F486737

General Info

Members Datasets Scaffolds Average Seq Length
956 328 1912 114

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100031872|Ga0070684_1000318722
Length 132
Sequence MIPSALDGIKCRVYDSDMTSRELDLLQGTLDVLVLRALSWGSMHGYAVARFIRAGSDNTFKVLDGALYTSLHRMEERGWVESEWGASDKKKRAKFYRLTAAGRRALRSETESWNDYVAAVGRVMTATPEAAT

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
303 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
304 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
305 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 0.94
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 25.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100031872 3300005535 Bacteria 4490
2 JGI25406J46586_10049714 3300003203 Bacteria 1413
3 rootH1_10324040 3300003323 Bacteria 1008
4 Ga0065712_10071943 3300005290 Unclassified 4976
5 Ga0065712_10353962 3300005290 Bacteria 784
6 Ga0065712_10675278 3300005290 Unclassified 557
7 Ga0070658_10416465 3300005327 Bacteria 1155
8 Ga0070658_11070524 3300005327 Unclassified 701
9 Ga0070676_10708376 3300005328 Bacteria 736
10 Ga0070683_100018417 3300005329 Bacteria 6186
11 Ga0070683_100019090 3300005329 Bacteria 6083
12 Ga0070683_100020750 3300005329 Bacteria 5852
13 Ga0070683_100031481 3300005329 Bacteria 4824
14 Ga0070683_100059446 3300005329 Bacteria 3551
15 Ga0070683_100070682 3300005329 Bacteria 3256
16 Ga0070683_100098223 3300005329 Unclassified 2755
17 Ga0070683_100114587 3300005329 Unclassified 2544
18 Ga0070683_100177316 3300005329 Bacteria 2023
19 Ga0070683_102299957 3300005329 Unclassified 517
20 Ga0070683_102385081 3300005329 Unclassified 507
21 Ga0070690_100012432 3300005330 Bacteria 5009
22 Ga0070690_100023235 3300005330 Bacteria 3801
23 Ga0070690_100088751 3300005330 Bacteria 2033
24 Ga0070670_100006749 3300005331 Bacteria 9728
25 Ga0070670_100141338 3300005331 Bacteria 2082
26 Ga0070670_100897421 3300005331 Unclassified 803
27 Ga0070677_10499716 3300005333 Bacteria 659
28 Ga0068869_100003425 3300005334 Bacteria 9695
29 Ga0068869_100100627 3300005334 Bacteria 2186
30 Ga0070666_10538142 3300005335 Bacteria 849
31 Ga0070680_100000097 3300005336 Bacteria 50005
32 Ga0070680_100001723 3300005336 Bacteria 16057
33 Ga0070680_100004718 3300005336 Bacteria 10257
34 Ga0070680_100038351 3300005336 Bacteria 3875
35 Ga0070680_100370077 3300005336 Bacteria 1219
36 Ga0070680_100560826 3300005336 Unclassified 979
37 Ga0070680_100657946 3300005336 Unclassified 900
38 Ga0070680_101906129 3300005336 Unclassified 515
39 Ga0070682_100002777 3300005337 Bacteria 9697
40 Ga0070682_101831392 3300005337 Bacteria 530
41 Ga0068868_100105702 3300005338 Bacteria 2283
42 Ga0068868_101007467 3300005338 Bacteria 762
43 Ga0070660_100021143 3300005339 Bacteria 4794
44 Ga0070660_100501108 3300005339 Unclassified 1010
45 Ga0070660_100726285 3300005339 Bacteria 833
46 Ga0070689_100068372 3300005340 Bacteria 2771
47 Ga0070689_100694190 3300005340 Unclassified 888
48 Ga0070691_10325942 3300005341 Unclassified 846
49 Ga0070687_100023637 3300005343 Bacteria 2922
50 Ga0070687_100102409 3300005343 Bacteria 1606
51 Ga0070661_100000874 3300005344 Bacteria 21640
52 Ga0070661_100422985 3300005344 Bacteria 1056
53 Ga0070661_100495646 3300005344 Bacteria 977
54 Ga0070661_100718999 3300005344 Bacteria 815
55 Ga0070692_10044946 3300005345 Bacteria 2277
56 Ga0070692_10498481 3300005345 Bacteria 789
57 Ga0070668_100162886 3300005347 Bacteria 1811
58 Ga0070668_100271815 3300005347 Bacteria 1413
59 Ga0070668_100336690 3300005347 Unclassified 1274
60 Ga0070669_100026132 3300005353 Bacteria 4199
61 Ga0070669_101049075 3300005353 Unclassified 701
62 Ga0070675_100007979 3300005354 Bacteria 8202
63 Ga0070675_100605443 3300005354 Bacteria 994
64 Ga0070675_100773994 3300005354 Bacteria 877
65 Ga0070675_100913635 3300005354 Unclassified 805
66 Ga0070675_101066634 3300005354 Unclassified 742
67 Ga0070671_100007789 3300005355 Bacteria 8555
68 Ga0070671_100154049 3300005355 Bacteria 1941
69 Ga0070671_100165973 3300005355 Bacteria 1867
70 Ga0070671_101582214 3300005355 Unclassified 581
71 Ga0070674_100533845 3300005356 Unclassified 982
72 Ga0070674_101401397 3300005356 Bacteria 626
73 Ga0070673_100149793 3300005364 Unclassified 1975
74 Ga0070673_100329695 3300005364 Bacteria 1350
75 Ga0070688_100025366 3300005365 Bacteria 3509
76 Ga0070659_100001208 3300005366 Bacteria 18774
77 Ga0070667_100014949 3300005367 Bacteria 6411
78 Ga0070667_101086435 3300005367 Bacteria 748
79 Ga0070703_10180602 3300005406 Bacteria 815
80 Ga0070709_10001029 3300005434 Bacteria 15432
81 Ga0070709_10427254 3300005434 Bacteria 994
82 Ga0070709_11491240 3300005434 Bacteria 549
83 Ga0070714_100024663 3300005435 Bacteria 4955
84 Ga0070714_100030581 3300005435 Bacteria 4484
85 Ga0070714_101441917 3300005435 Unclassified 672
86 Ga0070713_100002277 3300005436 Bacteria 12475
87 Ga0070713_100049800 3300005436 Unclassified 3458
88 Ga0070713_101174688 3300005436 Unclassified 743
89 Ga0070713_101248060 3300005436 Unclassified 720
90 Ga0070710_10060033 3300005437 Bacteria 2162
91 Ga0070710_10094287 3300005437 Bacteria 1771
92 Ga0070710_11145110 3300005437 Unclassified 573
93 Ga0070701_10048188 3300005438 Bacteria 2198
94 Ga0070701_10273998 3300005438 Bacteria 1028
95 Ga0070711_100193649 3300005439 Unclassified 1564
96 Ga0070711_100530349 3300005439 Bacteria 974
97 Ga0070711_100613607 3300005439 Bacteria 909
98 Ga0070705_100713637 3300005440 Bacteria 789
99 Ga0070700_101051665 3300005441 Unclassified 672
100 Ga0070708_100000073 3300005445 Bacteria 64587
101 Ga0070708_100309178 3300005445 Bacteria 1489
102 Ga0070708_101401209 3300005445 Bacteria 652
103 Ga0070663_100426384 3300005455 Bacteria 1089
104 Ga0070663_100822980 3300005455 Bacteria 797
105 Ga0070662_100027218 3300005457 Unclassified 3966
106 Ga0070681_10000719 3300005458 Bacteria 27400
107 Ga0070681_10012671 3300005458 Bacteria 8365
108 Ga0070681_10056842 3300005458 Bacteria 3893
109 Ga0070681_10879158 3300005458 Unclassified 814
110 Ga0070681_11067049 3300005458 Unclassified 728
111 Ga0068867_100349234 3300005459 Bacteria 1234
112 Ga0068867_100375016 3300005459 Unclassified 1194
113 Ga0068867_100535226 3300005459 Bacteria 1012
114 Ga0068867_100959894 3300005459 Bacteria 773
115 Ga0070685_10464449 3300005466 Bacteria 889
116 Ga0070706_100583244 3300005467 Bacteria 1039
117 Ga0070706_100798331 3300005467 Unclassified 874
118 Ga0070707_100003187 3300005468 Bacteria 15518
119 Ga0070707_100248218 3300005468 Unclassified 1732
120 Ga0070707_100892534 3300005468 Unclassified 853
121 Ga0070698_100025250 3300005471 Bacteria 6191
122 Ga0070698_100066554 3300005471 Bacteria 3626
123 Ga0070698_100148368 3300005471 Bacteria 2294
124 Ga0070698_100155537 3300005471 Bacteria 2232
125 Ga0070698_100366279 3300005471 Unclassified 1373
126 Ga0070698_100872296 3300005471 Bacteria 845
127 Ga0070698_100887420 3300005471 Bacteria 837
128 Ga0070698_101109572 3300005471 Bacteria 740
129 Ga0070699_100208350 3300005518 Unclassified 1740
130 Ga0070699_100243180 3300005518 Bacteria 1607
131 Ga0070699_100417872 3300005518 Bacteria 1214
132 Ga0070699_101744821 3300005518 Bacteria 570
133 Ga0070679_100000324 3300005530 Bacteria 40356
134 Ga0070679_100003088 3300005530 Bacteria 15217
135 Ga0070679_100031101 3300005530 Bacteria 5272
136 Ga0070679_100033292 3300005530 Bacteria 5103
137 Ga0070679_100749841 3300005530 Bacteria 919
138 Ga0070679_100995704 3300005530 Unclassified 782
139 Ga0070679_101428929 3300005530 Unclassified 638
140 Ga0070679_101718559 3300005530 Bacteria 575
141 Ga0070684_100008695 3300005535 Bacteria 7960
142 Ga0070684_100009879 3300005535 Bacteria 7540
143 Ga0070684_100019647 3300005535 Bacteria 5591
144 Ga0070684_100020262 3300005535 Bacteria 5517
145 Ga0070684_100037730 3300005535 Bacteria 4147
146 Ga0070684_100052208 3300005535 Unclassified 3554
147 Ga0070684_100087850 3300005535 Bacteria 2761
148 Ga0070684_100121929 3300005535 Unclassified 2346
149 Ga0070684_100154345 3300005535 Bacteria 2081
150 Ga0070684_100221074 3300005535 Unclassified 1728
151 Ga0070697_101137770 3300005536 Unclassified 695
152 Ga0070697_101380040 3300005536 Unclassified 629
153 Ga0068853_100129827 3300005539 Unclassified 2255
154 Ga0068853_100458388 3300005539 Bacteria 1200
155 Ga0068853_101291806 3300005539 Unclassified 705
156 Ga0070672_100103985 3300005543 Bacteria 2307
157 Ga0070672_101099765 3300005543 Bacteria 706
