F487022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 967 | 312 | 1934 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_10343809|Ga0207646_103438092 |
| Length | 172 |
| Sequence | MNTTPIADFLNRVVAAFGITATVNVEETADGPRFNLTGEEAELLVRHRGEPLKALQHIVDSSYGRSIDGEKRVFIDALEYRKGKDIELRQMAKFLAQKAKDSGLDQQLGPLNPYERRIVHMAVAEVPGVTTESIGRLPAVTYWSWYVTAAAPGGVGTVIVVSLPPAPSRPPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 94.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207646_10343809 | 3300025922 | Unclassified | 1348 |
| 2 | Ga0065714_10020465 | 3300005288 | Bacteria | 1559 |
| 3 | Ga0065704_10272398 | 3300005289 | Bacteria | 940 |
| 4 | Ga0065704_10394357 | 3300005289 | Unclassified | 759 |
| 5 | Ga0065712_10017326 | 3300005290 | Unclassified | 2017 |
| 6 | Ga0065712_10084377 | 3300005290 | Bacteria | 2768 |
| 7 | Ga0065715_10129866 | 3300005293 | Bacteria | 2028 |
| 8 | Ga0065715_10457654 | 3300005293 | Unclassified | 819 |
| 9 | Ga0065715_10563030 | 3300005293 | Unclassified | 732 |
| 10 | Ga0065715_10597780 | 3300005293 | Unclassified | 709 |
| 11 | Ga0065707_10041819 | 3300005295 | Bacteria | 882 |
| 12 | Ga0065707_10055820 | 3300005295 | Unclassified | 772 |
| 13 | Ga0065707_10541731 | 3300005295 | Bacteria | 727 |
| 14 | Ga0070676_10003053 | 3300005328 | Bacteria | 8646 |
| 15 | Ga0070676_10205622 | 3300005328 | Bacteria | 1293 |
| 16 | Ga0070676_10511841 | 3300005328 | Bacteria | 854 |
| 17 | Ga0070683_100024062 | 3300005329 | Bacteria | 5451 |
| 18 | Ga0070683_100122832 | 3300005329 | Bacteria | 2453 |
| 19 | Ga0070683_100510007 | 3300005329 | Bacteria | 1149 |
| 20 | Ga0070683_101054821 | 3300005329 | Bacteria | 780 |
| 21 | Ga0070690_100064683 | 3300005330 | Bacteria | 2363 |
| 22 | Ga0070670_100050066 | 3300005331 | Unclassified | 3591 |
| 23 | Ga0070670_100257519 | 3300005331 | Unclassified | 1521 |
| 24 | Ga0070677_10400803 | 3300005333 | Unclassified | 723 |
| 25 | Ga0070677_10730189 | 3300005333 | Bacteria | 560 |
| 26 | Ga0068869_100068178 | 3300005334 | Bacteria | 2627 |
| 27 | Ga0068869_100120659 | 3300005334 | Bacteria | 2005 |
| 28 | Ga0070666_10011714 | 3300005335 | Bacteria | 5515 |
| 29 | Ga0070666_10123429 | 3300005335 | Bacteria | 1797 |
| 30 | Ga0070666_10186173 | 3300005335 | Bacteria | 1458 |
| 31 | Ga0070666_10239099 | 3300005335 | Bacteria | 1284 |
| 32 | Ga0070666_10260989 | 3300005335 | Bacteria | 1228 |
| 33 | Ga0070666_10344043 | 3300005335 | Unclassified | 1066 |
| 34 | Ga0070680_100290309 | 3300005336 | Bacteria | 1386 |
| 35 | Ga0070682_100084121 | 3300005337 | Unclassified | 2067 |
| 36 | Ga0070682_101701129 | 3300005337 | Unclassified | 548 |
| 37 | Ga0068868_100016616 | 3300005338 | Bacteria | 5471 |
| 38 | Ga0068868_100056104 | 3300005338 | Bacteria | 3110 |
| 39 | Ga0068868_100080712 | 3300005338 | Bacteria | 2607 |
| 40 | Ga0068868_100126893 | 3300005338 | Bacteria | 2085 |
| 41 | Ga0068868_100550398 | 3300005338 | Bacteria | 1017 |
| 42 | Ga0068868_100561918 | 3300005338 | Bacteria | 1007 |
| 43 | Ga0068868_101080943 | 3300005338 | Bacteria | 737 |
| 44 | Ga0070660_100360819 | 3300005339 | Unclassified | 1198 |
| 45 | Ga0070660_100609604 | 3300005339 | Unclassified | 913 |
| 46 | Ga0070660_100652080 | 3300005339 | Bacteria | 882 |
| 47 | Ga0070689_100034783 | 3300005340 | Bacteria | 3845 |
| 48 | Ga0070691_10000837 | 3300005341 | Bacteria | 12405 |
| 49 | Ga0070691_10136622 | 3300005341 | Bacteria | 1246 |
| 50 | Ga0070687_100091476 | 3300005343 | Bacteria | 1684 |
| 51 | Ga0070687_100501226 | 3300005343 | Bacteria | 817 |
| 52 | Ga0070661_100067727 | 3300005344 | Bacteria | 2624 |
| 53 | Ga0070692_10107092 | 3300005345 | Bacteria | 1541 |
| 54 | Ga0070692_10283596 | 3300005345 | Bacteria | 1005 |
| 55 | Ga0070668_100039358 | 3300005347 | Bacteria | 3616 |
| 56 | Ga0070668_100217844 | 3300005347 | Bacteria | 1573 |
| 57 | Ga0070668_100457728 | 3300005347 | Unclassified | 1098 |
| 58 | Ga0070668_100943149 | 3300005347 | Unclassified | 773 |
| 59 | Ga0070669_100003885 | 3300005353 | Bacteria | 10808 |
| 60 | Ga0070669_100040254 | 3300005353 | Bacteria | 3397 |
| 61 | Ga0070669_100048756 | 3300005353 | Bacteria | 3091 |
| 62 | Ga0070669_100293153 | 3300005353 | Bacteria | 1307 |
| 63 | Ga0070669_100522595 | 3300005353 | Unclassified | 987 |
| 64 | Ga0070669_100534725 | 3300005353 | Unclassified | 976 |
| 65 | Ga0070669_100779967 | 3300005353 | Unclassified | 811 |
| 66 | Ga0070669_100928899 | 3300005353 | Bacteria | 744 |
| 67 | Ga0070669_100974081 | 3300005353 | Unclassified | 727 |
| 68 | Ga0070675_100040576 | 3300005354 | Bacteria | 3800 |
| 69 | Ga0070675_100086632 | 3300005354 | Bacteria | 2618 |
| 70 | Ga0070675_100763068 | 3300005354 | Bacteria | 883 |
| 71 | Ga0070671_100248401 | 3300005355 | Bacteria | 1511 |
| 72 | Ga0070671_100392783 | 3300005355 | Unclassified | 1186 |
| 73 | Ga0070671_100547216 | 3300005355 | Unclassified | 998 |
| 74 | Ga0070671_100723640 | 3300005355 | Unclassified | 864 |
| 75 | Ga0070674_100040108 | 3300005356 | Bacteria | 3165 |
| 76 | Ga0070674_100067515 | 3300005356 | Unclassified | 2515 |
| 77 | Ga0070674_100120391 | 3300005356 | Bacteria | 1942 |
| 78 | Ga0070674_100323659 | 3300005356 | Bacteria | 1237 |
| 79 | Ga0070674_100724771 | 3300005356 | Bacteria | 852 |
| 80 | Ga0070673_100085114 | 3300005364 | Bacteria | 2573 |
| 81 | Ga0070673_100309293 | 3300005364 | Unclassified | 1393 |
| 82 | Ga0070673_100481865 | 3300005364 | Unclassified | 1120 |
| 83 | Ga0070673_100517389 | 3300005364 | Bacteria | 1081 |
| 84 | Ga0070673_100696635 | 3300005364 | Unclassified | 933 |
| 85 | Ga0070673_100928247 | 3300005364 | Bacteria | 808 |
| 86 | Ga0070673_100931106 | 3300005364 | Bacteria | 807 |
| 87 | Ga0070673_101624105 | 3300005364 | Bacteria | 611 |
| 88 | Ga0070688_100008134 | 3300005365 | Bacteria | 5684 |
| 89 | Ga0070688_100235611 | 3300005365 | Bacteria | 1297 |
| 90 | Ga0070688_100268753 | 3300005365 | Bacteria | 1221 |
| 91 | Ga0070659_100081018 | 3300005366 | Bacteria | 2592 |
| 92 | Ga0070659_100694767 | 3300005366 | Bacteria | 879 |
| 93 | Ga0070667_100113102 | 3300005367 | Bacteria | 2356 |
| 94 | Ga0070667_100156808 | 3300005367 | Bacteria | 2003 |
| 95 | Ga0070667_100819007 | 3300005367 | Unclassified | 865 |
| 96 | Ga0070667_100820662 | 3300005367 | Bacteria | 864 |
| 97 | Ga0070667_101305036 | 3300005367 | Unclassified | 680 |
| 98 | Ga0070667_101533926 | 3300005367 | Unclassified | 626 |
| 99 | Ga0070703_10172188 | 3300005406 | Bacteria | 830 |
| 100 | Ga0070709_10489398 | 3300005434 | Bacteria | 933 |
| 101 | Ga0070709_10663068 | 3300005434 | Bacteria | 809 |
| 102 | Ga0070713_100006500 | 3300005436 | Bacteria | 8110 |
| 103 | Ga0070713_100257050 | 3300005436 | Bacteria | 1595 |
| 104 | Ga0070713_100676781 | 3300005436 | Unclassified | 984 |
| 105 | Ga0070701_10002538 | 3300005438 | Bacteria | 7064 |
| 106 | Ga0070701_10156121 | 3300005438 | Bacteria | 1318 |
| 107 | Ga0070701_10156996 | 3300005438 | Bacteria | 1315 |
| 108 | Ga0070711_100143115 | 3300005439 | Unclassified | 1795 |
| 109 | Ga0070705_100016534 | 3300005440 | Bacteria | 3834 |
| 110 | Ga0070705_100043461 | 3300005440 | Bacteria | 2575 |
| 111 | Ga0070705_100659089 | 3300005440 | Unclassified | 817 |
| 112 | Ga0070700_100003531 | 3300005441 | Bacteria | 8066 |
| 113 | Ga0070700_100048849 | 3300005441 | Bacteria | 2624 |
| 114 | Ga0070700_100110280 | 3300005441 | Bacteria | 1828 |
| 115 | Ga0070700_100152006 | 3300005441 | Bacteria | 1584 |
| 116 | Ga0070694_100070470 | 3300005444 | Bacteria | 2407 |
| 117 | Ga0070694_100088514 | 3300005444 | Bacteria | 2168 |
| 118 | Ga0070694_100292694 | 3300005444 | Bacteria | 1245 |
| 119 | Ga0070708_100019093 | 3300005445 | Bacteria | 5751 |
| 120 | Ga0070708_100079497 | 3300005445 | Bacteria | 2967 |
| 121 | Ga0070708_100801691 | 3300005445 | Unclassified | 885 |
| 122 | Ga0070663_101179535 | 3300005455 | Bacteria | 672 |
| 123 | Ga0070678_100290004 | 3300005456 | Unclassified | 1387 |
| 124 | Ga0070678_100359848 | 3300005456 | Bacteria | 1253 |
| 125 | Ga0070662_100036801 | 3300005457 | Bacteria | 3466 |
| 126 | Ga0070662_100216098 | 3300005457 | Bacteria | 1528 |
| 127 | Ga0070662_100241777 | 3300005457 | Bacteria | 1448 |
| 128 | Ga0070662_100361696 | 3300005457 | Bacteria | 1191 |
| 129 | Ga0070681_10003654 | 3300005458 | Bacteria | 14438 |
| 130 | Ga0070681_10222506 | 3300005458 | Bacteria | 1802 |
| 131 | Ga0070681_10461162 | 3300005458 | Bacteria | 1183 |
| 132 | Ga0070681_11025984 | 3300005458 | Bacteria | 745 |
| 133 | Ga0070681_11750172 | 3300005458 | Unclassified | 548 |
| 134 | Ga0068867_100100070 | 3300005459 | Bacteria | 2213 |
| 135 | Ga0068867_100147144 | 3300005459 | Bacteria | 1847 |
| 136 | Ga0068867_100153682 | 3300005459 | Bacteria | 1809 |
| 137 | Ga0068867_100442656 | 3300005459 | Bacteria | 1105 |
| 138 | Ga0068867_101451460 | 3300005459 | Unclassified | 638 |
| 139 | Ga0070685_10240297 | 3300005466 | Bacteria | 1195 |
| 140 | Ga0070706_100187714 | 3300005467 | Bacteria | 1932 |
| 141 | Ga0070706_100518351 | 3300005467 | Bacteria | 1109 |
| 142 | Ga0070706_101019020 | 3300005467 | Bacteria | 763 |
| 143 | Ga0070707_100872399 | 3300005468 | Bacteria | 864 |
| 144 | Ga0070707_101434051 | 3300005468 | Unclassified | 657 |
| 145 | Ga0070698_100012233 | 3300005471 | Bacteria | 9091 |
| 146 | Ga0070698_100082559 | 3300005471 | Bacteria | 3205 |
| 147 | Ga0070698_100179129 | 3300005471 | Bacteria | 2058 |
| 148 | Ga0070698_100206950 | 3300005471 | Bacteria | 1897 |
| 149 | Ga0070698_101354951 | 3300005471 | Bacteria | 662 |
| 150 | Ga0070699_100023159 | 3300005518 | Bacteria | 5351 |
| 151 | Ga0070679_100060903 | 3300005530 | Bacteria | 3762 |
| 152 | Ga0070679_100406580 | 3300005530 | Bacteria | 1307 |
| 153 | Ga0070684_100083898 | 3300005535 | Unclassified | 2824 |
| 154 | Ga0070684_100136628 | 3300005535 | Bacteria | 2215 |
| 155 | Ga0070684_100363773 | 3300005535 | Bacteria | 1331 |
| 156 | Ga0070684_100653905 | 3300005535 | Bacteria | 978 |
| 157 | Ga0070697_100062033 | 3300005536 | Bacteria | 3050 |
| 158 | Ga0068853_100324878 | 3300005539 | Bacteria | 1427 |
| 159 | Ga0068853_100581578 | 3300005539 | Bacteria | 1063 |
| 160 | Ga0068853_100975850 | 3300005539 | Bacteria | 815 |
| 161 | Ga0068853_101486371 | 3300005539 | Bacteria | 656 |
| 162 | Ga0070672_100036518 | 3300005543 | Bacteria | 3743 |
| 163 | Ga0070672_100276554 | 3300005543 | Bacteria | 1419 |
| 164 | Ga0070672_100668885 | 3300005543 | Unclassified | 908 |
| 165 | Ga0070672_100740916 | 3300005543 | Bacteria | 862 |
| 166 | Ga0070672_100944782 | 3300005543 | Unclassified | 763 |
| 167 | Ga0070672_101218867 | 3300005543 | Unclassified | 671 |
| 168 | Ga0070686_100000153 | 3300005544 | Bacteria | 47434 |
| 169 | Ga0070686_100570675 | 3300005544 | Bacteria | 888 |
| 170 | Ga0070686_100590751 | 3300005544 | Bacteria | 874 |
| 171 | Ga0070686_100636622 | 3300005544 | Unclassified | 844 |
| 172 | Ga0070686_100872571 | 3300005544 | Bacteria | 730 |
| 173 | Ga0070695_100000777 | 3300005545 | Bacteria | 17162 |
| 174 | Ga0070695_100043745 | 3300005545 | Bacteria | 2849 |
| 175 | Ga0070695_100969182 | 3300005545 | Bacteria | 690 |
| 176 | Ga0070695_101872291 | 3300005545 | Unclassified | 504 |
| 177 | Ga0070696_100011456 | 3300005546 | Bacteria | 5940 |
| 178 | Ga0070696_100151980 | 3300005546 | Unclassified | 1700 |
| 179 | Ga0070696_100198182 | 3300005546 | Bacteria | 1498 |
| 180 | Ga0070696_100265591 | 3300005546 | Bacteria | 1303 |
| 181 | Ga0070696_100323910 | 3300005546 | Bacteria | 1187 |
| 182 | Ga0070696_100494405 | 3300005546 | Bacteria | 972 |
| 183 | Ga0070696_101106842 | 3300005546 | Bacteria | 666 |
| 184 | Ga0070693_100475397 | 3300005547 | Bacteria | 882 |
| 185 | Ga0070693_101509464 | 3300005547 | Bacteria | 525 |
| 186 | Ga0070665_100001513 | 3300005548 | Bacteria | 26996 |
