F486895

General Info

Members Datasets Scaffolds Average Seq Length
962 294 961 211

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0089392|Ga0466959_0089392_1525_2199
Length 224
Sequence LNFFHTRECESVRREMQTFLAQHGWEIARLTFEHLWLTVSAMLLAAAIALPLGIVLTRRERLAKPVIGFANIVQTVPSLALFGLLLPVPWLGENAARLAIIALTGYALLPILRNTYTGIRNVDAALVDVADAMGMTANQRLVKVELPLAASVILAGLRTATVTCIGIATIAAAIGAGGLGELIFRGVASVDNGLVLAGAVPAALLALIADGVLGWLEKRMVVRR

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.1
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 2.49
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10022170 3300003320 Bacteria 1728
2 rootH2_10078606 3300003320 Bacteria 1378
3 rootH2_10092033 3300003320 Bacteria 1369
4 rootL2_10222464 3300003322 Bacteria 3413
5 rootH1_10121456 3300003323 Bacteria 1271
6 Ga0070658_10000010 3300005327 Bacteria 297212
7 Ga0070658_10003514 3300005327 Bacteria 12882
8 Ga0070658_10010438 3300005327 Bacteria 7447
9 Ga0070658_10050708 3300005327 Bacteria 3364
10 Ga0070658_10302683 3300005327 Bacteria 1363
11 Ga0070658_10979840 3300005327 Bacteria 735
12 Ga0070676_10040428 3300005328 Bacteria 2700
13 Ga0070683_100011583 3300005329 Bacteria 7631
14 Ga0070683_100024722 3300005329 Bacteria 5384
15 Ga0070683_100034144 3300005329 Bacteria 4645
16 Ga0070683_100068107 3300005329 Bacteria 3316
17 Ga0070683_100106475 3300005329 Bacteria 2644
18 Ga0070683_100851797 3300005329 Unclassified 874
19 Ga0070670_100001274 3300005331 Bacteria 20087
20 Ga0070670_100001705 3300005331 Bacteria 17895
21 Ga0070670_100858554 3300005331 Unclassified 821
22 Ga0068869_100001599 3300005334 Bacteria 13473
23 Ga0068869_100131161 3300005334 Bacteria 1926
24 Ga0070666_10061935 3300005335 Bacteria 2534
25 Ga0070666_10062367 3300005335 Bacteria 2525
26 Ga0070666_10220485 3300005335 Bacteria 1338
27 Ga0070680_100194163 3300005336 Bacteria 1711
28 Ga0068868_100000384 3300005338 Bacteria 30189
29 Ga0068868_100001694 3300005338 Bacteria 15095
30 Ga0068868_100008205 3300005338 Bacteria 7472
31 Ga0068868_100298732 3300005338 Bacteria 1367
32 Ga0070660_100029314 3300005339 Bacteria 4124
33 Ga0070660_100038722 3300005339 Bacteria 3620
34 Ga0070660_100076594 3300005339 Bacteria 2620
35 Ga0070660_100436512 3300005339 Bacteria 1085
36 Ga0070689_100034560 3300005340 Bacteria 3857
37 Ga0070691_10265739 3300005341 Unclassified 925
38 Ga0070691_10386215 3300005341 Bacteria 786
39 Ga0070661_100004625 3300005344 Bacteria 9472
40 Ga0070661_100005501 3300005344 Bacteria 8738
41 Ga0070661_100014750 3300005344 Bacteria 5510
42 Ga0070661_100064130 3300005344 Bacteria 2699
43 Ga0070661_100244713 3300005344 Bacteria 1382
44 Ga0070661_100405992 3300005344 Bacteria 1078
45 Ga0070668_100047969 3300005347 Bacteria 3284
46 Ga0070675_100043957 3300005354 Bacteria 3653
47 Ga0070675_100197924 3300005354 Bacteria 1743
48 Ga0070671_100002611 3300005355 Bacteria 13953
49 Ga0070671_100030005 3300005355 Bacteria 4486
50 Ga0070671_100219338 3300005355 Bacteria 1613
51 Ga0070673_100281095 3300005364 Bacteria 1460
52 Ga0070659_100007414 3300005366 Bacteria 7967
53 Ga0070659_100053569 3300005366 Bacteria 3175
54 Ga0070659_100077667 3300005366 Bacteria 2648
55 Ga0070659_100175670 3300005366 Bacteria 1756
56 Ga0070667_100002702 3300005367 Bacteria 15356
57 Ga0070667_100076833 3300005367 Bacteria 2851
58 Ga0070667_100311390 3300005367 Bacteria 1419
59 Ga0070714_100033734 3300005435 Bacteria 4282
60 Ga0070714_100047543 3300005435 Bacteria 3646
61 Ga0070714_100097646 3300005435 Bacteria 2583
62 Ga0070714_100231268 3300005435 Bacteria 1703
63 Ga0070714_100273686 3300005435 Bacteria 1566
64 Ga0070714_100388004 3300005435 Bacteria 1318
65 Ga0070714_100581607 3300005435 Bacteria 1074
66 Ga0070714_100920693 3300005435 Bacteria 849
67 Ga0070713_100011389 3300005436 Bacteria 6477
68 Ga0070713_100024689 3300005436 Bacteria 4688
69 Ga0070713_100234953 3300005436 Bacteria 1668
70 Ga0070713_100312439 3300005436 Bacteria 1449
71 Ga0070713_100373804 3300005436 Bacteria 1326
72 Ga0070713_100754837 3300005436 Unclassified 931
73 Ga0070710_10178710 3300005437 Bacteria 1327
74 Ga0070710_10188316 3300005437 Unclassified 1296
75 Ga0070711_100035273 3300005439 Bacteria 3343
76 Ga0070711_100427038 3300005439 Unclassified 1081
77 Ga0070711_100636126 3300005439 Unclassified 893
78 Ga0070708_100024357 3300005445 Bacteria 5162
79 Ga0070708_100065226 3300005445 Bacteria 3265
80 Ga0070663_100049150 3300005455 Bacteria 2994
81 Ga0070663_100080998 3300005455 Bacteria 2386
82 Ga0070663_100314997 3300005455 Bacteria 1256
83 Ga0070662_100327296 3300005457 Bacteria 1251
84 Ga0070681_10001443 3300005458 Bacteria 20931
85 Ga0070681_10013740 3300005458 Bacteria 8060
86 Ga0070681_10020502 3300005458 Bacteria 6625
87 Ga0070681_10428868 3300005458 Bacteria 1234
88 Ga0070706_100047551 3300005467 Bacteria 3959
89 Ga0070706_100136524 3300005467 Unclassified 2289
90 Ga0070707_100182918 3300005468 Bacteria 2043
91 Ga0070699_100027551 3300005518 Bacteria 4900
92 Ga0070679_100001140 3300005530 Bacteria 23233
93 Ga0070679_100005691 3300005530 Bacteria 11555
94 Ga0070679_100082623 3300005530 Bacteria 3202
95 Ga0070679_100269966 3300005530 Bacteria 1655
96 Ga0070684_100000393 3300005535 Bacteria 30209
97 Ga0070684_100000769 3300005535 Bacteria 22213
98 Ga0070684_100015832 3300005535 Bacteria 6153
99 Ga0070684_100019577 3300005535 Bacteria 5601
100 Ga0070684_100026968 3300005535 Bacteria 4844
101 Ga0070684_100032824 3300005535 Unclassified 4429
102 Ga0070684_100154968 3300005535 Bacteria 2077
103 Ga0070697_100400202 3300005536 Bacteria 1191
104 Ga0068853_100000123 3300005539 Bacteria 51593
105 Ga0068853_100008997 3300005539 Bacteria 8044
106 Ga0068853_100020915 3300005539 Bacteria 5445
107 Ga0068853_100023232 3300005539 Bacteria 5188
108 Ga0068853_100033117 3300005539 Bacteria 4383
109 Ga0068853_100089610 3300005539 Bacteria 2702
110 Ga0068853_100133502 3300005539 Unclassified 2224
111 Ga0068853_101036107 3300005539 Bacteria 790
112 Ga0070696_100034275 3300005546 Bacteria 3492
113 Ga0070693_100046588 3300005547 Bacteria 2463
114 Ga0070693_100060058 3300005547 Bacteria 2206
115 Ga0070693_100276757 3300005547 Bacteria 1122
116 Ga0070665_100002508 3300005548 Bacteria 20184
117 Ga0070665_100026988 3300005548 Bacteria 5782
118 Ga0070665_100081388 3300005548 Bacteria 3244
119 Ga0070665_100132681 3300005548 Bacteria 2492
120 Ga0070665_100192455 3300005548 Bacteria 2040
121 Ga0068855_100000412 3300005563 Bacteria 52997
122 Ga0068855_100000425 3300005563 Bacteria 52146
123 Ga0068855_100000966 3300005563 Bacteria 35784
124 Ga0068855_100001407 3300005563 Bacteria 29867
125 Ga0068855_100001596 3300005563 Bacteria 28475
126 Ga0068855_100003897 3300005563 Bacteria 18220
127 Ga0068855_100019038 3300005563 Bacteria 8252
128 Ga0068855_100019320 3300005563 Bacteria 8187
129 Ga0068855_100035148 3300005563 Bacteria 5970
130 Ga0068855_100042079 3300005563 Bacteria 5413
131 Ga0068855_100051395 3300005563 Bacteria 4855
132 Ga0068855_100075410 3300005563 Bacteria 3916
133 Ga0068855_100092126 3300005563 Bacteria 3495
134 Ga0068855_100101126 3300005563 Bacteria 3319
135 Ga0068855_100160284 3300005563 Bacteria 2554
136 Ga0068855_100162092 3300005563 Bacteria 2537
137 Ga0068855_100200958 3300005563 Bacteria 2243
138 Ga0068855_100488353 3300005563 Bacteria 1340
139 Ga0070664_100003184 3300005564 Bacteria 13261
140 Ga0070664_100048849 3300005564 Bacteria 3577
141 Ga0070664_100452389 3300005564 Bacteria 1179
142 Ga0068857_100000552 3300005577 Bacteria 27305
143 Ga0068857_100003436 3300005577 Bacteria 13222
144 Ga0068857_100009010 3300005577 Bacteria 8652
145 Ga0068857_100019504 3300005577 Bacteria 5956
146 Ga0068857_100025005 3300005577 Bacteria 5260
147 Ga0068857_100034840 3300005577 Bacteria 4454
148 Ga0068857_100067393 3300005577 Bacteria 3186
149 Ga0068857_100117340 3300005577 Bacteria 2395
150 Ga0068857_100233139 3300005577 Unclassified 1684
151 Ga0068854_100000691 3300005578 Bacteria 20115
152 Ga0068854_100000859 3300005578 Bacteria 18205
153 Ga0068854_100012781 3300005578 Bacteria 5497
154 Ga0068854_100012901 3300005578 Bacteria 5473
155 Ga0068854_100054568 3300005578 Bacteria 2875
156 Ga0068854_100078857 3300005578 Bacteria 2427
157 Ga0068854_100205584 3300005578 Unclassified 1550
158 Ga0068856_100000670 3300005614 Bacteria 37158
159 Ga0068856_100000708 3300005614 Bacteria 36263
160 Ga0068856_100001047 3300005614 Bacteria 29315
161 Ga0068856_100002586 3300005614 Bacteria 18634
162 Ga0068856_100003077 3300005614 Bacteria 17032
163 Ga0068856_100006375 3300005614 Bacteria 11576
164 Ga0068856_100016682 3300005614 Bacteria 7113
165 Ga0068856_100094952 3300005614 Bacteria 2969
166 Ga0068856_100124377 3300005614 Bacteria 2582
167 Ga0068856_100159592 3300005614 Bacteria 2265
168 Ga0068856_100162039 3300005614 Bacteria 2247
169 Ga0068856_100190147 3300005614 Bacteria 2067
170 Ga0068856_100223046 3300005614 Bacteria 1900
171 Ga0068856_100664591 3300005614 Bacteria 1062
172 Ga0068856_100896413 3300005614 Bacteria 906
173 Ga0068852_100000247 3300005616 Bacteria 36734
174 Ga0068852_100000293 3300005616 Bacteria 33519
175 Ga0068852_100043099 3300005616 Bacteria 3826
176 Ga0068852_100063954 3300005616 Bacteria 3205
177 Ga0068852_100066057 3300005616 Bacteria 3158
178 Ga0068852_100071070 3300005616 Bacteria 3055
179 Ga0068852_100327143 3300005616 Bacteria 1490
180 Ga0068852_100724848 3300005616 Bacteria 1005
181 Ga0068859_100001626 3300005617 Bacteria 22974
182 Ga0068859_100026677 3300005617 Bacteria 5794
183 Ga0068864_100001344 3300005618 Bacteria 20434
184 Ga0068864_100067427 3300005618 Bacteria 3107
185 Ga0068866_10002225 3300005718 Bacteria 8046
186 Ga0068851_10006997 3300005834 Bacteria 5173
187 Ga0068851_10029831 3300005834 Bacteria 2702
188 Ga0068851_10243866 3300005834 Bacteria 1017
189 Ga0068863_100000464 3300005841 Bacteria 41393
190 Ga0068863_100030082 3300005841 Bacteria 5187
191 Ga0068863_100106328 3300005841 Bacteria 2670
192 Ga0068863_100119671 3300005841 Bacteria 2510
193 Ga0068863_100126513 3300005841 Bacteria 2438
194 Ga0068858_100002355 3300005842 Bacteria 19092
195 Ga0068858_100002774 3300005842 Bacteria 17607
196 Ga0068858_100049520 3300005842 Bacteria 3891
197 Ga0068858_100678105 3300005842 Bacteria 1002
198 Ga0068860_100000665 3300005843 Bacteria 39791
199 Ga0068860_100052836 3300005843 Bacteria 3864
200 Ga0068860_100161410 3300005843 Bacteria 2161
201 Ga0068862_100575415 3300005844 Bacteria 1078
202 Ga0070717_10001551 3300006028 Bacteria 15935
203 Ga0070717_10004562 3300006028 Bacteria 10023
204 Ga0070717_10007251 3300006028 Bacteria 8220
205 Ga0070717_10013776 3300006028 Bacteria 6205
206 Ga0070717_10018510 3300006028 Bacteria 5439
207 Ga0070717_10043721 3300006028 Bacteria 3657
208 Ga0070717_10103048 3300006028 Bacteria 2425
209 Ga0070717_10420779 3300006028 Unclassified 1202
210 Ga0070717_10442822 3300006028 Bacteria 1170
211 Ga0070717_10542338 3300006028 Bacteria 1053
212 Ga0070717_10623614 3300006028 Unclassified 978
213 Ga0070716_100011551 3300006173 Bacteria 4448
214 Ga0070716_100034842 3300006173 Bacteria 2763
215 Ga0070712_100031742 3300006175 Bacteria 3561
216 Ga0070712_100034274 3300006175 Bacteria 3439
217 Ga0097621_100000210 3300006237 Bacteria 38363
218 Ga0097621_100000619 3300006237 Bacteria 25091
219 Ga0097621_100000983 3300006237 Bacteria 20004
220 Ga0097621_100009714 3300006237 Bacteria 6999
221 Ga0097621_100053837 3300006237 Bacteria 3280
222 Ga0097621_100116176 3300006237 Bacteria 2265
223 Ga0097621_100257477 3300006237 Bacteria 1530
224 Ga0068871_100000168 3300006358 Bacteria 43632
225 Ga0068871_100000648 3300006358 Bacteria 23911
226 Ga0068871_100000854 3300006358 Bacteria 20338
227 Ga0068871_100115495 3300006358 Bacteria 2262
228 Ga0068871_100137707 3300006358 Bacteria 2074
229 Ga0068871_100186092 3300006358 Bacteria 1787
230 Ga0075434_100018485 3300006871 Bacteria 6735
231 Ga0075434_100768232 3300006871 Bacteria 980
232 Ga0068865_100035423 3300006881 Bacteria 3356
233 Ga0075436_100017549 3300006914 Bacteria 4899
234 Ga0075436_100093913 3300006914 Bacteria 2086
235 Ga0097620_100001626 3300006931 Bacteria 22974
236 Ga0097620_100026677 3300006931 Bacteria 5794
237 Ga0075435_100017890 3300007076 Bacteria 5373
238 Ga0105240_10000002 3300009093 Bacteria 1924170
239 Ga0105240_10000187 3300009093 Bacteria 126042
240 Ga0105240_10000823 3300009093 Bacteria 56298
241 Ga0105240_10001148 3300009093 Bacteria 46340
242 Ga0105240_10002927 3300009093 Bacteria 26945
243 Ga0105240_10003423 3300009093 Bacteria 24650
244 Ga0105240_10010492 3300009093 Bacteria 13023
245 Ga0105240_10019330 3300009093 Bacteria 9103
246 Ga0105240_10031956 3300009093 Bacteria 6819
247 Ga0105240_10060070 3300009093 Bacteria 4741
248 Ga0105240_10072193 3300009093 Bacteria 4267
249 Ga0105240_10175129 3300009093 Bacteria 2537
250 Ga0105240_10237290 3300009093 Bacteria 2116
251 Ga0105240_10267562 3300009093 Bacteria 1969
252 Ga0105240_10376850 3300009093 Bacteria 1603
253 Ga0105240_10416359 3300009093 Bacteria 1511
254 Ga0105240_10438164 3300009093 Bacteria 1465
255 Ga0105240_10598803 3300009093 Bacteria 1214
256 Ga0105240_10706305 3300009093 Bacteria 1100
257 Ga0105240_10817642 3300009093 Bacteria 1008
258 Ga0105240_10864570 3300009093 Bacteria 975
259 Ga0105240_10980930 3300009093 Unclassified 905
260 Ga0105240_11160390 3300009093 Bacteria 819
261 Ga0105245_10001333 3300009098 Bacteria 22343