158 Ga0070672_101331168 3300005543 Unclassified 641
159 Ga0070686_101297342 3300005544 Unclassified 608
160 Ga0070695_100512723 3300005545 Bacteria 929
161 Ga0070696_100034134 3300005546 Bacteria 3499
162 Ga0070696_101081063 3300005546 Unclassified 673
163 Ga0070693_100001328 3300005547 Bacteria 11130
164 Ga0070693_100002384 3300005547 Bacteria 8642
165 Ga0070693_100232490 3300005547 Bacteria 1214
166 Ga0070693_100658607 3300005547 Unclassified 762
167 Ga0070665_100187490 3300005548 Bacteria 2069
168 Ga0070665_100589931 3300005548 Bacteria 1124
169 Ga0070704_101480747 3300005549 Bacteria 624
170 Ga0068855_100244380 3300005563 Bacteria 2004
171 Ga0068855_100867358 3300005563 Bacteria 955
172 Ga0070664_100012975 3300005564 Bacteria 6779
173 Ga0070664_100554352 3300005564 Bacteria 1063
174 Ga0070664_100711986 3300005564 Bacteria 936
175 Ga0070664_101084057 3300005564 Bacteria 754
176 Ga0070664_101577425 3300005564 Bacteria 622
177 Ga0068857_100007684 3300005577 Bacteria 9287
178 Ga0068857_100056503 3300005577 Bacteria 3483
179 Ga0068857_100339363 3300005577 Unclassified 1390
180 Ga0068857_100339664 3300005577 Unclassified 1389
181 Ga0068857_100585897 3300005577 Bacteria 1053
182 Ga0068857_101411462 3300005577 Unclassified 677
183 Ga0068854_100027930 3300005578 Bacteria 3893
184 Ga0068854_100205544 3300005578 Bacteria 1550
185 Ga0068856_100006312 3300005614 Bacteria 11631
186 Ga0068856_100012657 3300005614 Bacteria 8168
187 Ga0068856_100065719 3300005614 Bacteria 3585
188 Ga0068856_100102402 3300005614 Bacteria 2857
189 Ga0068856_100242472 3300005614 Bacteria 1818
190 Ga0070702_100004109 3300005615 Bacteria 6604
191 Ga0068852_100003985 3300005616 Bacteria 10379
192 Ga0068852_100101234 3300005616 Bacteria 2601
193 Ga0068852_101824343 3300005616 Bacteria 630
194 Ga0068859_100031530 3300005617 Bacteria 5323
195 Ga0068859_100054066 3300005617 Bacteria 4038
196 Ga0068859_100510121 3300005617 Bacteria 1298
197 Ga0068859_100562515 3300005617 Bacteria 1234
198 Ga0068859_100723186 3300005617 Bacteria 1085
199 Ga0068864_100024727 3300005618 Bacteria 5053
200 Ga0068864_100205354 3300005618 Bacteria 1812
201 Ga0068864_100905945 3300005618 Unclassified 871
202 Ga0068866_10458768 3300005718 Bacteria 835
203 Ga0068861_100317359 3300005719 Bacteria 1356
204 Ga0068861_100453297 3300005719 Bacteria 1150
205 Ga0068861_101195628 3300005719 Unclassified 735
206 Ga0068861_101287762 3300005719 Bacteria 710
207 Ga0068870_10021362 3300005840 Bacteria 3165
208 Ga0068870_10067816 3300005840 Unclassified 1937
209 Ga0068870_10520040 3300005840 Unclassified 796
210 Ga0068863_100006853 3300005841 Bacteria 11169
211 Ga0068863_100117994 3300005841 Bacteria 2529
212 Ga0068863_100276010 3300005841 Unclassified 1628
213 Ga0068863_101828901 3300005841 Unclassified 617
214 Ga0068858_100106428 3300005842 Bacteria 2618
215 Ga0068858_100657397 3300005842 Bacteria 1019
216 Ga0068860_100061141 3300005843 Bacteria 3579
217 Ga0068860_100859733 3300005843 Bacteria 922
218 Ga0068860_101166786 3300005843 Unclassified 790
219 Ga0068862_100028830 3300005844 Bacteria 4676
220 Ga0068862_100092395 3300005844 Bacteria 2638
221 Ga0068862_100904684 3300005844 Bacteria 868
222 Ga0081455_10004725 3300005937 Bacteria 15141
223 Ga0081455_10120825 3300005937 Bacteria 2064
224 Ga0081455_10593650 3300005937 Bacteria 723
225 Ga0081538_10271871 3300005981 Unclassified 634
226 Ga0081539_10000107 3300005985 Bacteria 195503
227 Ga0075368_10018959 3300006042 Bacteria 2593
228 Ga0075368_10372684 3300006042 Unclassified 624
229 Ga0075363_100779089 3300006048 Unclassified 581
230 Ga0075364_10026322 3300006051 Bacteria 3710
231 Ga0075432_10425780 3300006058 Bacteria 578
232 Ga0070715_10790507 3300006163 Archaea 575
233 Ga0070716_100074830 3300006173 Bacteria 2002
234 Ga0070716_100377546 3300006173 Bacteria 1012
235 Ga0070712_100002494 3300006175 Bacteria 11354
236 Ga0070712_100534025 3300006175 Archaea 987
237 Ga0070712_100688012 3300006175 Unclassified 871
238 Ga0070712_100776970 3300006175 Archaea 821
239 Ga0075362_10088586 3300006177 Bacteria 1434
240 Ga0075367_10038095 3300006178 Bacteria 2797
241 Ga0075367_10411566 3300006178 Bacteria 856
242 Ga0075427_10039799 3300006194 Unclassified 790
243 Ga0075366_10011850 3300006195 Bacteria 4933
244 Ga0097621_100162595 3300006237 Unclassified 1920
245 Ga0068871_100025960 3300006358 Bacteria 4565
246 Ga0068871_100285413 3300006358 Bacteria 1445
247 Ga0075428_100020760 3300006844 Bacteria 7272
248 Ga0075428_100177866 3300006844 Bacteria 2304
249 Ga0075428_100323663 3300006844 Bacteria 1656
250 Ga0075428_100611008 3300006844 Bacteria 1164
251 Ga0075428_102079146 3300006844 Unclassified 588
252 Ga0075430_100118559 3300006846 Unclassified 2206
253 Ga0075430_100202171 3300006846 Bacteria 1649
254 Ga0075430_100327327 3300006846 Bacteria 1267
255 Ga0075430_100538014 3300006846 Bacteria 963
256 Ga0075430_100769273 3300006846 Unclassified 794
257 Ga0075430_100842752 3300006846 Unclassified 755
258 Ga0075430_101686943 3300006846 Unclassified 520
259 Ga0075431_100053258 3300006847 Bacteria 4172
260 Ga0075431_100226728 3300006847 Bacteria 1905
261 Ga0075431_100230602 3300006847 Bacteria 1887
262 Ga0075431_100267999 3300006847 Unclassified 1732
263 Ga0075431_100396378 3300006847 Unclassified 1382
264 Ga0075431_100682016 3300006847 Bacteria 1006
265 Ga0075431_100982854 3300006847 Bacteria 811
266 Ga0075431_101093791 3300006847 Unclassified 762
267 Ga0075431_101358088 3300006847 Unclassified 671
268 Ga0075431_102039689 3300006847 Bacteria 529
269 Ga0075434_100620024 3300006871 Bacteria 1100
270 Ga0075429_100025053 3300006880 Bacteria 5178
271 Ga0075429_100220016 3300006880 Bacteria 1663
272 Ga0075429_100509393 3300006880 Bacteria 1055
273 Ga0075429_100680249 3300006880 Bacteria 901
274 Ga0075429_100900490 3300006880 Unclassified 774
275 Ga0075429_101363457 3300006880 Unclassified 618
276 Ga0068865_100305534 3300006881 Bacteria 1275
277 Ga0097620_100031530 3300006931 Bacteria 5323
278 Ga0097620_100054062 3300006931 Bacteria 4038
279 Ga0097620_100510126 3300006931 Bacteria 1298
280 Ga0097620_100562502 3300006931 Bacteria 1234
281 Ga0097620_100587344 3300006931 Bacteria 1207
282 Ga0097620_100723152 3300006931 Bacteria 1085
283 Ga0075435_100567702 3300007076 Unclassified 983
284 Ga0105250_10478615 3300009092 Unclassified 562
285 Ga0105240_10061480 3300009093 Bacteria 4680
286 Ga0105240_10289675 3300009093 Bacteria 1878
287 Ga0105240_11177790 3300009093 Unclassified 812
288 Ga0105240_11215814 3300009093 Bacteria 797
289 Ga0105240_11343744 3300009093 Unclassified 753
290 Ga0111539_10073471 3300009094 Bacteria 4032
291 Ga0111539_10535316 3300009094 Unclassified 1365
292 Ga0111539_10844173 3300009094 Bacteria 1066
293 Ga0105245_10001632 3300009098 Bacteria 20415
294 Ga0105245_10100561 3300009098 Bacteria 2675
295 Ga0105245_10152827 3300009098 Bacteria 2184
296 Ga0105245_10416389 3300009098 Bacteria 1346
297 Ga0105245_12264014 3300009098 Unclassified 597
298 Ga0105247_11112220 3300009101 Unclassified 624
299 Ga0114129_10496292 3300009147 Bacteria 1595
300 Ga0114129_10567250 3300009147 Bacteria 1474
301 Ga0114129_10774529 3300009147 Bacteria 1226
302 Ga0114129_12743264 3300009147 Bacteria 586
303 Ga0105243_10236791 3300009148 Bacteria 1622
304 Ga0105243_11343211 3300009148 Bacteria 733
305 Ga0105243_12308718 3300009148 Unclassified 576
306 Ga0105241_10005052 3300009174 Bacteria 9731
307 Ga0105241_10015542 3300009174 Bacteria 5579
308 Ga0105241_10112196 3300009174 Bacteria 2184
309 Ga0105241_11486034 3300009174 Unclassified 651
310 Ga0105241_12153388 3300009174 Unclassified 552
311 Ga0105242_10373338 3300009176 Bacteria 1323
312 Ga0105248_10004151 3300009177 Bacteria 16022
313 Ga0105248_10032866 3300009177 Bacteria 5796
314 Ga0105248_10275598 3300009177 Bacteria 1894
315 Ga0105248_11088984 3300009177 Unclassified 903
316 Ga0105237_10234653 3300009545 Unclassified 1836
317 Ga0105238_10043384 3300009551 Bacteria 4551
318 Ga0105238_10051012 3300009551 Bacteria 4163
319 Ga0105238_10091528 3300009551 Unclassified 3028
320 Ga0105238_10094171 3300009551 Unclassified 2983
321 Ga0105238_10707627 3300009551 Unclassified 1019
322 Ga0105249_10052953 3300009553 Bacteria 3708
323 Ga0105249_10528721 3300009553 Unclassified 1228
324 Ga0105249_10958874 3300009553 Bacteria 923
325 Ga0105249_12631652 3300009553 Unclassified 575
326 Ga0105239_10024044 3300010375 Bacteria 6712
327 Ga0105239_10737060 3300010375 Bacteria 1127