| 187 | Ga0070665_100021143 | 3300005548 | Bacteria | 6541 |
| 188 | Ga0070665_100263815 | 3300005548 | Bacteria | 1724 |
| 189 | Ga0070665_100290957 | 3300005548 | Bacteria | 1636 |
| 190 | Ga0070665_100463061 | 3300005548 | Bacteria | 1278 |
| 191 | Ga0070665_100545039 | 3300005548 | Bacteria | 1172 |
| 192 | Ga0070704_100002431 | 3300005549 | Bacteria | 10448 |
| 193 | Ga0070704_100005299 | 3300005549 | Bacteria | 7514 |
| 194 | Ga0070704_101375143 | 3300005549 | Unclassified | 647 |
| 195 | Ga0068855_100019451 | 3300005563 | Bacteria | 8159 |
| 196 | Ga0068855_100540126 | 3300005563 | Bacteria | 1263 |
| 197 | Ga0070664_100090116 | 3300005564 | Unclassified | 2654 |
| 198 | Ga0070664_100116360 | 3300005564 | Bacteria | 2338 |
| 199 | Ga0068857_100544617 | 3300005577 | Bacteria | 1093 |
| 200 | Ga0068854_100012660 | 3300005578 | Bacteria | 5526 |
| 201 | Ga0068854_100060130 | 3300005578 | Bacteria | 2747 |
| 202 | Ga0068854_100415052 | 3300005578 | Unclassified | 1117 |
| 203 | Ga0068854_100509103 | 3300005578 | Bacteria | 1015 |
| 204 | Ga0068854_102125927 | 3300005578 | Unclassified | 519 |
| 205 | Ga0068856_100027205 | 3300005614 | Bacteria | 5579 |
| 206 | Ga0070702_100003807 | 3300005615 | Bacteria | 6818 |
| 207 | Ga0068852_101244275 | 3300005616 | Unclassified | 766 |
| 208 | Ga0068859_100069609 | 3300005617 | Bacteria | 3554 |
| 209 | Ga0068859_100100830 | 3300005617 | Bacteria | 2944 |
| 210 | Ga0068859_100121750 | 3300005617 | Bacteria | 2676 |
| 211 | Ga0068859_100227375 | 3300005617 | Bacteria | 1954 |
| 212 | Ga0068859_100256039 | 3300005617 | Bacteria | 1841 |
| 213 | Ga0068859_100369930 | 3300005617 | Unclassified | 1529 |
| 214 | Ga0068859_100446991 | 3300005617 | Bacteria | 1389 |
| 215 | Ga0068859_100522452 | 3300005617 | Bacteria | 1282 |
| 216 | Ga0068859_100817800 | 3300005617 | Unclassified | 1019 |
| 217 | Ga0068864_100013809 | 3300005618 | Bacteria | 6693 |
| 218 | Ga0068864_100073303 | 3300005618 | Bacteria | 2985 |
| 219 | Ga0068864_100118661 | 3300005618 | Bacteria | 2362 |
| 220 | Ga0068864_100127701 | 3300005618 | Bacteria | 2280 |
| 221 | Ga0068864_100139677 | 3300005618 | Bacteria | 2184 |
| 222 | Ga0068864_100522129 | 3300005618 | Unclassified | 1145 |
| 223 | Ga0068866_10057287 | 3300005718 | Bacteria | 2007 |
| 224 | Ga0068866_10120424 | 3300005718 | Bacteria | 1478 |
| 225 | Ga0068866_10361872 | 3300005718 | Bacteria | 925 |
| 226 | Ga0068861_100112706 | 3300005719 | Bacteria | 2181 |
| 227 | Ga0068861_100162540 | 3300005719 | Bacteria | 1843 |
| 228 | Ga0068861_100221127 | 3300005719 | Bacteria | 1601 |
| 229 | Ga0068861_101031634 | 3300005719 | Unclassified | 787 |
| 230 | Ga0068861_101750380 | 3300005719 | Bacteria | 615 |
| 231 | Ga0068851_10020478 | 3300005834 | Bacteria | 3204 |
| 232 | Ga0068863_100006690 | 3300005841 | Bacteria | 11311 |
| 233 | Ga0068863_100128678 | 3300005841 | Bacteria | 2417 |
| 234 | Ga0068863_100180703 | 3300005841 | Bacteria | 2025 |
| 235 | Ga0068863_100542513 | 3300005841 | Unclassified | 1148 |
| 236 | Ga0068863_100543064 | 3300005841 | Bacteria | 1147 |
| 237 | Ga0068858_100003161 | 3300005842 | Bacteria | 16485 |
| 238 | Ga0068858_100005969 | 3300005842 | Bacteria | 11891 |
| 239 | Ga0068858_100044461 | 3300005842 | Unclassified | 4116 |
| 240 | Ga0068858_100085316 | 3300005842 | Bacteria | 2937 |
| 241 | Ga0068858_100091344 | 3300005842 | Bacteria | 2834 |
| 242 | Ga0068858_100127144 | 3300005842 | Bacteria | 2387 |
| 243 | Ga0068858_100152671 | 3300005842 | Bacteria | 2172 |
| 244 | Ga0068858_100448662 | 3300005842 | Bacteria | 1243 |
| 245 | Ga0068858_100885458 | 3300005842 | Unclassified | 873 |
| 246 | Ga0068860_100014590 | 3300005843 | Bacteria | 7687 |
| 247 | Ga0068860_100595934 | 3300005843 | Bacteria | 1110 |
| 248 | Ga0068860_101064118 | 3300005843 | Bacteria | 828 |
| 249 | Ga0068860_101093678 | 3300005843 | Unclassified | 816 |
| 250 | Ga0068860_101376597 | 3300005843 | Bacteria | 727 |
| 251 | Ga0068860_101421588 | 3300005843 | Bacteria | 715 |
| 252 | Ga0068860_101669792 | 3300005843 | Unclassified | 659 |
| 253 | Ga0068862_100002661 | 3300005844 | Bacteria | 15718 |
| 254 | Ga0068862_100024171 | 3300005844 | Bacteria | 5097 |
| 255 | Ga0068862_100129416 | 3300005844 | Bacteria | 2232 |
| 256 | Ga0068862_100275868 | 3300005844 | Bacteria | 1539 |
| 257 | Ga0068862_100350572 | 3300005844 | Bacteria | 1369 |
| 258 | Ga0068862_100462135 | 3300005844 | Unclassified | 1198 |
| 259 | Ga0068862_100541922 | 3300005844 | Bacteria | 1110 |
| 260 | Ga0068862_100984915 | 3300005844 | Unclassified | 833 |
| 261 | Ga0081455_10052456 | 3300005937 | Bacteria | 3491 |
| 262 | Ga0081539_10002012 | 3300005985 | Bacteria | 30795 |
| 263 | Ga0070717_10324080 | 3300006028 | Bacteria | 1373 |
| 264 | Ga0070712_100322187 | 3300006175 | Bacteria | 1257 |
| 265 | Ga0097621_100000125 | 3300006237 | Bacteria | 44370 |
| 266 | Ga0097621_100014247 | 3300006237 | Bacteria | 5947 |
| 267 | Ga0097621_100017775 | 3300006237 | Bacteria | 5411 |
| 268 | Ga0097621_100038740 | 3300006237 | Bacteria | 3825 |
| 269 | Ga0097621_100105568 | 3300006237 | Unclassified | 2375 |
| 270 | Ga0097621_100153526 | 3300006237 | Bacteria | 1975 |
| 271 | Ga0097621_100154846 | 3300006237 | Bacteria | 1967 |
| 272 | Ga0097621_100726154 | 3300006237 | Bacteria | 916 |
| 273 | Ga0097621_100996314 | 3300006237 | Unclassified | 784 |
| 274 | Ga0068871_100000134 | 3300006358 | Bacteria | 47412 |
| 275 | Ga0068871_100029682 | 3300006358 | Bacteria | 4297 |
| 276 | Ga0068871_100093179 | 3300006358 | Unclassified | 2513 |
| 277 | Ga0068871_100133321 | 3300006358 | Bacteria | 2108 |
| 278 | Ga0068871_100143254 | 3300006358 | Bacteria | 2033 |
| 279 | Ga0068871_102043834 | 3300006358 | Bacteria | 545 |
| 280 | Ga0075428_100088295 | 3300006844 | Bacteria | 3381 |
| 281 | Ga0075428_100452689 | 3300006844 | Bacteria | 1375 |
| 282 | Ga0075428_100639156 | 3300006844 | Bacteria | 1135 |
| 283 | Ga0075428_101217159 | 3300006844 | Bacteria | 794 |
| 284 | Ga0075431_100113206 | 3300006847 | Unclassified | 2800 |
| 285 | Ga0075433_10016907 | 3300006852 | Bacteria | 6028 |
| 286 | Ga0075433_10071887 | 3300006852 | Bacteria | 3041 |
| 287 | Ga0075433_10443069 | 3300006852 | Bacteria | 1145 |
| 288 | Ga0075433_10490849 | 3300006852 | Bacteria | 1081 |
| 289 | Ga0075433_11325147 | 3300006852 | Unclassified | 623 |
| 290 | Ga0075434_100001054 | 3300006871 | Bacteria | 22494 |
| 291 | Ga0075434_100001202 | 3300006871 | Bacteria | 21518 |
| 292 | Ga0075434_100002093 | 3300006871 | Bacteria | 17347 |
| 293 | Ga0075434_100065019 | 3300006871 | Bacteria | 3633 |
| 294 | Ga0075434_100073849 | 3300006871 | Bacteria | 3403 |
| 295 | Ga0075434_100218129 | 3300006871 | Bacteria | 1927 |
| 296 | Ga0075434_100348634 | 3300006871 | Unclassified | 1502 |
| 297 | Ga0075434_100410074 | 3300006871 | Unclassified | 1376 |
| 298 | Ga0075434_100893246 | 3300006871 | Bacteria | 903 |
| 299 | Ga0075434_101420627 | 3300006871 | Unclassified | 704 |
| 300 | Ga0075429_100200845 | 3300006880 | Bacteria | 1747 |
| 301 | Ga0075429_100252537 | 3300006880 | Bacteria | 1544 |
| 302 | Ga0075429_100372174 | 3300006880 | Unclassified | 1251 |
| 303 | Ga0068865_100053714 | 3300006881 | Bacteria | 2796 |
| 304 | Ga0068865_100083576 | 3300006881 | Bacteria | 2298 |
| 305 | Ga0068865_100138493 | 3300006881 | Bacteria | 1832 |
| 306 | Ga0068865_100358136 | 3300006881 | Bacteria | 1184 |
| 307 | Ga0068865_100763986 | 3300006881 | Bacteria | 831 |
| 308 | Ga0068865_100996900 | 3300006881 | Bacteria | 733 |
| 309 | Ga0068865_101173876 | 3300006881 | Bacteria | 679 |
| 310 | Ga0075436_100001908 | 3300006914 | Bacteria | 14320 |
| 311 | Ga0075436_100014361 | 3300006914 | Bacteria | 5421 |
| 312 | Ga0075436_100079509 | 3300006914 | Bacteria | 2271 |
| 313 | Ga0075436_100189856 | 3300006914 | Bacteria | 1453 |
| 314 | Ga0097620_100069610 | 3300006931 | Bacteria | 3554 |
| 315 | Ga0097620_100100838 | 3300006931 | Bacteria | 2944 |
| 316 | Ga0097620_100121760 | 3300006931 | Bacteria | 2676 |
| 317 | Ga0097620_100227376 | 3300006931 | Bacteria | 1954 |
| 318 | Ga0097620_100256046 | 3300006931 | Bacteria | 1841 |
| 319 | Ga0097620_100369941 | 3300006931 | Unclassified | 1529 |
| 320 | Ga0097620_100447026 | 3300006931 | Bacteria | 1389 |
| 321 | Ga0097620_100522408 | 3300006931 | Bacteria | 1282 |
| 322 | Ga0097620_100817802 | 3300006931 | Unclassified | 1019 |
| 323 | Ga0075435_100000204 | 3300007076 | Bacteria | 35933 |
| 324 | Ga0075435_100000924 | 3300007076 | Bacteria | 18527 |
| 325 | Ga0075435_100001088 | 3300007076 | Bacteria | 17281 |
| 326 | Ga0075435_100031162 | 3300007076 | Bacteria | 4199 |
| 327 | Ga0075435_100118917 | 3300007076 | Bacteria | 2203 |
| 328 | Ga0075435_100166785 | 3300007076 | Unclassified | 1857 |
| 329 | Ga0075435_100374576 | 3300007076 | Bacteria | 1222 |
| 330 | Ga0075435_100950628 | 3300007076 | Bacteria | 750 |
| 331 | Ga0075435_101341729 | 3300007076 | Unclassified | 626 |
| 332 | Ga0099794_10037690 | 3300007265 | Bacteria | 2289 |
| 333 | Ga0099794_10627984 | 3300007265 | Unclassified | 570 |
| 334 | Ga0105251_10302715 | 3300009011 | Bacteria | 725 |
| 335 | Ga0105240_10010017 | 3300009093 | Bacteria | 13352 |
| 336 | Ga0105240_10081871 | 3300009093 | Bacteria | 3965 |
| 337 | Ga0105240_10111828 | 3300009093 | Bacteria | 3303 |
| 338 | Ga0105240_10449709 | 3300009093 | Bacteria | 1442 |
| 339 | Ga0105240_11080709 | 3300009093 | Bacteria | 854 |
| 340 | Ga0105240_11459654 | 3300009093 | Unclassified | 718 |
| 341 | Ga0111539_10000466 | 3300009094 | Bacteria | 50937 |
| 342 | Ga0111539_10007493 | 3300009094 | Bacteria | 13970 |
| 343 | Ga0111539_10029457 | 3300009094 | Bacteria | 6686 |
| 344 | Ga0111539_10039828 | 3300009094 | Bacteria | 5660 |
| 345 | Ga0111539_10343310 | 3300009094 | Bacteria | 1738 |
| 346 | Ga0111539_10535520 | 3300009094 | Bacteria | 1364 |
| 347 | Ga0111539_11913496 | 3300009094 | Unclassified | 688 |
| 348 | Ga0105245_10009401 | 3300009098 | Bacteria | 8529 |
| 349 | Ga0105245_10148967 | 3300009098 | Bacteria | 2211 |
| 350 | Ga0105245_10167913 | 3300009098 | Bacteria | 2087 |
| 351 | Ga0105245_10221039 | 3300009098 | Bacteria | 1828 |
| 352 | Ga0105245_10248147 | 3300009098 | Bacteria | 1728 |
| 353 | Ga0105245_10330229 | 3300009098 | Bacteria | 1505 |
| 354 | Ga0105245_10655561 | 3300009098 | Bacteria | 1080 |
| 355 | Ga0105247_10001472 | 3300009101 | Bacteria | 16957 |
| 356 | Ga0105247_10013578 | 3300009101 | Bacteria | 4884 |
| 357 | Ga0105247_10024096 | 3300009101 | Unclassified | 3665 |
| 358 | Ga0105247_10778934 | 3300009101 | Bacteria | 728 |
| 359 | Ga0114129_10000426 | 3300009147 | Bacteria | 50026 |
| 360 | Ga0114129_10000876 | 3300009147 | Bacteria | 39161 |
| 361 | Ga0114129_10003910 | 3300009147 | Bacteria | 21025 |
| 362 | Ga0114129_10004361 | 3300009147 | Bacteria | 19964 |
| 363 | Ga0114129_10008094 | 3300009147 | Bacteria | 14980 |
| 364 | Ga0114129_10012966 | 3300009147 | Bacteria | 11866 |
| 365 | Ga0114129_10083778 | 3300009147 | Bacteria | 4427 |
| 366 | Ga0114129_10178236 | 3300009147 | Bacteria | 2893 |
| 367 | Ga0114129_10213988 | 3300009147 | Bacteria | 2604 |
| 368 | Ga0114129_10339302 | 3300009147 | Bacteria | 1993 |
| 369 | Ga0114129_10347070 | 3300009147 | Bacteria | 1967 |
| 370 | Ga0114129_10355253 | 3300009147 | Bacteria | 1940 |
| 371 | Ga0114129_11691886 | 3300009147 | Bacteria | 772 |
| 372 | Ga0114129_11692982 | 3300009147 | Unclassified | 772 |
| 373 | Ga0114129_11945287 | 3300009147 | Bacteria | 712 |
| 374 | Ga0114129_12802331 | 3300009147 | Bacteria | 579 |
| 375 | Ga0105243_10029595 | 3300009148 | Bacteria | 4212 |
| 376 | Ga0105243_10087732 | 3300009148 | Bacteria | 2554 |
| 377 | Ga0105243_10148007 | 3300009148 | Bacteria | 2011 |
| 378 | Ga0105243_10430108 | 3300009148 | Bacteria | 1234 |