262 Ga0105245_10268973 3300009098 Bacteria 1662
263 Ga0105247_10003250 3300009101 Bacteria 10674
264 Ga0105247_10072259 3300009101 Bacteria 2159
265 Ga0105241_10000313 3300009174 Bacteria 36548
266 Ga0105241_10000472 3300009174 Bacteria 30432
267 Ga0105241_10000713 3300009174 Bacteria 25147
268 Ga0105241_10003700 3300009174 Bacteria 11365
269 Ga0105241_10020422 3300009174 Bacteria 4893
270 Ga0105241_10085994 3300009174 Bacteria 2472
271 Ga0105241_10160947 3300009174 Bacteria 1845
272 Ga0105241_10163278 3300009174 Bacteria 1833
273 Ga0105241_10189247 3300009174 Bacteria 1712
274 Ga0105241_10238146 3300009174 Bacteria 1537
275 Ga0105241_10432547 3300009174 Bacteria 1160
276 Ga0105242_10174177 3300009176 Bacteria 1893
277 Ga0105242_10534214 3300009176 Bacteria 1121
278 Ga0105248_10000011 3300009177 Bacteria 339183
279 Ga0105248_10002466 3300009177 Bacteria 20556
280 Ga0105248_10008351 3300009177 Bacteria 11376
281 Ga0105248_10033281 3300009177 Bacteria 5757
282 Ga0105248_10050299 3300009177 Bacteria 4674
283 Ga0105248_10166950 3300009177 Bacteria 2481
284 Ga0105248_10179988 3300009177 Bacteria 2382
285 Ga0105248_10340294 3300009177 Bacteria 1689
286 Ga0105248_10735182 3300009177 Bacteria 1113
287 Ga0105237_10067194 3300009545 Bacteria 3579
288 Ga0105237_10078521 3300009545 Bacteria 3290
289 Ga0105237_10093922 3300009545 Bacteria 2989
290 Ga0105237_10155299 3300009545 Bacteria 2285
291 Ga0105237_10223822 3300009545 Bacteria 1882
292 Ga0105237_10303193 3300009545 Bacteria 1600
293 Ga0105238_10000382 3300009551 Bacteria 47455
294 Ga0105238_10000395 3300009551 Bacteria 46439
295 Ga0105238_10002128 3300009551 Bacteria 19996
296 Ga0105238_10002691 3300009551 Bacteria 17671
297 Ga0105238_10012308 3300009551 Bacteria 8627
298 Ga0105238_10013635 3300009551 Bacteria 8207
299 Ga0105238_10030973 3300009551 Bacteria 5445
300 Ga0105238_10075332 3300009551 Bacteria 3366
301 Ga0105238_10110340 3300009551 Viruses 2731
302 Ga0105238_10337096 3300009551 Bacteria 1496
303 Ga0105238_10458228 3300009551 Bacteria 1273
304 Ga0105238_10753609 3300009551 Bacteria 988
305 Ga0105238_11358524 3300009551 Unclassified 737
306 Ga0105249_10042856 3300009553 Bacteria 4117
307 Ga0099796_10137057 3300010159 Bacteria 954
308 Ga0105239_10003401 3300010375 Bacteria 19505
309 Ga0105239_10003500 3300010375 Bacteria 19221
310 Ga0105239_10004456 3300010375 Bacteria 16740
311 Ga0105239_10063662 3300010375 Bacteria 4049
312 Ga0105239_10115591 3300010375 Bacteria 2976
313 Ga0105239_10253078 3300010375 Bacteria 1978
314 Ga0105239_10409743 3300010375 Bacteria 1535
315 Ga0105239_10461417 3300010375 Bacteria 1442
316 Ga0105239_11093413 3300010375 Bacteria 918
317 Ga0105246_10000383 3300011119 Bacteria 23588
318 Ga0105246_10080879 3300011119 Bacteria 2314
319 Ga0105246_10117939 3300011119 Bacteria 1962
320 Ga0157373_10001418 3300013100 Bacteria 18282
321 Ga0157373_10037015 3300013100 Unclassified 3501
322 Ga0157371_10158708 3300013102 Bacteria 1615
323 Ga0157371_10322006 3300013102 Bacteria 1122
324 Ga0157370_10000066 3300013104 Bacteria 113884
325 Ga0157370_10046670 3300013104 Bacteria 4153
326 Ga0157370_10054020 3300013104 Bacteria 3829
327 Ga0157370_10060804 3300013104 Bacteria 3585
328 Ga0157370_10069612 3300013104 Bacteria 3322
329 Ga0157370_10177331 3300013104 Bacteria 1981
330 Ga0157370_10184139 3300013104 Unclassified 1940
331 Ga0157370_10229304 3300013104 Bacteria 1719
332 Ga0157370_10337227 3300013104 Bacteria 1390
333 Ga0157370_10758773 3300013104 Bacteria 884
334 Ga0157369_10000188 3300013105 Bacteria 85789
335 Ga0157369_10000269 3300013105 Bacteria 69979
336 Ga0157369_10002371 3300013105 Bacteria 22639
337 Ga0157369_10006629 3300013105 Bacteria 13392
338 Ga0157369_10008084 3300013105 Bacteria 12064
339 Ga0157369_10009004 3300013105 Bacteria 11433
340 Ga0157369_10012042 3300013105 Bacteria 9820
341 Ga0157369_10019768 3300013105 Bacteria 7536
342 Ga0157369_10026507 3300013105 Bacteria 6428
343 Ga0157369_10040792 3300013105 Bacteria 5067
344 Ga0157369_10061961 3300013105 Bacteria 4031
345 Ga0157369_10070356 3300013105 Bacteria 3759
346 Ga0157369_10108941 3300013105 Bacteria 2945
347 Ga0157369_10160847 3300013105 Bacteria 2370
348 Ga0157369_10165090 3300013105 Bacteria 2336
349 Ga0157369_10168739 3300013105 Bacteria 2307
350 Ga0157369_10180658 3300013105 Bacteria 2220
351 Ga0157369_10192490 3300013105 Bacteria 2143
352 Ga0157369_10197194 3300013105 Bacteria 2114
353 Ga0157369_10492867 3300013105 Bacteria 1268
354 Ga0157369_10553764 3300013105 Bacteria 1188
355 Ga0157369_10626134 3300013105 Bacteria 1110
356 Ga0157374_10001002 3300013296 Bacteria 24438
357 Ga0157374_10001029 3300013296 Bacteria 24206
358 Ga0157374_10001270 3300013296 Bacteria 21533
359 Ga0157374_10001822 3300013296 Bacteria 17965
360 Ga0157374_10002414 3300013296 Bacteria 15768
361 Ga0157374_10004017 3300013296 Bacteria 12366
362 Ga0157374_10019906 3300013296 Bacteria 5948
363 Ga0157374_10167391 3300013296 Bacteria 2143
364 Ga0157374_10215848 3300013296 Unclassified 1882
365 Ga0157374_10456802 3300013296 Unclassified 1279
366 Ga0157374_10546199 3300013296 Bacteria 1166
367 Ga0157378_10000014 3300013297 Bacteria 144214
368 Ga0157378_10000413 3300013297 Bacteria 42040
369 Ga0157378_10001685 3300013297 Bacteria 19922
370 Ga0157378_10005384 3300013297 Bacteria 11223
371 Ga0157378_10086840 3300013297 Bacteria 2836
372 Ga0157378_10188937 3300013297 Bacteria 1942
373 Ga0163162_10002694 3300013306 Bacteria 16845
374 Ga0163162_10067477 3300013306 Bacteria 3627
375 Ga0163162_10212824 3300013306 Bacteria 2063
376 Ga0163162_10429527 3300013306 Unclassified 1453
377 Ga0163162_10528626 3300013306 Bacteria 1309
378 Ga0163162_10597309 3300013306 Bacteria 1230
379 Ga0157372_10000114 3300013307 Bacteria 85156
380 Ga0157372_10000423 3300013307 Bacteria 46475
381 Ga0157372_10000641 3300013307 Bacteria 38393
382 Ga0157372_10000661 3300013307 Bacteria 37855
383 Ga0157372_10002853 3300013307 Bacteria 18678
384 Ga0157372_10008117 3300013307 Bacteria 11165
385 Ga0157372_10009019 3300013307 Bacteria 10599
386 Ga0157372_10010339 3300013307 Bacteria 9916
387 Ga0157372_10011455 3300013307 Bacteria 9429
388 Ga0157372_10033258 3300013307 Bacteria 5661
389 Ga0157372_10064478 3300013307 Bacteria 4110
390 Ga0157372_10091771 3300013307 Bacteria 3454
391 Ga0157372_10095592 3300013307 Bacteria 3385
392 Ga0157372_10098253 3300013307 Bacteria 3340
393 Ga0157372_10167312 3300013307 Bacteria 2543
394 Ga0157372_10189400 3300013307 Bacteria 2382
395 Ga0157372_10203166 3300013307 Bacteria 2296
396 Ga0157372_10239164 3300013307 Bacteria 2106
397 Ga0157372_10244906 3300013307 Bacteria 2080
398 Ga0157372_10439875 3300013307 Bacteria 1520
399 Ga0157372_10469034 3300013307 Unclassified 1467
400 Ga0157372_10496717 3300013307 Bacteria 1423
401 Ga0157372_10520469 3300013307 Bacteria 1387
402 Ga0157372_10555192 3300013307 Bacteria 1339
403 Ga0157375_10000856 3300013308 Bacteria 26506
404 Ga0157375_10014048 3300013308 Bacteria 7143
405 Ga0163163_10000740 3300014325 Bacteria 27790
406 Ga0163163_10051723 3300014325 Bacteria 4050
407 Ga0163163_10067606 3300014325 Bacteria 3553
408 Ga0182008_10029271 3300014497 Bacteria 2783
409 Ga0157377_10112810 3300014745 Bacteria 1636
410 Ga0157379_10000286 3300014968 Bacteria 39982
411 Ga0157379_10067354 3300014968 Bacteria 3200
412 Ga0157379_10230808 3300014968 Bacteria 1677
413 Ga0157379_10254985 3300014968 Bacteria 1593
414 Ga0157379_10346069 3300014968 Bacteria 1360
415 Ga0157376_10001538 3300014969 Bacteria 15218
416 Ga0157376_10012541 3300014969 Bacteria 6294
417 Ga0157376_10017315 3300014969 Bacteria 5492
418 Ga0157376_10021412 3300014969 Bacteria 5021
419 Ga0157376_10171032 3300014969 Bacteria 1979
420 Ga0157376_10505024 3300014969 Bacteria 1189
421 Ga0182007_10119848 3300015262 Bacteria 880
422 Ga0163161_10006873 3300017792 Bacteria 7871
423 Ga0213872_10000931 3300021361 Bacteria 20615
424 Ga0213871_10071539 3300021441 Bacteria 981
425 Ga0209437_104998 3300025233 Bacteria 2290
426 Ga0209233_1001575 3300025261 Bacteria 8923
427 Ga0209233_1020793 3300025261 Bacteria 1713
428 Ga0207656_10004327 3300025321 Bacteria 4951
429 Ga0207656_10142842 3300025321 Bacteria 1129
430 Ga0207692_10208628 3300025898 Bacteria 1152
431 Ga0207710_10000299 3300025900 Bacteria 39634
432 Ga0207710_10039833 3300025900 Bacteria 2080
433 Ga0207680_10050765 3300025903 Bacteria 2477
434 Ga0207680_10157745 3300025903 Bacteria 1519
435 Ga0207647_10006183 3300025904 Bacteria 8725
436 Ga0207647_10014623 3300025904 Bacteria 5406
437 Ga0207647_10019887 3300025904 Unclassified 4509
438 Ga0207647_10108193 3300025904 Bacteria 1645
439 Ga0207645_10078412 3300025907 Bacteria 2117
440 Ga0207705_10000016 3300025909 Bacteria 377359
441 Ga0207705_10002666 3300025909 Bacteria 13676
442 Ga0207705_10004483 3300025909 Bacteria 10555
443 Ga0207705_10017169 3300025909 Bacteria 5184
444 Ga0207705_10089141 3300025909 Bacteria 2257
445 Ga0207705_10679699 3300025909 Archaea 800
446 Ga0207684_10079053 3300025910 Bacteria 2798
447 Ga0207654_10000487 3300025911 Bacteria 22716
448 Ga0207654_10001935 3300025911 Bacteria 10733
449 Ga0207654_10031632 3300025911 Bacteria 2917
450 Ga0207654_10060227 3300025911 Bacteria 2217
451 Ga0207654_10262661 3300025911 Bacteria 1161
452 Ga0207654_10433796 3300025911 Bacteria 919
453 Ga0207654_10701033 3300025911 Bacteria 727
454 Ga0207707_10000828 3300025912 Bacteria 30353
455 Ga0207707_10002913 3300025912 Bacteria 15263
456 Ga0207707_10279620 3300025912 Bacteria 1446
457 Ga0207707_10366698 3300025912 Bacteria 1239
458 Ga0207695_10000002 3300025913 Bacteria 2188391
459 Ga0207695_10000052 3300025913 Bacteria 398089
460 Ga0207695_10000108 3300025913 Bacteria 252306
461 Ga0207695_10000231 3300025913 Bacteria 148736
462 Ga0207695_10000253 3300025913 Bacteria 139044
463 Ga0207695_10000345 3300025913 Bacteria 107062
464 Ga0207695_10001120 3300025913 Bacteria 46589
465 Ga0207695_10010544 3300025913 Bacteria 11299
466 Ga0207695_10010731 3300025913 Bacteria 11178
467 Ga0207695_10067207 3300025913 Bacteria 3678
468 Ga0207695_10069887 3300025913 Bacteria 3592
469 Ga0207695_10093249 3300025913 Bacteria 3021
470 Ga0207695_10112069 3300025913 Bacteria 2707
471 Ga0207695_10118844 3300025913 Bacteria 2614
472 Ga0207695_10258125 3300025913 Bacteria 1641
473 Ga0207695_10268477 3300025913 Bacteria 1602
474 Ga0207695_10358084 3300025913 Bacteria 1346
475 Ga0207695_10709875 3300025913 Bacteria 886
476 Ga0207695_10768894 3300025913 Unclassified 843
477 Ga0207671_10000081 3300025914 Bacteria 148476
478 Ga0207671_10001179 3300025914 Bacteria 31089
479 Ga0207671_10052812 3300025914 Bacteria 3012
480 Ga0207671_10215673 3300025914 Bacteria 1502
481 Ga0207693_10013297 3300025915 Bacteria 6639
482 Ga0207693_10026428 3300025915 Bacteria 4595
483 Ga0207663_10064583 3300025916 Bacteria 2336
484 Ga0207663_10347918 3300025916 Bacteria 1121
485 Ga0207663_10508178 3300025916 Unclassified 937
486 Ga0207660_10127400 3300025917 Bacteria 1935
487 Ga0207660_10222759 3300025917 Bacteria 1481
488 Ga0207657_10026228 3300025919 Bacteria 5359
489 Ga0207657_10030564 3300025919 Bacteria 4888
490 Ga0207657_10033939 3300025919 Bacteria 4595
491 Ga0207657_10037314 3300025919 Bacteria 4341
492 Ga0207657_10121526 3300025919 Bacteria 2149
493 Ga0207657_10418146 3300025919 Unclassified 1054
494 Ga0207649_10008087 3300025920 Bacteria 5723
495 Ga0207649_10028029 3300025920 Bacteria 3313
496 Ga0207649_10238211 3300025920 Bacteria 1305
497 Ga0207649_10246164 3300025920 Bacteria 1285
498 Ga0207649_10268036 3300025920 Bacteria 1237
499 Ga0207652_10001901 3300025921 Bacteria 18089
500 Ga0207652_10093730 3300025921 Bacteria 2643
501 Ga0207652_10199093 3300025921 Bacteria 1803
502 Ga0207646_10640860 3300025922 Bacteria 952
503 Ga0207694_10000029 3300025924 Bacteria 239107
504 Ga0207694_10000313 3300025924 Bacteria 45627
505 Ga0207694_10003163 3300025924 Bacteria 13150
506 Ga0207694_10003655 3300025924 Bacteria 12182
507 Ga0207694_10003908 3300025924 Bacteria 11774
508 Ga0207694_10075919 3300025924 Bacteria 2631
509 Ga0207694_10235353 3300025924 Bacteria 1496
510 Ga0207650_10005515 3300025925 Bacteria 8632
511 Ga0207650_10037223 3300025925 Bacteria 3544
512 Ga0207650_10758464 3300025925 Unclassified 821
513 Ga0207659_10067520 3300025926 Bacteria 2597
514 Ga0207687_10013081 3300025927 Bacteria 5423
515 Ga0207687_10051593 3300025927 Bacteria 2868
516 Ga0207687_10582162 3300025927 Bacteria 942
517 Ga0207700_10006281 3300025928 Bacteria 7171
518 Ga0207700_10052594 3300025928 Bacteria 3046
519 Ga0207700_10053361 3300025928 Bacteria 3028
520 Ga0207700_10113757 3300025928 Bacteria 2182
521 Ga0207664_10046041 3300025929 Bacteria 3423
522 Ga0207664_10096601 3300025929 Bacteria 2432
523 Ga0207664_10096906 3300025929 Unclassified 2429
524 Ga0207664_10119269 3300025929 Bacteria 2205
525 Ga0207664_10187506 3300025929 Bacteria 1779
526 Ga0207664_10280196 3300025929 Bacteria 1463
527 Ga0207664_10715179 3300025929 Bacteria 901
528 Ga0207644_10003761 3300025931 Bacteria 9832
529 Ga0207644_10004213 3300025931 Bacteria 9337
530 Ga0207644_10187569 3300025931 Bacteria 1624
531 Ga0207644_10212893 3300025931 Bacteria 1529
532 Ga0207690_10001150 3300025932 Bacteria 16789
533 Ga0207690_10105845 3300025932 Bacteria 2018
534 Ga0207690_10714901 3300025932 Unclassified 824
535 Ga0207706_10089936 3300025933 Bacteria 2699