328 Ga0105246_10029204 3300011119 Unclassified 3630
329 Ga0105246_10110529 3300011119 Unclassified 2018
330 Ga0157373_10081340 3300013100 Bacteria 2283
331 Ga0157373_10133031 3300013100 Unclassified 1749
332 Ga0157371_10013862 3300013102 Bacteria 6107
333 Ga0157370_10001778 3300013104 Bacteria 26589
334 Ga0157370_10011127 3300013104 Bacteria 9432
335 Ga0157370_10020822 3300013104 Bacteria 6543
336 Ga0157370_10039916 3300013104 Unclassified 4534
337 Ga0157370_10062810 3300013104 Bacteria 3521
338 Ga0157370_10138219 3300013104 Unclassified 2270
339 Ga0157370_10428000 3300013104 Unclassified 1217
340 Ga0157369_10048959 3300013105 Bacteria 4583
341 Ga0157369_10115557 3300013105 Bacteria 2850
342 Ga0157369_10339211 3300013105 Bacteria 1561
343 Ga0157369_10451928 3300013105 Bacteria 1331
344 Ga0157369_10681941 3300013105 Bacteria 1059
345 Ga0157369_10830411 3300013105 Bacteria 949
346 Ga0157369_11523212 3300013105 Bacteria 680
347 Ga0157374_10004077 3300013296 Bacteria 12266
348 Ga0157374_10042795 3300013296 Unclassified 4180
349 Ga0157374_11680131 3300013296 Bacteria 660
350 Ga0157374_12733592 3300013296 Unclassified 521
351 Ga0163162_10443457 3300013306 Bacteria 1430
352 Ga0163162_13416007 3300013306 Unclassified 506
353 Ga0157372_10005007 3300013307 Bacteria 14074
354 Ga0157372_10038332 3300013307 Bacteria 5288
355 Ga0157372_10041086 3300013307 Bacteria 5112
356 Ga0157372_10073408 3300013307 Unclassified 3856
357 Ga0157372_10085721 3300013307 Bacteria 3573
358 Ga0157372_10102836 3300013307 Unclassified 3264
359 Ga0157372_10176564 3300013307 Bacteria 2472
360 Ga0157372_10310025 3300013307 Bacteria 1837
361 Ga0157372_10411612 3300013307 Unclassified 1576
362 Ga0157372_10456862 3300013307 Unclassified 1488
363 Ga0157372_10477709 3300013307 Bacteria 1453
364 Ga0157372_11466329 3300013307 Unclassified 786
365 Ga0157372_12083461 3300013307 Bacteria 652
366 Ga0157372_12652118 3300013307 Bacteria 575
367 Ga0157375_10008426 3300013308 Bacteria 9030
368 Ga0157375_10066285 3300013308 Bacteria 3604
369 Ga0157375_10142251 3300013308 Bacteria 2527
370 Ga0157375_10311973 3300013308 Unclassified 1737
371 Ga0157375_10442056 3300013308 Bacteria 1466
372 Ga0157375_11931839 3300013308 Unclassified 701
373 Ga0157375_13093956 3300013308 Unclassified 555
374 Ga0163163_10008889 3300014325 Bacteria 8946
375 Ga0163163_10171235 3300014325 Bacteria 2218
376 Ga0157380_10037158 3300014326 Bacteria 3771
377 Ga0157380_10255716 3300014326 Unclassified 1588
378 Ga0157380_10358517 3300014326 Unclassified 1367
379 Ga0157380_10911170 3300014326 Bacteria 906
380 Ga0157380_11967827 3300014326 Bacteria 646
381 Ga0157380_12688504 3300014326 Unclassified 564
382 Ga0157377_10003078 3300014745 Bacteria 7488
383 Ga0157377_10460729 3300014745 Bacteria 880
384 Ga0157379_10406837 3300014968 Bacteria 1251
385 Ga0157379_10611869 3300014968 Bacteria 1018
386 Ga0157379_10771802 3300014968 Bacteria 906
387 Ga0157376_10197259 3300014969 Bacteria 1850
388 Ga0182007_10176977 3300015262 Bacteria 736
389 Ga0182007_10200790 3300015262 Viruses 697
390 Ga0182007_10203650 3300015262 Bacteria 693
391 Ga0163161_10834187 3300017792 Bacteria 777
392 Ga0213876_10002367 3300021384 Bacteria 11096
393 Ga0213876_10105025 3300021384 Bacteria 1499
394 Ga0213876_10172046 3300021384 Bacteria 1152
395 Ga0213876_10263687 3300021384 Bacteria 916
396 Ga0213876_10449776 3300021384 Bacteria 685
397 Ga0207697_10003546 3300025315 Bacteria 7685
398 Ga0207697_10412706 3300025315 Bacteria 600
399 Ga0207656_10462879 3300025321 Bacteria 641
400 Ga0207653_10023614 3300025885 Bacteria 1959
401 Ga0207692_10050796 3300025898 Bacteria 2099
402 Ga0207692_10546334 3300025898 Unclassified 740
403 Ga0207692_10787451 3300025898 Unclassified 621
404 Ga0207642_10172813 3300025899 Bacteria 1171
405 Ga0207688_10682678 3300025901 Unclassified 649
406 Ga0207680_10474296 3300025903 Bacteria 889
407 Ga0207680_11306591 3300025903 Bacteria 516
408 Ga0207647_10073309 3300025904 Bacteria 2063
409 Ga0207647_10283839 3300025904 Bacteria 945
410 Ga0207699_10019530 3300025906 Bacteria 3616
411 Ga0207699_10038219 3300025906 Bacteria 2749
412 Ga0207699_10144874 3300025906 Bacteria 1565
413 Ga0207699_10299341 3300025906 Bacteria 1123
414 Ga0207645_10008299 3300025907 Bacteria 7255
415 Ga0207643_10020488 3300025908 Bacteria 3629
416 Ga0207643_10027275 3300025908 Bacteria 3166
417 Ga0207654_10055572 3300025911 Bacteria 2292
418 Ga0207654_10159814 3300025911 Bacteria 1454
419 Ga0207654_10235603 3300025911 Bacteria 1221
420 Ga0207654_11118167 3300025911 Unclassified 574
421 Ga0207707_10015646 3300025912 Bacteria 6608
422 Ga0207707_10021534 3300025912 Bacteria 5635
423 Ga0207707_10336784 3300025912 Unclassified 1301
424 Ga0207695_10009415 3300025913 Bacteria 12081
425 Ga0207695_10029463 3300025913 Bacteria 6064
426 Ga0207695_10072580 3300025913 Bacteria 3511
427 Ga0207695_10082363 3300025913 Bacteria 3254
428 Ga0207695_11268244 3300025913 Unclassified 617
429 Ga0207671_11036950 3300025914 Unclassified 646
430 Ga0207693_10004728 3300025915 Bacteria 11452
431 Ga0207693_10226292 3300025915 Bacteria 1469
432 Ga0207693_10841670 3300025915 Unclassified 706
433 Ga0207663_10031396 3300025916 Bacteria 3144
434 Ga0207663_10377039 3300025916 Unclassified 1080
435 Ga0207660_10000125 3300025917 Bacteria 45245
436 Ga0207660_10006752 3300025917 Bacteria 7431
437 Ga0207660_10008506 3300025917 Bacteria 6638
438 Ga0207660_10021795 3300025917 Bacteria 4312
439 Ga0207660_10034479 3300025917 Bacteria 3509
440 Ga0207660_10935989 3300025917 Bacteria 707
441 Ga0207660_10955134 3300025917 Bacteria 699
442 Ga0207660_11606638 3300025917 Unclassified 524
443 Ga0207662_10002734 3300025918 Bacteria 8899
444 Ga0207662_10425584 3300025918 Bacteria 904
445 Ga0207657_10041916 3300025919 Unclassified 4043
446 Ga0207657_10068870 3300025919 Bacteria 3005
447 Ga0207657_10550599 3300025919 Bacteria 902
448 Ga0207657_10731045 3300025919 Bacteria 767
449 Ga0207649_10002072 3300025920 Bacteria 11405
450 Ga0207649_10152389 3300025920 Unclassified 1594
451 Ga0207649_10597298 3300025920 Bacteria 848
452 Ga0207649_10985539 3300025920 Bacteria 663
453 Ga0207649_11236432 3300025920 Bacteria 590
454 Ga0207652_10002437 3300025921 Bacteria 15709
455 Ga0207652_10004272 3300025921 Bacteria 11656
456 Ga0207652_10015782 3300025921 Bacteria 6153
457 Ga0207652_10022380 3300025921 Bacteria 5229
458 Ga0207652_10041904 3300025921 Bacteria 3894
459 Ga0207652_10178376 3300025921 Unclassified 1908
460 Ga0207652_10248355 3300025921 Bacteria 1604
461 Ga0207652_10462802 3300025921 Unclassified 1143
462 Ga0207652_11084688 3300025921 Unclassified 701
463 Ga0207646_10175902 3300025922 Bacteria 1933
464 Ga0207646_10759714 3300025922 Unclassified 865
465 Ga0207646_10872335 3300025922 Bacteria 799
466 Ga0207681_10109325 3300025923 Unclassified 2008
467 Ga0207681_10512401 3300025923 Bacteria 983
468 Ga0207694_10045387 3300025924 Bacteria 3395
469 Ga0207694_10119900 3300025924 Bacteria 2099
470 Ga0207694_10712543 3300025924 Unclassified 846
471 Ga0207650_10066983 3300025925 Unclassified 2693
472 Ga0207650_10136695 3300025925 Unclassified 1923
473 Ga0207650_10616067 3300025925 Unclassified 913
474 Ga0207650_10714237 3300025925 Unclassified 847
475 Ga0207650_10895813 3300025925 Unclassified 753
476 Ga0207650_10966159 3300025925 Bacteria 724
477 Ga0207650_10996385 3300025925 Bacteria 713
478 Ga0207659_10035565 3300025926 Bacteria 3444
479 Ga0207659_10175648 3300025926 Bacteria 1693
480 Ga0207659_10258705 3300025926 Bacteria 1415
481 Ga0207659_10329219 3300025926 Bacteria 1262
482 Ga0207659_10689681 3300025926 Unclassified 874
483 Ga0207659_10853246 3300025926 Bacteria 783
484 Ga0207687_10015005 3300025927 Bacteria 5075
485 Ga0207687_10199478 3300025927 Unclassified 1563
486 Ga0207687_10380276 3300025927 Bacteria 1157
487 Ga0207687_10683173 3300025927 Bacteria 870
488 Ga0207687_11874040 3300025927 Unclassified 513
489 Ga0207700_10000677 3300025928 Bacteria 19822
490 Ga0207700_11613492 3300025928 Unclassified 574
491 Ga0207664_10092197 3300025929 Bacteria 2486
492 Ga0207664_10160623 3300025929 Bacteria 1916
493 Ga0207644_10005945 3300025931 Bacteria 7955
494 Ga0207644_10285996 3300025931 Bacteria 1325
495 Ga0207644_11807282 3300025931 Unclassified 511
496 Ga0207690_10022978 3300025932 Bacteria 3886
497 Ga0207690_10079734 3300025932 Bacteria 2282
498 Ga0207690_10308053 3300025932 Bacteria 1241