| 379 | Ga0105243_10904185 | 3300009148 | Bacteria | 878 |
| 380 | Ga0105241_10289002 | 3300009174 | Bacteria | 1403 |
| 381 | Ga0105241_10492704 | 3300009174 | Bacteria | 1091 |
| 382 | Ga0105241_10843506 | 3300009174 | Unclassified | 847 |
| 383 | Ga0105242_10058695 | 3300009176 | Bacteria | 3156 |
| 384 | Ga0105242_10174182 | 3300009176 | Bacteria | 1893 |
| 385 | Ga0105242_10208811 | 3300009176 | Unclassified | 1739 |
| 386 | Ga0105242_10256614 | 3300009176 | Bacteria | 1577 |
| 387 | Ga0105242_11417459 | 3300009176 | Bacteria | 723 |
| 388 | Ga0105248_10002519 | 3300009177 | Bacteria | 20391 |
| 389 | Ga0105248_10036746 | 3300009177 | Bacteria | 5478 |
| 390 | Ga0105248_10045082 | 3300009177 | Bacteria | 4945 |
| 391 | Ga0105248_10157780 | 3300009177 | Bacteria | 2560 |
| 392 | Ga0105248_10180592 | 3300009177 | Bacteria | 2378 |
| 393 | Ga0105248_10221025 | 3300009177 | Bacteria | 2132 |
| 394 | Ga0105248_10239404 | 3300009177 | Bacteria | 2043 |
| 395 | Ga0105248_10666126 | 3300009177 | Bacteria | 1174 |
| 396 | Ga0105248_10859833 | 3300009177 | Bacteria | 1024 |
| 397 | Ga0105248_10948005 | 3300009177 | Bacteria | 972 |
| 398 | Ga0105248_11712830 | 3300009177 | Bacteria | 713 |
| 399 | Ga0105237_10296246 | 3300009545 | Unclassified | 1620 |
| 400 | Ga0105238_10212048 | 3300009551 | Bacteria | 1913 |
| 401 | Ga0105238_10212722 | 3300009551 | Bacteria | 1910 |
| 402 | Ga0105238_10403112 | 3300009551 | Bacteria | 1361 |
| 403 | Ga0105249_10248805 | 3300009553 | Bacteria | 1761 |
| 404 | Ga0105249_10605556 | 3300009553 | Bacteria | 1150 |
| 405 | Ga0105249_11132999 | 3300009553 | Bacteria | 853 |
| 406 | Ga0105249_11454211 | 3300009553 | Bacteria | 757 |
| 407 | Ga0105249_12585168 | 3300009553 | Bacteria | 580 |
| 408 | Ga0105239_12019841 | 3300010375 | Unclassified | 669 |
| 409 | Ga0105246_10202185 | 3300011119 | Bacteria | 1545 |
| 410 | Ga0105246_11518790 | 3300011119 | Unclassified | 630 |
| 411 | Ga0105246_11637124 | 3300011119 | Unclassified | 609 |
| 412 | Ga0157323_1005343 | 3300012495 | Unclassified | 856 |
| 413 | Ga0157369_11294663 | 3300013105 | Bacteria | 743 |
| 414 | Ga0157374_10037537 | 3300013296 | Bacteria | 4447 |
| 415 | Ga0157374_10055503 | 3300013296 | Unclassified | 3697 |
| 416 | Ga0157374_10547047 | 3300013296 | Bacteria | 1165 |
| 417 | Ga0157374_10701591 | 3300013296 | Bacteria | 1025 |
| 418 | Ga0157378_10005743 | 3300013297 | Bacteria | 10865 |
| 419 | Ga0157378_10250526 | 3300013297 | Bacteria | 1695 |
| 420 | Ga0157378_10296475 | 3300013297 | Unclassified | 1563 |
| 421 | Ga0157378_10308617 | 3300013297 | Bacteria | 1534 |
| 422 | Ga0157378_12127291 | 3300013297 | Unclassified | 612 |
| 423 | Ga0163162_10034270 | 3300013306 | Bacteria | 5052 |
| 424 | Ga0163162_10276059 | 3300013306 | Unclassified | 1813 |
| 425 | Ga0163162_11143377 | 3300013306 | Bacteria | 883 |
| 426 | Ga0157372_10286901 | 3300013307 | Bacteria | 1914 |
| 427 | Ga0157375_10059732 | 3300013308 | Bacteria | 3778 |
| 428 | Ga0157375_10172839 | 3300013308 | Bacteria | 2309 |
| 429 | Ga0157375_10798370 | 3300013308 | Unclassified | 1093 |
| 430 | Ga0157375_11452447 | 3300013308 | Bacteria | 809 |
| 431 | Ga0157375_11825967 | 3300013308 | Unclassified | 721 |
| 432 | Ga0163163_10011654 | 3300014325 | Bacteria | 7986 |
| 433 | Ga0163163_10019039 | 3300014325 | Bacteria | 6441 |
| 434 | Ga0163163_10661526 | 3300014325 | Bacteria | 1108 |
| 435 | Ga0163163_10801737 | 3300014325 | Unclassified | 1005 |
| 436 | Ga0163163_11196478 | 3300014325 | Bacteria | 823 |
| 437 | Ga0163163_11403490 | 3300014325 | Bacteria | 760 |
| 438 | Ga0157380_10166704 | 3300014326 | Unclassified | 1920 |
| 439 | Ga0157380_10623187 | 3300014326 | Unclassified | 1071 |
| 440 | Ga0157380_10803574 | 3300014326 | Bacteria | 958 |
| 441 | Ga0157380_12391106 | 3300014326 | Bacteria | 593 |
| 442 | Ga0157377_10258257 | 3300014745 | Bacteria | 1132 |
| 443 | Ga0157377_10351327 | 3300014745 | Bacteria | 989 |
| 444 | Ga0157379_10002568 | 3300014968 | Bacteria | 15239 |
| 445 | Ga0157379_10003372 | 3300014968 | Bacteria | 13516 |
| 446 | Ga0157379_10025073 | 3300014968 | Bacteria | 5295 |
| 447 | Ga0157379_10064423 | 3300014968 | Unclassified | 3275 |
| 448 | Ga0157379_10385560 | 3300014968 | Bacteria | 1286 |
| 449 | Ga0157379_10843896 | 3300014968 | Unclassified | 867 |
| 450 | Ga0157376_10002539 | 3300014969 | Bacteria | 12376 |
| 451 | Ga0157376_10011019 | 3300014969 | Bacteria | 6644 |
| 452 | Ga0157376_10024820 | 3300014969 | Bacteria | 4714 |
| 453 | Ga0157376_10050013 | 3300014969 | Bacteria | 3465 |
| 454 | Ga0157376_10137508 | 3300014969 | Bacteria | 2188 |
| 455 | Ga0157376_10145968 | 3300014969 | Unclassified | 2128 |
| 456 | Ga0157376_10297582 | 3300014969 | Bacteria | 1526 |
| 457 | Ga0157376_10414484 | 3300014969 | Bacteria | 1305 |
| 458 | Ga0157376_10440374 | 3300014969 | Bacteria | 1269 |
| 459 | Ga0157376_11288399 | 3300014969 | Bacteria | 761 |
| 460 | Ga0157376_11724519 | 3300014969 | Unclassified | 662 |
| 461 | Ga0163161_10464758 | 3300017792 | Unclassified | 1025 |
| 462 | Ga0213876_10077902 | 3300021384 | Bacteria | 1751 |
| 463 | Ga0207697_10134709 | 3300025315 | Bacteria | 1069 |
| 464 | Ga0207653_10052402 | 3300025885 | Bacteria | 1361 |
| 465 | Ga0207653_10059000 | 3300025885 | Bacteria | 1291 |
| 466 | Ga0207682_10270388 | 3300025893 | Unclassified | 793 |
| 467 | Ga0207642_10024812 | 3300025899 | Bacteria | 2416 |
| 468 | Ga0207642_10054789 | 3300025899 | Bacteria | 1820 |
| 469 | Ga0207642_10344187 | 3300025899 | Unclassified | 877 |
| 470 | Ga0207688_10137520 | 3300025901 | Bacteria | 1436 |
| 471 | Ga0207688_10185636 | 3300025901 | Bacteria | 1242 |
| 472 | Ga0207680_10033007 | 3300025903 | Bacteria | 2948 |
| 473 | Ga0207680_10067592 | 3300025903 | Bacteria | 2202 |
| 474 | Ga0207680_10071456 | 3300025903 | Bacteria | 2151 |
| 475 | Ga0207680_10137089 | 3300025903 | Bacteria | 1619 |
| 476 | Ga0207680_10683533 | 3300025903 | Bacteria | 735 |
| 477 | Ga0207685_10007767 | 3300025905 | Bacteria | 3012 |
| 478 | Ga0207685_10462606 | 3300025905 | Unclassified | 661 |
| 479 | Ga0207645_10005648 | 3300025907 | Bacteria | 9039 |
| 480 | Ga0207645_10600295 | 3300025907 | Bacteria | 747 |
| 481 | Ga0207645_10658946 | 3300025907 | Unclassified | 711 |
| 482 | Ga0207645_10882594 | 3300025907 | Unclassified | 608 |
| 483 | Ga0207643_10223628 | 3300025908 | Bacteria | 1153 |
| 484 | Ga0207643_10574663 | 3300025908 | Bacteria | 724 |
| 485 | Ga0207705_10156957 | 3300025909 | Bacteria | 1707 |
| 486 | Ga0207684_10369142 | 3300025910 | Bacteria | 1235 |
| 487 | Ga0207654_10130226 | 3300025911 | Unclassified | 1591 |
| 488 | Ga0207654_10300968 | 3300025911 | Bacteria | 1091 |
| 489 | Ga0207654_10366993 | 3300025911 | Bacteria | 994 |
| 490 | Ga0207707_10008859 | 3300025912 | Bacteria | 8738 |
| 491 | Ga0207707_10034907 | 3300025912 | Bacteria | 4399 |
| 492 | Ga0207707_10156653 | 3300025912 | Bacteria | 1992 |
| 493 | Ga0207707_10195159 | 3300025912 | Bacteria | 1766 |
| 494 | Ga0207707_11278914 | 3300025912 | Unclassified | 590 |
| 495 | Ga0207695_10066322 | 3300025913 | Unclassified | 3708 |
| 496 | Ga0207695_10202742 | 3300025913 | Bacteria | 1897 |
| 497 | Ga0207695_10237457 | 3300025913 | Bacteria | 1725 |
| 498 | Ga0207695_11395915 | 3300025913 | Archaea | 581 |
| 499 | Ga0207671_10433322 | 3300025914 | Unclassified | 1046 |
| 500 | Ga0207663_10279936 | 3300025916 | Unclassified | 1239 |
| 501 | Ga0207660_10038187 | 3300025917 | Bacteria | 3351 |
| 502 | Ga0207662_10057705 | 3300025918 | Bacteria | 2321 |
| 503 | Ga0207662_10203639 | 3300025918 | Bacteria | 1282 |
| 504 | Ga0207662_10489339 | 3300025918 | Bacteria | 846 |
| 505 | Ga0207657_10000489 | 3300025919 | Bacteria | 41785 |
| 506 | Ga0207649_10087098 | 3300025920 | Bacteria | 2037 |
| 507 | Ga0207649_10348314 | 3300025920 | Bacteria | 1096 |
| 508 | Ga0207652_10024759 | 3300025921 | Bacteria | 4981 |
| 509 | Ga0207652_10187340 | 3300025921 | Bacteria | 1861 |
| 510 | Ga0207646_10203816 | 3300025922 | Unclassified | 1787 |
| 511 | Ga0207646_10592876 | 3300025922 | Bacteria | 995 |
| 512 | Ga0207646_10802924 | 3300025922 | Bacteria | 838 |
| 513 | Ga0207646_11222293 | 3300025922 | Unclassified | 658 |
| 514 | Ga0207681_10057387 | 3300025923 | Bacteria | 2660 |
| 515 | Ga0207681_10090798 | 3300025923 | Bacteria | 2181 |
| 516 | Ga0207681_10119098 | 3300025923 | Unclassified | 1933 |
| 517 | Ga0207681_10247764 | 3300025923 | Unclassified | 1390 |
| 518 | Ga0207681_10281926 | 3300025923 | Bacteria | 1308 |
| 519 | Ga0207681_10972118 | 3300025923 | Unclassified | 712 |
| 520 | Ga0207694_10455689 | 3300025924 | Bacteria | 1068 |
| 521 | Ga0207650_11019739 | 3300025925 | Bacteria | 704 |
| 522 | Ga0207650_11211821 | 3300025925 | Bacteria | 643 |
| 523 | Ga0207659_10157078 | 3300025926 | Bacteria | 1782 |
| 524 | Ga0207659_10484111 | 3300025926 | Bacteria | 1046 |
| 525 | Ga0207659_10528054 | 3300025926 | Unclassified | 1001 |
| 526 | Ga0207659_10580608 | 3300025926 | Bacteria | 954 |
| 527 | Ga0207659_10794357 | 3300025926 | Unclassified | 813 |
| 528 | Ga0207687_10084438 | 3300025927 | Bacteria | 2301 |
| 529 | Ga0207687_10164797 | 3300025927 | Bacteria | 1704 |
| 530 | Ga0207687_10272219 | 3300025927 | Bacteria | 1354 |
| 531 | Ga0207700_10008186 | 3300025928 | Bacteria | 6459 |
| 532 | Ga0207644_10283851 | 3300025931 | Bacteria | 1330 |
| 533 | Ga0207644_10334324 | 3300025931 | Bacteria | 1227 |
| 534 | Ga0207690_10177567 | 3300025932 | Bacteria | 1601 |
| 535 | Ga0207706_10175950 | 3300025933 | Unclassified | 1880 |
| 536 | Ga0207706_10219852 | 3300025933 | Bacteria | 1663 |
| 537 | Ga0207706_10340871 | 3300025933 | Unclassified | 1304 |
| 538 | Ga0207706_10529809 | 3300025933 | Bacteria | 1015 |
| 539 | Ga0207686_10002741 | 3300025934 | Bacteria | 9550 |
| 540 | Ga0207686_10162219 | 3300025934 | Bacteria | 1568 |
| 541 | Ga0207686_10454712 | 3300025934 | Bacteria | 986 |
| 542 | Ga0207686_10759403 | 3300025934 | Bacteria | 775 |
| 543 | Ga0207686_11161580 | 3300025934 | Bacteria | 631 |
| 544 | Ga0207709_10013009 | 3300025935 | Bacteria | 4587 |
| 545 | Ga0207709_10072344 | 3300025935 | Bacteria | 2193 |
| 546 | Ga0207709_10326916 | 3300025935 | Bacteria | 1150 |
| 547 | Ga0207670_10079013 | 3300025936 | Bacteria | 2296 |
| 548 | Ga0207670_10557166 | 3300025936 | Unclassified | 937 |
| 549 | Ga0207670_10730858 | 3300025936 | Bacteria | 821 |
| 550 | Ga0207670_11033327 | 3300025936 | Bacteria | 692 |
| 551 | Ga0207669_10042565 | 3300025937 | Bacteria | 2652 |
| 552 | Ga0207669_10060200 | 3300025937 | Bacteria | 2327 |
| 553 | Ga0207669_10315587 | 3300025937 | Unclassified | 1194 |
| 554 | Ga0207669_10441655 | 3300025937 | Bacteria | 1029 |
| 555 | Ga0207704_10203266 | 3300025938 | Bacteria | 1452 |
| 556 | Ga0207704_10230660 | 3300025938 | Bacteria | 1376 |
| 557 | Ga0207704_10936278 | 3300025938 | Bacteria | 730 |
| 558 | Ga0207704_11572477 | 3300025938 | Unclassified | 565 |
| 559 | Ga0207665_10780964 | 3300025939 | Bacteria | 754 |
| 560 | Ga0207691_10028678 | 3300025940 | Bacteria | 5209 |
| 561 | Ga0207691_10254075 | 3300025940 | Bacteria | 1516 |
| 562 | Ga0207691_10474046 | 3300025940 | Bacteria | 1064 |
| 563 | Ga0207691_10927894 | 3300025940 | Unclassified | 728 |
| 564 | Ga0207711_10027871 | 3300025941 | Bacteria | 4748 |
| 565 | Ga0207711_10049925 | 3300025941 | Bacteria | 3581 |
| 566 | Ga0207711_10062119 | 3300025941 | Unclassified | 3222 |
| 567 | Ga0207711_10115715 | 3300025941 | Bacteria | 2390 |
| 568 | Ga0207711_10164554 | 3300025941 | Unclassified | 2010 |
| 569 | Ga0207711_10230211 | 3300025941 | Bacteria | 1697 |
| 570 | Ga0207711_11154601 | 3300025941 | Bacteria | 716 |
| 571 | Ga0207689_10033103 | 3300025942 | Bacteria | 4295 |
| 572 | Ga0207689_10069887 | 3300025942 | Bacteria | 2885 |
