

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.7936 6 81
2fph-assembly1.cif.gz_X cell division protein ylmh from streptococcus pneumoniae 0.793 84 145
2a1s-assembly1.cif.gz_A crystal structure of native parn nuclease domain 0.7747 84 146
2cpm-assembly1.cif.gz_A solution structure of the r3h domain of human sperm-associated antigen 7 0.7699 85 147
1wh9-assembly1.cif.gz_A solution structure of the kh domain of human ribosomal protein s3 0.759 6 76
ID Description Score Start End Superfamily
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9799 85 146 3.30.1370.50
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9311 80 146 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9217 85 146 3.30.1370.50
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8932 80 146 3.30.1370.50
af_A0A1D6NC26_56_123_3.30.1370.160 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8771 84 145 3.30.1370.160
ID Description Score Start End GO Terms
AF-A0A2V7ZNT6-F1-model_v4 Uncharacterized protein 0.9672 5 76
AF-X1RQD4-F1-model_v4 R3H domain-containing protein 0.9655 87 148 GO:0003723
AF-A0A350TK17-F1-model_v4 R3H domain-containing protein 0.9627 77 146 GO:0003723
AF-X1V4P2-F1-model_v4 R3H domain-containing protein 0.9582 76 148 GO:0003723
AF-A0A2V8TF78-F1-model_v4 R3H domain-containing protein 0.9577 77 148 GO:0003723

Map