536 Ga0207706_10292990 3300025933 Bacteria 1419
537 Ga0207686_10099494 3300025934 Bacteria 1939
538 Ga0207670_10087926 3300025936 Bacteria 2190
539 Ga0207704_10006339 3300025938 Bacteria 5511
540 Ga0207704_10189902 3300025938 Bacteria 1493
541 Ga0207665_10051159 3300025939 Bacteria 2780
542 Ga0207711_10000028 3300025941 Bacteria 214107
543 Ga0207711_10002491 3300025941 Bacteria 16436
544 Ga0207711_10022828 3300025941 Bacteria 5235
545 Ga0207711_10073094 3300025941 Bacteria 2980
546 Ga0207711_10150869 3300025941 Bacteria 2097
547 Ga0207711_11033857 3300025941 Unclassified 761
548 Ga0207689_10003619 3300025942 Bacteria 14125
549 Ga0207689_10021816 3300025942 Bacteria 5385
550 Ga0207689_10026241 3300025942 Bacteria 4878
551 Ga0207661_10000229 3300025944 Bacteria 36779
552 Ga0207661_10036017 3300025944 Bacteria 3860
553 Ga0207661_10055494 3300025944 Bacteria 3178
554 Ga0207661_10079743 3300025944 Bacteria 2699
555 Ga0207661_10154510 3300025944 Bacteria 1986
556 Ga0207661_10320839 3300025944 Bacteria 1392
557 Ga0207679_10010827 3300025945 Bacteria 5879
558 Ga0207679_10041807 3300025945 Bacteria 3290
559 Ga0207679_10269386 3300025945 Bacteria 1456
560 Ga0207679_10373793 3300025945 Bacteria 1248
561 Ga0207667_10000311 3300025949 Bacteria 67671
562 Ga0207667_10002461 3300025949 Bacteria 23142
563 Ga0207667_10002505 3300025949 Bacteria 22903
564 Ga0207667_10003631 3300025949 Bacteria 19034
565 Ga0207667_10004738 3300025949 Bacteria 16644
566 Ga0207667_10020853 3300025949 Bacteria 7276
567 Ga0207667_10021791 3300025949 Bacteria 7094
568 Ga0207667_10050199 3300025949 Bacteria 4402
569 Ga0207667_10054717 3300025949 Bacteria 4197
570 Ga0207667_10064171 3300025949 Bacteria 3835
571 Ga0207667_10068657 3300025949 Unclassified 3690
572 Ga0207667_10088316 3300025949 Bacteria 3206
573 Ga0207667_10101038 3300025949 Bacteria 2975
574 Ga0207667_10462820 3300025949 Bacteria 1288
575 Ga0207667_10686052 3300025949 Bacteria 1027
576 Ga0207640_10000475 3300025981 Bacteria 24505
577 Ga0207640_10001546 3300025981 Bacteria 12391
578 Ga0207640_10097290 3300025981 Bacteria 2054
579 Ga0207640_10127637 3300025981 Bacteria 1833
580 Ga0207640_10271854 3300025981 Bacteria 1326
581 Ga0207640_10473926 3300025981 Bacteria 1037
582 Ga0207640_10477498 3300025981 Unclassified 1033
583 Ga0207658_10001177 3300025986 Bacteria 20867
584 Ga0207677_10000025 3300026023 Bacteria 127400
585 Ga0207677_10000049 3300026023 Bacteria 101470
586 Ga0207677_10002313 3300026023 Bacteria 10015
587 Ga0207677_10054263 3300026023 Bacteria 2734
588 Ga0207677_10371649 3300026023 Bacteria 1204
589 Ga0207703_10000516 3300026035 Bacteria 39968
590 Ga0207703_10005309 3300026035 Bacteria 10384
591 Ga0207703_10087100 3300026035 Bacteria 2618
592 Ga0207639_10000055 3300026041 Bacteria 110260
593 Ga0207639_10000310 3300026041 Bacteria 34547
594 Ga0207639_10020123 3300026041 Bacteria 4775
595 Ga0207639_10073387 3300026041 Bacteria 2682
596 Ga0207639_10115820 3300026041 Bacteria 2193
597 Ga0207639_10147881 3300026041 Bacteria 1965
598 Ga0207639_10227711 3300026041 Bacteria 1614
599 Ga0207639_10253981 3300026041 Bacteria 1534
600 Ga0207639_10591087 3300026041 Bacteria 1023
601 Ga0207678_10018079 3300026067 Bacteria 6191
602 Ga0207678_10037558 3300026067 Bacteria 4212
603 Ga0207678_10048900 3300026067 Bacteria 3654
604 Ga0207678_10153644 3300026067 Bacteria 1965
605 Ga0207678_10174227 3300026067 Bacteria 1837
606 Ga0207678_10526291 3300026067 Bacteria 1032
607 Ga0207702_10000341 3300026078 Bacteria 53691
608 Ga0207702_10002439 3300026078 Bacteria 17621
609 Ga0207702_10002856 3300026078 Bacteria 16153
610 Ga0207702_10003567 3300026078 Bacteria 14152
611 Ga0207702_10011207 3300026078 Bacteria 7478
612 Ga0207702_10018572 3300026078 Bacteria 5754
613 Ga0207702_10043691 3300026078 Bacteria 3764
614 Ga0207702_10103574 3300026078 Unclassified 2517
615 Ga0207702_10118183 3300026078 Bacteria 2368
616 Ga0207702_10202655 3300026078 Bacteria 1840
617 Ga0207702_10348616 3300026078 Bacteria 1416
618 Ga0207641_10002209 3300026088 Bacteria 18283
619 Ga0207641_10111532 3300026088 Bacteria 2425
620 Ga0207641_10134902 3300026088 Bacteria 2221
621 Ga0207641_10966732 3300026088 Bacteria 847
622 Ga0207648_10018404 3300026089 Bacteria 6325
623 Ga0207648_10038146 3300026089 Bacteria 4229
624 Ga0207676_10005540 3300026095 Bacteria 8936
625 Ga0207676_10043793 3300026095 Bacteria 3448
626 Ga0207676_10297438 3300026095 Bacteria 1472
627 Ga0207674_10000788 3300026116 Bacteria 41336
628 Ga0207674_10001141 3300026116 Bacteria 34464
629 Ga0207674_10001426 3300026116 Bacteria 30868
630 Ga0207674_10011664 3300026116 Bacteria 9868
631 Ga0207674_10013987 3300026116 Bacteria 8872
632 Ga0207674_10257474 3300026116 Bacteria 1692
633 Ga0207674_10282446 3300026116 Bacteria 1608
634 Ga0207674_10293022 3300026116 Bacteria 1576
635 Ga0207683_10000884 3300026121 Bacteria 27532
636 Ga0207698_10000034 3300026142 Bacteria 108528
637 Ga0207698_10000215 3300026142 Bacteria 36031
638 Ga0207698_10039664 3300026142 Bacteria 3491
639 Ga0207698_10050509 3300026142 Bacteria 3173
640 Ga0207698_10129999 3300026142 Bacteria 2150
641 Ga0207698_10141804 3300026142 Bacteria 2072
642 Ga0207698_10145965 3300026142 Bacteria 2046
643 Ga0207698_10223341 3300026142 Bacteria 1704
644 Ga0207698_10465252 3300026142 Bacteria 1224
645 Ga0268266_10035380 3300028379 Bacteria 4248
646 Ga0268266_10043903 3300028379 Bacteria 3820
647 Ga0268266_10068899 3300028379 Bacteria 3064
648 Ga0268266_10143177 3300028379 Bacteria 2147
649 Ga0268266_10415256 3300028379 Bacteria 1274
650 Ga0268264_10000086 3300028381 Bacteria 239021
651 Ga0268264_10089027 3300028381 Bacteria 2657
652 Ga0268264_10109020 3300028381 Bacteria 2421
653 Ga0268264_10195924 3300028381 Bacteria 1845
654 Ga0268264_10236266 3300028381 Unclassified 1690
655 Ga0265336_10001257 3300028666 Bacteria 12007
656 Ga0265338_10020190 3300028800 Bacteria 7020
657 Ga0265338_10093855 3300028800 Bacteria 2471
658 Ga0265338_10194089 3300028800 Bacteria 1536
659 Ga0265338_10242551 3300028800 Bacteria 1334
660 Ga0265338_10266382 3300028800 Bacteria 1258
661 Ga0265770_1006415 3300030878 Bacteria 1635
662 Ga0265330_10013687 3300031235 Bacteria 3776
663 Ga0265328_10012341 3300031239 Bacteria 3402
664 Ga0265328_10015519 3300031239 Bacteria 2982
665 Ga0265320_10081168 3300031240 Bacteria 1514
666 Ga0265325_10004552 3300031241 Bacteria 8735
667 Ga0265325_10106675 3300031241 Bacteria 1366
668 Ga0265340_10126465 3300031247 Bacteria 1174
669 Ga0265339_10000028 3300031249 Bacteria 152096
670 Ga0265339_10012509 3300031249 Bacteria 5178
671 Ga0265339_10132815 3300031249 Bacteria 1271
672 Ga0265327_10302658 3300031251 Bacteria 704
673 Ga0265316_10022110 3300031344 Bacteria 5372
674 Ga0265316_10050288 3300031344 Bacteria 3278
675 Ga0265316_10075669 3300031344 Bacteria 2589
676 Ga0265316_10304224 3300031344 Bacteria 1161
677 Ga0265314_10019349 3300031711 Bacteria 5276
678 Ga0265314_10091875 3300031711 Bacteria 1974
679 Ga0265314_10094363 3300031711 Bacteria 1940
680 Ga0265342_10003417 3300031712 Bacteria 13050
681 Ga0265342_10063841 3300031712 Bacteria 2163
682 Ga0265342_10118852 3300031712 Bacteria 1490
683 Ga0307510_10074223 3300033180 Bacteria 3363
684 Ga0307510_10215282 3300033180 Bacteria 1439
685 Ga0373926_0154633 3300035083 Unclassified 874
686 Ga0373940_0095184 3300035088 Unclassified 897
687 Ga0373923_0117968 3300035111 Unclassified 1183
688 Ga0373936_0018058 3300035113 Bacteria 2721
689 Ga0373936_0277764 3300035113 Unclassified 752
690 Ga0373936_0302339 3300035113 Bacteria 722
691 Ga0373943_0023649 3300035170 Bacteria 2858
692 Ga0373943_0107371 3300035170 Bacteria 1468
693 Ga0373931_0010165 3300035691 Bacteria 4519
694 Ga0373931_0074705 3300035691 Bacteria 1857
695 Ga0373931_0138276 3300035691 Bacteria 1408
696 Ga0373935_0013718 3300035692 Bacteria 4892
697 Ga0373935_0172121 3300035692 Bacteria 1482
698 Ga0373935_0270970 3300035692 Bacteria 1193
699 Ga0373927_0021983 3300035695 Bacteria 4180
700 Ga0373927_0039893 3300035695 Bacteria 3047
701 Ga0373927_0163341 3300035695 Bacteria 1459
702 Ga0373933_0093101 3300035724 Unclassified 1862
703 Ga0373933_0192314 3300035724 Bacteria 1304
704 Ga0373933_0489007 3300035724 Unclassified 806
705 Ga0373947_0004501 3300035725 Bacteria 8175
706 Ga0373947_0110867 3300035725 Unclassified 1734
707 Ga0373947_0415970 3300035725 Unclassified 908
708 Ga0373937_0024608 3300036401 Bacteria 5433
709 Ga0373937_0045037 3300036401 Bacteria 4031
710 Ga0373925_0016455 3300037068 Bacteria 5357
711 Ga0373925_0018194 3300037068 Bacteria 5104
712 Ga0373925_0070516 3300037068 Bacteria 2642
713 Ga0373925_0682444 3300037068 Bacteria 847
714 Ga0395905_0064991 3300037471 Bacteria 3415
715 Ga0395905_0238240 3300037471 Bacteria 1701
716 Ga0436364_1158429 3300037853 Bacteria 1802
717 Ga0436365_0699659 3300039437 Unclassified 619
718 Ga0436365_1150646 3300039437 Bacteria 4842
719 Ga0436360_0783548 3300039438 Bacteria 2508
720 Ga0436360_1108617 3300039438 Bacteria 1386
721 Ga0436361_0463072 3300039447 Bacteria 1163
722 Ga0436361_0483255 3300039447 Bacteria 1663
723 Ga0436361_0631728 3300039447 Bacteria 1359
724 Ga0436361_0947034 3300039447 Bacteria 19611
725 Ga0436361_1095759 3300039447 Bacteria 3845
726 Ga0436363_1278735 3300039450 Bacteria 3919
727 Ga0436363_1654375 3300039450 Bacteria 2323
728 Ga0436362_0069304 3300039453 Unclassified 839
729 Ga0466966_0057362 3300044684 Bacteria 2462
730 Ga0466966_0078211 3300044684 Bacteria 2063
731 Ga0466966_0082339 3300044684 Bacteria 2003
732 Ga0466961_0254355 3300044693 Unclassified 1078
733 Ga0466961_0448947 3300044693 Bacteria 780
734 Ga0466963_0006138 3300044694 Bacteria 7089
735 Ga0466963_0021416 3300044694 Unclassified 4078
736 Ga0466963_0059535 3300044694 Bacteria 2549
737 Ga0466963_0146659 3300044694 Bacteria 1638
738 Ga0466957_0062233 3300044842 Unclassified 2292
739 Ga0466959_0089392 3300045049 Unclassified 2213
740 Ga0466967_0001765 3300045976 Bacteria 12937
741 Ga0466967_0030305 3300045976 Bacteria 4539
742 Ga0466967_0051151 3300045976 Bacteria 3620
743 Ga0466967_0062860 3300045976 Bacteria 3297
744 Ga0495592_0095508 3300046454 Bacteria 2126
745 Ga0495603_0008277 3300046455 Bacteria 6286
746 Ga0495603_0052771 3300046455 Bacteria 2413
747 Ga0495629_0018700 3300046459 Bacteria 4953
748 Ga0495629_0120306 3300046459 Unclassified 1829
749 Ga0495629_0358945 3300046459 Bacteria 993
750 Ga0495638_0236631 3300046460 Bacteria 1013
751 Ga0495651_0010080 3300046462 Bacteria 7259
752 Ga0495651_0385408 3300046462 Unclassified 918
753 Ga0495653_0002597 3300046463 Bacteria 14381
754 Ga0495650_0000010 3300046471 Bacteria 645599
755 Ga0495650_0045653 3300046471 Bacteria 1843
756 Ga0495580_0000162 3300046472 Bacteria 49248
757 Ga0495580_0002488 3300046472 Bacteria 16073
758 Ga0495580_0050832 3300046472 Bacteria 2930
759 Ga0495580_0062715 3300046472 Bacteria 2607
760 Ga0495580_0089717 3300046472 Bacteria 2140
761 Ga0495580_0125916 3300046472 Bacteria 1778
762 Ga0495580_0154488 3300046472 Bacteria 1589
763 Ga0495580_0273507 3300046472 Bacteria 1153
764 Ga0495580_0447518 3300046472 Bacteria 867
765 Ga0495582_0017051 3300046473 Bacteria 3977
766 Ga0495582_0037066 3300046473 Bacteria 2682
767 Ga0495605_0050413 3300046474 Bacteria 2031
768 Ga0495639_0001589 3300046475 Bacteria 10130
769 Ga0495639_0056967 3300046475 Bacteria 1785
770 Ga0495639_0156014 3300046475 Bacteria 1103
771 Ga0495662_0000645 3300046476 Bacteria 16330
772 Ga0495664_0010426 3300046477 Bacteria 5214
773 Ga0495585_0029334 3300046492 Bacteria 3132
774 Ga0495594_0001581 3300046499 Bacteria 11833
775 Ga0495594_0013311 3300046499 Bacteria 4292
776 Ga0495594_0017641 3300046499 Bacteria 3773
777 Ga0495583_0024207 3300046506 Bacteria 3056
778 Ga0495583_0095513 3300046506 Bacteria 1275
779 Ga0495606_0133269 3300046507 Bacteria 1475
780 Ga0495608_0020709 3300046511 Bacteria 4518
781 Ga0495628_0001223 3300046516 Bacteria 23508
782 Ga0495628_0100780 3300046516 Bacteria 2229
783 Ga0495630_0134707 3300046517 Bacteria 1877
784 Ga0495643_0148070 3300046522 Bacteria 1165
785 Ga0495644_0000118 3300046523 Bacteria 37646
786 Ga0495648_0382270 3300046524 Bacteria 634
787 Ga0495666_0010117 3300046526 Bacteria 4706
788 Ga0495666_0020928 3300046526 Bacteria 3238
789 Ga0495642_0015651 3300046528 Bacteria 2952
790 Ga0495642_0055830 3300046528 Unclassified 1631
791 Ga0495652_0003190 3300046529 Bacteria 16339
792 Ga0495652_0061333 3300046529 Bacteria 3175
793 Ga0495652_0193084 3300046529 Bacteria 1552
794 Ga0495652_0210540 3300046529 Bacteria 1468
795 Ga0495652_0296962 3300046529 Bacteria 1176
796 Ga0495665_0005640 3300046531 Bacteria 6751
797 Ga0495665_0011022 3300046531 Bacteria 4891
798 Ga0495640_0002236 3300046533 Bacteria 15504
799 Ga0495586_0001329 3300046535 Bacteria 13740
800 Ga0495586_0139985 3300046535 Unclassified 1358
801 Ga0495587_0021849 3300046536 Bacteria 3947
802 Ga0495587_0032591 3300046536 Bacteria 3149
803 Ga0495587_0034499 3300046536 Bacteria 3051
804 Ga0495587_0055036 3300046536 Bacteria 2344
805 Ga0495587_0326820 3300046536 Bacteria 856
806 Ga0495609_0013222 3300046538 Bacteria 3902
807 Ga0495609_0146497 3300046538 Bacteria 1006
808 Ga0495645_0002700 3300046543 Bacteria 12038
809 Ga0495645_0026658 3300046543 Bacteria 4196
810 Ga0495645_0028592 3300046543 Bacteria 4052
811 Ga0495645_0110279 3300046543 Bacteria 1948