| 573 | Ga0207689_10326895 | 3300025942 | Bacteria | 1273 |
| 574 | Ga0207661_10028809 | 3300025944 | Bacteria | 4258 |
| 575 | Ga0207661_10589381 | 3300025944 | Bacteria | 1020 |
| 576 | Ga0207661_10865976 | 3300025944 | Bacteria | 832 |
| 577 | Ga0207679_10054644 | 3300025945 | Unclassified | 2941 |
| 578 | Ga0207679_10063933 | 3300025945 | Unclassified | 2749 |
| 579 | Ga0207679_10699364 | 3300025945 | Unclassified | 920 |
| 580 | Ga0207679_10857503 | 3300025945 | Unclassified | 830 |
| 581 | Ga0207667_10014648 | 3300025949 | Bacteria | 8929 |
| 582 | Ga0207667_10237154 | 3300025949 | Bacteria | 1867 |
| 583 | Ga0207667_10561666 | 3300025949 | Unclassified | 1153 |
| 584 | Ga0207651_10259042 | 3300025960 | Bacteria | 1427 |
| 585 | Ga0207651_10388758 | 3300025960 | Unclassified | 1184 |
| 586 | Ga0207651_10445961 | 3300025960 | Unclassified | 1110 |
| 587 | Ga0207651_11138943 | 3300025960 | Bacteria | 700 |
| 588 | Ga0207712_10075629 | 3300025961 | Bacteria | 2435 |
| 589 | Ga0207712_10188076 | 3300025961 | Bacteria | 1628 |
| 590 | Ga0207712_10572332 | 3300025961 | Bacteria | 974 |
| 591 | Ga0207712_10690276 | 3300025961 | Unclassified | 890 |
| 592 | Ga0207712_10916190 | 3300025961 | Unclassified | 775 |
| 593 | Ga0207668_10083109 | 3300025972 | Bacteria | 2329 |
| 594 | Ga0207668_10217751 | 3300025972 | Bacteria | 1531 |
| 595 | Ga0207640_10004577 | 3300025981 | Bacteria | 7500 |
| 596 | Ga0207640_10010018 | 3300025981 | Bacteria | 5323 |
| 597 | Ga0207640_10440786 | 3300025981 | Unclassified | 1071 |
| 598 | Ga0207658_10300199 | 3300025986 | Bacteria | 1383 |
| 599 | Ga0207658_10390827 | 3300025986 | Bacteria | 1220 |
| 600 | Ga0207677_10051231 | 3300026023 | Bacteria | 2798 |
| 601 | Ga0207677_10084337 | 3300026023 | Bacteria | 2290 |
| 602 | Ga0207677_10155187 | 3300026023 | Bacteria | 1772 |
| 603 | Ga0207677_10801347 | 3300026023 | Unclassified | 843 |
| 604 | Ga0207677_10857256 | 3300026023 | Bacteria | 817 |
| 605 | Ga0207677_11129927 | 3300026023 | Unclassified | 715 |
| 606 | Ga0207677_11775481 | 3300026023 | Bacteria | 572 |
| 607 | Ga0207703_10007066 | 3300026035 | Bacteria | 8933 |
| 608 | Ga0207703_10020073 | 3300026035 | Bacteria | 5222 |
| 609 | Ga0207703_10049524 | 3300026035 | Unclassified | 3397 |
| 610 | Ga0207703_10080823 | 3300026035 | Bacteria | 2708 |
| 611 | Ga0207703_10209948 | 3300026035 | Bacteria | 1735 |
| 612 | Ga0207703_10281224 | 3300026035 | Bacteria | 1511 |
| 613 | Ga0207703_10505504 | 3300026035 | Bacteria | 1135 |
| 614 | Ga0207703_11429516 | 3300026035 | Unclassified | 665 |
| 615 | Ga0207703_11512413 | 3300026035 | Unclassified | 646 |
| 616 | Ga0207639_10699112 | 3300026041 | Bacteria | 941 |
| 617 | Ga0207639_11253709 | 3300026041 | Bacteria | 696 |
| 618 | Ga0207708_10004038 | 3300026075 | Bacteria | 10791 |
| 619 | Ga0207708_10019580 | 3300026075 | Bacteria | 5102 |
| 620 | Ga0207708_10071341 | 3300026075 | Bacteria | 2661 |
| 621 | Ga0207708_11094444 | 3300026075 | Unclassified | 695 |
| 622 | Ga0207702_10391965 | 3300026078 | Bacteria | 1337 |
| 623 | Ga0207702_10651134 | 3300026078 | Unclassified | 1036 |
| 624 | Ga0207641_10002698 | 3300026088 | Bacteria | 16196 |
| 625 | Ga0207641_10060911 | 3300026088 | Unclassified | 3218 |
| 626 | Ga0207641_10068431 | 3300026088 | Bacteria | 3045 |
| 627 | Ga0207641_10150518 | 3300026088 | Bacteria | 2107 |
| 628 | Ga0207641_10363313 | 3300026088 | Bacteria | 1383 |
| 629 | Ga0207641_10865708 | 3300026088 | Unclassified | 896 |
| 630 | Ga0207648_10012103 | 3300026089 | Bacteria | 8090 |
| 631 | Ga0207648_10185956 | 3300026089 | Bacteria | 1840 |
| 632 | Ga0207648_10262833 | 3300026089 | Unclassified | 1540 |
| 633 | Ga0207648_10279887 | 3300026089 | Bacteria | 1492 |
| 634 | Ga0207648_10661927 | 3300026089 | Bacteria | 965 |
| 635 | Ga0207648_11547802 | 3300026089 | Unclassified | 623 |
| 636 | Ga0207676_10006464 | 3300026095 | Bacteria | 8279 |
| 637 | Ga0207676_10091796 | 3300026095 | Bacteria | 2496 |
| 638 | Ga0207676_10106338 | 3300026095 | Bacteria | 2338 |
| 639 | Ga0207676_10166192 | 3300026095 | Bacteria | 1917 |
| 640 | Ga0207676_10208453 | 3300026095 | Bacteria | 1732 |
| 641 | Ga0207674_10228166 | 3300026116 | Bacteria | 1810 |
| 642 | Ga0207674_10231774 | 3300026116 | Bacteria | 1794 |
| 643 | Ga0207674_10669298 | 3300026116 | Bacteria | 1002 |
| 644 | Ga0207675_100020610 | 3300026118 | Bacteria | 6145 |
| 645 | Ga0207675_100182632 | 3300026118 | Bacteria | 2009 |
| 646 | Ga0207675_100291292 | 3300026118 | Bacteria | 1588 |
| 647 | Ga0207675_100554882 | 3300026118 | Bacteria | 1148 |
| 648 | Ga0207675_100642165 | 3300026118 | Unclassified | 1067 |
| 649 | Ga0207675_100833424 | 3300026118 | Bacteria | 937 |
| 650 | Ga0207675_101959617 | 3300026118 | Unclassified | 604 |
| 651 | Ga0207675_102488125 | 3300026118 | Bacteria | 529 |
| 652 | Ga0207683_10074230 | 3300026121 | Bacteria | 3009 |
| 653 | Ga0207683_10077685 | 3300026121 | Bacteria | 2941 |
| 654 | Ga0207683_10172836 | 3300026121 | Unclassified | 1957 |
| 655 | Ga0207698_12011170 | 3300026142 | Bacteria | 592 |
| 656 | Ga0207428_10020520 | 3300027907 | Bacteria | 5612 |
| 657 | Ga0207428_10033173 | 3300027907 | Bacteria | 4243 |
| 658 | Ga0207428_10124057 | 3300027907 | Bacteria | 1978 |
| 659 | Ga0268266_10017449 | 3300028379 | Bacteria | 6121 |
| 660 | Ga0268266_10155676 | 3300028379 | Bacteria | 2064 |
| 661 | Ga0268266_10358039 | 3300028379 | Bacteria | 1372 |
| 662 | Ga0268266_10367120 | 3300028379 | Bacteria | 1355 |
| 663 | Ga0268266_10431813 | 3300028379 | Bacteria | 1250 |
| 664 | Ga0268266_10766556 | 3300028379 | Bacteria | 931 |
| 665 | Ga0268265_10029803 | 3300028380 | Bacteria | 3923 |
| 666 | Ga0268265_10039292 | 3300028380 | Bacteria | 3487 |
| 667 | Ga0268265_10150452 | 3300028380 | Bacteria | 1962 |
| 668 | Ga0268265_10169551 | 3300028380 | Unclassified | 1864 |
| 669 | Ga0268265_10450100 | 3300028380 | Unclassified | 1202 |
| 670 | Ga0268265_10614972 | 3300028380 | Bacteria | 1040 |
| 671 | Ga0268265_11458296 | 3300028380 | Unclassified | 687 |
| 672 | Ga0268265_11790188 | 3300028380 | Bacteria | 620 |
| 673 | Ga0268264_10010441 | 3300028381 | Bacteria | 7678 |
| 674 | Ga0268264_10128496 | 3300028381 | Bacteria | 2243 |
| 675 | Ga0268264_10148973 | 3300028381 | Bacteria | 2096 |
| 676 | Ga0268264_10254213 | 3300028381 | Bacteria | 1634 |
| 677 | Ga0268264_10842490 | 3300028381 | Bacteria | 918 |
| 678 | Ga0268264_11112698 | 3300028381 | Unclassified | 798 |
| 679 | Ga0268264_11831410 | 3300028381 | Unclassified | 617 |
| 680 | Ga0307511_10213100 | 3300030521 | Bacteria | 983 |
| 681 | Ga0265332_10177359 | 3300031238 | Unclassified | 888 |
| 682 | Ga0265332_10278009 | 3300031238 | Bacteria | 692 |
| 683 | Ga0265328_10103350 | 3300031239 | Unclassified | 1056 |
| 684 | Ga0265328_10305414 | 3300031239 | Bacteria | 615 |
| 685 | Ga0307408_101443714 | 3300031548 | Unclassified | 649 |
| 686 | Ga0265314_10032705 | 3300031711 | Bacteria | 3822 |
| 687 | Ga0307416_101405385 | 3300032002 | Bacteria | 804 |
| 688 | Ga0373930_0003233 | 3300034816 | Bacteria | 2574 |
| 689 | Ga0373958_0000583 | 3300034819 | Bacteria | 4533 |
| 690 | Ga0373958_0094093 | 3300034819 | Unclassified | 695 |
| 691 | Ga0373959_0003459 | 3300034820 | Bacteria | 2512 |
| 692 | Ga0373938_0001307 | 3300034957 | Bacteria | 4002 |
| 693 | Ga0373928_0002173 | 3300035084 | Bacteria | 3822 |
| 694 | Ga0373929_0001258 | 3300035085 | Bacteria | 4892 |
| 695 | Ga0373929_0037540 | 3300035085 | Bacteria | 1063 |
| 696 | Ga0373934_0092016 | 3300035086 | Bacteria | 1223 |
| 697 | Ga0373949_0002582 | 3300035090 | Bacteria | 4592 |
| 698 | Ga0373951_0000435 | 3300035091 | Bacteria | 12218 |
| 699 | Ga0373952_0001680 | 3300035092 | Bacteria | 4024 |
| 700 | Ga0373952_0028051 | 3300035092 | Bacteria | 1233 |
| 701 | Ga0373923_0377908 | 3300035111 | Unclassified | 679 |
| 702 | Ga0373923_0657788 | 3300035111 | Unclassified | 518 |
| 703 | Ga0373932_0000144 | 3300035112 | Bacteria | 20208 |
| 704 | Ga0373939_0001957 | 3300035114 | Bacteria | 4925 |
| 705 | Ga0373939_0238142 | 3300035114 | Unclassified | 703 |
| 706 | Ga0373939_0253235 | 3300035114 | Unclassified | 686 |
| 707 | Ga0373941_0001787 | 3300035115 | Bacteria | 4627 |
| 708 | Ga0373941_0005149 | 3300035115 | Unclassified | 3057 |
| 709 | Ga0373941_0015740 | 3300035115 | Bacteria | 2045 |
| 710 | Ga0373941_0261612 | 3300035115 | Unclassified | 679 |
| 711 | Ga0373945_0114571 | 3300035116 | Unclassified | 1067 |
| 712 | Ga0373953_0188833 | 3300035117 | Unclassified | 890 |
| 713 | Ga0373954_0097240 | 3300035118 | Bacteria | 1419 |
| 714 | Ga0373954_0285217 | 3300035118 | Bacteria | 814 |
| 715 | Ga0373956_0039249 | 3300035119 | Unclassified | 2098 |
| 716 | Ga0373956_0058807 | 3300035119 | Bacteria | 1738 |
| 717 | Ga0373960_0002303 | 3300035121 | Bacteria | 4299 |
| 718 | Ga0373943_0008530 | 3300035170 | Bacteria | 4596 |
| 719 | Ga0373943_0098159 | 3300035170 | Bacteria | 1528 |
| 720 | Ga0373943_0830832 | 3300035170 | Unclassified | 550 |
| 721 | Ga0373946_0002505 | 3300035171 | Bacteria | 6487 |
| 722 | Ga0373946_0278500 | 3300035171 | Bacteria | 822 |
| 723 | Ga0373955_0097915 | 3300035172 | Unclassified | 1680 |
| 724 | Ga0373955_0107349 | 3300035172 | Bacteria | 1611 |
| 725 | Ga0373955_0585100 | 3300035172 | Unclassified | 683 |
| 726 | Ga0373942_0000163 | 3300035207 | Bacteria | 16262 |
| 727 | Ga0373961_0000863 | 3300035241 | Bacteria | 10204 |
| 728 | Ga0373961_0072398 | 3300035241 | Bacteria | 1068 |
| 729 | Ga0373961_0131173 | 3300035241 | Bacteria | 839 |
| 730 | Ga0373962_0000442 | 3300035242 | Bacteria | 9068 |
| 731 | Ga0373962_0231084 | 3300035242 | Unclassified | 636 |
| 732 | Ga0373924_0067235 | 3300035410 | Bacteria | 1507 |
| 733 | Ga0373931_0771369 | 3300035691 | Unclassified | 639 |
| 734 | Ga0373935_0031073 | 3300035692 | Unclassified | 3312 |
| 735 | Ga0373935_0666785 | 3300035692 | Bacteria | 764 |
| 736 | Ga0373927_0102927 | 3300035695 | Bacteria | 1858 |
| 737 | Ga0373927_0150646 | 3300035695 | Bacteria | 1523 |
| 738 | Ga0373927_0327787 | 3300035695 | Bacteria | 1009 |
| 739 | Ga0373933_0046024 | 3300035724 | Unclassified | 2589 |
| 740 | Ga0373933_0233783 | 3300035724 | Bacteria | 1181 |
| 741 | Ga0373947_0003502 | 3300035725 | Bacteria | 9274 |
| 742 | Ga0373947_0092719 | 3300035725 | Unclassified | 1887 |
| 743 | Ga0373947_0283973 | 3300035725 | Unclassified | 1101 |
| 744 | Ga0373947_0286830 | 3300035725 | Bacteria | 1095 |
| 745 | Ga0373947_0395764 | 3300035725 | Bacteria | 931 |
| 746 | Ga0373947_0635555 | 3300035725 | Unclassified | 728 |
| 747 | Ga0373937_0062556 | 3300036401 | Bacteria | 3422 |
| 748 | Ga0373937_0110117 | 3300036401 | Unclassified | 2561 |
| 749 | Ga0373937_0121942 | 3300036401 | Bacteria | 2430 |
| 750 | Ga0373937_0236123 | 3300036401 | Unclassified | 1722 |
| 751 | Ga0373937_0338010 | 3300036401 | Bacteria | 1426 |
| 752 | Ga0373937_0595180 | 3300036401 | Unclassified | 1050 |
| 753 | Ga0373937_1343281 | 3300036401 | Unclassified | 663 |
| 754 | Ga0373925_0066673 | 3300037068 | Bacteria | 2714 |
| 755 | Ga0373925_0132539 | 3300037068 | Bacteria | 1944 |
| 756 | Ga0373925_0318550 | 3300037068 | Bacteria | 1258 |
| 757 | Ga0373925_0380091 | 3300037068 | Unclassified | 1150 |
| 758 | Ga0373925_0564668 | 3300037068 | Bacteria | 936 |
| 759 | Ga0373925_1349197 | 3300037068 | Unclassified | 585 |
| 760 | Ga0395898_1544047 | 3300037466 | Bacteria | 589 |
| 761 | Ga0395905_1767868 | 3300037471 | Bacteria | 524 |
| 762 | Ga0436365_1388943 | 3300039437 | Bacteria | 1849 |
| 763 | Ga0451802_0423297 | 3300041460 | Bacteria | 505 |
| 764 | Ga0439441_111997 | 3300042001 | Unclassified | 620 |
| 765 | Ga0439435_0012171 | 3300042436 | Unclassified | 2078 |
| 766 | Ga0466963_0218031 | 3300044694 | Bacteria | 1336 |
| 767 | Ga0466957_0822769 | 3300044842 | Unclassified | 661 |