499 Ga0207706_10001438 3300025933 Bacteria 23820
500 Ga0207706_10001946 3300025933 Bacteria 20277
501 Ga0207706_10078194 3300025933 Bacteria 2910
502 Ga0207686_10025717 3300025934 Bacteria 3428
503 Ga0207686_10109855 3300025934 Bacteria 1857
504 Ga0207686_10162093 3300025934 Bacteria 1568
505 Ga0207686_10362396 3300025934 Bacteria 1094
506 Ga0207709_10228169 3300025935 Bacteria 1347
507 Ga0207670_10147939 3300025936 Bacteria 1739
508 Ga0207670_10210326 3300025936 Bacteria 1483
509 Ga0207670_10941849 3300025936 Bacteria 725
510 Ga0207670_11578068 3300025936 Unclassified 558
511 Ga0207669_10354369 3300025937 Bacteria 1135
512 Ga0207669_11057138 3300025937 Unclassified 684
513 Ga0207669_11110635 3300025937 Unclassified 668
514 Ga0207704_10089889 3300025938 Unclassified 2013
515 Ga0207665_10042233 3300025939 Unclassified 3048
516 Ga0207665_10171612 3300025939 Bacteria 1567
517 Ga0207665_10497011 3300025939 Bacteria 942
518 Ga0207691_10002778 3300025940 Bacteria 17069
519 Ga0207691_10095357 3300025940 Bacteria 2661
520 Ga0207691_10417487 3300025940 Bacteria 1143
521 Ga0207691_11404737 3300025940 Bacteria 573
522 Ga0207711_10015343 3300025941 Bacteria 6359
523 Ga0207711_10469551 3300025941 Bacteria 1172
524 Ga0207689_10012567 3300025942 Bacteria 7233
525 Ga0207689_10013117 3300025942 Bacteria 7074
526 Ga0207689_10019669 3300025942 Bacteria 5690
527 Ga0207689_10645289 3300025942 Bacteria 892
528 Ga0207661_10001069 3300025944 Bacteria 18229
529 Ga0207661_10004658 3300025944 Bacteria 9607
530 Ga0207661_10007254 3300025944 Bacteria 7884
531 Ga0207661_10010780 3300025944 Bacteria 6590
532 Ga0207661_10026981 3300025944 Unclassified 4383
533 Ga0207661_10028616 3300025944 Bacteria 4270
534 Ga0207661_10101216 3300025944 Bacteria 2420
535 Ga0207661_10155307 3300025944 Bacteria 1981
536 Ga0207661_10155686 3300025944 Unclassified 1979
537 Ga0207661_10386441 3300025944 Unclassified 1267
538 Ga0207661_10434734 3300025944 Bacteria 1193
539 Ga0207661_10611064 3300025944 Bacteria 1001
540 Ga0207661_10633455 3300025944 Bacteria 982
541 Ga0207661_10742534 3300025944 Bacteria 903
542 Ga0207661_10895460 3300025944 Bacteria 817
543 Ga0207679_10024364 3300025945 Unclassified 4148
544 Ga0207679_10098470 3300025945 Bacteria 2280
545 Ga0207679_10305353 3300025945 Bacteria 1373
546 Ga0207679_10658117 3300025945 Bacteria 948
547 Ga0207679_10672010 3300025945 Bacteria 938
548 Ga0207679_10699290 3300025945 Unclassified 920
549 Ga0207679_11619154 3300025945 Unclassified 593
550 Ga0207679_11874745 3300025945 Bacteria 547
551 Ga0207667_10253880 3300025949 Bacteria 1799
552 Ga0207667_10318590 3300025949 Unclassified 1588
553 Ga0207667_10338306 3300025949 Bacteria 1536
554 Ga0207651_10307759 3300025960 Bacteria 1320
555 Ga0207651_10356518 3300025960 Bacteria 1233
556 Ga0207651_11466347 3300025960 Unclassified 614
557 Ga0207651_11916245 3300025960 Unclassified 533
558 Ga0207712_10013492 3300025961 Bacteria 5240
559 Ga0207712_10269362 3300025961 Bacteria 1385
560 Ga0207712_11633266 3300025961 Unclassified 578
561 Ga0207668_10065543 3300025972 Bacteria 2571
562 Ga0207668_10175927 3300025972 Unclassified 1683
563 Ga0207668_10375211 3300025972 Bacteria 1196
564 Ga0207668_10412845 3300025972 Bacteria 1144
565 Ga0207668_11370852 3300025972 Unclassified 637
566 Ga0207640_10037807 3300025981 Bacteria 3040
567 Ga0207640_10323324 3300025981 Bacteria 1229
568 Ga0207640_12130164 3300025981 Unclassified 509
569 Ga0207658_10119403 3300025986 Bacteria 2099
570 Ga0207658_10145665 3300025986 Bacteria 1923
571 Ga0207658_10165610 3300025986 Bacteria 1816
572 Ga0207658_11361505 3300025986 Unclassified 649
573 Ga0207677_10064425 3300026023 Bacteria 2552
574 Ga0207677_10065972 3300026023 Bacteria 2528
575 Ga0207703_10056394 3300026035 Bacteria 3200
576 Ga0207703_10504854 3300026035 Bacteria 1136
577 Ga0207639_10797993 3300026041 Bacteria 880
578 Ga0207639_11907401 3300026041 Bacteria 555
579 Ga0207678_10028798 3300026067 Bacteria 4849
580 Ga0207678_10770968 3300026067 Bacteria 848
581 Ga0207678_11329888 3300026067 Bacteria 636
582 Ga0207708_10098309 3300026075 Bacteria 2262
583 Ga0207708_10118272 3300026075 Bacteria 2063
584 Ga0207708_10937526 3300026075 Bacteria 750
585 Ga0207702_10021029 3300026078 Bacteria 5399
586 Ga0207702_10049102 3300026078 Unclassified 3560
587 Ga0207702_10122516 3300026078 Bacteria 2329
588 Ga0207702_10268145 3300026078 Bacteria 1610
589 Ga0207702_10386363 3300026078 Bacteria 1347
590 Ga0207702_11057419 3300026078 Bacteria 805
591 Ga0207702_11161478 3300026078 Unclassified 766
592 Ga0207702_11229024 3300026078 Bacteria 743
593 Ga0207641_10006735 3300026088 Bacteria 9629
594 Ga0207641_10304785 3300026088 Unclassified 1506
595 Ga0207641_10676552 3300026088 Bacteria 1015
596 Ga0207641_11183550 3300026088 Bacteria 764
597 Ga0207641_11905791 3300026088 Unclassified 596
598 Ga0207648_10067873 3300026089 Unclassified 3108
599 Ga0207648_10278989 3300026089 Bacteria 1494
600 Ga0207648_10330095 3300026089 Unclassified 1372
601 Ga0207648_10561578 3300026089 Bacteria 1049
602 Ga0207648_10589394 3300026089 Unclassified 1024
603 Ga0207676_10003700 3300026095 Bacteria 10811
604 Ga0207676_10068045 3300026095 Bacteria 2847
605 Ga0207676_11247915 3300026095 Unclassified 737
606 Ga0207676_11399384 3300026095 Unclassified 695
607 Ga0207674_10000013 3300026116 Bacteria 187953
608 Ga0207674_10011483 3300026116 Bacteria 9950
609 Ga0207674_10089072 3300026116 Bacteria 3079
610 Ga0207674_10431586 3300026116 Bacteria 1273
611 Ga0207674_10510380 3300026116 Unclassified 1161
612 Ga0207674_10655031 3300026116 Unclassified 1014
613 Ga0207674_11091001 3300026116 Unclassified 768
614 Ga0207674_11331888 3300026116 Unclassified 687
615 Ga0207675_100000197 3300026118 Bacteria 55600
616 Ga0207675_100373052 3300026118 Bacteria 1402
617 Ga0207675_100793253 3300026118 Bacteria 960
618 Ga0207675_102017396 3300026118 Bacteria 594
619 Ga0207683_10272354 3300026121 Bacteria 1547
620 Ga0207698_10002825 3300026142 Bacteria 10395
621 Ga0207698_10020146 3300026142 Bacteria 4586
622 Ga0207698_10028729 3300026142 Bacteria 3970
623 Ga0207698_10082339 3300026142 Bacteria 2601
624 Ga0207698_10426926 3300026142 Bacteria 1273
625 Ga0209995_1025033 3300027471 Bacteria 994
626 Ga0207428_10032517 3300027907 Bacteria 4289
627 Ga0207428_10563647 3300027907 Unclassified 823
628 Ga0207428_10637499 3300027907 Unclassified 765
629 Ga0268266_10935734 3300028379 Bacteria 838
630 Ga0268265_10044736 3300028380 Bacteria 3298
631 Ga0268265_10127006 3300028380 Bacteria 2112
632 Ga0268265_10156081 3300028380 Unclassified 1931
633 Ga0268265_10246921 3300028380 Bacteria 1578
634 Ga0268264_10033854 3300028381 Bacteria 4200
635 Ga0268264_10825923 3300028381 Unclassified 927
636 Ga0265332_10061825 3300031238 Bacteria 1600
637 Ga0265327_10056319 3300031251 Bacteria 2026
638 Ga0307408_100020829 3300031548 Bacteria 4430
639 Ga0307408_100176679 3300031548 Bacteria 1709
640 Ga0307408_100240210 3300031548 Bacteria 1488
641 Ga0307408_100319807 3300031548 Bacteria 1307
642 Ga0307408_100447095 3300031548 Unclassified 1120
643 Ga0307408_100739135 3300031548 Bacteria 888
644 Ga0307408_100875138 3300031548 Bacteria 820
645 Ga0265314_10033130 3300031711 Bacteria 3792
646 Ga0307405_10002340 3300031731 Bacteria 8331
647 Ga0307405_10121822 3300031731 Unclassified 1786
648 Ga0307405_10202340 3300031731 Bacteria 1443
649 Ga0307405_10376813 3300031731 Bacteria 1103
650 Ga0307413_10122775 3300031824 Bacteria 1762
651 Ga0307413_10148424 3300031824 Bacteria 1630
652 Ga0307413_10327175 3300031824 Bacteria 1173
653 Ga0307413_10403828 3300031824 Bacteria 1071
654 Ga0307413_10408827 3300031824 Unclassified 1066
655 Ga0307413_11592791 3300031824 Bacteria 580
656 Ga0307410_10000113 3300031852 Bacteria 28226
657 Ga0307410_10598599 3300031852 Bacteria 919
658 Ga0307410_11112383 3300031852 Bacteria 685
659 Ga0307410_11479951 3300031852 Unclassified 598
660 Ga0307406_10001742 3300031901 Bacteria 11928
661 Ga0307406_10019235 3300031901 Bacteria 4005
662 Ga0307406_10024566 3300031901 Bacteria 3601
663 Ga0307406_10472345 3300031901 Bacteria 1011
664 Ga0307406_11438652 3300031901 Unclassified 605
665 Ga0307406_11885800 3300031901 Bacteria 533
666 Ga0307407_10002675 3300031903 Bacteria 7061
667 Ga0307407_10003744 3300031903 Bacteria 6315
668 Ga0307407_10156346 3300031903 Bacteria 1487
669 Ga0307407_11181047 3300031903 Bacteria 597
670 Ga0307412_10065380 3300031911 Bacteria 2461