812 Ga0495645_0522959 3300046543 Unclassified 739
813 Ga0495633_0023778 3300046558 Bacteria 3033
814 Ga0495667_0001549 3300046559 Bacteria 15245
815 Ga0495667_0404810 3300046559 Unclassified 859
816 Ga0495667_0510648 3300046559 Unclassified 753
817 Ga0495634_0002593 3300046642 Bacteria 14886
818 Ga0495634_0209035 3300046642 Bacteria 1209
819 Ga0495611_0077767 3300046648 Bacteria 1522
820 Ga0495625_0000276 3300046660 Bacteria 79774
821 Ga0495625_0052277 3300046660 Bacteria 2926
822 Ga0495625_0119271 3300046660 Bacteria 1797
823 Ga0495625_0175439 3300046660 Unclassified 1428
824 Ga0495625_0220547 3300046660 Bacteria 1243
825 Ga0495635_0012902 3300046663 Bacteria 5850
826 Ga0495635_0220992 3300046663 Bacteria 1281
827 Ga0495635_0248430 3300046663 Bacteria 1200
828 Ga0495659_0069980 3300046664 Bacteria 1313
829 Ga0495661_0034257 3300046665 Bacteria 3196
830 Ga0495588_0148462 3300046674 Bacteria 1239
831 Ga0495657_0492080 3300046675 Unclassified 716
832 Ga0495657_0596539 3300046675 Bacteria 639
833 Ga0495599_0001357 3300046678 Bacteria 13983
834 Ga0495599_0203777 3300046678 Unclassified 1215
835 Ga0495623_0014020 3300046679 Bacteria 5194
836 Ga0495623_0049226 3300046679 Bacteria 2671
837 Ga0495623_0390190 3300046679 Unclassified 751
838 Ga0495646_0013488 3300046680 Bacteria 5194
839 Ga0495646_0046134 3300046680 Bacteria 2658
840 Ga0495647_0057910 3300046681 Bacteria 1522
841 Ga0495669_0011807 3300046684 Bacteria 3714
842 Ga0495669_0014517 3300046684 Bacteria 3366
843 Ga0495669_0018605 3300046684 Bacteria 2989
844 Ga0495669_0226599 3300046684 Bacteria 896
845 Ga0495613_0005516 3300046689 Bacteria 9500
846 Ga0495613_0009988 3300046689 Bacteria 7052
847 Ga0495613_0012524 3300046689 Bacteria 6304
848 Ga0495613_0065947 3300046689 Bacteria 2645
849 Ga0495613_0075314 3300046689 Bacteria 2457
850 Ga0495613_0537742 3300046689 Bacteria 783
851 Ga0495624_0001915 3300046690 Bacteria 15843
852 Ga0495624_0327658 3300046690 Unclassified 922
853 Ga0495670_0037315 3300046691 Bacteria 2422
854 Ga0495589_0069528 3300046794 Bacteria 1722
855 Ga0495600_0003635 3300046809 Bacteria 9095
856 Ga0495600_0085023 3300046809 Bacteria 2064
857 Ga0495581_0000228 3300047315 Bacteria 26396
858 Ga0495581_0051089 3300047315 Bacteria 2388
859 Ga0495604_0000531 3300047317 Bacteria 33573
860 Ga0495604_0008803 3300047317 Bacteria 7977
861 Ga0495674_0036215 3300047319 Bacteria 4444
862 Ga0495674_0278427 3300047319 Bacteria 1371
863 Ga0495674_0357418 3300047319 Bacteria 1185
864 Ga0495672_0002914 3300047320 Bacteria 15141
865 Ga0495672_0162073 3300047320 Bacteria 1149
866 Ga0495676_0013756 3300047321 Bacteria 7255
867 Ga0495680_0012626 3300047322 Bacteria 7422
868 Ga0495687_176630 3300047443 Bacteria 701
869 Ga0495675_0000944 3300047444 Bacteria 17626
870 Ga0495675_0542147 3300047444 Bacteria 664
871 Ga0495673_0071849 3300047469 Bacteria 1454
872 Ga0495681_0148956 3300047470 Bacteria 983
873 Ga0495684_0043160 3300047471 Bacteria 3452
874 Ga0495684_0453800 3300047471 Bacteria 890
875 Ga0495684_0761823 3300047471 Bacteria 636
876 Ga0495686_0000018 3300047472 Bacteria 434962
877 Ga0495686_0002175 3300047472 Bacteria 19088
878 Ga0495686_0003658 3300047472 Bacteria 13158
879 Ga0495686_0010318 3300047472 Bacteria 6653
880 Ga0495686_0019632 3300047472 Bacteria 4515
881 Ga0495686_0058454 3300047472 Unclassified 2404
882 Ga0495593_0005453 3300047673 Bacteria 7515
883 Ga0495593_0107162 3300047673 Bacteria 1429
884 Ga0495602_0066150 3300048088 Bacteria 3116
885 Ga0495602_0082682 3300048088 Bacteria 2694
886 Ga0495602_0137015 3300048088 Bacteria 1943
887 Ga0495602_0151025 3300048088 Bacteria 1826
888 Ga0495602_0224549 3300048088 Bacteria 1415
889 Ga0495602_0225842 3300048088 Bacteria 1410
890 Ga0495614_0000079 3300048089 Bacteria 32033
891 Ga0495614_0001908 3300048089 Bacteria 9149
892 Ga0495614_0045777 3300048089 Bacteria 1876
893 Ga0496101_0339358 3300048904 Bacteria 1180
894 Ga0496102_0076658 3300048905 Bacteria 3076
895 Ga0496102_0305309 3300048905 Bacteria 1500
896 Ga0496104_0002087 3300048907 Bacteria 17340
897 Ga0496104_0021972 3300048907 Bacteria 5861
898 Ga0496104_0181505 3300048907 Bacteria 2015
899 Ga0496104_0272472 3300048907 Bacteria 1605
900 Ga0496104_1026326 3300048907 Unclassified 728
901 Ga0496105_0082594 3300048908 Bacteria 2654
902 Ga0496105_0117885 3300048908 Bacteria 2190
903 Ga0496105_0334237 3300048908 Bacteria 1212
904 Ga0496108_0247982 3300048911 Bacteria 1549
905 Ga0496108_0538540 3300048911 Bacteria 1019
906 Ga0496109_0318856 3300048912 Bacteria 1467
907 Ga0496110_0174183 3300048913 Bacteria 1953
908 Ga0496112_0001864 3300048915 Bacteria 16604
909 Ga0496112_0028267 3300048915 Bacteria 5412
910 Ga0496112_0057083 3300048915 Bacteria 3843
911 Ga0496112_0092413 3300048915 Bacteria 2995
912 Ga0496112_0118538 3300048915 Bacteria 2617
913 Ga0496113_0312179 3300048916 Bacteria 1260
914 Ga0496114_0022423 3300048917 Bacteria 5147
915 Ga0496115_0019046 3300048918 Bacteria 5277
916 Ga0496115_0102142 3300048918 Bacteria 2351
917 Ga0496121_0417478 3300048924 Bacteria 874
918 Ga0496124_0237730 3300048927 Bacteria 1357
919 Ga0496126_0000004 3300048929 Bacteria 925026
920 Ga0496126_0000042 3300048929 Bacteria 340121
921 Ga0496126_0001033 3300048929 Bacteria 47113
922 Ga0495682_0070227 3300049460 Bacteria 1261
923 Ga0495682_0113285 3300049460 Bacteria 972
924 Ga0501032_0022516 3300049569 Bacteria 4367
925 Ga0501032_0169470 3300049569 Bacteria 1432
926 Ga0501034_0035278 3300049571 Bacteria 5071
927 Ga0501036_0028098 3300049572 Bacteria 4755
928 Ga0501037_0021275 3300049573 Bacteria 4793
929 Ga0501037_0087981 3300049573 Bacteria 2248
930 Ga0501037_0175354 3300049573 Bacteria 1523
931 Ga0501038_0002278 3300049574 Bacteria 17853
932 Ga0501038_0040290 3300049574 Bacteria 4082
933 Ga0501039_0042132 3300049575 Bacteria 3528
934 Ga0501043_0009547 3300049579 Bacteria 7606
935 Ga0501046_0000448 3300049580 Bacteria 41389
936 Ga0501047_0000517 3300049581 Bacteria 41739
937 Ga0501047_0014404 3300049581 Bacteria 7519
938 Ga0501070_0070040 3300049586 Bacteria 2904
939 Ga0501070_0154479 3300049586 Bacteria 1893
940 Ga0501073_0017179 3300049589 Bacteria 5240
941 Ga0501073_0125600 3300049589 Bacteria 1778
942 Ga0501073_0690424 3300049589 Bacteria 704
943 Ga0501074_0282354 3300049590 Bacteria 1180
944 Ga0501080_0046116 3300049742 Bacteria 4060
945 Ga0501035_0011383 3300049822 Bacteria 8246
946 Ga0501035_0179859 3300049822 Bacteria 1822
947 Ga0501035_1197280 3300049822 Bacteria 589
948 Ga0501044_0018099 3300049823 Bacteria 7555
949 Ga0501044_0024458 3300049823 Bacteria 6409
950 nmdc:mga0n895_34721_c1 3300050512 Bacteria 4857
951 nmdc:mga0rr50_119202_c1 3300050513 Bacteria 2098
952 nmdc:mga0rr50_9844_c1 3300050513 Bacteria 6038
953 nmdc:mga08x19_3300_c1 3300050514 Bacteria 9642
954 Ga0495601_0335090 3300053077 Unclassified 984
955 Ga0495595_0217554 3300053084 Unclassified 953
956 Ga0495619_0807639 3300053085 Bacteria 634
957 Ga0500644_0098210 3300053088 Bacteria 1108
958 Ga0500651_0000008 3300053093 Bacteria 287738
959 Ga0500595_000112 3300053119 Bacteria 54078
960 Ga0500595_030389 3300053119 Bacteria 1820
961 Ga0500661_001396 3300055283 Bacteria 4511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010159 Ga0099796_10137057 Ga0099796_101370572 178
2 3300014325 Ga0163163_10067606 Ga0163163_100676062 179
3 3300046528 Ga0495642_0055830 Ga0495642_0055830_770_1408 179
4 3300046684 Ga0495669_0014517 Ga0495669_0014517_1985_2623 179
5 3300005339 Ga0070660_100076594 Ga0070660_1000765942 183
6 3300005455 Ga0070663_100049150 Ga0070663_1000491502 183
7 3300005563 Ga0068855_100003897 Ga0068855_10000389715 183
8 3300005563 Ga0068855_100075410 Ga0068855_1000754103 183
9 3300005616 Ga0068852_100066057 Ga0068852_1000660573 183
10 3300025929 Ga0207664_10046041 Ga0207664_100460413 183
11 3300025981 Ga0207640_10473926 Ga0207640_104739262 183
12 3300026078 Ga0207702_10202655 Ga0207702_102026552 183
13 3300026142 Ga0207698_10039664 Ga0207698_100396642 183
14 3300046524 Ga0495648_0382270 Ga0495648_0382270_22_576 183
15 3300046543 Ga0495645_0522959 Ga0495645_0522959_64_618 183
16 3300046675 Ga0495657_0492080 Ga0495657_0492080_78_632 183
17 3300046675 Ga0495657_0596539 Ga0495657_0596539_37_591 183
18 3300046678 Ga0495599_0203777 Ga0495599_0203777_57_611 183
19 3300046679 Ga0495623_0390190 Ga0495623_0390190_72_626 183
20 3300046684 Ga0495669_0226599 Ga0495669_0226599_30_584 183
21 3300049460 Ga0495682_0113285 Ga0495682_0113285_29_583 183
22 3300049575 Ga0501039_0042132 Ga0501039_0042132_53_607 183
23 3300049822 Ga0501035_1197280 Ga0501035_1197280_17_571 183
24 3300053077 Ga0495601_0335090 Ga0495601_0335090_73_642 183
25 3300053085 Ga0495619_0807639 Ga0495619_0807639_37_591 183
26 3300028381 Ga0268264_10236266 Ga0268264_102362663 184
27 3300005435 Ga0070714_100273686 Ga0070714_1002736862 187
28 3300005436 Ga0070713_100312439 Ga0070713_1003124392 187
29 3300006028 Ga0070717_10007251 Ga0070717_100072519 187
30 3300025928 Ga0207700_10053361 Ga0207700_100533612 187
31 3300025929 Ga0207664_10096601 Ga0207664_100966014 187
32 3300039437 Ga0436365_0699659 Ga0436365_0699659_35_607 187
33 3300047444 Ga0495675_0542147 Ga0495675_0542147_14_586 190
34 3300047471 Ga0495684_0761823 Ga0495684_0761823_11_583 190
35 3300035113 Ga0373936_0277764 Ga0373936_0277764_108_707 193
36 3300039453 Ga0436362_0069304 Ga0436362_0069304_184_813 196
37 3300035691 Ga0373931_0074705 Ga0373931_0074705_1003_1608 197
38 3300039437 Ga0436365_1150646 Ga0436365_1150646_721_1350 197
39 3300039450 Ga0436363_1278735 Ga0436363_1278735_2645_3274 197
40 3300005335 Ga0070666_10220485 Ga0070666_102204852 198
41 3300005445 Ga0070708_100065226 Ga0070708_1000652263 198
42 3300005467 Ga0070706_100047551 Ga0070706_1000475512 198
43 3300005518 Ga0070699_100027551 Ga0070699_1000275513 198
44 3300009177 Ga0105248_10033281 Ga0105248_100332812 198
45 3300009177 Ga0105248_10179988 Ga0105248_101799882 198
46 3300013296 Ga0157374_10001002 Ga0157374_100010025 198
47 3300014325 Ga0163163_10051723 Ga0163163_100517235 198
48 3300014968 Ga0157379_10254985 Ga0157379_102549852 198
49 3300014969 Ga0157376_10505024 Ga0157376_105050242 198
50 3300025925 Ga0207650_10758464 Ga0207650_107584641 198
51 3300046472 Ga0495580_0447518 Ga0495580_0447518_247_843 198
52 3300046506 Ga0495583_0095513 Ga0495583_0095513_102_701 198
53 3300047443 Ga0495687_176630 Ga0495687_176630_90_689 198
54 3300047471 Ga0495684_0453800 Ga0495684_0453800_23_622 198
55 3300048911 Ga0496108_0538540 Ga0496108_0538540_19_627 199
56 3300046642 Ga0495634_0209035 Ga0495634_0209035_70_690 200
57 3300046663 Ga0495635_0220992 Ga0495635_0220992_374_994 200
58 3300035170 Ga0373943_0107371 Ga0373943_0107371_120_749 202
59 3300035725 Ga0373947_0110867 Ga0373947_0110867_1053_1682 202
60 3300006028 Ga0070717_10043721 Ga0070717_100437214 204
61 iso_pu_bacteria 2884215851 2884216154 205
62 3300033180 Ga0307510_10074223 Ga0307510_100742233 207
63 3300005327 Ga0070658_10000010 Ga0070658_10000010200 208
64 3300005327 Ga0070658_10050708 Ga0070658_100507083 208
65 3300005327 Ga0070658_10302683 Ga0070658_103026832 208
66 3300005339 Ga0070660_100038722 Ga0070660_1000387223 208
67 3300005436 Ga0070713_100024689 Ga0070713_1000246895 208
68 3300005458 Ga0070681_10020502 Ga0070681_100205022 208
69 3300005548 Ga0070665_100081388 Ga0070665_1000813883 208
70 3300005548 Ga0070665_100192455 Ga0070665_1001924553 208
71 3300005563 Ga0068855_100092126 Ga0068855_1000921263 208
72 3300005614 Ga0068856_100124377 Ga0068856_1001243772 208
73 3300009093 Ga0105240_10072193 Ga0105240_100721932 208
74 3300009551 Ga0105238_10030973 Ga0105238_100309732 208
75 3300013104 Ga0157370_10046670 Ga0157370_100466704 208
76 3300013104 Ga0157370_10758773 Ga0157370_107587731 208
77 3300013105 Ga0157369_10168739 Ga0157369_101687392 208
78 3300013307 Ga0157372_10244906 Ga0157372_102449063 208
79 3300025233 Ga0209437_104998 Ga0209437_1049983 208
80 3300025261 Ga0209233_1001575 Ga0209233_100157512 208
81 3300025898 Ga0207692_10208628 Ga0207692_102086282 208
82 3300025909 Ga0207705_10000016 Ga0207705_10000016266 208
83 3300025909 Ga0207705_10089141 Ga0207705_100891412 208
84 3300025924 Ga0207694_10003908 Ga0207694_100039089 208
85 3300025928 Ga0207700_10052594 Ga0207700_100525944 208
86 3300025949 Ga0207667_10002461 Ga0207667_1000246118 208
87 3300028379 Ga0268266_10035380 Ga0268266_100353803 208
88 3300028379 Ga0268266_10043903 Ga0268266_100439032 208
89 3300046471 Ga0495650_0045653 Ga0495650_0045653_495_1124 208
90 3300046660 Ga0495625_0000276 Ga0495625_0000276_23533_24162 208
91 3300047472 Ga0495686_0002175 Ga0495686_0002175_9836_10465 208
92 3300048911 Ga0496108_0247982 Ga0496108_0247982_740_1366 208
93 3300048929 Ga0496126_0000042 Ga0496126_0000042_5839_6471 208
94 3300003320 rootH2_10092033 rootH2_100920332 209
95 3300003322 rootL2_10222464 rootL2_102224642 209
96 3300005327 Ga0070658_10003514 Ga0070658_100035144 209
97 3300005327 Ga0070658_10010438 Ga0070658_100104386 209
98 3300005327 Ga0070658_10979840 Ga0070658_109798401 209
99 3300005328 Ga0070676_10040428 Ga0070676_100404283 209
100 3300005329 Ga0070683_100011583 Ga0070683_1000115835 209
101 3300005329 Ga0070683_100024722 Ga0070683_1000247223 209
102 3300005329 Ga0070683_100068107 Ga0070683_1000681074 209
103 3300005329 Ga0070683_100106475 Ga0070683_1001064753 209
104 3300005331 Ga0070670_100001705 Ga0070670_1000017059 209