| 768 | Ga0451576_0680206 | 3300045051 | Unclassified | 1081 |
| 769 | Ga0451576_0810082 | 3300045051 | Bacteria | 983 |
| 770 | Ga0451576_0820265 | 3300045051 | Bacteria | 977 |
| 771 | Ga0466967_0342134 | 3300045976 | Bacteria | 1447 |
| 772 | Ga0466967_1656042 | 3300045976 | Bacteria | 637 |
| 773 | Ga0495592_0024179 | 3300046454 | Bacteria | 4618 |
| 774 | Ga0495592_0552214 | 3300046454 | Bacteria | 708 |
| 775 | Ga0495603_0086791 | 3300046455 | Bacteria | 1831 |
| 776 | Ga0495629_0411940 | 3300046459 | Unclassified | 918 |
| 777 | Ga0495651_0209551 | 3300046462 | Unclassified | 1358 |
| 778 | Ga0495580_0084286 | 3300046472 | Unclassified | 2214 |
| 779 | Ga0495580_0316371 | 3300046472 | Bacteria | 1061 |
| 780 | Ga0495582_0095492 | 3300046473 | Bacteria | 1661 |
| 781 | Ga0495582_0154950 | 3300046473 | Bacteria | 1302 |
| 782 | Ga0495582_0470316 | 3300046473 | Unclassified | 726 |
| 783 | Ga0495664_0060668 | 3300046477 | Bacteria | 2252 |
| 784 | Ga0495664_0141489 | 3300046477 | Bacteria | 1459 |
| 785 | Ga0495608_0004074 | 3300046511 | Bacteria | 10481 |
| 786 | Ga0495618_0152429 | 3300046514 | Bacteria | 1476 |
| 787 | Ga0495618_0492678 | 3300046514 | Unclassified | 740 |
| 788 | Ga0495628_0051306 | 3300046516 | Bacteria | 3262 |
| 789 | Ga0495628_0501915 | 3300046516 | Unclassified | 876 |
| 790 | Ga0495628_0741532 | 3300046516 | Bacteria | 691 |
| 791 | Ga0495630_0018154 | 3300046517 | Bacteria | 5165 |
| 792 | Ga0495630_0316431 | 3300046517 | Bacteria | 1193 |
| 793 | Ga0495642_0209817 | 3300046528 | Bacteria | 850 |
| 794 | Ga0495640_0497111 | 3300046533 | Bacteria | 742 |
| 795 | Ga0495586_0094488 | 3300046535 | Unclassified | 1654 |
| 796 | Ga0495587_0023908 | 3300046536 | Unclassified | 3751 |
| 797 | Ga0495598_0091370 | 3300046537 | Bacteria | 993 |
| 798 | Ga0495645_0003196 | 3300046543 | Bacteria | 11105 |
| 799 | Ga0495645_0499485 | 3300046543 | Bacteria | 760 |
| 800 | Ga0495622_0374412 | 3300046557 | Unclassified | 615 |
| 801 | Ga0495667_0043893 | 3300046559 | Bacteria | 2961 |
| 802 | Ga0495667_0450479 | 3300046559 | Bacteria | 809 |
| 803 | Ga0495656_0172590 | 3300046615 | Bacteria | 1058 |
| 804 | Ga0495634_0067477 | 3300046642 | Bacteria | 2366 |
| 805 | Ga0495635_0214989 | 3300046663 | Bacteria | 1301 |
| 806 | Ga0495659_0077888 | 3300046664 | Bacteria | 1253 |
| 807 | Ga0495599_0206004 | 3300046678 | Bacteria | 1207 |
| 808 | Ga0495623_0199003 | 3300046679 | Bacteria | 1153 |
| 809 | Ga0495646_0326599 | 3300046680 | Unclassified | 807 |
| 810 | Ga0495647_0139147 | 3300046681 | Unclassified | 1034 |
| 811 | Ga0495647_0491750 | 3300046681 | Bacteria | 570 |
| 812 | Ga0495658_0061316 | 3300046683 | Bacteria | 2159 |
| 813 | Ga0495658_0063577 | 3300046683 | Unclassified | 2124 |
| 814 | Ga0495658_0127132 | 3300046683 | Bacteria | 1548 |
| 815 | Ga0495658_0153629 | 3300046683 | Bacteria | 1415 |
| 816 | Ga0495658_0251480 | 3300046683 | Unclassified | 1112 |
| 817 | Ga0495669_0011196 | 3300046684 | Bacteria | 3804 |
| 818 | Ga0495669_0103501 | 3300046684 | Bacteria | 1324 |
| 819 | Ga0495613_0004189 | 3300046689 | Bacteria | 10793 |
| 820 | Ga0495613_0317750 | 3300046689 | Bacteria | 1075 |
| 821 | Ga0495600_0037792 | 3300046809 | Bacteria | 3140 |
| 822 | Ga0495600_0175680 | 3300046809 | Unclassified | 1381 |
| 823 | Ga0495604_0043852 | 3300047317 | Bacteria | 3498 |
| 824 | Ga0495636_0353230 | 3300047318 | Unclassified | 694 |
| 825 | Ga0495674_0017759 | 3300047319 | Bacteria | 6623 |
| 826 | Ga0495674_0479677 | 3300047319 | Unclassified | 997 |
| 827 | Ga0495680_0141393 | 3300047322 | Unclassified | 1761 |
| 828 | Ga0495680_0470694 | 3300047322 | Bacteria | 857 |
| 829 | Ga0495680_0796297 | 3300047322 | Bacteria | 618 |
| 830 | Ga0495677_0324851 | 3300047445 | Bacteria | 606 |
| 831 | Ga0495684_0016032 | 3300047471 | Bacteria | 5769 |
| 832 | Ga0495684_0278933 | 3300047471 | Bacteria | 1206 |
| 833 | Ga0495684_0573315 | 3300047471 | Unclassified | 765 |
| 834 | Ga0495602_0488060 | 3300048088 | Unclassified | 863 |
| 835 | Ga0495615_0239296 | 3300048090 | Bacteria | 572 |
| 836 | Ga0496100_0069575 | 3300048903 | Unclassified | 2344 |
| 837 | Ga0496100_0222789 | 3300048903 | Bacteria | 1385 |
| 838 | Ga0496101_0000830 | 3300048904 | Bacteria | 18197 |
| 839 | Ga0496102_0230493 | 3300048905 | Bacteria | 1746 |
| 840 | Ga0496102_0295365 | 3300048905 | Bacteria | 1527 |
| 841 | Ga0496102_0849409 | 3300048905 | Bacteria | 835 |
| 842 | Ga0496102_1157241 | 3300048905 | Bacteria | 693 |
| 843 | Ga0496102_1559372 | 3300048905 | Bacteria | 579 |
| 844 | Ga0496104_0006932 | 3300048907 | Bacteria | 9996 |
| 845 | Ga0496104_0041811 | 3300048907 | Bacteria | 4299 |
| 846 | Ga0496104_0067011 | 3300048907 | Unclassified | 3410 |
| 847 | Ga0496104_0076320 | 3300048907 | Unclassified | 3192 |
| 848 | Ga0496104_0167975 | 3300048907 | Bacteria | 2104 |
| 849 | Ga0496104_0277524 | 3300048907 | Unclassified | 1589 |
| 850 | Ga0496104_0425838 | 3300048907 | Bacteria | 1239 |
| 851 | Ga0496104_0855719 | 3300048907 | Unclassified | 815 |
| 852 | Ga0496104_0882001 | 3300048907 | Unclassified | 800 |
| 853 | Ga0496104_1701338 | 3300048907 | Unclassified | 533 |
| 854 | Ga0496106_0117938 | 3300048909 | Unclassified | 2072 |
| 855 | Ga0496106_0197281 | 3300048909 | Bacteria | 1601 |
| 856 | Ga0496106_0312867 | 3300048909 | Unclassified | 1260 |
| 857 | Ga0496107_0290486 | 3300048910 | Bacteria | 1217 |
| 858 | Ga0496108_0036029 | 3300048911 | Bacteria | 4115 |
| 859 | Ga0496108_0304210 | 3300048911 | Unclassified | 1389 |
| 860 | Ga0496108_0326505 | 3300048911 | Bacteria | 1338 |
| 861 | Ga0496108_1207854 | 3300048911 | Unclassified | 639 |
| 862 | Ga0496109_0397924 | 3300048912 | Unclassified | 1301 |
| 863 | Ga0496110_0040200 | 3300048913 | Bacteria | 4076 |
| 864 | Ga0496110_0111618 | 3300048913 | Bacteria | 2458 |
| 865 | Ga0496111_0047559 | 3300048914 | Bacteria | 3090 |
| 866 | Ga0496111_0932724 | 3300048914 | Unclassified | 624 |
| 867 | Ga0496111_1206471 | 3300048914 | Unclassified | 536 |
| 868 | Ga0496112_0006817 | 3300048915 | Bacteria | 10070 |
| 869 | Ga0496112_0055550 | 3300048915 | Bacteria | 3894 |
| 870 | Ga0496112_0175963 | 3300048915 | Unclassified | 2105 |
| 871 | Ga0496112_0223638 | 3300048915 | Bacteria | 1838 |
| 872 | Ga0496112_0548100 | 3300048915 | Bacteria | 1090 |
| 873 | Ga0496112_1308332 | 3300048915 | Unclassified | 640 |
| 874 | Ga0496113_0002074 | 3300048916 | Bacteria | 11532 |
| 875 | Ga0496113_0288905 | 3300048916 | Bacteria | 1312 |
| 876 | Ga0496114_0028582 | 3300048917 | Bacteria | 4576 |
| 877 | Ga0496114_0035672 | 3300048917 | Bacteria | 4108 |
| 878 | Ga0496114_0468282 | 3300048917 | Bacteria | 1115 |
| 879 | Ga0496114_0653409 | 3300048917 | Unclassified | 925 |
| 880 | Ga0496114_1494799 | 3300048917 | Bacteria | 563 |
| 881 | Ga0496115_0079979 | 3300048918 | Bacteria | 2661 |
| 882 | Ga0501033_0587576 | 3300049570 | Bacteria | 765 |
| 883 | Ga0501034_0105145 | 3300049571 | Bacteria | 2816 |
| 884 | Ga0501040_0194504 | 3300049576 | Bacteria | 1440 |
| 885 | Ga0501043_0067616 | 3300049579 | Bacteria | 2806 |
| 886 | Ga0501047_0025626 | 3300049581 | Bacteria | 5670 |
| 887 | Ga0501047_0147278 | 3300049581 | Bacteria | 2231 |
| 888 | Ga0501048_0655712 | 3300049582 | Unclassified | 754 |
| 889 | Ga0501073_0203228 | 3300049589 | Bacteria | 1370 |
| 890 | Ga0501079_0612018 | 3300049741 | Bacteria | 857 |
| 891 | Ga0501083_0169387 | 3300049744 | Bacteria | 1428 |
| 892 | Ga0501083_0251005 | 3300049744 | Unclassified | 1152 |
| 893 | Ga0501044_0017983 | 3300049823 | Bacteria | 7579 |
| 894 | nmdc:mga05p37_1026191_c1 | 3300050507 | Bacteria | 873 |
| 895 | nmdc:mga05p37_104043_c2 | 3300050507 | Unclassified | 2963 |
| 896 | nmdc:mga05p37_141928_c1 | 3300050507 | Bacteria | 2942 |
| 897 | nmdc:mga05p37_15195_c1 | 3300050507 | Bacteria | 9245 |
| 898 | nmdc:mga05p37_212237_c1 | 3300050507 | Bacteria | 2340 |
| 899 | nmdc:mga05p37_22345_c1 | 3300050507 | Bacteria | 7673 |
| 900 | nmdc:mga05p37_2445_c1 | 3300050507 | Bacteria | 21611 |
| 901 | nmdc:mga05p37_26793_c1 | 3300050507 | Bacteria | 7010 |
| 902 | nmdc:mga05p37_300236_c1 | 3300050507 | Bacteria | 1908 |
| 903 | nmdc:mga05p37_55115_c2 | 3300050507 | Bacteria | 2350 |
| 904 | nmdc:mga05p37_70171_c1 | 3300050507 | Bacteria | 4310 |
| 905 | nmdc:mga05p37_79243_c1 | 3300050507 | Bacteria | 4045 |
| 906 | nmdc:mga05p37_8679_c1 | 3300050507 | Bacteria | 12009 |
| 907 | nmdc:mga09592_1061329_c1 | 3300050508 | Bacteria | 675 |
| 908 | nmdc:mga09592_57903_c1 | 3300050508 | Bacteria | 3276 |
| 909 | nmdc:mga09592_720733_c1 | 3300050508 | Bacteria | 848 |
| 910 | nmdc:mga09592_803475_c1 | 3300050508 | Bacteria | 795 |
| 911 | nmdc:mga09592_846854_c1 | 3300050508 | Bacteria | 771 |
| 912 | nmdc:mga06r32_353903_c1 | 3300050510 | Unclassified | 1453 |
| 913 | nmdc:mga08y16_10551_c1 | 3300050511 | Bacteria | 9696 |
| 914 | nmdc:mga08y16_179180_c1 | 3300050511 | Bacteria | 2200 |
| 915 | nmdc:mga08y16_18326_c1 | 3300050511 | Bacteria | 7377 |
| 916 | nmdc:mga08y16_19245_c1 | 3300050511 | Bacteria | 7196 |
| 917 | nmdc:mga0n895_12013_c1 | 3300050512 | Bacteria | 7750 |
| 918 | nmdc:mga0n895_131955_c1 | 3300050512 | Bacteria | 2523 |
| 919 | nmdc:mga0n895_141_c1 | 3300050512 | Bacteria | 43611 |
| 920 | nmdc:mga0n895_220120_c1 | 3300050512 | Bacteria | 1928 |
| 921 | nmdc:mga0n895_2213967_c1 | 3300050512 | Unclassified | 505 |
| 922 | nmdc:mga0n895_484250_c1 | 3300050512 | Unclassified | 1247 |
| 923 | nmdc:mga0n895_7789_c1 | 3300050512 | Bacteria | 9229 |
| 924 | nmdc:mga0n895_880199_c1 | 3300050512 | Bacteria | 882 |
| 925 | nmdc:mga0rr50_13152_c1 | 3300050513 | Bacteria | 5377 |
| 926 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 927 | nmdc:mga0rr50_54258_c1 | 3300050513 | Bacteria | 2985 |
| 928 | nmdc:mga0rr50_67237_c1 | 3300050513 | Bacteria | 2722 |
| 929 | nmdc:mga0rr50_743880_c1 | 3300050513 | Bacteria | 837 |
| 930 | nmdc:mga0rr50_91466_c1 | 3300050513 | Unclassified | 2370 |
| 931 | nmdc:mga0rr50_9174_c1 | 3300050513 | Bacteria | 6202 |
| 932 | nmdc:mga0rr50_94174_c2 | 3300050513 | Unclassified | 1938 |
| 933 | nmdc:mga08x19_13318_c1 | 3300050514 | Bacteria | 4969 |
| 934 | nmdc:mga08x19_133546_c1 | 3300050514 | Bacteria | 1671 |
| 935 | nmdc:mga08x19_234209_c1 | 3300050514 | Bacteria | 1265 |
| 936 | nmdc:mga08x19_47168_c1 | 3300050514 | Bacteria | 2757 |
| 937 | nmdc:mga08x19_507845_c1 | 3300050514 | Unclassified | 851 |
| 938 | nmdc:mga08x19_61999_c1 | 3300050514 | Bacteria | 2424 |
| 939 | nmdc:mga08x19_8030_c1 | 3300050514 | Bacteria | 6272 |
| 940 | nmdc:mga08x19_88190_c1 | 3300050514 | Bacteria | 2045 |
| 941 | nmdc:mga08x19_92_c1 | 3300050514 | Bacteria | 80986 |
| 942 | nmdc:mga0a205_132096_c1 | 3300050515 | Bacteria | 2397 |
| 943 | nmdc:mga0a205_1463535_c1 | 3300050515 | Unclassified | 531 |
| 944 | nmdc:mga0a205_147006_c1 | 3300050515 | Bacteria | 2257 |
| 945 | nmdc:mga0a205_148542_c1 | 3300050515 | Bacteria | 2244 |
| 946 | nmdc:mga0a205_463756_c1 | 3300050515 | Bacteria | 1126 |
| 947 | nmdc:mga0a205_489849_c1 | 3300050515 | Bacteria | 1087 |
| 948 | nmdc:mga0a205_84754_c1 | 3300050515 | Bacteria | 3061 |
| 949 | Ga0495601_0003358 | 3300053077 | Bacteria | 9163 |
| 950 | Ga0495601_0034147 | 3300053077 | Bacteria | 3172 |
| 951 | Ga0495601_0090234 | 3300053077 | Bacteria | 1971 |
| 952 | Ga0495601_0216205 | 3300053077 | Bacteria | 1252 |
| 953 | Ga0495595_0014239 | 3300053084 | Unclassified | 3371 |
| 954 | Ga0495595_0054476 | 3300053084 | Bacteria | 1860 |
| 955 | Ga0495619_0003172 | 3300053085 | Bacteria | 10651 |
| 956 | Ga0495619_0132127 | 3300053085 | Unclassified | 1716 |
| 957 | Ga0495619_0166321 | 3300053085 | Unclassified | 1524 |
| 958 | Ga0495619_0173344 | 3300053085 | Bacteria | 1492 |
| 959 | Ga0495619_0737235 | 3300053085 | Unclassified | 669 |