671 Ga0307412_10096468 3300031911 Bacteria 2081
672 Ga0307412_10202943 3300031911 Bacteria 1507
673 Ga0307412_10334915 3300031911 Bacteria 1209
674 Ga0307412_10628487 3300031911 Bacteria 913
675 Ga0307409_100044182 3300031995 Bacteria 3353
676 Ga0307409_100084586 3300031995 Bacteria 2576
677 Ga0307409_100088407 3300031995 Bacteria 2529
678 Ga0307409_100120034 3300031995 Bacteria 2224
679 Ga0307409_100124105 3300031995 Bacteria 2193
680 Ga0307409_100445518 3300031995 Bacteria 1248
681 Ga0307409_101466908 3300031995 Bacteria 709
682 Ga0307409_101694565 3300031995 Unclassified 661
683 Ga0307409_101743100 3300031995 Bacteria 652
684 Ga0307416_100035530 3300032002 Bacteria 3807
685 Ga0307416_100047843 3300032002 Bacteria 3388
686 Ga0307416_100221494 3300032002 Bacteria 1815
687 Ga0307416_100275416 3300032002 Unclassified 1655
688 Ga0307414_10063483 3300032004 Bacteria 2625
689 Ga0307414_11129550 3300032004 Bacteria 724
690 Ga0307414_12010564 3300032004 Bacteria 540
691 Ga0307411_10003115 3300032005 Bacteria 7595
692 Ga0307411_10139848 3300032005 Bacteria 1783
693 Ga0307411_10346635 3300032005 Unclassified 1209
694 Ga0307411_10542120 3300032005 Bacteria 991
695 Ga0307411_10858675 3300032005 Bacteria 803
696 Ga0307411_11153115 3300032005 Bacteria 701
697 Ga0307411_11481657 3300032005 Bacteria 623
698 Ga0307415_100002414 3300032126 Bacteria 9314
699 Ga0307415_100003797 3300032126 Bacteria 7740
700 Ga0307415_100159889 3300032126 Bacteria 1745
701 Ga0307415_101621936 3300032126 Bacteria 622
702 Ga0307415_101666298 3300032126 Bacteria 614
703 Ga0307415_102073366 3300032126 Bacteria 555
704 Ga0373934_0000881 3300035086 Bacteria 10826
705 Ga0373934_0004308 3300035086 Bacteria 5253
706 Ga0373934_0059403 3300035086 Bacteria 1522
707 Ga0373923_0042004 3300035111 Unclassified 1887
708 Ga0373945_0027103 3300035116 Bacteria 2001
709 Ga0373953_0119380 3300035117 Bacteria 1119
710 Ga0373953_0202587 3300035117 Unclassified 858
711 Ga0373954_0046112 3300035118 Bacteria 2037
712 Ga0373954_0349814 3300035118 Unclassified 730
713 Ga0373956_0015144 3300035119 Bacteria 3227
714 Ga0373956_0129674 3300035119 Bacteria 1180
715 Ga0373956_0378157 3300035119 Bacteria 675
716 Ga0373943_0205184 3300035170 Unclassified 1092
717 Ga0373946_0319199 3300035171 Bacteria 771
718 Ga0373955_0239198 3300035172 Unclassified 1087
719 Ga0373955_0264714 3300035172 Bacteria 1032
720 Ga0373924_0108933 3300035410 Bacteria 1196
721 Ga0373924_0583313 3300035410 Bacteria 504
722 Ga0373931_0021274 3300035691 Bacteria 3253
723 Ga0373931_0610711 3300035691 Bacteria 714
724 Ga0373935_0988214 3300035692 Bacteria 625
725 Ga0373933_0017865 3300035724 Bacteria 3983
726 Ga0373933_0164186 3300035724 Bacteria 1411
727 Ga0373933_0524484 3300035724 Unclassified 776
728 Ga0373947_0015708 3300035725 Bacteria 4349
729 Ga0373947_0269944 3300035725 Bacteria 1129
730 Ga0373937_0002454 3300036401 Bacteria 15410
731 Ga0373937_0004785 3300036401 Bacteria 11498
732 Ga0373937_0041478 3300036401 Bacteria 4197
733 Ga0373937_0153941 3300036401 Bacteria 2154
734 Ga0373937_0848927 3300036401 Bacteria 861
735 Ga0373925_0348004 3300037068 Bacteria 1203
736 Ga0395905_0533449 3300037471 Bacteria 1074
737 Ga0395905_0872912 3300037471 Bacteria 803
738 Ga0436364_0114030 3300037853 Bacteria 659
739 Ga0436365_0284014 3300039437 Bacteria 4178
740 Ga0436365_0306410 3300039437 Bacteria 1586
741 Ga0436365_0335369 3300039437 Bacteria 1612
742 Ga0436365_1213574 3300039437 Bacteria 1819
743 Ga0436365_1221399 3300039437 Unclassified 605
744 Ga0436365_1467046 3300039437 Bacteria 9175
745 Ga0436365_1734924 3300039437 Bacteria 23675
746 Ga0436365_1758490 3300039437 Bacteria 2822
747 Ga0439439_0039418 3300041406 Unclassified 1221
748 Ga0451797_1057055 3300041453 Bacteria 862
749 Ga0439449_0310378 3300042007 Unclassified 596
750 Ga0453683_1225930 3300044673 Unclassified 503
751 Ga0466966_0045910 3300044684 Unclassified 2792
752 Ga0466963_0085191 3300044694 Bacteria 2145
753 Ga0466963_0162877 3300044694 Bacteria 1553
754 Ga0466963_0644964 3300044694 Unclassified 747
755 Ga0466963_1143280 3300044694 Bacteria 547
756 Ga0466957_0360763 3300044842 Bacteria 987
757 Ga0466957_0379502 3300044842 Bacteria 964
758 Ga0466957_1022693 3300044842 Bacteria 594
759 Ga0466957_1165816 3300044842 Bacteria 557
760 Ga0451576_0047630 3300045051 Bacteria 4506
761 Ga0451576_0363861 3300045051 Bacteria 1515
762 Ga0466967_0032967 3300045976 Bacteria 4380
763 Ga0466967_0124076 3300045976 Bacteria 2390
764 Ga0466967_0187709 3300045976 Bacteria 1952
765 Ga0466967_0209304 3300045976 Bacteria 1849
766 Ga0466967_0297537 3300045976 Bacteria 1552
767 Ga0466967_0310993 3300045976 Bacteria 1518
768 Ga0495629_0545934 3300046459 Unclassified 778
769 Ga0495651_0004902 3300046462 Bacteria 10236
770 Ga0495651_0010243 3300046462 Bacteria 7197
771 Ga0495651_0171585 3300046462 Bacteria 1544
772 Ga0495651_0500406 3300046462 Bacteria 778
773 Ga0495653_0012480 3300046463 Bacteria 6937
774 Ga0495653_0056264 3300046463 Bacteria 2999
775 Ga0495580_0150627 3300046472 Unclassified 1612
776 Ga0495582_0043911 3300046473 Bacteria 2461
777 Ga0495639_0013357 3300046475 Unclassified 3545
778 Ga0495639_0253615 3300046475 Bacteria 870
779 Ga0495662_0074216 3300046476 Unclassified 1650
780 Ga0495594_0033924 3300046499 Bacteria 2776
781 Ga0495594_0039739 3300046499 Bacteria 2573
782 Ga0495594_0047435 3300046499 Bacteria 2359
783 Ga0495594_0100229 3300046499 Unclassified 1629
784 Ga0495594_0166977 3300046499 Bacteria 1252
785 Ga0495594_0629725 3300046499 Bacteria 608
786 Ga0495594_0735252 3300046499 Bacteria 557
787 Ga0495608_0020747 3300046511 Bacteria 4514
788 Ga0495608_0028866 3300046511 Unclassified 3769
789 Ga0495628_0005987 3300046516 Bacteria 10639
790 Ga0495628_0054405 3300046516 Bacteria 3156
791 Ga0495630_0013715 3300046517 Bacteria 5893
792 Ga0495630_0350414 3300046517 Bacteria 1130
793 Ga0495630_0386704 3300046517 Bacteria 1072
794 Ga0495666_0022927 3300046526 Unclassified 3090
795 Ga0495666_0040900 3300046526 Bacteria 2247
796 Ga0495652_0001660 3300046529 Bacteria 24160
797 Ga0495652_0027548 3300046529 Bacteria 5005
798 Ga0495652_0088730 3300046529 Bacteria 2534
799 Ga0495652_0343734 3300046529 Bacteria 1071
800 Ga0495665_0069509 3300046531 Unclassified 1856
801 Ga0495665_0072233 3300046531 Unclassified 1817
802 Ga0495665_0216913 3300046531 Bacteria 990
803 Ga0495586_0009104 3300046535 Bacteria 5281
804 Ga0495586_0020548 3300046535 Bacteria 3516
805 Ga0495586_0131603 3300046535 Unclassified 1401
806 Ga0495586_0206626 3300046535 Unclassified 1114
807 Ga0495586_0503144 3300046535 Bacteria 699
808 Ga0495587_0008335 3300046536 Bacteria 6673
809 Ga0495587_0013275 3300046536 Bacteria 5179
810 Ga0495587_0025782 3300046536 Bacteria 3591
811 Ga0495587_0030824 3300046536 Bacteria 3251
812 Ga0495645_0000135 3300046543 Bacteria 50272
813 Ga0495645_0000968 3300046543 Bacteria 19580
814 Ga0495645_0010754 3300046543 Bacteria 6431
815 Ga0495645_0212507 3300046543 Bacteria 1305
816 Ga0495667_0002562 3300046559 Bacteria 12138
817 Ga0495667_0009476 3300046559 Bacteria 6598
818 Ga0495667_0015721 3300046559 Bacteria 5116
819 Ga0495667_0103897 3300046559 Bacteria 1837
820 Ga0495634_0367478 3300046642 Bacteria 859
821 Ga0495635_0021269 3300046663 Bacteria 4522
822 Ga0495659_0140650 3300046664 Unclassified 963
823 Ga0495588_0135995 3300046674 Bacteria 1297
824 Ga0495588_0156746 3300046674 Bacteria 1204
825 Ga0495657_0006488 3300046675 Bacteria 9145
826 Ga0495657_0063012 3300046675 Bacteria 2448
827 Ga0495657_0746718 3300046675 Bacteria 561
828 Ga0495599_0000483 3300046678 Bacteria 22701
829 Ga0495599_0045547 3300046678 Bacteria 2751
830 Ga0495599_0288653 3300046678 Bacteria 992
831 Ga0495623_0006091 3300046679 Bacteria 7847
832 Ga0495623_0029365 3300046679 Bacteria 3538
833 Ga0495623_0036034 3300046679 Unclassified 3170
834 Ga0495623_0038465 3300046679 Bacteria 3059
835 Ga0495623_0074989 3300046679 Bacteria 2101
836 Ga0495658_0222030 3300046683 Bacteria 1183
837 Ga0495613_0221577 3300046689 Unclassified 1328
838 Ga0495613_0415382 3300046689 Bacteria 916
839 Ga0495613_0788331 3300046689 Bacteria 621
840 Ga0495600_0015013 3300046809 Bacteria 4892
841 Ga0495604_0021481 3300047317 Bacteria 5153
842 Ga0495604_0111915 3300047317 Bacteria 1990
843 Ga0495636_0290110 3300047318 Bacteria 764
844 Ga0495674_0034841 3300047319 Unclassified 4548
845 Ga0495674_0402287 3300047319 Unclassified 1105