105 3300005331 Ga0070670_100858554 Ga0070670_1008585542 209
106 3300005336 Ga0070680_100194163 Ga0070680_1001941632 209
107 3300005338 Ga0068868_100001694 Ga0068868_1000016949 209
108 3300005338 Ga0068868_100008205 Ga0068868_1000082053 209
109 3300005339 Ga0070660_100029314 Ga0070660_1000293142 209
110 3300005339 Ga0070660_100436512 Ga0070660_1004365122 209
111 3300005340 Ga0070689_100034560 Ga0070689_1000345604 209
112 3300005341 Ga0070691_10265739 Ga0070691_102657391 209
113 3300005341 Ga0070691_10386215 Ga0070691_103862151 209
114 3300005344 Ga0070661_100014750 Ga0070661_1000147502 209
115 3300005354 Ga0070675_100197924 Ga0070675_1001979242 209
116 3300005355 Ga0070671_100030005 Ga0070671_1000300052 209
117 3300005364 Ga0070673_100281095 Ga0070673_1002810952 209
118 3300005366 Ga0070659_100007414 Ga0070659_1000074141 209
119 3300005366 Ga0070659_100053569 Ga0070659_1000535692 209
120 3300005366 Ga0070659_100077667 Ga0070659_1000776673 209
121 3300005366 Ga0070659_100175670 Ga0070659_1001756702 209
122 3300005367 Ga0070667_100311390 Ga0070667_1003113902 209
123 3300005435 Ga0070714_100033734 Ga0070714_1000337344 209
124 3300005435 Ga0070714_100047543 Ga0070714_1000475434 209
125 3300005435 Ga0070714_100097646 Ga0070714_1000976462 209
126 3300005435 Ga0070714_100231268 Ga0070714_1002312682 209
127 3300005435 Ga0070714_100388004 Ga0070714_1003880042 209
128 3300005435 Ga0070714_100581607 Ga0070714_1005816071 209
129 3300005435 Ga0070714_100920693 Ga0070714_1009206932 209
130 3300005436 Ga0070713_100011389 Ga0070713_1000113893 209
131 3300005436 Ga0070713_100234953 Ga0070713_1002349532 209
132 3300005436 Ga0070713_100373804 Ga0070713_1003738042 209
133 3300005437 Ga0070710_10178710 Ga0070710_101787102 209
134 3300005437 Ga0070710_10188316 Ga0070710_101883161 209
135 3300005439 Ga0070711_100035273 Ga0070711_1000352733 209
136 3300005439 Ga0070711_100427038 Ga0070711_1004270382 209
137 3300005439 Ga0070711_100636126 Ga0070711_1006361262 209
138 3300005445 Ga0070708_100024357 Ga0070708_1000243574 209
139 3300005455 Ga0070663_100080998 Ga0070663_1000809982 209
140 3300005455 Ga0070663_100314997 Ga0070663_1003149972 209
141 3300005458 Ga0070681_10001443 Ga0070681_1000144322 209
142 3300005458 Ga0070681_10013740 Ga0070681_100137404 209
143 3300005458 Ga0070681_10428868 Ga0070681_104288682 209
144 3300005467 Ga0070706_100136524 Ga0070706_1001365243 209
145 3300005468 Ga0070707_100182918 Ga0070707_1001829181 209
146 3300005530 Ga0070679_100001140 Ga0070679_10000114020 209
147 3300005530 Ga0070679_100005691 Ga0070679_1000056912 209
148 3300005530 Ga0070679_100082623 Ga0070679_1000826234 209
149 3300005530 Ga0070679_100269966 Ga0070679_1002699662 209
150 3300005535 Ga0070684_100000769 Ga0070684_10000076915 209
151 3300005535 Ga0070684_100019577 Ga0070684_1000195776 209
152 3300005535 Ga0070684_100026968 Ga0070684_1000269683 209
153 3300005535 Ga0070684_100032824 Ga0070684_1000328244 209
154 3300005536 Ga0070697_100400202 Ga0070697_1004002022 209
155 3300005539 Ga0068853_100008997 Ga0068853_1000089979 209
156 3300005539 Ga0068853_100023232 Ga0068853_1000232324 209
157 3300005539 Ga0068853_100033117 Ga0068853_1000331174 209
158 3300005539 Ga0068853_100089610 Ga0068853_1000896103 209
159 3300005539 Ga0068853_100133502 Ga0068853_1001335022 209
160 3300005539 Ga0068853_101036107 Ga0068853_1010361071 209
161 3300005547 Ga0070693_100046588 Ga0070693_1000465883 209
162 3300005547 Ga0070693_100060058 Ga0070693_1000600583 209
163 3300005547 Ga0070693_100276757 Ga0070693_1002767572 209
164 3300005548 Ga0070665_100026988 Ga0070665_1000269882 209
165 3300005563 Ga0068855_100000412 Ga0068855_10000041216 209
166 3300005563 Ga0068855_100000425 Ga0068855_10000042534 209
167 3300005563 Ga0068855_100019038 Ga0068855_1000190382 209
168 3300005563 Ga0068855_100019320 Ga0068855_1000193204 209
169 3300005563 Ga0068855_100035148 Ga0068855_1000351486 209
170 3300005563 Ga0068855_100042079 Ga0068855_1000420795 209
171 3300005563 Ga0068855_100051395 Ga0068855_1000513952 209
172 3300005563 Ga0068855_100160284 Ga0068855_1001602843 209
173 3300005563 Ga0068855_100162092 Ga0068855_1001620923 209
174 3300005563 Ga0068855_100200958 Ga0068855_1002009581 209
175 3300005563 Ga0068855_100488353 Ga0068855_1004883532 209
176 3300005564 Ga0070664_100003184 Ga0070664_1000031847 209
177 3300005564 Ga0070664_100048849 Ga0070664_1000488495 209
178 3300005564 Ga0070664_100452389 Ga0070664_1004523892 209
179 3300005577 Ga0068857_100003436 Ga0068857_1000034364 209
180 3300005577 Ga0068857_100019504 Ga0068857_1000195045 209
181 3300005577 Ga0068857_100025005 Ga0068857_1000250052 209
182 3300005577 Ga0068857_100117340 Ga0068857_1001173403 209
183 3300005578 Ga0068854_100000691 Ga0068854_1000006912 209
184 3300005578 Ga0068854_100000859 Ga0068854_10000085918 209
185 3300005578 Ga0068854_100012781 Ga0068854_1000127815 209
186 3300005578 Ga0068854_100012901 Ga0068854_1000129017 209
187 3300005578 Ga0068854_100078857 Ga0068854_1000788572 209
188 3300005578 Ga0068854_100205584 Ga0068854_1002055842 209
189 3300005614 Ga0068856_100000670 Ga0068856_10000067024 209
190 3300005614 Ga0068856_100000708 Ga0068856_10000070821 209
191 3300005614 Ga0068856_100003077 Ga0068856_10000307712 209
192 3300005614 Ga0068856_100006375 Ga0068856_1000063758 209
193 3300005614 Ga0068856_100159592 Ga0068856_1001595923 209
194 3300005614 Ga0068856_100162039 Ga0068856_1001620392 209
195 3300005614 Ga0068856_100190147 Ga0068856_1001901472 209
196 3300005614 Ga0068856_100896413 Ga0068856_1008964132 209
197 3300005616 Ga0068852_100043099 Ga0068852_1000430993 209
198 3300005616 Ga0068852_100071070 Ga0068852_1000710702 209
199 3300005616 Ga0068852_100327143 Ga0068852_1003271432 209
200 3300005617 Ga0068859_100001626 Ga0068859_10000162614 209
201 3300005618 Ga0068864_100067427 Ga0068864_1000674272 209
202 3300005718 Ga0068866_10002225 Ga0068866_100022259 209
203 3300005841 Ga0068863_100030082 Ga0068863_1000300822 209
204 3300005841 Ga0068863_100106328 Ga0068863_1001063283 209
205 3300005841 Ga0068863_100119671 Ga0068863_1001196713 209
206 3300005841 Ga0068863_100126513 Ga0068863_1001265133 209
207 3300005842 Ga0068858_100002774 Ga0068858_10000277419 209
208 3300005842 Ga0068858_100049520 Ga0068858_1000495202 209
209 3300005842 Ga0068858_100678105 Ga0068858_1006781052 209
210 3300005843 Ga0068860_100161410 Ga0068860_1001614103 209
211 3300005844 Ga0068862_100575415 Ga0068862_1005754152 209
212 3300006028 Ga0070717_10001551 Ga0070717_1000155110 209
213 3300006028 Ga0070717_10004562 Ga0070717_100045627 209
214 3300006028 Ga0070717_10013776 Ga0070717_100137763 209
215 3300006028 Ga0070717_10018510 Ga0070717_100185102 209
216 3300006028 Ga0070717_10103048 Ga0070717_101030483 209
217 3300006028 Ga0070717_10420779 Ga0070717_104207792 209
218 3300006028 Ga0070717_10623614 Ga0070717_106236141 209
219 3300006173 Ga0070716_100011551 Ga0070716_1000115515 209
220 3300006173 Ga0070716_100034842 Ga0070716_1000348423 209
221 3300006175 Ga0070712_100031742 Ga0070712_1000317423 209
222 3300006175 Ga0070712_100034274 Ga0070712_1000342743 209
223 3300006237 Ga0097621_100000210 Ga0097621_1000002104 209
224 3300006237 Ga0097621_100000619 Ga0097621_1000006199 209
225 3300006237 Ga0097621_100009714 Ga0097621_1000097145 209
226 3300006237 Ga0097621_100053837 Ga0097621_1000538372 209
227 3300006237 Ga0097621_100257477 Ga0097621_1002574772 209
228 3300006358 Ga0068871_100000168 Ga0068871_1000001686 209
229 3300006358 Ga0068871_100000854 Ga0068871_1000008545 209
230 3300006358 Ga0068871_100137707 Ga0068871_1001377072 209
231 3300006358 Ga0068871_100186092 Ga0068871_1001860922 209
232 3300006871 Ga0075434_100018485 Ga0075434_1000184859 209
233 3300006871 Ga0075434_100768232 Ga0075434_1007682321 209
234 3300006914 Ga0075436_100017549 Ga0075436_1000175494 209
235 3300006914 Ga0075436_100093913 Ga0075436_1000939133 209
236 3300006931 Ga0097620_100001626 Ga0097620_10000162614 209
237 3300007076 Ga0075435_100017890 Ga0075435_1000178906 209
238 3300009093 Ga0105240_10000002 Ga0105240_10000002119 209
239 3300009093 Ga0105240_10000823 Ga0105240_1000082334 209
240 3300009093 Ga0105240_10010492 Ga0105240_1001049214 209
241 3300009093 Ga0105240_10019330 Ga0105240_100193303 209
242 3300009093 Ga0105240_10031956 Ga0105240_100319563 209
243 3300009093 Ga0105240_10175129 Ga0105240_101751292 209
244 3300009093 Ga0105240_10237290 Ga0105240_102372902 209
245 3300009093 Ga0105240_10376850 Ga0105240_103768502 209
246 3300009093 Ga0105240_10416359 Ga0105240_104163592 209
247 3300009093 Ga0105240_10438164 Ga0105240_104381642 209
248 3300009093 Ga0105240_10817642 Ga0105240_108176422 209
249 3300009093 Ga0105240_10980930 Ga0105240_109809301 209
250 3300009093 Ga0105240_11160390 Ga0105240_111603902 209
251 3300009174 Ga0105241_10000713 Ga0105241_1000071321 209
252 3300009174 Ga0105241_10020422 Ga0105241_100204222 209
253 3300009174 Ga0105241_10085994 Ga0105241_100859943 209
254 3300009174 Ga0105241_10432547 Ga0105241_104325471 209
255 3300009176 Ga0105242_10534214 Ga0105242_105342142 209
256 3300009177 Ga0105248_10008351 Ga0105248_1000835115 209
257 3300009177 Ga0105248_10166950 Ga0105248_101669503 209
258 3300009177 Ga0105248_10340294 Ga0105248_103402943 209
259 3300009545 Ga0105237_10067194 Ga0105237_100671943 209
260 3300009545 Ga0105237_10078521 Ga0105237_100785213 209
261 3300009545 Ga0105237_10093922 Ga0105237_100939224 209
262 3300009551 Ga0105238_10000382 Ga0105238_1000038215 209
263 3300009551 Ga0105238_10013635 Ga0105238_100136355 209
264 3300009551 Ga0105238_10075332 Ga0105238_100753321 209
265 3300009551 Ga0105238_10110340 Ga0105238_101103402 209
266 3300009551 Ga0105238_10337096 Ga0105238_103370962 209
267 3300009551 Ga0105238_10753609 Ga0105238_107536092 209
268 3300010375 Ga0105239_10063662 Ga0105239_100636624 209
269 3300010375 Ga0105239_10253078 Ga0105239_102530783 209
270 3300010375 Ga0105239_10461417 Ga0105239_104614172 209
271 3300011119 Ga0105246_10080879 Ga0105246_100808793 209
272 3300013100 Ga0157373_10001418 Ga0157373_100014183 209
273 3300013100 Ga0157373_10037015 Ga0157373_100370154 209
274 3300013102 Ga0157371_10158708 Ga0157371_101587082 209
275 3300013104 Ga0157370_10054020 Ga0157370_100540204 209
276 3300013104 Ga0157370_10060804 Ga0157370_100608044 209
277 3300013104 Ga0157370_10069612 Ga0157370_100696124 209
278 3300013104 Ga0157370_10177331 Ga0157370_101773312 209
279 3300013104 Ga0157370_10184139 Ga0157370_101841392 209
280 3300013104 Ga0157370_10229304 Ga0157370_102293042 209
281 3300013104 Ga0157370_10337227 Ga0157370_103372272 209
282 3300013105 Ga0157369_10000269 Ga0157369_1000026925 209
283 3300013105 Ga0157369_10009004 Ga0157369_100090042 209
284 3300013105 Ga0157369_10012042 Ga0157369_100120426 209
285 3300013105 Ga0157369_10040792 Ga0157369_100407922 209
286 3300013105 Ga0157369_10061961 Ga0157369_100619613 209
287 3300013105 Ga0157369_10070356 Ga0157369_100703563 209
288 3300013105 Ga0157369_10165090 Ga0157369_101650903 209
289 3300013105 Ga0157369_10180658 Ga0157369_101806584 209
290 3300013105 Ga0157369_10192490 Ga0157369_101924902 209
291 3300013105 Ga0157369_10197194 Ga0157369_101971942 209
292 3300013105 Ga0157369_10492867 Ga0157369_104928672 209
293 3300013105 Ga0157369_10553764 Ga0157369_105537642 209
294 3300013296 Ga0157374_10001029 Ga0157374_100010294 209
295 3300013296 Ga0157374_10001270 Ga0157374_1000127016 209
296 3300013296 Ga0157374_10001822 Ga0157374_100018221 209
297 3300013296 Ga0157374_10019906 Ga0157374_100199062 209
298 3300013296 Ga0157374_10215848 Ga0157374_102158481 209
299 3300013296 Ga0157374_10546199 Ga0157374_105461992 209
300 3300013297 Ga0157378_10000014 Ga0157378_1000001419 209
301 3300013297 Ga0157378_10000413 Ga0157378_1000041339 209
302 3300013297 Ga0157378_10005384 Ga0157378_100053844 209
303 3300013306 Ga0163162_10067477 Ga0163162_100674772 209
304 3300013306 Ga0163162_10212824 Ga0163162_102128243 209
305 3300013306 Ga0163162_10597309 Ga0163162_105973091 209
306 3300013307 Ga0157372_10000423 Ga0157372_100004234 209
307 3300013307 Ga0157372_10000641 Ga0157372_1000064124 209
308 3300013307 Ga0157372_10000661 Ga0157372_100006614 209
309 3300013307 Ga0157372_10008117 Ga0157372_100081175 209
310 3300013307 Ga0157372_10009019 Ga0157372_100090198 209
311 3300013307 Ga0157372_10010339 Ga0157372_100103398 209
312 3300013307 Ga0157372_10033258 Ga0157372_100332584 209
313 3300013307 Ga0157372_10064478 Ga0157372_100644782 209
314 3300013307 Ga0157372_10095592 Ga0157372_100955924 209
315 3300013307 Ga0157372_10098253 Ga0157372_100982532 209
316 3300013307 Ga0157372_10167312 Ga0157372_101673123 209
317 3300013307 Ga0157372_10189400 Ga0157372_101894003 209
318 3300013307 Ga0157372_10203166 Ga0157372_102031662 209
319 3300013307 Ga0157372_10239164 Ga0157372_102391642 209
320 3300013307 Ga0157372_10469034 Ga0157372_104690342 209
321 3300013307 Ga0157372_10496717 Ga0157372_104967172 209
322 3300014497 Ga0182008_10029271 Ga0182008_100292712 209
323 3300014968 Ga0157379_10067354 Ga0157379_100673544 209
324 3300014968 Ga0157379_10346069 Ga0157379_103460692 209
325 3300014969 Ga0157376_10012541 Ga0157376_100125414 209
326 3300014969 Ga0157376_10017315 Ga0157376_100173153 209
327 3300014969 Ga0157376_10021412 Ga0157376_100214123 209
328 3300015262 Ga0182007_10119848 Ga0182007_101198482 209