| 960 | Ga0495619_0863685 | 3300053085 | Bacteria | 610 |
| 961 | Ga0500658_0027878 | 3300053134 | Bacteria | 2188 |
| 962 | Ga0501084_0357429 | 3300054114 | Bacteria | 1234 |
| 963 | Ga0501082_0038319 | 3300060353 | Bacteria | 4135 |
| 964 | Ga0501082_0515728 | 3300060353 | Bacteria | 1045 |
| 965 | Ga0501082_0771975 | 3300060353 | Bacteria | 841 |
| 966 | Ga0501082_1108991 | 3300060353 | Bacteria | 692 |
| 967 | Ga0530510_0792266 | 3300061734 | Bacteria | 723 |
| 968 | Ga0207646_10343809 | |||
| 969 | Ga0065714_10020465 | |||
| 970 | Ga0065704_10272398 | |||
| 971 | Ga0065704_10394357 | |||
| 972 | Ga0065712_10017326 | |||
| 973 | Ga0065712_10084377 | |||
| 974 | Ga0065715_10129866 | |||
| 975 | Ga0065715_10457654 | |||
| 976 | Ga0065715_10563030 | |||
| 977 | Ga0065715_10597780 | |||
| 978 | Ga0065707_10041819 | |||
| 979 | Ga0065707_10055820 | |||
| 980 | Ga0065707_10541731 | |||
| 981 | Ga0070676_10003053 | |||
| 982 | Ga0070676_10205622 | |||
| 983 | Ga0070676_10511841 | |||
| 984 | Ga0070683_100024062 | |||
| 985 | Ga0070683_100122832 | |||
| 986 | Ga0070683_100510007 | |||
| 987 | Ga0070683_101054821 | |||
| 988 | Ga0070690_100064683 | |||
| 989 | Ga0070670_100050066 | |||
| 990 | Ga0070670_100257519 | |||
| 991 | Ga0070677_10400803 | |||
| 992 | Ga0070677_10730189 | |||
| 993 | Ga0068869_100068178 | |||
| 994 | Ga0068869_100120659 | |||
| 995 | Ga0070666_10011714 | |||
| 996 | Ga0070666_10123429 | |||
| 997 | Ga0070666_10186173 | |||
| 998 | Ga0070666_10239099 | |||
| 999 | Ga0070666_10260989 | |||
| 1000 | Ga0070666_10344043 | |||
| 1001 | Ga0070680_100290309 | |||
| 1002 | Ga0070682_100084121 | |||
| 1003 | Ga0070682_101701129 | |||
| 1004 | Ga0068868_100016616 | |||
| 1005 | Ga0068868_100056104 | |||
| 1006 | Ga0068868_100080712 | |||
| 1007 | Ga0068868_100126893 | |||
| 1008 | Ga0068868_100550398 | |||
| 1009 | Ga0068868_100561918 | |||
| 1010 | Ga0068868_101080943 | |||
| 1011 | Ga0070660_100360819 | |||
| 1012 | Ga0070660_100609604 | |||
| 1013 | Ga0070660_100652080 | |||
| 1014 | Ga0070689_100034783 | |||
| 1015 | Ga0070691_10000837 | |||
| 1016 | Ga0070691_10136622 | |||
| 1017 | Ga0070687_100091476 | |||
| 1018 | Ga0070687_100501226 | |||
| 1019 | Ga0070661_100067727 | |||
| 1020 | Ga0070692_10107092 | |||
| 1021 | Ga0070692_10283596 | |||
| 1022 | Ga0070668_100039358 | |||
| 1023 | Ga0070668_100217844 | |||
| 1024 | Ga0070668_100457728 | |||
| 1025 | Ga0070668_100943149 | |||
| 1026 | Ga0070669_100003885 | |||
| 1027 | Ga0070669_100040254 | |||
| 1028 | Ga0070669_100048756 | |||
| 1029 | Ga0070669_100293153 | |||
| 1030 | Ga0070669_100522595 | |||
| 1031 | Ga0070669_100534725 | |||
| 1032 | Ga0070669_100779967 | |||
| 1033 | Ga0070669_100928899 | |||
| 1034 | Ga0070669_100974081 | |||
| 1035 | Ga0070675_100040576 | |||
| 1036 | Ga0070675_100086632 | |||
| 1037 | Ga0070675_100763068 | |||
| 1038 | Ga0070671_100248401 | |||
| 1039 | Ga0070671_100392783 | |||
| 1040 | Ga0070671_100547216 | |||
| 1041 | Ga0070671_100723640 | |||
| 1042 | Ga0070674_100040108 | |||
| 1043 | Ga0070674_100067515 | |||
| 1044 | Ga0070674_100120391 | |||
| 1045 | Ga0070674_100323659 | |||
| 1046 | Ga0070674_100724771 | |||
| 1047 | Ga0070673_100085114 | |||
| 1048 | Ga0070673_100309293 | |||
| 1049 | Ga0070673_100481865 | |||
| 1050 | Ga0070673_100517389 | |||
| 1051 | Ga0070673_100696635 | |||
| 1052 | Ga0070673_100928247 | |||
| 1053 | Ga0070673_100931106 | |||
| 1054 | Ga0070673_101624105 | |||
| 1055 | Ga0070688_100008134 | |||
| 1056 | Ga0070688_100235611 | |||
| 1057 | Ga0070688_100268753 | |||
| 1058 | Ga0070659_100081018 | |||
| 1059 | Ga0070659_100694767 | |||
| 1060 | Ga0070667_100113102 | |||
| 1061 | Ga0070667_100156808 | |||
| 1062 | Ga0070667_100819007 | |||
| 1063 | Ga0070667_100820662 | |||
| 1064 | Ga0070667_101305036 | |||
| 1065 | Ga0070667_101533926 | |||
| 1066 | Ga0070703_10172188 | |||
| 1067 | Ga0070709_10489398 | |||
| 1068 | Ga0070709_10663068 | |||
| 1069 | Ga0070713_100006500 | |||
| 1070 | Ga0070713_100257050 | |||
| 1071 | Ga0070713_100676781 | |||
| 1072 | Ga0070701_10002538 | |||
| 1073 | Ga0070701_10156121 | |||
| 1074 | Ga0070701_10156996 | |||
| 1075 | Ga0070711_100143115 | |||
| 1076 | Ga0070705_100016534 | |||
| 1077 | Ga0070705_100043461 | |||
| 1078 | Ga0070705_100659089 | |||
| 1079 | Ga0070700_100003531 | |||
| 1080 | Ga0070700_100048849 | |||
| 1081 | Ga0070700_100110280 | |||
| 1082 | Ga0070700_100152006 | |||
| 1083 | Ga0070694_100070470 | |||
| 1084 | Ga0070694_100088514 | |||
| 1085 | Ga0070694_100292694 | |||
| 1086 | Ga0070708_100019093 | |||
| 1087 | Ga0070708_100079497 | |||
| 1088 | Ga0070708_100801691 | |||
| 1089 | Ga0070663_101179535 | |||
| 1090 | Ga0070678_100290004 | |||
| 1091 | Ga0070678_100359848 | |||
| 1092 | Ga0070662_100036801 | |||
| 1093 | Ga0070662_100216098 | |||
| 1094 | Ga0070662_100241777 | |||
| 1095 | Ga0070662_100361696 | |||
| 1096 | Ga0070681_10003654 | |||
| 1097 | Ga0070681_10222506 | |||
| 1098 | Ga0070681_10461162 | |||
| 1099 | Ga0070681_11025984 | |||
| 1100 | Ga0070681_11750172 | |||
| 1101 | Ga0068867_100100070 | |||
| 1102 | Ga0068867_100147144 | |||
| 1103 | Ga0068867_100153682 | |||
| 1104 | Ga0068867_100442656 | |||
| 1105 | Ga0068867_101451460 | |||
| 1106 | Ga0070685_10240297 | |||
| 1107 | Ga0070706_100187714 | |||
| 1108 | Ga0070706_100518351 | |||
| 1109 | Ga0070706_101019020 | |||
| 1110 | Ga0070707_100872399 | |||
| 1111 | Ga0070707_101434051 | |||
| 1112 | Ga0070698_100012233 | |||
| 1113 | Ga0070698_100082559 | |||
| 1114 | Ga0070698_100179129 | |||
| 1115 | Ga0070698_100206950 | |||
| 1116 | Ga0070698_101354951 | |||
| 1117 | Ga0070699_100023159 | |||
| 1118 | Ga0070679_100060903 | |||
| 1119 | Ga0070679_100406580 | |||
| 1120 | Ga0070684_100083898 | |||
| 1121 | Ga0070684_100136628 | |||
| 1122 | Ga0070684_100363773 | |||
| 1123 | Ga0070684_100653905 | |||
| 1124 | Ga0070697_100062033 | |||
| 1125 | Ga0068853_100324878 | |||
| 1126 | Ga0068853_100581578 | |||
| 1127 | Ga0068853_100975850 | |||
| 1128 | Ga0068853_101486371 | |||
| 1129 | Ga0070672_100036518 | |||
| 1130 | Ga0070672_100276554 | |||
| 1131 | Ga0070672_100668885 | |||
| 1132 | Ga0070672_100740916 | |||
| 1133 | Ga0070672_100944782 | |||
| 1134 | Ga0070672_101218867 | |||
| 1135 | Ga0070686_100000153 | |||
| 1136 | Ga0070686_100570675 | |||
| 1137 | Ga0070686_100590751 | |||
| 1138 | Ga0070686_100636622 | |||
| 1139 | Ga0070686_100872571 | |||
| 1140 | Ga0070695_100000777 | |||
| 1141 | Ga0070695_100043745 | |||
| 1142 | Ga0070695_100969182 | |||
| 1143 | Ga0070695_101872291 | |||
| 1144 | Ga0070696_100011456 | |||
| 1145 | Ga0070696_100151980 | |||
| 1146 | Ga0070696_100198182 | |||
| 1147 | Ga0070696_100265591 | |||
| 1148 | Ga0070696_100323910 | |||
| 1149 | Ga0070696_100494405 | |||
| 1150 | Ga0070696_101106842 | |||
| 1151 | Ga0070693_100475397 | |||
| 1152 | Ga0070693_101509464 | |||
| 1153 | Ga0070665_100001513 | |||
| 1154 | Ga0070665_100021143 | |||
| 1155 | Ga0070665_100263815 | |||
| 1156 | Ga0070665_100290957 | |||
| 1157 | Ga0070665_100463061 | |||
| 1158 | Ga0070665_100545039 | |||
| 1159 | Ga0070704_100002431 | |||
| 1160 | Ga0070704_100005299 | |||
| 1161 | Ga0070704_101375143 | |||
| 1162 | Ga0068855_100019451 | |||
| 1163 | Ga0068855_100540126 | |||
| 1164 | Ga0070664_100090116 | |||
| 1165 | Ga0070664_100116360 | |||
| 1166 | Ga0068857_100544617 | |||
| 1167 | Ga0068854_100012660 | |||
| 1168 | Ga0068854_100060130 | |||
| 1169 | Ga0068854_100415052 | |||
| 1170 | Ga0068854_100509103 | |||
| 1171 | Ga0068854_102125927 | |||
| 1172 | Ga0068856_100027205 | |||
| 1173 | Ga0070702_100003807 | |||
| 1174 | Ga0068852_101244275 | |||
| 1175 | Ga0068859_100069609 | |||
| 1176 | Ga0068859_100100830 | |||
| 1177 | Ga0068859_100121750 | |||
| 1178 | Ga0068859_100227375 | |||
| 1179 | Ga0068859_100256039 | |||
| 1180 | Ga0068859_100369930 | |||
| 1181 | Ga0068859_100446991 | |||
| 1182 | Ga0068859_100522452 | |||
| 1183 | Ga0068859_100817800 | |||
| 1184 | Ga0068864_100013809 | |||
| 1185 | Ga0068864_100073303 | |||
| 1186 | Ga0068864_100118661 | |||
| 1187 | Ga0068864_100127701 | |||
| 1188 | Ga0068864_100139677 | |||
| 1189 | Ga0068864_100522129 | |||
| 1190 | Ga0068866_10057287 | |||
| 1191 | Ga0068866_10120424 | |||
| 1192 | Ga0068866_10361872 | |||
| 1193 | Ga0068861_100112706 | |||
| 1194 | Ga0068861_100162540 | |||
| 1195 | Ga0068861_100221127 | |||
| 1196 | Ga0068861_101031634 | |||
| 1197 | Ga0068861_101750380 | |||
| 1198 | Ga0068851_10020478 | |||
| 1199 | Ga0068863_100006690 | |||
| 1200 | Ga0068863_100128678 | |||
| 1201 | Ga0068863_100180703 | |||
| 1202 | Ga0068863_100542513 | |||
| 1203 | Ga0068863_100543064 | |||
| 1204 | Ga0068858_100003161 | |||
| 1205 | Ga0068858_100005969 | |||
| 1206 | Ga0068858_100044461 | |||
| 1207 | Ga0068858_100085316 | |||
| 1208 | Ga0068858_100091344 | |||
| 1209 | Ga0068858_100127144 | |||
| 1210 | Ga0068858_100152671 | |||
| 1211 | Ga0068858_100448662 | |||
| 1212 | Ga0068858_100885458 | |||
| 1213 | Ga0068860_100014590 | |||
| 1214 | Ga0068860_100595934 | |||
| 1215 | Ga0068860_101064118 | |||
| 1216 | Ga0068860_101093678 | |||
| 1217 | Ga0068860_101376597 | |||
| 1218 | Ga0068860_101421588 | |||
| 1219 | Ga0068860_101669792 | |||
| 1220 | Ga0068862_100002661 | |||
| 1221 | Ga0068862_100024171 | |||
| 1222 | Ga0068862_100129416 | |||
| 1223 | Ga0068862_100275868 | |||
| 1224 | Ga0068862_100350572 | |||
| 1225 | Ga0068862_100462135 | |||
| 1226 | Ga0068862_100541922 | |||
| 1227 | Ga0068862_100984915 | |||
| 1228 | Ga0081455_10052456 | |||
| 1229 | Ga0081539_10002012 | |||
| 1230 | Ga0070717_10324080 | |||
| 1231 | Ga0070712_100322187 | |||
| 1232 | Ga0097621_100000125 | |||
| 1233 | Ga0097621_100014247 | |||
| 1234 | Ga0097621_100017775 | |||
| 1235 | Ga0097621_100038740 | |||
| 1236 | Ga0097621_100105568 | |||
| 1237 | Ga0097621_100153526 | |||
| 1238 | Ga0097621_100154846 | |||
| 1239 | Ga0097621_100726154 | |||
| 1240 | Ga0097621_100996314 | |||
| 1241 | Ga0068871_100000134 | |||
| 1242 | Ga0068871_100029682 | |||
| 1243 | Ga0068871_100093179 | |||
| 1244 | Ga0068871_100133321 | |||
| 1245 | Ga0068871_100143254 | |||
| 1246 | Ga0068871_102043834 | |||
| 1247 | Ga0075428_100088295 | |||
| 1248 | Ga0075428_100452689 | |||
| 1249 | Ga0075428_100639156 | |||
| 1250 | Ga0075428_101217159 | |||
| 1251 | Ga0075431_100113206 | |||
| 1252 | Ga0075433_10016907 | |||
| 1253 | Ga0075433_10071887 | |||
| 1254 | Ga0075433_10443069 | |||
| 1255 | Ga0075433_10490849 | |||
| 1256 | Ga0075433_11325147 | |||
| 1257 | Ga0075434_100001054 | |||
| 1258 | Ga0075434_100001202 | |||
| 1259 | Ga0075434_100002093 | |||
| 1260 | Ga0075434_100065019 | |||
| 1261 | Ga0075434_100073849 | |||
| 1262 | Ga0075434_100218129 | |||
| 1263 | Ga0075434_100348634 | |||
| 1264 | Ga0075434_100410074 | |||
| 1265 | Ga0075434_100893246 | |||
| 1266 | Ga0075434_101420627 | |||
| 1267 | Ga0075429_100200845 | |||
| 1268 | Ga0075429_100252537 | |||
| 1269 | Ga0075429_100372174 | |||
| 1270 | Ga0068865_100053714 | |||
| 1271 | Ga0068865_100083576 | |||
| 1272 | Ga0068865_100138493 | |||
| 1273 | Ga0068865_100358136 | |||
| 1274 | Ga0068865_100763986 | |||
| 1275 | Ga0068865_100996900 | |||
| 1276 | Ga0068865_101173876 | |||
| 1277 | Ga0075436_100001908 | |||
| 1278 | Ga0075436_100014361 | |||
| 1279 | Ga0075436_100079509 | |||
| 1280 | Ga0075436_100189856 | |||
| 1281 | Ga0097620_100069610 | |||
| 1282 | Ga0097620_100100838 | |||
| 1283 | Ga0097620_100121760 | |||
| 1284 | Ga0097620_100227376 | |||
| 1285 | Ga0097620_100256046 | |||
| 1286 | Ga0097620_100369941 | |||
| 1287 | Ga0097620_100447026 | |||
| 1288 | Ga0097620_100522408 | |||
| 1289 | Ga0097620_100817802 | |||
| 1290 | Ga0075435_100000204 | |||
| 1291 | Ga0075435_100000924 | |||
| 1292 | Ga0075435_100001088 | |||