846 Ga0495672_0004266 3300047320 Bacteria 11804
847 Ga0495672_0004304 3300047320 Bacteria 11732
848 Ga0495675_0011709 3300047444 Bacteria 5508
849 Ga0495675_0057652 3300047444 Bacteria 2463
850 Ga0495675_0095200 3300047444 Unclassified 1867
851 Ga0495675_0817687 3300047444 Unclassified 515
852 Ga0495677_0365203 3300047445 Unclassified 570
853 Ga0495684_0027194 3300047471 Bacteria 4392
854 Ga0495684_0083394 3300047471 Bacteria 2424
855 Ga0495684_0106657 3300047471 Bacteria 2116
856 Ga0495684_0129666 3300047471 Bacteria 1895
857 Ga0495684_0145064 3300047471 Bacteria 1778
858 Ga0495602_0002867 3300048088 Bacteria 17654
859 Ga0495602_0094024 3300048088 Bacteria 2479
860 Ga0495602_0238628 3300048088 Bacteria 1361
861 Ga0495602_0263766 3300048088 Bacteria 1276
862 Ga0496104_0053249 3300048907 Bacteria 3823
863 Ga0496107_1210595 3300048910 Unclassified 543
864 Ga0496109_1824925 3300048912 Unclassified 541
865 Ga0496110_0886602 3300048913 Unclassified 798
866 Ga0496112_0033280 3300048915 Bacteria 5009
867 Ga0496112_0187720 3300048915 Bacteria 2030
868 Ga0496115_0242298 3300048918 Unclassified 1486
869 Ga0496115_0673762 3300048918 Bacteria 815
870 Ga0501299_084135 3300049522 Bacteria 712
871 Ga0501032_0350579 3300049569 Bacteria 951
872 Ga0501033_0007466 3300049570 Bacteria 8512
873 Ga0501033_0224158 3300049570 Bacteria 1337
874 Ga0501034_0208110 3300049571 Bacteria 1912
875 Ga0501034_0211231 3300049571 Bacteria 1896
876 Ga0501034_1229768 3300049571 Unclassified 627
877 Ga0501036_0149629 3300049572 Bacteria 1969
878 Ga0501038_0119536 3300049574 Bacteria 2175
879 Ga0501039_0515486 3300049575 Bacteria 939
880 Ga0501040_0120503 3300049576 Bacteria 1841
881 Ga0501043_0125464 3300049579 Bacteria 2013
882 Ga0501043_0686317 3300049579 Bacteria 749
883 Ga0501046_0556546 3300049580 Bacteria 817
884 Ga0501047_0232395 3300049581 Bacteria 1697
885 Ga0501047_0651307 3300049581 Bacteria 873
886 Ga0501070_0218731 3300049586 Bacteria 1562
887 Ga0501070_0809027 3300049586 Unclassified 735
888 Ga0501071_1407673 3300049587 Bacteria 538
889 Ga0501072_0163537 3300049588 Unclassified 1776
890 Ga0501073_0044836 3300049589 Bacteria 3117
891 Ga0501073_0127863 3300049589 Bacteria 1761
892 Ga0501075_0550009 3300049591 Bacteria 881
893 Ga0501077_0070005 3300049593 Bacteria 2223
894 Ga0501077_0248191 3300049593 Bacteria 1132
895 Ga0501223_039199 3300049663 Bacteria 920
896 Ga0501247_038141 3300049677 Bacteria 679
897 Ga0501247_078125 3300049677 Bacteria 531
898 Ga0501253_107377 3300049683 Bacteria 662
899 Ga0501259_089663 3300049688 Bacteria 689
900 Ga0501234_072894 3300049707 Bacteria 596
901 Ga0501079_0548852 3300049741 Bacteria 909
902 Ga0501083_0414735 3300049744 Bacteria 876
903 Ga0501083_0809697 3300049744 Bacteria 610
904 Ga0501268_039602 3300049765 Bacteria 883
905 Ga0501035_0026537 3300049822 Bacteria 5299
906 Ga0501044_0032563 3300049823 Bacteria 5479
907 Ga0501044_0350090 3300049823 Bacteria 1397
908 nmdc:mga03n38_332214_c1 3300050490 Unclassified 823
909 nmdc:mga06z11_243599_c1 3300050494 Bacteria 1057
910 nmdc:mga05p37_1438142_c1 3300050507 Bacteria 691
911 nmdc:mga05p37_28216_c1 3300050507 Bacteria 6842
912 nmdc:mga05p37_58133_c1 3300050507 Bacteria 4762
913 nmdc:mga09592_282056_c1 3300050508 Unclassified 1441
914 nmdc:mga09592_420045_c1 3300050508 Unclassified 1155
915 nmdc:mga09592_71968_c1 3300050508 Unclassified 2935
916 nmdc:mga0qj67_16474_c1 3300050509 Bacteria 5607
917 nmdc:mga0qj67_463110_c1 3300050509 Unclassified 1021
918 nmdc:mga0qj67_977515_c1 3300050509 Unclassified 665
919 nmdc:mga06r32_1035340_c1 3300050510 Bacteria 772
920 nmdc:mga06r32_1892906_c1 3300050510 Bacteria 531
921 nmdc:mga06r32_245537_c1 3300050510 Bacteria 1778
922 nmdc:mga06r32_284669_c1 3300050510 Bacteria 1640
923 nmdc:mga06r32_66351_c1 3300050510 Unclassified 3482
924 nmdc:mga06r32_733556_c1 3300050510 Bacteria 952
925 nmdc:mga06r32_772287_c1 3300050510 Unclassified 923
926 nmdc:mga06r32_77445_c1 3300050510 Bacteria 3230
927 nmdc:mga06r32_81326_c1 3300050510 Unclassified 3155
928 nmdc:mga06r32_976814_c1 3300050510 Bacteria 800
929 nmdc:mga08y16_1091241_c1 3300050511 Unclassified 774
930 nmdc:mga08y16_125746_c1 3300050511 Bacteria 2667
931 nmdc:mga08y16_177417_c1 3300050511 Unclassified 2212
932 nmdc:mga08y16_340403_c1 3300050511 Unclassified 1542
933 nmdc:mga08y16_46297_c1 3300050511 Bacteria 4554
934 nmdc:mga0n895_182554_c1 3300050512 Unclassified 2130
935 nmdc:mga0n895_6412_c1 3300050512 Bacteria 9985
936 nmdc:mga0n895_723796_c1 3300050512 Bacteria 990
937 nmdc:mga0rr50_1698838_c1 3300050513 Unclassified 532
938 nmdc:mga0rr50_460956_c1 3300050513 Bacteria 1078
939 nmdc:mga0a205_1143260_c1 3300050515 Bacteria 626
940 nmdc:mga0a205_16117_c1 3300050515 Bacteria 6997
941 nmdc:mga0a205_56331_c1 3300050515 Bacteria 3795
942 Ga0495601_0099099 3300053077 Bacteria 1881
943 Ga0495601_0217866 3300053077 Bacteria 1247
944 Ga0495612_0009892 3300053078 Bacteria 3862
945 Ga0495612_0120026 3300053078 Bacteria 1130
946 Ga0495595_0032497 3300053084 Bacteria 2351
947 Ga0495595_0142607 3300053084 Unclassified 1176
948 Ga0495595_0147043 3300053084 Bacteria 1158
949 Ga0495619_0202489 3300053085 Unclassified 1374
950 Ga0495619_0803549 3300053085 Unclassified 636
951 Ga0501084_0217478 3300054114 Bacteria 1612
952 Ga0590071_050782 3300059421 Bacteria 1005
953 Ga0501082_0799539 3300060353 Unclassified 825
954 Ga0501082_1383188 3300060353 Bacteria 615
955 Ga0530510_0330025 3300061734 Bacteria 1144
956 Ga0530510_0454148 3300061734 Unclassified 969
957 Ga0070684_100031872
958 JGI25406J46586_10049714
959 rootH1_10324040
960 Ga0065712_10071943
961 Ga0065712_10353962
962 Ga0065712_10675278
963 Ga0070658_10416465
964 Ga0070658_11070524
965 Ga0070676_10708376
966 Ga0070683_100018417
967 Ga0070683_100019090
968 Ga0070683_100020750
969 Ga0070683_100031481
970 Ga0070683_100059446
971 Ga0070683_100070682
972 Ga0070683_100098223
973 Ga0070683_100114587
974 Ga0070683_100177316
975 Ga0070683_102299957
976 Ga0070683_102385081
977 Ga0070690_100012432
978 Ga0070690_100023235
979 Ga0070690_100088751
980 Ga0070670_100006749
981 Ga0070670_100141338
982 Ga0070670_100897421
983 Ga0070677_10499716
984 Ga0068869_100003425
985 Ga0068869_100100627
986 Ga0070666_10538142
987 Ga0070680_100000097
988 Ga0070680_100001723
989 Ga0070680_100004718
990 Ga0070680_100038351
991 Ga0070680_100370077
992 Ga0070680_100560826
993 Ga0070680_100657946
994 Ga0070680_101906129
995 Ga0070682_100002777
996 Ga0070682_101831392
997 Ga0068868_100105702
998 Ga0068868_101007467
999 Ga0070660_100021143
1000 Ga0070660_100501108
1001 Ga0070660_100726285
1002 Ga0070689_100068372
1003 Ga0070689_100694190
1004 Ga0070691_10325942
1005 Ga0070687_100023637
1006 Ga0070687_100102409
1007 Ga0070661_100000874
1008 Ga0070661_100422985
1009 Ga0070661_100495646
1010 Ga0070661_100718999
1011 Ga0070692_10044946
1012 Ga0070692_10498481
1013 Ga0070668_100162886
1014 Ga0070668_100271815
1015 Ga0070668_100336690
1016 Ga0070669_100026132
1017 Ga0070669_101049075
1018 Ga0070675_100007979
1019 Ga0070675_100605443
1020 Ga0070675_100773994
1021 Ga0070675_100913635
1022 Ga0070675_101066634
1023 Ga0070671_100007789
1024 Ga0070671_100154049
1025 Ga0070671_100165973
1026 Ga0070671_101582214
1027 Ga0070674_100533845
1028 Ga0070674_101401397
1029 Ga0070673_100149793
1030 Ga0070673_100329695
1031 Ga0070688_100025366
1032 Ga0070659_100001208
1033 Ga0070667_100014949
1034 Ga0070667_101086435
1035 Ga0070703_10180602
1036 Ga0070709_10001029
1037 Ga0070709_10427254
1038 Ga0070709_11491240
1039 Ga0070714_100024663
1040 Ga0070714_100030581
1041 Ga0070714_101441917
1042 Ga0070713_100002277
1043 Ga0070713_100049800
1044 Ga0070713_101174688
1045 Ga0070713_101248060
1046 Ga0070710_10060033
1047 Ga0070710_10094287
1048 Ga0070710_11145110
1049 Ga0070701_10048188
1050 Ga0070701_10273998
1051 Ga0070711_100193649
1052 Ga0070711_100530349
1053 Ga0070711_100613607
1054 Ga0070705_100713637
1055 Ga0070700_101051665
1056 Ga0070708_100000073
1057 Ga0070708_100309178
1058 Ga0070708_101401209
1059 Ga0070663_100426384
1060 Ga0070663_100822980
1061 Ga0070662_100027218
1062 Ga0070681_10000719
1063 Ga0070681_10012671
1064 Ga0070681_10056842
1065 Ga0070681_10879158
1066 Ga0070681_11067049
1067 Ga0068867_100349234
1068 Ga0068867_100375016
1069 Ga0068867_100535226
1070 Ga0068867_100959894
1071 Ga0070685_10464449
1072 Ga0070706_100583244
1073 Ga0070706_100798331
1074 Ga0070707_100003187