329 3300021361 Ga0213872_10000931 Ga0213872_1000093119 209
330 3300021441 Ga0213871_10071539 Ga0213871_100715392 209
331 3300025261 Ga0209233_1020793 Ga0209233_10207932 209
332 3300025903 Ga0207680_10050765 Ga0207680_100507652 209
333 3300025904 Ga0207647_10006183 Ga0207647_1000618310 209
334 3300025904 Ga0207647_10014623 Ga0207647_100146235 209
335 3300025904 Ga0207647_10019887 Ga0207647_100198874 209
336 3300025907 Ga0207645_10078412 Ga0207645_100784121 209
337 3300025909 Ga0207705_10002666 Ga0207705_100026668 209
338 3300025909 Ga0207705_10004483 Ga0207705_100044839 209
339 3300025909 Ga0207705_10017169 Ga0207705_100171694 209
340 3300025909 Ga0207705_10679699 Ga0207705_106796991 209
341 3300025910 Ga0207684_10079053 Ga0207684_100790532 209
342 3300025911 Ga0207654_10031632 Ga0207654_100316321 209
343 3300025911 Ga0207654_10060227 Ga0207654_100602273 209
344 3300025911 Ga0207654_10701033 Ga0207654_107010331 209
345 3300025912 Ga0207707_10000828 Ga0207707_1000082828 209
346 3300025912 Ga0207707_10002913 Ga0207707_100029134 209
347 3300025912 Ga0207707_10279620 Ga0207707_102796202 209
348 3300025912 Ga0207707_10366698 Ga0207707_103666982 209
349 3300025913 Ga0207695_10000002 Ga0207695_10000002121 209
350 3300025913 Ga0207695_10000231 Ga0207695_10000231127 209
351 3300025913 Ga0207695_10067207 Ga0207695_100672074 209
352 3300025913 Ga0207695_10069887 Ga0207695_100698873 209
353 3300025913 Ga0207695_10093249 Ga0207695_100932493 209
354 3300025913 Ga0207695_10112069 Ga0207695_101120693 209
355 3300025913 Ga0207695_10118844 Ga0207695_101188443 209
356 3300025913 Ga0207695_10268477 Ga0207695_102684772 209
357 3300025913 Ga0207695_10358084 Ga0207695_103580842 209
358 3300025913 Ga0207695_10709875 Ga0207695_107098752 209
359 3300025913 Ga0207695_10768894 Ga0207695_107688941 209
360 3300025914 Ga0207671_10052812 Ga0207671_100528122 209
361 3300025915 Ga0207693_10013297 Ga0207693_100132976 209
362 3300025915 Ga0207693_10026428 Ga0207693_100264282 209
363 3300025916 Ga0207663_10064583 Ga0207663_100645832 209
364 3300025916 Ga0207663_10347918 Ga0207663_103479181 209
365 3300025916 Ga0207663_10508178 Ga0207663_105081781 209
366 3300025917 Ga0207660_10127400 Ga0207660_101274002 209
367 3300025917 Ga0207660_10222759 Ga0207660_102227592 209
368 3300025919 Ga0207657_10026228 Ga0207657_100262287 209
369 3300025919 Ga0207657_10030564 Ga0207657_100305642 209
370 3300025919 Ga0207657_10033939 Ga0207657_100339394 209
371 3300025919 Ga0207657_10037314 Ga0207657_100373142 209
372 3300025919 Ga0207657_10121526 Ga0207657_101215262 209
373 3300025919 Ga0207657_10418146 Ga0207657_104181462 209
374 3300025921 Ga0207652_10001901 Ga0207652_1000190118 209
375 3300025921 Ga0207652_10093730 Ga0207652_100937302 209
376 3300025921 Ga0207652_10199093 Ga0207652_101990932 209
377 3300025922 Ga0207646_10640860 Ga0207646_106408602 209
378 3300025924 Ga0207694_10075919 Ga0207694_100759192 209
379 3300025924 Ga0207694_10235353 Ga0207694_102353531 209
380 3300025925 Ga0207650_10005515 Ga0207650_100055152 209
381 3300025928 Ga0207700_10006281 Ga0207700_100062813 209
382 3300025928 Ga0207700_10113757 Ga0207700_101137572 209
383 3300025929 Ga0207664_10096906 Ga0207664_100969064 209
384 3300025929 Ga0207664_10119269 Ga0207664_101192692 209
385 3300025929 Ga0207664_10187506 Ga0207664_101875062 209
386 3300025929 Ga0207664_10280196 Ga0207664_102801962 209
387 3300025929 Ga0207664_10715179 Ga0207664_107151792 209
388 3300025931 Ga0207644_10004213 Ga0207644_100042135 209
389 3300025932 Ga0207690_10001150 Ga0207690_1000115011 209
390 3300025932 Ga0207690_10105845 Ga0207690_101058452 209
391 3300025932 Ga0207690_10714901 Ga0207690_107149011 209
392 3300025933 Ga0207706_10292990 Ga0207706_102929903 209
393 3300025934 Ga0207686_10099494 Ga0207686_100994943 209
394 3300025936 Ga0207670_10087926 Ga0207670_100879262 209
395 3300025938 Ga0207704_10006339 Ga0207704_100063393 209
396 3300025939 Ga0207665_10051159 Ga0207665_100511592 209
397 3300025941 Ga0207711_10073094 Ga0207711_100730943 209
398 3300025941 Ga0207711_11033857 Ga0207711_110338571 209
399 3300025942 Ga0207689_10021816 Ga0207689_100218164 209
400 3300025944 Ga0207661_10036017 Ga0207661_100360173 209
401 3300025944 Ga0207661_10055494 Ga0207661_100554943 209
402 3300025944 Ga0207661_10079743 Ga0207661_100797433 209
403 3300025944 Ga0207661_10154510 Ga0207661_101545102 209
404 3300025944 Ga0207661_10320839 Ga0207661_103208392 209
405 3300025945 Ga0207679_10010827 Ga0207679_100108274 209
406 3300025945 Ga0207679_10041807 Ga0207679_100418072 209
407 3300025945 Ga0207679_10373793 Ga0207679_103737932 209
408 3300025949 Ga0207667_10000311 Ga0207667_1000031134 209
409 3300025949 Ga0207667_10002505 Ga0207667_100025056 209
410 3300025949 Ga0207667_10020853 Ga0207667_100208532 209
411 3300025949 Ga0207667_10050199 Ga0207667_100501993 209
412 3300025949 Ga0207667_10054717 Ga0207667_100547173 209
413 3300025949 Ga0207667_10064171 Ga0207667_100641713 209
414 3300025949 Ga0207667_10068657 Ga0207667_100686574 209
415 3300025949 Ga0207667_10088316 Ga0207667_100883164 209
416 3300025949 Ga0207667_10101038 Ga0207667_101010382 209
417 3300025949 Ga0207667_10462820 Ga0207667_104628202 209
418 3300025949 Ga0207667_10686052 Ga0207667_106860522 209
419 3300025981 Ga0207640_10000475 Ga0207640_100004752 209
420 3300025981 Ga0207640_10001546 Ga0207640_100015462 209
421 3300025981 Ga0207640_10097290 Ga0207640_100972902 209
422 3300025981 Ga0207640_10271854 Ga0207640_102718542 209
423 3300025981 Ga0207640_10477498 Ga0207640_104774982 209
424 3300026023 Ga0207677_10002313 Ga0207677_100023133 209
425 3300026023 Ga0207677_10054263 Ga0207677_100542633 209
426 3300026035 Ga0207703_10005309 Ga0207703_100053092 209
427 3300026041 Ga0207639_10000310 Ga0207639_1000031019 209
428 3300026041 Ga0207639_10020123 Ga0207639_100201234 209
429 3300026041 Ga0207639_10115820 Ga0207639_101158203 209
430 3300026041 Ga0207639_10147881 Ga0207639_101478812 209
431 3300026041 Ga0207639_10591087 Ga0207639_105910871 209
432 3300026067 Ga0207678_10018079 Ga0207678_100180793 209
433 3300026067 Ga0207678_10037558 Ga0207678_100375584 209
434 3300026067 Ga0207678_10048900 Ga0207678_100489002 209
435 3300026067 Ga0207678_10174227 Ga0207678_101742272 209
436 3300026067 Ga0207678_10526291 Ga0207678_105262912 209
437 3300026078 Ga0207702_10002439 Ga0207702_1000243913 209
438 3300026078 Ga0207702_10003567 Ga0207702_100035673 209
439 3300026078 Ga0207702_10018572 Ga0207702_100185724 209
440 3300026078 Ga0207702_10043691 Ga0207702_100436914 209
441 3300026078 Ga0207702_10348616 Ga0207702_103486162 209
442 3300026088 Ga0207641_10111532 Ga0207641_101115322 209
443 3300026088 Ga0207641_10134902 Ga0207641_101349023 209
444 3300026088 Ga0207641_10966732 Ga0207641_109667321 209
445 3300026089 Ga0207648_10018404 Ga0207648_100184047 209
446 3300026089 Ga0207648_10038146 Ga0207648_100381464 209
447 3300026095 Ga0207676_10043793 Ga0207676_100437933 209
448 3300026095 Ga0207676_10297438 Ga0207676_102974382 209
449 3300026116 Ga0207674_10000788 Ga0207674_1000078824 209
450 3300026116 Ga0207674_10001141 Ga0207674_1000114120 209
451 3300026116 Ga0207674_10011664 Ga0207674_100116642 209
452 3300026116 Ga0207674_10293022 Ga0207674_102930222 209
453 3300026142 Ga0207698_10050509 Ga0207698_100505094 209
454 3300026142 Ga0207698_10141804 Ga0207698_101418041 209
455 3300026142 Ga0207698_10145965 Ga0207698_101459652 209
456 3300026142 Ga0207698_10223341 Ga0207698_102233412 209
457 3300028379 Ga0268266_10068899 Ga0268266_100688991 209
458 3300028381 Ga0268264_10089027 Ga0268264_100890273 209
459 3300028381 Ga0268264_10195924 Ga0268264_101959241 209
460 3300028800 Ga0265338_10194089 Ga0265338_101940891 209
461 3300028800 Ga0265338_10242551 Ga0265338_102425512 209
462 3300031239 Ga0265328_10012341 Ga0265328_100123413 209
463 3300031240 Ga0265320_10081168 Ga0265320_100811681 209
464 3300031241 Ga0265325_10106675 Ga0265325_101066752 209
465 3300031249 Ga0265339_10012509 Ga0265339_100125094 209
466 3300031344 Ga0265316_10022110 Ga0265316_100221105 209
467 3300031344 Ga0265316_10304224 Ga0265316_103042241 209
468 3300031711 Ga0265314_10019349 Ga0265314_100193493 209
469 3300031711 Ga0265314_10091875 Ga0265314_100918753 209
470 3300031712 Ga0265342_10118852 Ga0265342_101188522 209
471 3300033180 Ga0307510_10215282 Ga0307510_102152822 209
472 3300035083 Ga0373926_0154633 Ga0373926_0154633_62_700 209
473 3300035088 Ga0373940_0095184 Ga0373940_0095184_51_692 209
474 3300035111 Ga0373923_0117968 Ga0373923_0117968_421_1062 209
475 3300035113 Ga0373936_0018058 Ga0373936_0018058_246_887 209
476 3300035113 Ga0373936_0302339 Ga0373936_0302339_55_693 209
477 3300035170 Ga0373943_0023649 Ga0373943_0023649_1653_2291 209
478 3300035691 Ga0373931_0010165 Ga0373931_0010165_2033_2674 209
479 3300035691 Ga0373931_0138276 Ga0373931_0138276_755_1396 209
480 3300035692 Ga0373935_0013718 Ga0373935_0013718_626_1264 209
481 3300035692 Ga0373935_0172121 Ga0373935_0172121_801_1442 209
482 3300035695 Ga0373927_0021983 Ga0373927_0021983_379_1017 209
483 3300035695 Ga0373927_0039893 Ga0373927_0039893_2376_3017 209
484 3300035695 Ga0373927_0163341 Ga0373927_0163341_298_939 209
485 3300035724 Ga0373933_0192314 Ga0373933_0192314_598_1239 209
486 3300035724 Ga0373933_0489007 Ga0373933_0489007_55_699 209
487 3300035725 Ga0373947_0004501 Ga0373947_0004501_4288_4926 209
488 3300035725 Ga0373947_0415970 Ga0373947_0415970_23_664 209
489 3300037068 Ga0373925_0016455 Ga0373925_0016455_1800_2438 209
490 3300037068 Ga0373925_0018194 Ga0373925_0018194_623_1264 209
491 3300037068 Ga0373925_0070516 Ga0373925_0070516_642_1283 209
492 3300037853 Ga0436364_1158429 Ga0436364_1158429_378_1019 209
493 3300039438 Ga0436360_0783548 Ga0436360_0783548_1131_1763 209
494 3300039438 Ga0436360_1108617 Ga0436360_1108617_700_1332 209
495 3300039447 Ga0436361_0463072 Ga0436361_0463072_152_784 209
496 3300039447 Ga0436361_0483255 Ga0436361_0483255_316_948 209
497 3300039447 Ga0436361_0631728 Ga0436361_0631728_159_791 209
498 3300039447 Ga0436361_0947034 Ga0436361_0947034_5159_5791 209
499 3300039447 Ga0436361_1095759 Ga0436361_1095759_2720_3352 209
500 3300039450 Ga0436363_1654375 Ga0436363_1654375_1110_1751 209
501 3300044684 Ga0466966_0057362 Ga0466966_0057362_944_1576 209
502 3300044684 Ga0466966_0078211 Ga0466966_0078211_544_1173 209
503 3300044684 Ga0466966_0082339 Ga0466966_0082339_776_1417 209
504 3300044693 Ga0466961_0254355 Ga0466961_0254355_201_830 209
505 3300044693 Ga0466961_0448947 Ga0466961_0448947_44_673 209
506 3300044694 Ga0466963_0006138 Ga0466963_0006138_6420_7061 209
507 3300044694 Ga0466963_0059535 Ga0466963_0059535_1398_2039 209
508 3300044694 Ga0466963_0146659 Ga0466963_0146659_20_652 209
509 3300044842 Ga0466957_0062233 Ga0466957_0062233_260_901 209
510 3300045976 Ga0466967_0030305 Ga0466967_0030305_3071_3712 209
511 3300045976 Ga0466967_0051151 Ga0466967_0051151_796_1437 209
512 3300045976 Ga0466967_0062860 Ga0466967_0062860_282_926 209
513 3300046454 Ga0495592_0095508 Ga0495592_0095508_642_1274 209
514 3300046455 Ga0495603_0008277 Ga0495603_0008277_1584_2216 209
515 3300046455 Ga0495603_0052771 Ga0495603_0052771_768_1400 209
516 3300046459 Ga0495629_0018700 Ga0495629_0018700_1468_2100 209
517 3300046459 Ga0495629_0358945 Ga0495629_0358945_346_978 209
518 3300046460 Ga0495638_0236631 Ga0495638_0236631_347_979 209
519 3300046462 Ga0495651_0010080 Ga0495651_0010080_5317_5949 209
520 3300046463 Ga0495653_0002597 Ga0495653_0002597_12412_13044 209
521 3300046471 Ga0495650_0000010 Ga0495650_0000010_576490_577122 209
522 3300046472 Ga0495580_0000162 Ga0495580_0000162_38635_39276 209
523 3300046472 Ga0495580_0002488 Ga0495580_0002488_4131_4769 209
524 3300046472 Ga0495580_0050832 Ga0495580_0050832_625_1284 209
525 3300046472 Ga0495580_0089717 Ga0495580_0089717_996_1628 209
526 3300046472 Ga0495580_0125916 Ga0495580_0125916_59_691 209
527 3300046472 Ga0495580_0154488 Ga0495580_0154488_244_882 209
528 3300046472 Ga0495580_0273507 Ga0495580_0273507_194_826 209
529 3300046473 Ga0495582_0017051 Ga0495582_0017051_69_701 209
530 3300046473 Ga0495582_0037066 Ga0495582_0037066_273_905 209
531 3300046474 Ga0495605_0050413 Ga0495605_0050413_196_828 209
532 3300046475 Ga0495639_0001589 Ga0495639_0001589_5738_6370 209
533 3300046475 Ga0495639_0056967 Ga0495639_0056967_178_816 209
534 3300046475 Ga0495639_0156014 Ga0495639_0156014_217_858 209
535 3300046476 Ga0495662_0000645 Ga0495662_0000645_5237_5869 209
536 3300046477 Ga0495664_0010426 Ga0495664_0010426_3028_3660 209
537 3300046492 Ga0495585_0029334 Ga0495585_0029334_1736_2368 209
538 3300046499 Ga0495594_0001581 Ga0495594_0001581_7507_8139 209
539 3300046499 Ga0495594_0013311 Ga0495594_0013311_1545_2177 209
540 3300046499 Ga0495594_0017641 Ga0495594_0017641_1803_2435 209
541 3300046506 Ga0495583_0024207 Ga0495583_0024207_1338_1970 209
542 3300046507 Ga0495606_0133269 Ga0495606_0133269_752_1384 209
543 3300046511 Ga0495608_0020709 Ga0495608_0020709_829_1461 209
544 3300046516 Ga0495628_0001223 Ga0495628_0001223_3655_4287 209
545 3300046516 Ga0495628_0100780 Ga0495628_0100780_665_1294 209
546 3300046517 Ga0495630_0134707 Ga0495630_0134707_493_1134 209
547 3300046522 Ga0495643_0148070 Ga0495643_0148070_490_1122 209
548 3300046523 Ga0495644_0000118 Ga0495644_0000118_25563_26195 209
549 3300046526 Ga0495666_0010117 Ga0495666_0010117_3830_4468 209