| 1293 | Ga0075435_100031162 | |||
| 1294 | Ga0075435_100118917 | |||
| 1295 | Ga0075435_100166785 | |||
| 1296 | Ga0075435_100374576 | |||
| 1297 | Ga0075435_100950628 | |||
| 1298 | Ga0075435_101341729 | |||
| 1299 | Ga0099794_10037690 | |||
| 1300 | Ga0099794_10627984 | |||
| 1301 | Ga0105251_10302715 | |||
| 1302 | Ga0105240_10010017 | |||
| 1303 | Ga0105240_10081871 | |||
| 1304 | Ga0105240_10111828 | |||
| 1305 | Ga0105240_10449709 | |||
| 1306 | Ga0105240_11080709 | |||
| 1307 | Ga0105240_11459654 | |||
| 1308 | Ga0111539_10000466 | |||
| 1309 | Ga0111539_10007493 | |||
| 1310 | Ga0111539_10029457 | |||
| 1311 | Ga0111539_10039828 | |||
| 1312 | Ga0111539_10343310 | |||
| 1313 | Ga0111539_10535520 | |||
| 1314 | Ga0111539_11913496 | |||
| 1315 | Ga0105245_10009401 | |||
| 1316 | Ga0105245_10148967 | |||
| 1317 | Ga0105245_10167913 | |||
| 1318 | Ga0105245_10221039 | |||
| 1319 | Ga0105245_10248147 | |||
| 1320 | Ga0105245_10330229 | |||
| 1321 | Ga0105245_10655561 | |||
| 1322 | Ga0105247_10001472 | |||
| 1323 | Ga0105247_10013578 | |||
| 1324 | Ga0105247_10024096 | |||
| 1325 | Ga0105247_10778934 | |||
| 1326 | Ga0114129_10000426 | |||
| 1327 | Ga0114129_10000876 | |||
| 1328 | Ga0114129_10003910 | |||
| 1329 | Ga0114129_10004361 | |||
| 1330 | Ga0114129_10008094 | |||
| 1331 | Ga0114129_10012966 | |||
| 1332 | Ga0114129_10083778 | |||
| 1333 | Ga0114129_10178236 | |||
| 1334 | Ga0114129_10213988 | |||
| 1335 | Ga0114129_10339302 | |||
| 1336 | Ga0114129_10347070 | |||
| 1337 | Ga0114129_10355253 | |||
| 1338 | Ga0114129_11691886 | |||
| 1339 | Ga0114129_11692982 | |||
| 1340 | Ga0114129_11945287 | |||
| 1341 | Ga0114129_12802331 | |||
| 1342 | Ga0105243_10029595 | |||
| 1343 | Ga0105243_10087732 | |||
| 1344 | Ga0105243_10148007 | |||
| 1345 | Ga0105243_10430108 | |||
| 1346 | Ga0105243_10904185 | |||
| 1347 | Ga0105241_10289002 | |||
| 1348 | Ga0105241_10492704 | |||
| 1349 | Ga0105241_10843506 | |||
| 1350 | Ga0105242_10058695 | |||
| 1351 | Ga0105242_10174182 | |||
| 1352 | Ga0105242_10208811 | |||
| 1353 | Ga0105242_10256614 | |||
| 1354 | Ga0105242_11417459 | |||
| 1355 | Ga0105248_10002519 | |||
| 1356 | Ga0105248_10036746 | |||
| 1357 | Ga0105248_10045082 | |||
| 1358 | Ga0105248_10157780 | |||
| 1359 | Ga0105248_10180592 | |||
| 1360 | Ga0105248_10221025 | |||
| 1361 | Ga0105248_10239404 | |||
| 1362 | Ga0105248_10666126 | |||
| 1363 | Ga0105248_10859833 | |||
| 1364 | Ga0105248_10948005 | |||
| 1365 | Ga0105248_11712830 | |||
| 1366 | Ga0105237_10296246 | |||
| 1367 | Ga0105238_10212048 | |||
| 1368 | Ga0105238_10212722 | |||
| 1369 | Ga0105238_10403112 | |||
| 1370 | Ga0105249_10248805 | |||
| 1371 | Ga0105249_10605556 | |||
| 1372 | Ga0105249_11132999 | |||
| 1373 | Ga0105249_11454211 | |||
| 1374 | Ga0105249_12585168 | |||
| 1375 | Ga0105239_12019841 | |||
| 1376 | Ga0105246_10202185 | |||
| 1377 | Ga0105246_11518790 | |||
| 1378 | Ga0105246_11637124 | |||
| 1379 | Ga0157323_1005343 | |||
| 1380 | Ga0157369_11294663 | |||
| 1381 | Ga0157374_10037537 | |||
| 1382 | Ga0157374_10055503 | |||
| 1383 | Ga0157374_10547047 | |||
| 1384 | Ga0157374_10701591 | |||
| 1385 | Ga0157378_10005743 | |||
| 1386 | Ga0157378_10250526 | |||
| 1387 | Ga0157378_10296475 | |||
| 1388 | Ga0157378_10308617 | |||
| 1389 | Ga0157378_12127291 | |||
| 1390 | Ga0163162_10034270 | |||
| 1391 | Ga0163162_10276059 | |||
| 1392 | Ga0163162_11143377 | |||
| 1393 | Ga0157372_10286901 | |||
| 1394 | Ga0157375_10059732 | |||
| 1395 | Ga0157375_10172839 | |||
| 1396 | Ga0157375_10798370 | |||
| 1397 | Ga0157375_11452447 | |||
| 1398 | Ga0157375_11825967 | |||
| 1399 | Ga0163163_10011654 | |||
| 1400 | Ga0163163_10019039 | |||
| 1401 | Ga0163163_10661526 | |||
| 1402 | Ga0163163_10801737 | |||
| 1403 | Ga0163163_11196478 | |||
| 1404 | Ga0163163_11403490 | |||
| 1405 | Ga0157380_10166704 | |||
| 1406 | Ga0157380_10623187 | |||
| 1407 | Ga0157380_10803574 | |||
| 1408 | Ga0157380_12391106 | |||
| 1409 | Ga0157377_10258257 | |||
| 1410 | Ga0157377_10351327 | |||
| 1411 | Ga0157379_10002568 | |||
| 1412 | Ga0157379_10003372 | |||
| 1413 | Ga0157379_10025073 | |||
| 1414 | Ga0157379_10064423 | |||
| 1415 | Ga0157379_10385560 | |||
| 1416 | Ga0157379_10843896 | |||
| 1417 | Ga0157376_10002539 | |||
| 1418 | Ga0157376_10011019 | |||
| 1419 | Ga0157376_10024820 | |||
| 1420 | Ga0157376_10050013 | |||
| 1421 | Ga0157376_10137508 | |||
| 1422 | Ga0157376_10145968 | |||
| 1423 | Ga0157376_10297582 | |||
| 1424 | Ga0157376_10414484 | |||
| 1425 | Ga0157376_10440374 | |||
| 1426 | Ga0157376_11288399 | |||
| 1427 | Ga0157376_11724519 | |||
| 1428 | Ga0163161_10464758 | |||
| 1429 | Ga0213876_10077902 | |||
| 1430 | Ga0207697_10134709 | |||
| 1431 | Ga0207653_10052402 | |||
| 1432 | Ga0207653_10059000 | |||
| 1433 | Ga0207682_10270388 | |||
| 1434 | Ga0207642_10024812 | |||
| 1435 | Ga0207642_10054789 | |||
| 1436 | Ga0207642_10344187 | |||
| 1437 | Ga0207688_10137520 | |||
| 1438 | Ga0207688_10185636 | |||
| 1439 | Ga0207680_10033007 | |||
| 1440 | Ga0207680_10067592 | |||
| 1441 | Ga0207680_10071456 | |||
| 1442 | Ga0207680_10137089 | |||
| 1443 | Ga0207680_10683533 | |||
| 1444 | Ga0207685_10007767 | |||
| 1445 | Ga0207685_10462606 | |||
| 1446 | Ga0207645_10005648 | |||
| 1447 | Ga0207645_10600295 | |||
| 1448 | Ga0207645_10658946 | |||
| 1449 | Ga0207645_10882594 | |||
| 1450 | Ga0207643_10223628 | |||
| 1451 | Ga0207643_10574663 | |||
| 1452 | Ga0207705_10156957 | |||
| 1453 | Ga0207684_10369142 | |||
| 1454 | Ga0207654_10130226 | |||
| 1455 | Ga0207654_10300968 | |||
| 1456 | Ga0207654_10366993 | |||
| 1457 | Ga0207707_10008859 | |||
| 1458 | Ga0207707_10034907 | |||
| 1459 | Ga0207707_10156653 | |||
| 1460 | Ga0207707_10195159 | |||
| 1461 | Ga0207707_11278914 | |||
| 1462 | Ga0207695_10066322 | |||
| 1463 | Ga0207695_10202742 | |||
| 1464 | Ga0207695_10237457 | |||
| 1465 | Ga0207695_11395915 | |||
| 1466 | Ga0207671_10433322 | |||
| 1467 | Ga0207663_10279936 | |||
| 1468 | Ga0207660_10038187 | |||
| 1469 | Ga0207662_10057705 | |||
| 1470 | Ga0207662_10203639 | |||
| 1471 | Ga0207662_10489339 | |||
| 1472 | Ga0207657_10000489 | |||
| 1473 | Ga0207649_10087098 | |||
| 1474 | Ga0207649_10348314 | |||
| 1475 | Ga0207652_10024759 | |||
| 1476 | Ga0207652_10187340 | |||
| 1477 | Ga0207646_10203816 | |||
| 1478 | Ga0207646_10592876 | |||
| 1479 | Ga0207646_10802924 | |||
| 1480 | Ga0207646_11222293 | |||
| 1481 | Ga0207681_10057387 | |||
| 1482 | Ga0207681_10090798 | |||
| 1483 | Ga0207681_10119098 | |||
| 1484 | Ga0207681_10247764 | |||
| 1485 | Ga0207681_10281926 | |||
| 1486 | Ga0207681_10972118 | |||
| 1487 | Ga0207694_10455689 | |||
| 1488 | Ga0207650_11019739 | |||
| 1489 | Ga0207650_11211821 | |||
| 1490 | Ga0207659_10157078 | |||
| 1491 | Ga0207659_10484111 | |||
| 1492 | Ga0207659_10528054 | |||
| 1493 | Ga0207659_10580608 | |||
| 1494 | Ga0207659_10794357 | |||
| 1495 | Ga0207687_10084438 | |||
| 1496 | Ga0207687_10164797 | |||
| 1497 | Ga0207687_10272219 | |||
| 1498 | Ga0207700_10008186 | |||
| 1499 | Ga0207644_10283851 | |||
| 1500 | Ga0207644_10334324 | |||
| 1501 | Ga0207690_10177567 | |||
| 1502 | Ga0207706_10175950 | |||
| 1503 | Ga0207706_10219852 | |||
| 1504 | Ga0207706_10340871 | |||
| 1505 | Ga0207706_10529809 | |||
| 1506 | Ga0207686_10002741 | |||
| 1507 | Ga0207686_10162219 | |||
| 1508 | Ga0207686_10454712 | |||
| 1509 | Ga0207686_10759403 | |||
| 1510 | Ga0207686_11161580 | |||
| 1511 | Ga0207709_10013009 | |||
| 1512 | Ga0207709_10072344 | |||
| 1513 | Ga0207709_10326916 | |||
| 1514 | Ga0207670_10079013 | |||
| 1515 | Ga0207670_10557166 | |||
| 1516 | Ga0207670_10730858 | |||
| 1517 | Ga0207670_11033327 | |||
| 1518 | Ga0207669_10042565 | |||
| 1519 | Ga0207669_10060200 | |||
| 1520 | Ga0207669_10315587 | |||
| 1521 | Ga0207669_10441655 | |||
| 1522 | Ga0207704_10203266 | |||
| 1523 | Ga0207704_10230660 | |||
| 1524 | Ga0207704_10936278 | |||
| 1525 | Ga0207704_11572477 | |||
| 1526 | Ga0207665_10780964 | |||
| 1527 | Ga0207691_10028678 | |||
| 1528 | Ga0207691_10254075 | |||
| 1529 | Ga0207691_10474046 | |||
| 1530 | Ga0207691_10927894 | |||
| 1531 | Ga0207711_10027871 | |||
| 1532 | Ga0207711_10049925 | |||
| 1533 | Ga0207711_10062119 | |||
| 1534 | Ga0207711_10115715 | |||
| 1535 | Ga0207711_10164554 | |||
| 1536 | Ga0207711_10230211 | |||
| 1537 | Ga0207711_11154601 | |||
| 1538 | Ga0207689_10033103 | |||
| 1539 | Ga0207689_10069887 | |||
| 1540 | Ga0207689_10326895 | |||
| 1541 | Ga0207661_10028809 | |||
| 1542 | Ga0207661_10589381 | |||
| 1543 | Ga0207661_10865976 | |||
| 1544 | Ga0207679_10054644 | |||
| 1545 | Ga0207679_10063933 | |||
| 1546 | Ga0207679_10699364 | |||
| 1547 | Ga0207679_10857503 | |||
| 1548 | Ga0207667_10014648 | |||
| 1549 | Ga0207667_10237154 | |||
| 1550 | Ga0207667_10561666 | |||
| 1551 | Ga0207651_10259042 | |||
| 1552 | Ga0207651_10388758 | |||
| 1553 | Ga0207651_10445961 | |||
| 1554 | Ga0207651_11138943 | |||
| 1555 | Ga0207712_10075629 | |||
| 1556 | Ga0207712_10188076 | |||
| 1557 | Ga0207712_10572332 | |||
| 1558 | Ga0207712_10690276 | |||
| 1559 | Ga0207712_10916190 | |||
| 1560 | Ga0207668_10083109 | |||
| 1561 | Ga0207668_10217751 | |||
| 1562 | Ga0207640_10004577 | |||
| 1563 | Ga0207640_10010018 | |||
| 1564 | Ga0207640_10440786 | |||
| 1565 | Ga0207658_10300199 | |||
| 1566 | Ga0207658_10390827 | |||
| 1567 | Ga0207677_10051231 | |||
| 1568 | Ga0207677_10084337 | |||
| 1569 | Ga0207677_10155187 | |||
| 1570 | Ga0207677_10801347 | |||
| 1571 | Ga0207677_10857256 | |||
| 1572 | Ga0207677_11129927 | |||
| 1573 | Ga0207677_11775481 | |||
| 1574 | Ga0207703_10007066 | |||
| 1575 | Ga0207703_10020073 | |||
| 1576 | Ga0207703_10049524 | |||
| 1577 | Ga0207703_10080823 | |||
| 1578 | Ga0207703_10209948 | |||
| 1579 | Ga0207703_10281224 | |||
| 1580 | Ga0207703_10505504 | |||
| 1581 | Ga0207703_11429516 | |||
| 1582 | Ga0207703_11512413 | |||
| 1583 | Ga0207639_10699112 | |||
| 1584 | Ga0207639_11253709 | |||
| 1585 | Ga0207708_10004038 | |||
| 1586 | Ga0207708_10019580 | |||
| 1587 | Ga0207708_10071341 | |||
| 1588 | Ga0207708_11094444 | |||
| 1589 | Ga0207702_10391965 | |||
| 1590 | Ga0207702_10651134 | |||
| 1591 | Ga0207641_10002698 | |||
| 1592 | Ga0207641_10060911 | |||
| 1593 | Ga0207641_10068431 | |||
| 1594 | Ga0207641_10150518 | |||
| 1595 | Ga0207641_10363313 | |||
| 1596 | Ga0207641_10865708 | |||
| 1597 | Ga0207648_10012103 | |||
| 1598 | Ga0207648_10185956 | |||
| 1599 | Ga0207648_10262833 | |||
| 1600 | Ga0207648_10279887 | |||
| 1601 | Ga0207648_10661927 | |||
| 1602 | Ga0207648_11547802 | |||
| 1603 | Ga0207676_10006464 | |||
| 1604 | Ga0207676_10091796 | |||
| 1605 | Ga0207676_10106338 | |||
| 1606 | Ga0207676_10166192 | |||
| 1607 | Ga0207676_10208453 | |||
| 1608 | Ga0207674_10228166 | |||
| 1609 | Ga0207674_10231774 | |||
| 1610 | Ga0207674_10669298 | |||
| 1611 | Ga0207675_100020610 | |||
| 1612 | Ga0207675_100182632 | |||
| 1613 | Ga0207675_100291292 | |||
| 1614 | Ga0207675_100554882 | |||
| 1615 | Ga0207675_100642165 | |||
| 1616 | Ga0207675_100833424 | |||
| 1617 | Ga0207675_101959617 | |||
| 1618 | Ga0207675_102488125 | |||
| 1619 | Ga0207683_10074230 | |||
| 1620 | Ga0207683_10077685 | |||
| 1621 | Ga0207683_10172836 | |||
| 1622 | Ga0207698_12011170 | |||
| 1623 | Ga0207428_10020520 | |||
| 1624 | Ga0207428_10033173 | |||
| 1625 | Ga0207428_10124057 | |||
| 1626 | Ga0268266_10017449 | |||
| 1627 | Ga0268266_10155676 | |||
| 1628 | Ga0268266_10358039 | |||
| 1629 | Ga0268266_10367120 | |||
| 1630 | Ga0268266_10431813 | |||
| 1631 | Ga0268266_10766556 | |||
| 1632 | Ga0268265_10029803 | |||
| 1633 | Ga0268265_10039292 | |||
| 1634 | Ga0268265_10150452 | |||
| 1635 | Ga0268265_10169551 | |||
| 1636 | Ga0268265_10450100 | |||
| 1637 | Ga0268265_10614972 | |||
| 1638 | Ga0268265_11458296 | |||