1075 Ga0070707_100248218
1076 Ga0070707_100892534
1077 Ga0070698_100025250
1078 Ga0070698_100066554
1079 Ga0070698_100148368
1080 Ga0070698_100155537
1081 Ga0070698_100366279
1082 Ga0070698_100872296
1083 Ga0070698_100887420
1084 Ga0070698_101109572
1085 Ga0070699_100208350
1086 Ga0070699_100243180
1087 Ga0070699_100417872
1088 Ga0070699_101744821
1089 Ga0070679_100000324
1090 Ga0070679_100003088
1091 Ga0070679_100031101
1092 Ga0070679_100033292
1093 Ga0070679_100749841
1094 Ga0070679_100995704
1095 Ga0070679_101428929
1096 Ga0070679_101718559
1097 Ga0070684_100008695
1098 Ga0070684_100009879
1099 Ga0070684_100019647
1100 Ga0070684_100020262
1101 Ga0070684_100037730
1102 Ga0070684_100052208
1103 Ga0070684_100087850
1104 Ga0070684_100121929
1105 Ga0070684_100154345
1106 Ga0070684_100221074
1107 Ga0070697_101137770
1108 Ga0070697_101380040
1109 Ga0068853_100129827
1110 Ga0068853_100458388
1111 Ga0068853_101291806
1112 Ga0070672_100103985
1113 Ga0070672_101099765
1114 Ga0070672_101331168
1115 Ga0070686_101297342
1116 Ga0070695_100512723
1117 Ga0070696_100034134
1118 Ga0070696_101081063
1119 Ga0070693_100001328
1120 Ga0070693_100002384
1121 Ga0070693_100232490
1122 Ga0070693_100658607
1123 Ga0070665_100187490
1124 Ga0070665_100589931
1125 Ga0070704_101480747
1126 Ga0068855_100244380
1127 Ga0068855_100867358
1128 Ga0070664_100012975
1129 Ga0070664_100554352
1130 Ga0070664_100711986
1131 Ga0070664_101084057
1132 Ga0070664_101577425
1133 Ga0068857_100007684
1134 Ga0068857_100056503
1135 Ga0068857_100339363
1136 Ga0068857_100339664
1137 Ga0068857_100585897
1138 Ga0068857_101411462
1139 Ga0068854_100027930
1140 Ga0068854_100205544
1141 Ga0068856_100006312
1142 Ga0068856_100012657
1143 Ga0068856_100065719
1144 Ga0068856_100102402
1145 Ga0068856_100242472
1146 Ga0070702_100004109
1147 Ga0068852_100003985
1148 Ga0068852_100101234
1149 Ga0068852_101824343
1150 Ga0068859_100031530
1151 Ga0068859_100054066
1152 Ga0068859_100510121
1153 Ga0068859_100562515
1154 Ga0068859_100723186
1155 Ga0068864_100024727
1156 Ga0068864_100205354
1157 Ga0068864_100905945
1158 Ga0068866_10458768
1159 Ga0068861_100317359
1160 Ga0068861_100453297
1161 Ga0068861_101195628
1162 Ga0068861_101287762
1163 Ga0068870_10021362
1164 Ga0068870_10067816
1165 Ga0068870_10520040
1166 Ga0068863_100006853
1167 Ga0068863_100117994
1168 Ga0068863_100276010
1169 Ga0068863_101828901
1170 Ga0068858_100106428
1171 Ga0068858_100657397
1172 Ga0068860_100061141
1173 Ga0068860_100859733
1174 Ga0068860_101166786
1175 Ga0068862_100028830
1176 Ga0068862_100092395
1177 Ga0068862_100904684
1178 Ga0081455_10004725
1179 Ga0081455_10120825
1180 Ga0081455_10593650
1181 Ga0081538_10271871
1182 Ga0081539_10000107
1183 Ga0075368_10018959
1184 Ga0075368_10372684
1185 Ga0075363_100779089
1186 Ga0075364_10026322
1187 Ga0075432_10425780
1188 Ga0070715_10790507
1189 Ga0070716_100074830
1190 Ga0070716_100377546
1191 Ga0070712_100002494
1192 Ga0070712_100534025
1193 Ga0070712_100688012
1194 Ga0070712_100776970
1195 Ga0075362_10088586
1196 Ga0075367_10038095
1197 Ga0075367_10411566
1198 Ga0075427_10039799
1199 Ga0075366_10011850
1200 Ga0097621_100162595
1201 Ga0068871_100025960
1202 Ga0068871_100285413
1203 Ga0075428_100020760
1204 Ga0075428_100177866
1205 Ga0075428_100323663
1206 Ga0075428_100611008
1207 Ga0075428_102079146
1208 Ga0075430_100118559
1209 Ga0075430_100202171
1210 Ga0075430_100327327
1211 Ga0075430_100538014
1212 Ga0075430_100769273
1213 Ga0075430_100842752
1214 Ga0075430_101686943
1215 Ga0075431_100053258
1216 Ga0075431_100226728
1217 Ga0075431_100230602
1218 Ga0075431_100267999
1219 Ga0075431_100396378
1220 Ga0075431_100682016
1221 Ga0075431_100982854
1222 Ga0075431_101093791
1223 Ga0075431_101358088
1224 Ga0075431_102039689
1225 Ga0075434_100620024
1226 Ga0075429_100025053
1227 Ga0075429_100220016
1228 Ga0075429_100509393
1229 Ga0075429_100680249
1230 Ga0075429_100900490
1231 Ga0075429_101363457
1232 Ga0068865_100305534
1233 Ga0097620_100031530
1234 Ga0097620_100054062
1235 Ga0097620_100510126
1236 Ga0097620_100562502
1237 Ga0097620_100587344
1238 Ga0097620_100723152
1239 Ga0075435_100567702
1240 Ga0105250_10478615
1241 Ga0105240_10061480
1242 Ga0105240_10289675
1243 Ga0105240_11177790
1244 Ga0105240_11215814
1245 Ga0105240_11343744
1246 Ga0111539_10073471
1247 Ga0111539_10535316
1248 Ga0111539_10844173
1249 Ga0105245_10001632
1250 Ga0105245_10100561
1251 Ga0105245_10152827
1252 Ga0105245_10416389
1253 Ga0105245_12264014
1254 Ga0105247_11112220
1255 Ga0114129_10496292
1256 Ga0114129_10567250
1257 Ga0114129_10774529
1258 Ga0114129_12743264
1259 Ga0105243_10236791
1260 Ga0105243_11343211
1261 Ga0105243_12308718
1262 Ga0105241_10005052
1263 Ga0105241_10015542
1264 Ga0105241_10112196
1265 Ga0105241_11486034
1266 Ga0105241_12153388
1267 Ga0105242_10373338
1268 Ga0105248_10004151
1269 Ga0105248_10032866
1270 Ga0105248_10275598
1271 Ga0105248_11088984
1272 Ga0105237_10234653
1273 Ga0105238_10043384
1274 Ga0105238_10051012
1275 Ga0105238_10091528
1276 Ga0105238_10094171
1277 Ga0105238_10707627
1278 Ga0105249_10052953
1279 Ga0105249_10528721
1280 Ga0105249_10958874
1281 Ga0105249_12631652
1282 Ga0105239_10024044
1283 Ga0105239_10737060
1284 Ga0105246_10029204
1285 Ga0105246_10110529
1286 Ga0157373_10081340
1287 Ga0157373_10133031
1288 Ga0157371_10013862
1289 Ga0157370_10001778
1290 Ga0157370_10011127
1291 Ga0157370_10020822
1292 Ga0157370_10039916
1293 Ga0157370_10062810
1294 Ga0157370_10138219
1295 Ga0157370_10428000
1296 Ga0157369_10048959
1297 Ga0157369_10115557
1298 Ga0157369_10339211
1299 Ga0157369_10451928
1300 Ga0157369_10681941
1301 Ga0157369_10830411
1302 Ga0157369_11523212
1303 Ga0157374_10004077
1304 Ga0157374_10042795
1305 Ga0157374_11680131
1306 Ga0157374_12733592
1307 Ga0163162_10443457
1308 Ga0163162_13416007
1309 Ga0157372_10005007
1310 Ga0157372_10038332
1311 Ga0157372_10041086
1312 Ga0157372_10073408
1313 Ga0157372_10085721
1314 Ga0157372_10102836
1315 Ga0157372_10176564
1316 Ga0157372_10310025
1317 Ga0157372_10411612
1318 Ga0157372_10456862
1319 Ga0157372_10477709
1320 Ga0157372_11466329
1321 Ga0157372_12083461
1322 Ga0157372_12652118
1323 Ga0157375_10008426
1324 Ga0157375_10066285
1325 Ga0157375_10142251
1326 Ga0157375_10311973
1327 Ga0157375_10442056
1328 Ga0157375_11931839
1329 Ga0157375_13093956
1330 Ga0163163_10008889
1331 Ga0163163_10171235
1332 Ga0157380_10037158
1333 Ga0157380_10255716
1334 Ga0157380_10358517
1335 Ga0157380_10911170
1336 Ga0157380_11967827
1337 Ga0157380_12688504
1338 Ga0157377_10003078
1339 Ga0157377_10460729
1340 Ga0157379_10406837
1341 Ga0157379_10611869
1342 Ga0157379_10771802
1343 Ga0157376_10197259
1344 Ga0182007_10176977
1345 Ga0182007_10200790
1346 Ga0182007_10203650
1347 Ga0163161_10834187
1348 Ga0213876_10002367
1349 Ga0213876_10105025
1350 Ga0213876_10172046
1351 Ga0213876_10263687
1352 Ga0213876_10449776
1353 Ga0207697_10003546
1354 Ga0207697_10412706
1355 Ga0207656_10462879
1356 Ga0207653_10023614
1357 Ga0207692_10050796
1358 Ga0207692_10546334
1359 Ga0207692_10787451
1360 Ga0207642_10172813
1361 Ga0207688_10682678
1362 Ga0207680_10474296
1363 Ga0207680_11306591
1364 Ga0207647_10073309
1365 Ga0207647_10283839
1366 Ga0207699_10019530
1367 Ga0207699_10038219
1368 Ga0207699_10144874
1369 Ga0207699_10299341
1370 Ga0207645_10008299
1371 Ga0207643_10020488
1372 Ga0207643_10027275
1373 Ga0207654_10055572
1374 Ga0207654_10159814
1375 Ga0207654_10235603
1376 Ga0207654_11118167
1377 Ga0207707_10015646
1378 Ga0207707_10021534
1379 Ga0207707_10336784
1380 Ga0207695_10009415
1381 Ga0207695_10029463
1382 Ga0207695_10072580
1383 Ga0207695_10082363
1384 Ga0207695_11268244
1385 Ga0207671_11036950
1386 Ga0207693_10004728
1387 Ga0207693_10226292
1388 Ga0207693_10841670
1389 Ga0207663_10031396
1390 Ga0207663_10377039
1391 Ga0207660_10000125
1392 Ga0207660_10006752
1393 Ga0207660_10008506
1394 Ga0207660_10021795
1395 Ga0207660_10034479
1396 Ga0207660_10935989
1397 Ga0207660_10955134
1398 Ga0207660_11606638
1399 Ga0207662_10002734
1400 Ga0207662_10425584
1401 Ga0207657_10041916
1402 Ga0207657_10068870
1403 Ga0207657_10550599
1404 Ga0207657_10731045
1405 Ga0207649_10002072
1406 Ga0207649_10152389
1407 Ga0207649_10597298
1408 Ga0207649_10985539
1409 Ga0207649_11236432
1410 Ga0207652_10002437
1411 Ga0207652_10004272
1412 Ga0207652_10015782
1413 Ga0207652_10022380
1414 Ga0207652_10041904
1415 Ga0207652_10178376
1416 Ga0207652_10248355
1417 Ga0207652_10462802