550 3300046526 Ga0495666_0020928 Ga0495666_0020928_1620_2252 209
551 3300046528 Ga0495642_0015651 Ga0495642_0015651_1722_2354 209
552 3300046529 Ga0495652_0003190 Ga0495652_0003190_12184_12816 209
553 3300046529 Ga0495652_0193084 Ga0495652_0193084_484_1116 209
554 3300046529 Ga0495652_0296962 Ga0495652_0296962_66_695 209
555 3300046531 Ga0495665_0005640 Ga0495665_0005640_1927_2565 209
556 3300046531 Ga0495665_0011022 Ga0495665_0011022_1360_1992 209
557 3300046533 Ga0495640_0002236 Ga0495640_0002236_2900_3532 209
558 3300046535 Ga0495586_0001329 Ga0495586_0001329_11258_11890 209
559 3300046536 Ga0495587_0021849 Ga0495587_0021849_2908_3537 209
560 3300046536 Ga0495587_0055036 Ga0495587_0055036_1216_1848 209
561 3300046538 Ga0495609_0013222 Ga0495609_0013222_1186_1818 209
562 3300046538 Ga0495609_0146497 Ga0495609_0146497_178_810 209
563 3300046543 Ga0495645_0002700 Ga0495645_0002700_5837_6466 209
564 3300046543 Ga0495645_0026658 Ga0495645_0026658_3346_3978 209
565 3300046558 Ga0495633_0023778 Ga0495633_0023778_1539_2171 209
566 3300046559 Ga0495667_0001549 Ga0495667_0001549_4345_4977 209
567 3300046642 Ga0495634_0002593 Ga0495634_0002593_2071_2703 209
568 3300046648 Ga0495611_0077767 Ga0495611_0077767_163_795 209
569 3300046660 Ga0495625_0052277 Ga0495625_0052277_460_1092 209
570 3300046660 Ga0495625_0119271 Ga0495625_0119271_134_766 209
571 3300046660 Ga0495625_0175439 Ga0495625_0175439_734_1366 209
572 3300046660 Ga0495625_0220547 Ga0495625_0220547_532_1164 209
573 3300046663 Ga0495635_0012902 Ga0495635_0012902_4390_5022 209
574 3300046663 Ga0495635_0248430 Ga0495635_0248430_494_1126 209
575 3300046665 Ga0495661_0034257 Ga0495661_0034257_893_1525 209
576 3300046674 Ga0495588_0148462 Ga0495588_0148462_42_674 209
577 3300046678 Ga0495599_0001357 Ga0495599_0001357_3249_3881 209
578 3300046679 Ga0495623_0014020 Ga0495623_0014020_4156_4788 209
579 3300046679 Ga0495623_0049226 Ga0495623_0049226_98_727 209
580 3300046680 Ga0495646_0013488 Ga0495646_0013488_71_700 209
581 3300046680 Ga0495646_0046134 Ga0495646_0046134_829_1461 209
582 3300046681 Ga0495647_0057910 Ga0495647_0057910_309_941 209
583 3300046684 Ga0495669_0018605 Ga0495669_0018605_1522_2154 209
584 3300046689 Ga0495613_0005516 Ga0495613_0005516_1564_2196 209
585 3300046689 Ga0495613_0009988 Ga0495613_0009988_4839_5471 209
586 3300046689 Ga0495613_0065947 Ga0495613_0065947_795_1424 209
587 3300046689 Ga0495613_0537742 Ga0495613_0537742_12_644 209
588 3300046690 Ga0495624_0001915 Ga0495624_0001915_1216_1848 209
589 3300046690 Ga0495624_0327658 Ga0495624_0327658_23_664 209
590 3300046691 Ga0495670_0037315 Ga0495670_0037315_154_786 209
591 3300046794 Ga0495589_0069528 Ga0495589_0069528_1074_1706 209
592 3300046809 Ga0495600_0003635 Ga0495600_0003635_4093_4725 209
593 3300047315 Ga0495581_0000228 Ga0495581_0000228_3790_4422 209
594 3300047315 Ga0495581_0051089 Ga0495581_0051089_1476_2117 209
595 3300047317 Ga0495604_0000531 Ga0495604_0000531_31723_32355 209
596 3300047317 Ga0495604_0008803 Ga0495604_0008803_4095_4724 209
597 3300047319 Ga0495674_0036215 Ga0495674_0036215_2742_3374 209
598 3300047319 Ga0495674_0278427 Ga0495674_0278427_452_1084 209
599 3300047319 Ga0495674_0357418 Ga0495674_0357418_355_993 209
600 3300047320 Ga0495672_0002914 Ga0495672_0002914_34_666 209
601 3300047320 Ga0495672_0162073 Ga0495672_0162073_339_971 209
602 3300047321 Ga0495676_0013756 Ga0495676_0013756_1071_1703 209
603 3300047322 Ga0495680_0012626 Ga0495680_0012626_2878_3510 209
604 3300047444 Ga0495675_0000944 Ga0495675_0000944_12820_13452 209
605 3300047469 Ga0495673_0071849 Ga0495673_0071849_191_823 209
606 3300047470 Ga0495681_0148956 Ga0495681_0148956_124_756 209
607 3300047471 Ga0495684_0043160 Ga0495684_0043160_1859_2491 209
608 3300047472 Ga0495686_0000018 Ga0495686_0000018_170449_171084 209
609 3300047472 Ga0495686_0003658 Ga0495686_0003658_631_1266 209
610 3300047472 Ga0495686_0010318 Ga0495686_0010318_2909_3547 209
611 3300047472 Ga0495686_0019632 Ga0495686_0019632_2607_3242 209
612 3300047472 Ga0495686_0058454 Ga0495686_0058454_1765_2394 209
613 3300047673 Ga0495593_0005453 Ga0495593_0005453_2380_3012 209
614 3300047673 Ga0495593_0107162 Ga0495593_0107162_370_1011 209
615 3300048088 Ga0495602_0137015 Ga0495602_0137015_128_757 209
616 3300048088 Ga0495602_0224549 Ga0495602_0224549_467_1105 209
617 3300048088 Ga0495602_0225842 Ga0495602_0225842_359_1000 209
618 3300048089 Ga0495614_0000079 Ga0495614_0000079_6449_7081 209
619 3300048089 Ga0495614_0001908 Ga0495614_0001908_8196_8828 209
620 3300048089 Ga0495614_0045777 Ga0495614_0045777_1221_1859 209
621 3300048905 Ga0496102_0076658 Ga0496102_0076658_361_1002 209
622 3300048907 Ga0496104_0002087 Ga0496104_0002087_9828_10463 209
623 3300048907 Ga0496104_0181505 Ga0496104_0181505_1191_1832 209
624 3300048907 Ga0496104_0272472 Ga0496104_0272472_300_932 209
625 3300048907 Ga0496104_1026326 Ga0496104_1026326_49_690 209
626 3300048908 Ga0496105_0082594 Ga0496105_0082594_1795_2427 209
627 3300048908 Ga0496105_0117885 Ga0496105_0117885_1045_1686 209
628 3300048915 Ga0496112_0001864 Ga0496112_0001864_15155_15796 209
629 3300048915 Ga0496112_0028267 Ga0496112_0028267_851_1492 209
630 3300048915 Ga0496112_0057083 Ga0496112_0057083_404_1045 209
631 3300048915 Ga0496112_0092413 Ga0496112_0092413_2260_2901 209
632 3300048915 Ga0496112_0118538 Ga0496112_0118538_233_871 209
633 3300048916 Ga0496113_0312179 Ga0496113_0312179_382_1020 209
634 3300048924 Ga0496121_0417478 Ga0496121_0417478_200_832 209
635 3300048927 Ga0496124_0237730 Ga0496124_0237730_387_1028 209
636 3300048929 Ga0496126_0000004 Ga0496126_0000004_90244_90876 209
637 3300048929 Ga0496126_0001033 Ga0496126_0001033_26737_27369 209
638 3300049460 Ga0495682_0070227 Ga0495682_0070227_117_749 209
639 3300049569 Ga0501032_0022516 Ga0501032_0022516_2775_3407 209
640 3300049569 Ga0501032_0169470 Ga0501032_0169470_126_758 209
641 3300049571 Ga0501034_0035278 Ga0501034_0035278_3474_4106 209
642 3300049572 Ga0501036_0028098 Ga0501036_0028098_974_1606 209
643 3300049573 Ga0501037_0021275 Ga0501037_0021275_3110_3742 209
644 3300049573 Ga0501037_0087981 Ga0501037_0087981_1100_1732 209
645 3300049573 Ga0501037_0175354 Ga0501037_0175354_415_1047 209
646 3300049574 Ga0501038_0002278 Ga0501038_0002278_13929_14561 209
647 3300049574 Ga0501038_0040290 Ga0501038_0040290_942_1574 209
648 3300049579 Ga0501043_0009547 Ga0501043_0009547_2879_3511 209
649 3300049580 Ga0501046_0000448 Ga0501046_0000448_35548_36180 209
650 3300049581 Ga0501047_0000517 Ga0501047_0000517_7708_8340 209
651 3300049581 Ga0501047_0014404 Ga0501047_0014404_1285_1917 209
652 3300049586 Ga0501070_0070040 Ga0501070_0070040_1747_2379 209
653 3300049586 Ga0501070_0154479 Ga0501070_0154479_439_1071 209
654 3300049589 Ga0501073_0017179 Ga0501073_0017179_3672_4304 209
655 3300049589 Ga0501073_0125600 Ga0501073_0125600_303_935 209
656 3300049589 Ga0501073_0690424 Ga0501073_0690424_24_656 209
657 3300049590 Ga0501074_0282354 Ga0501074_0282354_173_805 209
658 3300049742 Ga0501080_0046116 Ga0501080_0046116_1998_2630 209
659 3300049822 Ga0501035_0011383 Ga0501035_0011383_7260_7892 209
660 3300049822 Ga0501035_0179859 Ga0501035_0179859_438_1070 209
661 3300049823 Ga0501044_0018099 Ga0501044_0018099_291_923 209
662 3300049823 Ga0501044_0024458 Ga0501044_0024458_3876_4508 209
663 3300050512 nmdc:mga0n895_34721_c1 nmdc:mga0n895_34721_c1_2776_3414 209
664 3300050513 nmdc:mga0rr50_119202_c1 nmdc:mga0rr50_119202_c1_1450_2088 209
665 3300050513 nmdc:mga0rr50_9844_c1 nmdc:mga0rr50_9844_c1_3096_3734 209
666 3300050514 nmdc:mga08x19_3300_c1 nmdc:mga08x19_3300_c1_2996_3634 209
667 3300053093 Ga0500651_0000008 Ga0500651_0000008_157615_158247 209
668 3300053119 Ga0500595_000112 Ga0500595_000112_16300_16932 209
669 3300053119 Ga0500595_030389 Ga0500595_030389_120_752 209
670 3300055283 Ga0500661_001396 Ga0500661_001396_491_1123 209
671 3300003320 rootH2_10022170 rootH2_100221702 210
672 3300003320 rootH2_10078606 rootH2_100786062 210
673 3300003323 rootH1_10121456 rootH1_101214562 210
674 3300005329 Ga0070683_100034144 Ga0070683_1000341443 210
675 3300005329 Ga0070683_100851797 Ga0070683_1008517971 210
676 3300005331 Ga0070670_100001274 Ga0070670_10000127411 210
677 3300005334 Ga0068869_100001599 Ga0068869_10000159910 210
678 3300005334 Ga0068869_100131161 Ga0068869_1001311612 210
679 3300005335 Ga0070666_10061935 Ga0070666_100619353 210
680 3300005335 Ga0070666_10062367 Ga0070666_100623673 210
681 3300005338 Ga0068868_100000384 Ga0068868_10000038414 210
682 3300005338 Ga0068868_100298732 Ga0068868_1002987322 210
683 3300005344 Ga0070661_100004625 Ga0070661_1000046252 210
684 3300005344 Ga0070661_100005501 Ga0070661_1000055013 210
685 3300005344 Ga0070661_100064130 Ga0070661_1000641302 210
686 3300005344 Ga0070661_100244713 Ga0070661_1002447132 210
687 3300005344 Ga0070661_100405992 Ga0070661_1004059922 210
688 3300005347 Ga0070668_100047969 Ga0070668_1000479693 210
689 3300005354 Ga0070675_100043957 Ga0070675_1000439574 210
690 3300005355 Ga0070671_100002611 Ga0070671_1000026115 210
691 3300005355 Ga0070671_100219338 Ga0070671_1002193382 210
692 3300005367 Ga0070667_100002702 Ga0070667_1000027026 210
693 3300005367 Ga0070667_100076833 Ga0070667_1000768332 210
694 3300005436 Ga0070713_100754837 Ga0070713_1007548371 210
695 3300005457 Ga0070662_100327296 Ga0070662_1003272962 210
696 3300005535 Ga0070684_100000393 Ga0070684_10000039314 210
697 3300005535 Ga0070684_100015832 Ga0070684_1000158325 210
698 3300005535 Ga0070684_100154968 Ga0070684_1001549683 210
699 3300005539 Ga0068853_100000123 Ga0068853_1000001233 210
700 3300005539 Ga0068853_100020915 Ga0068853_1000209156 210
701 3300005546 Ga0070696_100034275 Ga0070696_1000342754 210
702 3300005548 Ga0070665_100002508 Ga0070665_1000025087 210
703 3300005548 Ga0070665_100132681 Ga0070665_1001326812 210
704 3300005563 Ga0068855_100000966 Ga0068855_10000096622 210
705 3300005563 Ga0068855_100001407 Ga0068855_1000014072 210
706 3300005563 Ga0068855_100001596 Ga0068855_10000159614 210
707 3300005563 Ga0068855_100101126 Ga0068855_1001011264 210
708 3300005577 Ga0068857_100000552 Ga0068857_1000005522 210
709 3300005577 Ga0068857_100009010 Ga0068857_1000090104 210
710 3300005577 Ga0068857_100034840 Ga0068857_1000348405 210
711 3300005577 Ga0068857_100067393 Ga0068857_1000673932 210
712 3300005577 Ga0068857_100233139 Ga0068857_1002331393 210
713 3300005578 Ga0068854_100054568 Ga0068854_1000545683 210
714 3300005614 Ga0068856_100001047 Ga0068856_10000104715 210
715 3300005614 Ga0068856_100002586 Ga0068856_1000025865 210
716 3300005614 Ga0068856_100016682 Ga0068856_1000166823 210
717 3300005614 Ga0068856_100094952 Ga0068856_1000949524 210
718 3300005614 Ga0068856_100223046 Ga0068856_1002230462 210
719 3300005614 Ga0068856_100664591 Ga0068856_1006645912 210
720 3300005616 Ga0068852_100000247 Ga0068852_10000024722 210
721 3300005616 Ga0068852_100000293 Ga0068852_10000029324 210
722 3300005616 Ga0068852_100063954 Ga0068852_1000639543 210
723 3300005616 Ga0068852_100724848 Ga0068852_1007248482 210
724 3300005617 Ga0068859_100026677 Ga0068859_1000266776 210
725 3300005618 Ga0068864_100001344 Ga0068864_1000013445 210
726 3300005834 Ga0068851_10006997 Ga0068851_100069973 210
727 3300005834 Ga0068851_10029831 Ga0068851_100298313 210
728 3300005834 Ga0068851_10243866 Ga0068851_102438662 210
729 3300005841 Ga0068863_100000464 Ga0068863_10000046427 210
730 3300005842 Ga0068858_100002355 Ga0068858_1000023559 210
731 3300005843 Ga0068860_100000665 Ga0068860_10000066523 210
732 3300005843 Ga0068860_100052836 Ga0068860_1000528362 210
733 3300006028 Ga0070717_10442822 Ga0070717_104428222 210
734 3300006028 Ga0070717_10542338 Ga0070717_105423382 210
735 3300006237 Ga0097621_100000983 Ga0097621_1000009839 210
736 3300006237 Ga0097621_100116176 Ga0097621_1001161762 210
737 3300006358 Ga0068871_100000648 Ga0068871_1000006488 210
738 3300006358 Ga0068871_100115495 Ga0068871_1001154952 210
739 3300006881 Ga0068865_100035423 Ga0068865_1000354234 210
740 3300006931 Ga0097620_100026677 Ga0097620_1000266776 210
741 3300009093 Ga0105240_10000187 Ga0105240_1000018759 210
742 3300009093 Ga0105240_10001148 Ga0105240_1000114815 210
743 3300009093 Ga0105240_10002927 Ga0105240_100029275 210
744 3300009093 Ga0105240_10003423 Ga0105240_100034236 210
745 3300009093 Ga0105240_10060070 Ga0105240_100600702 210
746 3300009093 Ga0105240_10267562 Ga0105240_102675622 210
747 3300009093 Ga0105240_10598803 Ga0105240_105988032 210
748 3300009093 Ga0105240_10706305 Ga0105240_107063052 210
749 3300009093 Ga0105240_10864570 Ga0105240_108645702 210
750 3300009098 Ga0105245_10001333 Ga0105245_100013339 210
751 3300009098 Ga0105245_10268973 Ga0105245_102689732 210
752 3300009101 Ga0105247_10003250 Ga0105247_100032504 210
753 3300009101 Ga0105247_10072259 Ga0105247_100722592 210
754 3300009174 Ga0105241_10000313 Ga0105241_100003135 210
755 3300009174 Ga0105241_10000472 Ga0105241_100004729 210
756 3300009174 Ga0105241_10003700 Ga0105241_100037008 210
757 3300009174 Ga0105241_10160947 Ga0105241_101609472 210
758 3300009174 Ga0105241_10163278 Ga0105241_101632782 210
759 3300009174 Ga0105241_10189247 Ga0105241_101892472 210
760 3300009174 Ga0105241_10238146 Ga0105241_102381462 210
761 3300009176 Ga0105242_10174177 Ga0105242_101741772 210
762 3300009177 Ga0105248_10000011 Ga0105248_10000011118 210