| 1639 | Ga0268265_11790188 | |||
| 1640 | Ga0268264_10010441 | |||
| 1641 | Ga0268264_10128496 | |||
| 1642 | Ga0268264_10148973 | |||
| 1643 | Ga0268264_10254213 | |||
| 1644 | Ga0268264_10842490 | |||
| 1645 | Ga0268264_11112698 | |||
| 1646 | Ga0268264_11831410 | |||
| 1647 | Ga0307511_10213100 | |||
| 1648 | Ga0265332_10177359 | |||
| 1649 | Ga0265332_10278009 | |||
| 1650 | Ga0265328_10103350 | |||
| 1651 | Ga0265328_10305414 | |||
| 1652 | Ga0307408_101443714 | |||
| 1653 | Ga0265314_10032705 | |||
| 1654 | Ga0307416_101405385 | |||
| 1655 | Ga0373930_0003233 | |||
| 1656 | Ga0373958_0000583 | |||
| 1657 | Ga0373958_0094093 | |||
| 1658 | Ga0373959_0003459 | |||
| 1659 | Ga0373938_0001307 | |||
| 1660 | Ga0373928_0002173 | |||
| 1661 | Ga0373929_0001258 | |||
| 1662 | Ga0373929_0037540 | |||
| 1663 | Ga0373934_0092016 | |||
| 1664 | Ga0373949_0002582 | |||
| 1665 | Ga0373951_0000435 | |||
| 1666 | Ga0373952_0001680 | |||
| 1667 | Ga0373952_0028051 | |||
| 1668 | Ga0373923_0377908 | |||
| 1669 | Ga0373923_0657788 | |||
| 1670 | Ga0373932_0000144 | |||
| 1671 | Ga0373939_0001957 | |||
| 1672 | Ga0373939_0238142 | |||
| 1673 | Ga0373939_0253235 | |||
| 1674 | Ga0373941_0001787 | |||
| 1675 | Ga0373941_0005149 | |||
| 1676 | Ga0373941_0015740 | |||
| 1677 | Ga0373941_0261612 | |||
| 1678 | Ga0373945_0114571 | |||
| 1679 | Ga0373953_0188833 | |||
| 1680 | Ga0373954_0097240 | |||
| 1681 | Ga0373954_0285217 | |||
| 1682 | Ga0373956_0039249 | |||
| 1683 | Ga0373956_0058807 | |||
| 1684 | Ga0373960_0002303 | |||
| 1685 | Ga0373943_0008530 | |||
| 1686 | Ga0373943_0098159 | |||
| 1687 | Ga0373943_0830832 | |||
| 1688 | Ga0373946_0002505 | |||
| 1689 | Ga0373946_0278500 | |||
| 1690 | Ga0373955_0097915 | |||
| 1691 | Ga0373955_0107349 | |||
| 1692 | Ga0373955_0585100 | |||
| 1693 | Ga0373942_0000163 | |||
| 1694 | Ga0373961_0000863 | |||
| 1695 | Ga0373961_0072398 | |||
| 1696 | Ga0373961_0131173 | |||
| 1697 | Ga0373962_0000442 | |||
| 1698 | Ga0373962_0231084 | |||
| 1699 | Ga0373924_0067235 | |||
| 1700 | Ga0373931_0771369 | |||
| 1701 | Ga0373935_0031073 | |||
| 1702 | Ga0373935_0666785 | |||
| 1703 | Ga0373927_0102927 | |||
| 1704 | Ga0373927_0150646 | |||
| 1705 | Ga0373927_0327787 | |||
| 1706 | Ga0373933_0046024 | |||
| 1707 | Ga0373933_0233783 | |||
| 1708 | Ga0373947_0003502 | |||
| 1709 | Ga0373947_0092719 | |||
| 1710 | Ga0373947_0283973 | |||
| 1711 | Ga0373947_0286830 | |||
| 1712 | Ga0373947_0395764 | |||
| 1713 | Ga0373947_0635555 | |||
| 1714 | Ga0373937_0062556 | |||
| 1715 | Ga0373937_0110117 | |||
| 1716 | Ga0373937_0121942 | |||
| 1717 | Ga0373937_0236123 | |||
| 1718 | Ga0373937_0338010 | |||
| 1719 | Ga0373937_0595180 | |||
| 1720 | Ga0373937_1343281 | |||
| 1721 | Ga0373925_0066673 | |||
| 1722 | Ga0373925_0132539 | |||
| 1723 | Ga0373925_0318550 | |||
| 1724 | Ga0373925_0380091 | |||
| 1725 | Ga0373925_0564668 | |||
| 1726 | Ga0373925_1349197 | |||
| 1727 | Ga0395898_1544047 | |||
| 1728 | Ga0395905_1767868 | |||
| 1729 | Ga0436365_1388943 | |||
| 1730 | Ga0451802_0423297 | |||
| 1731 | Ga0439441_111997 | |||
| 1732 | Ga0439435_0012171 | |||
| 1733 | Ga0466963_0218031 | |||
| 1734 | Ga0466957_0822769 | |||
| 1735 | Ga0451576_0680206 | |||
| 1736 | Ga0451576_0810082 | |||
| 1737 | Ga0451576_0820265 | |||
| 1738 | Ga0466967_0342134 | |||
| 1739 | Ga0466967_1656042 | |||
| 1740 | Ga0495592_0024179 | |||
| 1741 | Ga0495592_0552214 | |||
| 1742 | Ga0495603_0086791 | |||
| 1743 | Ga0495629_0411940 | |||
| 1744 | Ga0495651_0209551 | |||
| 1745 | Ga0495580_0084286 | |||
| 1746 | Ga0495580_0316371 | |||
| 1747 | Ga0495582_0095492 | |||
| 1748 | Ga0495582_0154950 | |||
| 1749 | Ga0495582_0470316 | |||
| 1750 | Ga0495664_0060668 | |||
| 1751 | Ga0495664_0141489 | |||
| 1752 | Ga0495608_0004074 | |||
| 1753 | Ga0495618_0152429 | |||
| 1754 | Ga0495618_0492678 | |||
| 1755 | Ga0495628_0051306 | |||
| 1756 | Ga0495628_0501915 | |||
| 1757 | Ga0495628_0741532 | |||
| 1758 | Ga0495630_0018154 | |||
| 1759 | Ga0495630_0316431 | |||
| 1760 | Ga0495642_0209817 | |||
| 1761 | Ga0495640_0497111 | |||
| 1762 | Ga0495586_0094488 | |||
| 1763 | Ga0495587_0023908 | |||
| 1764 | Ga0495598_0091370 | |||
| 1765 | Ga0495645_0003196 | |||
| 1766 | Ga0495645_0499485 | |||
| 1767 | Ga0495622_0374412 | |||
| 1768 | Ga0495667_0043893 | |||
| 1769 | Ga0495667_0450479 | |||
| 1770 | Ga0495656_0172590 | |||
| 1771 | Ga0495634_0067477 | |||
| 1772 | Ga0495635_0214989 | |||
| 1773 | Ga0495659_0077888 | |||
| 1774 | Ga0495599_0206004 | |||
| 1775 | Ga0495623_0199003 | |||
| 1776 | Ga0495646_0326599 | |||
| 1777 | Ga0495647_0139147 | |||
| 1778 | Ga0495647_0491750 | |||
| 1779 | Ga0495658_0061316 | |||
| 1780 | Ga0495658_0063577 | |||
| 1781 | Ga0495658_0127132 | |||
| 1782 | Ga0495658_0153629 | |||
| 1783 | Ga0495658_0251480 | |||
| 1784 | Ga0495669_0011196 | |||
| 1785 | Ga0495669_0103501 | |||
| 1786 | Ga0495613_0004189 | |||
| 1787 | Ga0495613_0317750 | |||
| 1788 | Ga0495600_0037792 | |||
| 1789 | Ga0495600_0175680 | |||
| 1790 | Ga0495604_0043852 | |||
| 1791 | Ga0495636_0353230 | |||
| 1792 | Ga0495674_0017759 | |||
| 1793 | Ga0495674_0479677 | |||
| 1794 | Ga0495680_0141393 | |||
| 1795 | Ga0495680_0470694 | |||
| 1796 | Ga0495680_0796297 | |||
| 1797 | Ga0495677_0324851 | |||
| 1798 | Ga0495684_0016032 | |||
| 1799 | Ga0495684_0278933 | |||
| 1800 | Ga0495684_0573315 | |||
| 1801 | Ga0495602_0488060 | |||
| 1802 | Ga0495615_0239296 | |||
| 1803 | Ga0496100_0069575 | |||
| 1804 | Ga0496100_0222789 | |||
| 1805 | Ga0496101_0000830 | |||
| 1806 | Ga0496102_0230493 | |||
| 1807 | Ga0496102_0295365 | |||
| 1808 | Ga0496102_0849409 | |||
| 1809 | Ga0496102_1157241 | |||
| 1810 | Ga0496102_1559372 | |||
| 1811 | Ga0496104_0006932 | |||
| 1812 | Ga0496104_0041811 | |||
| 1813 | Ga0496104_0067011 | |||
| 1814 | Ga0496104_0076320 | |||
| 1815 | Ga0496104_0167975 | |||
| 1816 | Ga0496104_0277524 | |||
| 1817 | Ga0496104_0425838 | |||
| 1818 | Ga0496104_0855719 | |||
| 1819 | Ga0496104_0882001 | |||
| 1820 | Ga0496104_1701338 | |||
| 1821 | Ga0496106_0117938 | |||
| 1822 | Ga0496106_0197281 | |||
| 1823 | Ga0496106_0312867 | |||
| 1824 | Ga0496107_0290486 | |||
| 1825 | Ga0496108_0036029 | |||
| 1826 | Ga0496108_0304210 | |||
| 1827 | Ga0496108_0326505 | |||
| 1828 | Ga0496108_1207854 | |||
| 1829 | Ga0496109_0397924 | |||
| 1830 | Ga0496110_0040200 | |||
| 1831 | Ga0496110_0111618 | |||
| 1832 | Ga0496111_0047559 | |||
| 1833 | Ga0496111_0932724 | |||
| 1834 | Ga0496111_1206471 | |||
| 1835 | Ga0496112_0006817 | |||
| 1836 | Ga0496112_0055550 | |||
| 1837 | Ga0496112_0175963 | |||
| 1838 | Ga0496112_0223638 | |||
| 1839 | Ga0496112_0548100 | |||
| 1840 | Ga0496112_1308332 | |||
| 1841 | Ga0496113_0002074 | |||
| 1842 | Ga0496113_0288905 | |||
| 1843 | Ga0496114_0028582 | |||
| 1844 | Ga0496114_0035672 | |||
| 1845 | Ga0496114_0468282 | |||
| 1846 | Ga0496114_0653409 | |||
| 1847 | Ga0496114_1494799 | |||
| 1848 | Ga0496115_0079979 | |||
| 1849 | Ga0501033_0587576 | |||
| 1850 | Ga0501034_0105145 | |||
| 1851 | Ga0501040_0194504 | |||
| 1852 | Ga0501043_0067616 | |||
| 1853 | Ga0501047_0025626 | |||
| 1854 | Ga0501047_0147278 | |||
| 1855 | Ga0501048_0655712 | |||
| 1856 | Ga0501073_0203228 | |||
| 1857 | Ga0501079_0612018 | |||
| 1858 | Ga0501083_0169387 | |||
| 1859 | Ga0501083_0251005 | |||
| 1860 | Ga0501044_0017983 | |||
| 1861 | nmdc:mga05p37_1026191_c1 | |||
| 1862 | nmdc:mga05p37_104043_c2 | |||
| 1863 | nmdc:mga05p37_141928_c1 | |||
| 1864 | nmdc:mga05p37_15195_c1 | |||
| 1865 | nmdc:mga05p37_212237_c1 | |||
| 1866 | nmdc:mga05p37_22345_c1 | |||
| 1867 | nmdc:mga05p37_2445_c1 | |||
| 1868 | nmdc:mga05p37_26793_c1 | |||
| 1869 | nmdc:mga05p37_300236_c1 | |||
| 1870 | nmdc:mga05p37_55115_c2 | |||
| 1871 | nmdc:mga05p37_70171_c1 | |||
| 1872 | nmdc:mga05p37_79243_c1 | |||
| 1873 | nmdc:mga05p37_8679_c1 | |||
| 1874 | nmdc:mga09592_1061329_c1 | |||
| 1875 | nmdc:mga09592_57903_c1 | |||
| 1876 | nmdc:mga09592_720733_c1 | |||
| 1877 | nmdc:mga09592_803475_c1 | |||
| 1878 | nmdc:mga09592_846854_c1 | |||
| 1879 | nmdc:mga06r32_353903_c1 | |||
| 1880 | nmdc:mga08y16_10551_c1 | |||
| 1881 | nmdc:mga08y16_179180_c1 | |||
| 1882 | nmdc:mga08y16_18326_c1 | |||
| 1883 | nmdc:mga08y16_19245_c1 | |||
| 1884 | nmdc:mga0n895_12013_c1 | |||
| 1885 | nmdc:mga0n895_131955_c1 | |||
| 1886 | nmdc:mga0n895_141_c1 | |||
| 1887 | nmdc:mga0n895_220120_c1 | |||
| 1888 | nmdc:mga0n895_2213967_c1 | |||
| 1889 | nmdc:mga0n895_484250_c1 | |||
| 1890 | nmdc:mga0n895_7789_c1 | |||
| 1891 | nmdc:mga0n895_880199_c1 | |||
| 1892 | nmdc:mga0rr50_13152_c1 | |||
| 1893 | nmdc:mga0rr50_1_c1 | |||
| 1894 | nmdc:mga0rr50_54258_c1 | |||
| 1895 | nmdc:mga0rr50_67237_c1 | |||
| 1896 | nmdc:mga0rr50_743880_c1 | |||
| 1897 | nmdc:mga0rr50_91466_c1 | |||
| 1898 | nmdc:mga0rr50_9174_c1 | |||
| 1899 | nmdc:mga0rr50_94174_c2 | |||
| 1900 | nmdc:mga08x19_13318_c1 | |||
| 1901 | nmdc:mga08x19_133546_c1 | |||
| 1902 | nmdc:mga08x19_234209_c1 | |||
| 1903 | nmdc:mga08x19_47168_c1 | |||
| 1904 | nmdc:mga08x19_507845_c1 | |||
| 1905 | nmdc:mga08x19_61999_c1 | |||
| 1906 | nmdc:mga08x19_8030_c1 | |||
| 1907 | nmdc:mga08x19_88190_c1 | |||
| 1908 | nmdc:mga08x19_92_c1 | |||
| 1909 | nmdc:mga0a205_132096_c1 | |||
| 1910 | nmdc:mga0a205_1463535_c1 | |||
| 1911 | nmdc:mga0a205_147006_c1 | |||
| 1912 | nmdc:mga0a205_148542_c1 | |||
| 1913 | nmdc:mga0a205_463756_c1 | |||
| 1914 | nmdc:mga0a205_489849_c1 | |||
| 1915 | nmdc:mga0a205_84754_c1 | |||
| 1916 | Ga0495601_0003358 | |||
| 1917 | Ga0495601_0034147 | |||
| 1918 | Ga0495601_0090234 | |||
| 1919 | Ga0495601_0216205 | |||
| 1920 | Ga0495595_0014239 | |||
| 1921 | Ga0495595_0054476 | |||
| 1922 | Ga0495619_0003172 | |||
| 1923 | Ga0495619_0132127 | |||
| 1924 | Ga0495619_0166321 | |||
| 1925 | Ga0495619_0173344 | |||
| 1926 | Ga0495619_0737235 | |||
| 1927 | Ga0495619_0863685 | |||
| 1928 | Ga0500658_0027878 | |||
| 1929 | Ga0501084_0357429 | |||
| 1930 | Ga0501082_0038319 | |||
| 1931 | Ga0501082_0515728 | |||
| 1932 | Ga0501082_0771975 | |||
| 1933 | Ga0501082_1108991 | |||
| 1934 | Ga0530510_0792266 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gku-assembly2.cif.gz_C-2 | crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 | 0.7936 | 6 | 81 |
| 2fph-assembly1.cif.gz_X | cell division protein ylmh from streptococcus pneumoniae | 0.793 | 84 | 145 |
| 2a1s-assembly1.cif.gz_A | crystal structure of native parn nuclease domain | 0.7747 | 84 | 146 |
| 2cpm-assembly1.cif.gz_A | solution structure of the r3h domain of human sperm-associated antigen 7 | 0.7699 | 85 | 147 |
| 1wh9-assembly1.cif.gz_A | solution structure of the kh domain of human ribosomal protein s3 | 0.759 | 6 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53598_123_187_3.30.1370.50 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain | 0.9799 | 85 | 146 | 3.30.1370.50 |
| 3gkuB03 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain | 0.9311 | 80 | 146 | 3.30.1370.50 |
| af_O53598_123_187_3.30.1370.50 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain | 0.9217 | 85 | 146 | 3.30.1370.50 |
| 3gkuB03 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain | 0.8932 | 80 | 146 | 3.30.1370.50 |
| af_A0A1D6NC26_56_123_3.30.1370.160 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.8771 | 84 | 145 | 3.30.1370.160 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7ZNT6-F1-model_v4 | Uncharacterized protein | 0.9672 | 5 | 76 |
|
| AF-X1RQD4-F1-model_v4 | R3H domain-containing protein | 0.9655 | 87 | 148 |
GO:0003723
|
| AF-A0A350TK17-F1-model_v4 | R3H domain-containing protein | 0.9627 | 77 | 146 |
GO:0003723
|
| AF-X1V4P2-F1-model_v4 | R3H domain-containing protein | 0.9582 | 76 | 148 |
GO:0003723
|
| AF-A0A2V8TF78-F1-model_v4 | R3H domain-containing protein | 0.9577 | 77 | 148 |
GO:0003723
|