763 3300009177 Ga0105248_10002466 Ga0105248_1000246612 210
764 3300009177 Ga0105248_10050299 Ga0105248_100502995 210
765 3300009177 Ga0105248_10735182 Ga0105248_107351822 210
766 3300009545 Ga0105237_10155299 Ga0105237_101552994 210
767 3300009545 Ga0105237_10223822 Ga0105237_102238222 210
768 3300009545 Ga0105237_10303193 Ga0105237_103031932 210
769 3300009551 Ga0105238_10000395 Ga0105238_1000039515 210
770 3300009551 Ga0105238_10002128 Ga0105238_100021289 210
771 3300009551 Ga0105238_10002691 Ga0105238_1000269112 210
772 3300009551 Ga0105238_10012308 Ga0105238_100123082 210
773 3300009551 Ga0105238_10458228 Ga0105238_104582282 210
774 3300009551 Ga0105238_11358524 Ga0105238_113585241 210
775 3300009553 Ga0105249_10042856 Ga0105249_100428563 210
776 3300010375 Ga0105239_10003401 Ga0105239_1000340111 210
777 3300010375 Ga0105239_10003500 Ga0105239_100035003 210
778 3300010375 Ga0105239_10004456 Ga0105239_100044565 210
779 3300010375 Ga0105239_10115591 Ga0105239_101155914 210
780 3300010375 Ga0105239_10409743 Ga0105239_104097432 210
781 3300010375 Ga0105239_11093413 Ga0105239_110934132 210
782 3300011119 Ga0105246_10000383 Ga0105246_1000038310 210
783 3300011119 Ga0105246_10117939 Ga0105246_101179392 210
784 3300013102 Ga0157371_10322006 Ga0157371_103220062 210
785 3300013104 Ga0157370_10000066 Ga0157370_1000006658 210
786 3300013105 Ga0157369_10000188 Ga0157369_1000018834 210
787 3300013105 Ga0157369_10002371 Ga0157369_100023713 210
788 3300013105 Ga0157369_10006629 Ga0157369_100066299 210
789 3300013105 Ga0157369_10008084 Ga0157369_100080844 210
790 3300013105 Ga0157369_10019768 Ga0157369_1001976810 210
791 3300013105 Ga0157369_10026507 Ga0157369_100265075 210
792 3300013105 Ga0157369_10108941 Ga0157369_101089414 210
793 3300013105 Ga0157369_10160847 Ga0157369_101608472 210
794 3300013105 Ga0157369_10626134 Ga0157369_106261341 210
795 3300013296 Ga0157374_10002414 Ga0157374_100024144 210
796 3300013296 Ga0157374_10004017 Ga0157374_100040177 210
797 3300013296 Ga0157374_10167391 Ga0157374_101673911 210
798 3300013296 Ga0157374_10456802 Ga0157374_104568022 210
799 3300013297 Ga0157378_10001685 Ga0157378_100016856 210
800 3300013297 Ga0157378_10086840 Ga0157378_100868402 210
801 3300013297 Ga0157378_10188937 Ga0157378_101889372 210
802 3300013306 Ga0163162_10002694 Ga0163162_100026943 210
803 3300013306 Ga0163162_10429527 Ga0163162_104295272 210
804 3300013306 Ga0163162_10528626 Ga0163162_105286262 210
805 3300013307 Ga0157372_10000114 Ga0157372_100001146 210
806 3300013307 Ga0157372_10002853 Ga0157372_100028535 210
807 3300013307 Ga0157372_10011455 Ga0157372_100114555 210
808 3300013307 Ga0157372_10091771 Ga0157372_100917712 210
809 3300013307 Ga0157372_10439875 Ga0157372_104398752 210
810 3300013307 Ga0157372_10520469 Ga0157372_105204692 210
811 3300013307 Ga0157372_10555192 Ga0157372_105551922 210
812 3300013308 Ga0157375_10000856 Ga0157375_1000085613 210
813 3300013308 Ga0157375_10014048 Ga0157375_100140482 210
814 3300014325 Ga0163163_10000740 Ga0163163_1000074015 210
815 3300014745 Ga0157377_10112810 Ga0157377_101128102 210
816 3300014968 Ga0157379_10000286 Ga0157379_1000028622 210
817 3300014968 Ga0157379_10230808 Ga0157379_102308082 210
818 3300014969 Ga0157376_10001538 Ga0157376_100015388 210
819 3300014969 Ga0157376_10171032 Ga0157376_101710322 210
820 3300017792 Ga0163161_10006873 Ga0163161_100068732 210
821 3300025321 Ga0207656_10004327 Ga0207656_100043273 210
822 3300025321 Ga0207656_10142842 Ga0207656_101428422 210
823 3300025900 Ga0207710_10000299 Ga0207710_1000029922 210
824 3300025900 Ga0207710_10039833 Ga0207710_100398332 210
825 3300025903 Ga0207680_10157745 Ga0207680_101577452 210
826 3300025904 Ga0207647_10108193 Ga0207647_101081932 210
827 3300025911 Ga0207654_10000487 Ga0207654_1000048717 210
828 3300025911 Ga0207654_10001935 Ga0207654_100019352 210
829 3300025911 Ga0207654_10262661 Ga0207654_102626612 210
830 3300025911 Ga0207654_10433796 Ga0207654_104337961 210
831 3300025913 Ga0207695_10000052 Ga0207695_10000052257 210
832 3300025913 Ga0207695_10000108 Ga0207695_1000010873 210
833 3300025913 Ga0207695_10000253 Ga0207695_1000025373 210
834 3300025913 Ga0207695_10000345 Ga0207695_1000034573 210
835 3300025913 Ga0207695_10001120 Ga0207695_1000112024 210
836 3300025913 Ga0207695_10010544 Ga0207695_100105448 210
837 3300025913 Ga0207695_10010731 Ga0207695_100107314 210
838 3300025913 Ga0207695_10258125 Ga0207695_102581252 210
839 3300025914 Ga0207671_10000081 Ga0207671_1000008140 210
840 3300025914 Ga0207671_10001179 Ga0207671_1000117923 210
841 3300025914 Ga0207671_10215673 Ga0207671_102156732 210
842 3300025920 Ga0207649_10008087 Ga0207649_100080876 210
843 3300025920 Ga0207649_10028029 Ga0207649_100280292 210
844 3300025920 Ga0207649_10238211 Ga0207649_102382112 210
845 3300025920 Ga0207649_10246164 Ga0207649_102461642 210
846 3300025920 Ga0207649_10268036 Ga0207649_102680362 210
847 3300025924 Ga0207694_10000029 Ga0207694_10000029180 210
848 3300025924 Ga0207694_10000313 Ga0207694_1000031324 210
849 3300025924 Ga0207694_10003163 Ga0207694_100031637 210
850 3300025924 Ga0207694_10003655 Ga0207694_100036555 210
851 3300025925 Ga0207650_10037223 Ga0207650_100372233 210
852 3300025926 Ga0207659_10067520 Ga0207659_100675202 210
853 3300025927 Ga0207687_10013081 Ga0207687_100130815 210
854 3300025927 Ga0207687_10051593 Ga0207687_100515933 210
855 3300025927 Ga0207687_10582162 Ga0207687_105821622 210
856 3300025931 Ga0207644_10003761 Ga0207644_100037613 210
857 3300025931 Ga0207644_10187569 Ga0207644_101875692 210
858 3300025931 Ga0207644_10212893 Ga0207644_102128932 210
859 3300025933 Ga0207706_10089936 Ga0207706_100899363 210
860 3300025938 Ga0207704_10189902 Ga0207704_101899022 210
861 3300025941 Ga0207711_10000028 Ga0207711_1000002853 210
862 3300025941 Ga0207711_10002491 Ga0207711_100024913 210
863 3300025941 Ga0207711_10022828 Ga0207711_100228285 210
864 3300025941 Ga0207711_10150869 Ga0207711_101508692 210
865 3300025942 Ga0207689_10003619 Ga0207689_100036194 210
866 3300025942 Ga0207689_10026241 Ga0207689_100262413 210
867 3300025944 Ga0207661_10000229 Ga0207661_100002296 210
868 3300025945 Ga0207679_10269386 Ga0207679_102693862 210
869 3300025949 Ga0207667_10003631 Ga0207667_100036316 210
870 3300025949 Ga0207667_10004738 Ga0207667_1000473811 210
871 3300025949 Ga0207667_10021791 Ga0207667_100217914 210
872 3300025981 Ga0207640_10127637 Ga0207640_101276373 210
873 3300025986 Ga0207658_10001177 Ga0207658_100011773 210
874 3300026023 Ga0207677_10000025 Ga0207677_1000002578 210
875 3300026023 Ga0207677_10000049 Ga0207677_1000004964 210
876 3300026023 Ga0207677_10371649 Ga0207677_103716492 210
877 3300026035 Ga0207703_10000516 Ga0207703_100005166 210
878 3300026035 Ga0207703_10087100 Ga0207703_100871003 210
879 3300026041 Ga0207639_10000055 Ga0207639_1000005513 210
880 3300026041 Ga0207639_10073387 Ga0207639_100733872 210
881 3300026041 Ga0207639_10227711 Ga0207639_102277112 210
882 3300026041 Ga0207639_10253981 Ga0207639_102539812 210
883 3300026067 Ga0207678_10153644 Ga0207678_101536442 210
884 3300026078 Ga0207702_10000341 Ga0207702_1000034128 210
885 3300026078 Ga0207702_10002856 Ga0207702_1000285612 210
886 3300026078 Ga0207702_10011207 Ga0207702_100112072 210
887 3300026078 Ga0207702_10103574 Ga0207702_101035743 210
888 3300026078 Ga0207702_10118183 Ga0207702_101181832 210
889 3300026088 Ga0207641_10002209 Ga0207641_100022096 210
890 3300026095 Ga0207676_10005540 Ga0207676_100055405 210
891 3300026116 Ga0207674_10001426 Ga0207674_100014262 210
892 3300026116 Ga0207674_10013987 Ga0207674_100139874 210
893 3300026116 Ga0207674_10257474 Ga0207674_102574742 210
894 3300026116 Ga0207674_10282446 Ga0207674_102824462 210
895 3300026121 Ga0207683_10000884 Ga0207683_1000088417 210
896 3300026142 Ga0207698_10000034 Ga0207698_1000003479 210
897 3300026142 Ga0207698_10000215 Ga0207698_1000021524 210
898 3300026142 Ga0207698_10129999 Ga0207698_101299993 210
899 3300026142 Ga0207698_10465252 Ga0207698_104652522 210
900 3300028379 Ga0268266_10143177 Ga0268266_101431772 210
901 3300028379 Ga0268266_10415256 Ga0268266_104152562 210
902 3300028381 Ga0268264_10000086 Ga0268264_1000008614 210
903 3300028381 Ga0268264_10109020 Ga0268264_101090202 210
904 3300028666 Ga0265336_10001257 Ga0265336_100012578 210
905 3300028800 Ga0265338_10020190 Ga0265338_100201902 210
906 3300028800 Ga0265338_10093855 Ga0265338_100938551 210
907 3300028800 Ga0265338_10266382 Ga0265338_102663822 210
908 3300030878 Ga0265770_1006415 Ga0265770_10064152 210
909 3300031235 Ga0265330_10013687 Ga0265330_100136872 210
910 3300031239 Ga0265328_10015519 Ga0265328_100155192 210
911 3300031241 Ga0265325_10004552 Ga0265325_100045527 210
912 3300031247 Ga0265340_10126465 Ga0265340_101264652 210
913 3300031249 Ga0265339_10000028 Ga0265339_1000002888 210
914 3300031249 Ga0265339_10132815 Ga0265339_101328152 210
915 3300031251 Ga0265327_10302658 Ga0265327_103026581 210
916 3300031344 Ga0265316_10050288 Ga0265316_100502883 210
917 3300031344 Ga0265316_10075669 Ga0265316_100756692 210
918 3300031711 Ga0265314_10094363 Ga0265314_100943632 210
919 3300031712 Ga0265342_10003417 Ga0265342_100034177 210
920 3300031712 Ga0265342_10063841 Ga0265342_100638412 210
921 3300035692 Ga0373935_0270970 Ga0373935_0270970_461_1111 210
922 3300035724 Ga0373933_0093101 Ga0373933_0093101_1114_1746 210
923 3300036401 Ga0373937_0024608 Ga0373937_0024608_4101_4733 210
924 3300036401 Ga0373937_0045037 Ga0373937_0045037_256_906 210
925 3300037068 Ga0373925_0682444 Ga0373925_0682444_19_651 210
926 3300037471 Ga0395905_0064991 Ga0395905_0064991_1000_1638 210
927 3300037471 Ga0395905_0238240 Ga0395905_0238240_531_1169 210
928 3300044694 Ga0466963_0021416 Ga0466963_0021416_3165_3815 210
929 3300045049 Ga0466959_0089392 Ga0466959_0089392_1525_2199 210
930 3300045976 Ga0466967_0001765 Ga0466967_0001765_8423_9073 210
931 3300046459 Ga0495629_0120306 Ga0495629_0120306_131_781 210
932 3300046462 Ga0495651_0385408 Ga0495651_0385408_156_806 210
933 3300046472 Ga0495580_0062715 Ga0495580_0062715_1876_2526 210
934 3300046529 Ga0495652_0061333 Ga0495652_0061333_238_888 210
935 3300046529 Ga0495652_0210540 Ga0495652_0210540_203_853 210
936 3300046535 Ga0495586_0139985 Ga0495586_0139985_687_1337 210
937 3300046536 Ga0495587_0032591 Ga0495587_0032591_1504_2154 210
938 3300046536 Ga0495587_0034499 Ga0495587_0034499_1930_2580 210
939 3300046536 Ga0495587_0326820 Ga0495587_0326820_209_841 210
940 3300046543 Ga0495645_0028592 Ga0495645_0028592_1561_2211 210
941 3300046543 Ga0495645_0110279 Ga0495645_0110279_225_875 210
942 3300046559 Ga0495667_0404810 Ga0495667_0404810_187_837 210
943 3300046559 Ga0495667_0510648 Ga0495667_0510648_48_698 210
944 3300046664 Ga0495659_0069980 Ga0495659_0069980_459_1097 210
945 3300046684 Ga0495669_0011807 Ga0495669_0011807_2289_2936 210
946 3300046689 Ga0495613_0012524 Ga0495613_0012524_4062_4712 210
947 3300046689 Ga0495613_0075314 Ga0495613_0075314_1367_2017 210
948 3300046809 Ga0495600_0085023 Ga0495600_0085023_985_1635 210
949 3300048088 Ga0495602_0066150 Ga0495602_0066150_470_1120 210
950 3300048088 Ga0495602_0082682 Ga0495602_0082682_457_1107 210
951 3300048088 Ga0495602_0151025 Ga0495602_0151025_652_1284 210
952 3300048904 Ga0496101_0339358 Ga0496101_0339358_520_1170 210
953 3300048905 Ga0496102_0305309 Ga0496102_0305309_136_786 210
954 3300048907 Ga0496104_0021972 Ga0496104_0021972_3342_3992 210
955 3300048908 Ga0496105_0334237 Ga0496105_0334237_246_896 210
956 3300048912 Ga0496109_0318856 Ga0496109_0318856_656_1306 210
957 3300048913 Ga0496110_0174183 Ga0496110_0174183_805_1455 210
958 3300048917 Ga0496114_0022423 Ga0496114_0022423_840_1490 210
959 3300048918 Ga0496115_0019046 Ga0496115_0019046_4058_4708 210
960 3300048918 Ga0496115_0102142 Ga0496115_0102142_53_685 210
961 3300053084 Ga0495595_0217554 Ga0495595_0217554_266_916 210
962 3300053088 Ga0500644_0098210 Ga0500644_0098210_420_1064 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

49

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.8206 23 150
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.8196 23 203
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.8102 23 208
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.8059 20 203
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7943 23 203
ID Description Score Start End Superfamily
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.846 9 208 1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.838 9 208 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8289 21 204 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8246 18 201 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.824 18 203 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1D2UDN1-F1-model_v4 Glycine/betaine ABC transporter 0.8902 5 206 GO:0005886
GO:0031460
GO:0055085
AF-A0A1C6AVT0-F1-model_v4 Putative osmoprotectant uptake system permease protein yehW 0.8559 6 208 GO:0005886
GO:0031460
GO:0055085
AF-A0A1D2UDN1-F1-model_v4 Glycine/betaine ABC transporter 0.8553 5 206 GO:0005886
GO:0031460
GO:0055085
AF-A0A6B0PQ89-F1-model_v4 deleted 0.8536 7 205
AF-A0A7X8HZ53-F1-model_v4 ABC transporter permease 0.8514 23 206 GO:0005886
GO:0031460
GO:0055085

Feature Viewer

pLDDT pTM Quality
73.19 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map