1418 Ga0207652_11084688
1419 Ga0207646_10175902
1420 Ga0207646_10759714
1421 Ga0207646_10872335
1422 Ga0207681_10109325
1423 Ga0207681_10512401
1424 Ga0207694_10045387
1425 Ga0207694_10119900
1426 Ga0207694_10712543
1427 Ga0207650_10066983
1428 Ga0207650_10136695
1429 Ga0207650_10616067
1430 Ga0207650_10714237
1431 Ga0207650_10895813
1432 Ga0207650_10966159
1433 Ga0207650_10996385
1434 Ga0207659_10035565
1435 Ga0207659_10175648
1436 Ga0207659_10258705
1437 Ga0207659_10329219
1438 Ga0207659_10689681
1439 Ga0207659_10853246
1440 Ga0207687_10015005
1441 Ga0207687_10199478
1442 Ga0207687_10380276
1443 Ga0207687_10683173
1444 Ga0207687_11874040
1445 Ga0207700_10000677
1446 Ga0207700_11613492
1447 Ga0207664_10092197
1448 Ga0207664_10160623
1449 Ga0207644_10005945
1450 Ga0207644_10285996
1451 Ga0207644_11807282
1452 Ga0207690_10022978
1453 Ga0207690_10079734
1454 Ga0207690_10308053
1455 Ga0207706_10001438
1456 Ga0207706_10001946
1457 Ga0207706_10078194
1458 Ga0207686_10025717
1459 Ga0207686_10109855
1460 Ga0207686_10162093
1461 Ga0207686_10362396
1462 Ga0207709_10228169
1463 Ga0207670_10147939
1464 Ga0207670_10210326
1465 Ga0207670_10941849
1466 Ga0207670_11578068
1467 Ga0207669_10354369
1468 Ga0207669_11057138
1469 Ga0207669_11110635
1470 Ga0207704_10089889
1471 Ga0207665_10042233
1472 Ga0207665_10171612
1473 Ga0207665_10497011
1474 Ga0207691_10002778
1475 Ga0207691_10095357
1476 Ga0207691_10417487
1477 Ga0207691_11404737
1478 Ga0207711_10015343
1479 Ga0207711_10469551
1480 Ga0207689_10012567
1481 Ga0207689_10013117
1482 Ga0207689_10019669
1483 Ga0207689_10645289
1484 Ga0207661_10001069
1485 Ga0207661_10004658
1486 Ga0207661_10007254
1487 Ga0207661_10010780
1488 Ga0207661_10026981
1489 Ga0207661_10028616
1490 Ga0207661_10101216
1491 Ga0207661_10155307
1492 Ga0207661_10155686
1493 Ga0207661_10386441
1494 Ga0207661_10434734
1495 Ga0207661_10611064
1496 Ga0207661_10633455
1497 Ga0207661_10742534
1498 Ga0207661_10895460
1499 Ga0207679_10024364
1500 Ga0207679_10098470
1501 Ga0207679_10305353
1502 Ga0207679_10658117
1503 Ga0207679_10672010
1504 Ga0207679_10699290
1505 Ga0207679_11619154
1506 Ga0207679_11874745
1507 Ga0207667_10253880
1508 Ga0207667_10318590
1509 Ga0207667_10338306
1510 Ga0207651_10307759
1511 Ga0207651_10356518
1512 Ga0207651_11466347
1513 Ga0207651_11916245
1514 Ga0207712_10013492
1515 Ga0207712_10269362
1516 Ga0207712_11633266
1517 Ga0207668_10065543
1518 Ga0207668_10175927
1519 Ga0207668_10375211
1520 Ga0207668_10412845
1521 Ga0207668_11370852
1522 Ga0207640_10037807
1523 Ga0207640_10323324
1524 Ga0207640_12130164
1525 Ga0207658_10119403
1526 Ga0207658_10145665
1527 Ga0207658_10165610
1528 Ga0207658_11361505
1529 Ga0207677_10064425
1530 Ga0207677_10065972
1531 Ga0207703_10056394
1532 Ga0207703_10504854
1533 Ga0207639_10797993
1534 Ga0207639_11907401
1535 Ga0207678_10028798
1536 Ga0207678_10770968
1537 Ga0207678_11329888
1538 Ga0207708_10098309
1539 Ga0207708_10118272
1540 Ga0207708_10937526
1541 Ga0207702_10021029
1542 Ga0207702_10049102
1543 Ga0207702_10122516
1544 Ga0207702_10268145
1545 Ga0207702_10386363
1546 Ga0207702_11057419
1547 Ga0207702_11161478
1548 Ga0207702_11229024
1549 Ga0207641_10006735
1550 Ga0207641_10304785
1551 Ga0207641_10676552
1552 Ga0207641_11183550
1553 Ga0207641_11905791
1554 Ga0207648_10067873
1555 Ga0207648_10278989
1556 Ga0207648_10330095
1557 Ga0207648_10561578
1558 Ga0207648_10589394
1559 Ga0207676_10003700
1560 Ga0207676_10068045
1561 Ga0207676_11247915
1562 Ga0207676_11399384
1563 Ga0207674_10000013
1564 Ga0207674_10011483
1565 Ga0207674_10089072
1566 Ga0207674_10431586
1567 Ga0207674_10510380
1568 Ga0207674_10655031
1569 Ga0207674_11091001
1570 Ga0207674_11331888
1571 Ga0207675_100000197
1572 Ga0207675_100373052
1573 Ga0207675_100793253
1574 Ga0207675_102017396
1575 Ga0207683_10272354
1576 Ga0207698_10002825
1577 Ga0207698_10020146
1578 Ga0207698_10028729
1579 Ga0207698_10082339
1580 Ga0207698_10426926
1581 Ga0209995_1025033
1582 Ga0207428_10032517
1583 Ga0207428_10563647
1584 Ga0207428_10637499
1585 Ga0268266_10935734
1586 Ga0268265_10044736
1587 Ga0268265_10127006
1588 Ga0268265_10156081
1589 Ga0268265_10246921
1590 Ga0268264_10033854
1591 Ga0268264_10825923
1592 Ga0265332_10061825
1593 Ga0265327_10056319
1594 Ga0307408_100020829
1595 Ga0307408_100176679
1596 Ga0307408_100240210
1597 Ga0307408_100319807
1598 Ga0307408_100447095
1599 Ga0307408_100739135
1600 Ga0307408_100875138
1601 Ga0265314_10033130
1602 Ga0307405_10002340
1603 Ga0307405_10121822
1604 Ga0307405_10202340
1605 Ga0307405_10376813
1606 Ga0307413_10122775
1607 Ga0307413_10148424
1608 Ga0307413_10327175
1609 Ga0307413_10403828
1610 Ga0307413_10408827
1611 Ga0307413_11592791
1612 Ga0307410_10000113
1613 Ga0307410_10598599
1614 Ga0307410_11112383
1615 Ga0307410_11479951
1616 Ga0307406_10001742
1617 Ga0307406_10019235
1618 Ga0307406_10024566
1619 Ga0307406_10472345
1620 Ga0307406_11438652
1621 Ga0307406_11885800
1622 Ga0307407_10002675
1623 Ga0307407_10003744
1624 Ga0307407_10156346
1625 Ga0307407_11181047
1626 Ga0307412_10065380
1627 Ga0307412_10096468
1628 Ga0307412_10202943
1629 Ga0307412_10334915
1630 Ga0307412_10628487
1631 Ga0307409_100044182
1632 Ga0307409_100084586
1633 Ga0307409_100088407
1634 Ga0307409_100120034
1635 Ga0307409_100124105
1636 Ga0307409_100445518
1637 Ga0307409_101466908
1638 Ga0307409_101694565
1639 Ga0307409_101743100
1640 Ga0307416_100035530
1641 Ga0307416_100047843
1642 Ga0307416_100221494
1643 Ga0307416_100275416
1644 Ga0307414_10063483
1645 Ga0307414_11129550
1646 Ga0307414_12010564
1647 Ga0307411_10003115
1648 Ga0307411_10139848
1649 Ga0307411_10346635
1650 Ga0307411_10542120
1651 Ga0307411_10858675
1652 Ga0307411_11153115
1653 Ga0307411_11481657
1654 Ga0307415_100002414
1655 Ga0307415_100003797
1656 Ga0307415_100159889
1657 Ga0307415_101621936
1658 Ga0307415_101666298
1659 Ga0307415_102073366
1660 Ga0373934_0000881
1661 Ga0373934_0004308
1662 Ga0373934_0059403
1663 Ga0373923_0042004
1664 Ga0373945_0027103
1665 Ga0373953_0119380
1666 Ga0373953_0202587
1667 Ga0373954_0046112
1668 Ga0373954_0349814
1669 Ga0373956_0015144
1670 Ga0373956_0129674
1671 Ga0373956_0378157
1672 Ga0373943_0205184
1673 Ga0373946_0319199
1674 Ga0373955_0239198
1675 Ga0373955_0264714
1676 Ga0373924_0108933
1677 Ga0373924_0583313
1678 Ga0373931_0021274
1679 Ga0373931_0610711
1680 Ga0373935_0988214
1681 Ga0373933_0017865
1682 Ga0373933_0164186
1683 Ga0373933_0524484
1684 Ga0373947_0015708
1685 Ga0373947_0269944
1686 Ga0373937_0002454
1687 Ga0373937_0004785
1688 Ga0373937_0041478
1689 Ga0373937_0153941
1690 Ga0373937_0848927
1691 Ga0373925_0348004
1692 Ga0395905_0533449
1693 Ga0395905_0872912
1694 Ga0436364_0114030
1695 Ga0436365_0284014
1696 Ga0436365_0306410
1697 Ga0436365_0335369
1698 Ga0436365_1213574
1699 Ga0436365_1221399
1700 Ga0436365_1467046
1701 Ga0436365_1734924
1702 Ga0436365_1758490
1703 Ga0439439_0039418
1704 Ga0451797_1057055
1705 Ga0439449_0310378
1706 Ga0453683_1225930
1707 Ga0466966_0045910
1708 Ga0466963_0085191
1709 Ga0466963_0162877
1710 Ga0466963_0644964
1711 Ga0466963_1143280
1712 Ga0466957_0360763
1713 Ga0466957_0379502
1714 Ga0466957_1022693
1715 Ga0466957_1165816
1716 Ga0451576_0047630
1717 Ga0451576_0363861
1718 Ga0466967_0032967
1719 Ga0466967_0124076
1720 Ga0466967_0187709
1721 Ga0466967_0209304
1722 Ga0466967_0297537
1723 Ga0466967_0310993
1724 Ga0495629_0545934
1725 Ga0495651_0004902
1726 Ga0495651_0010243
1727 Ga0495651_0171585
1728 Ga0495651_0500406
1729 Ga0495653_0012480
1730 Ga0495653_0056264
1731 Ga0495580_0150627
1732 Ga0495582_0043911
1733 Ga0495639_0013357
1734 Ga0495639_0253615
1735 Ga0495662_0074216
1736 Ga0495594_0033924
1737 Ga0495594_0039739
1738 Ga0495594_0047435
1739 Ga0495594_0100229
1740 Ga0495594_0166977
1741 Ga0495594_0629725
1742 Ga0495594_0735252
1743 Ga0495608_0020747
1744 Ga0495608_0028866
1745 Ga0495628_0005987
1746 Ga0495628_0054405
1747 Ga0495630_0013715
1748 Ga0495630_0350414
1749 Ga0495630_0386704
1750 Ga0495666_0022927
1751 Ga0495666_0040900
1752 Ga0495652_0001660
1753 Ga0495652_0027548
1754 Ga0495652_0088730
1755 Ga0495652_0343734
1756 Ga0495665_0069509
1757 Ga0495665_0072233
1758 Ga0495665_0216913
1759 Ga0495586_0009104
1760 Ga0495586_0020548
1761 Ga0495586_0131603
1762 Ga0495586_0206626
1763 Ga0495586_0503144
1764 Ga0495587_0008335
1765 Ga0495587_0013275
1766 Ga0495587_0025782
1767 Ga0495587_0030824
1768 Ga0495645_0000135
1769 Ga0495645_0000968
1770 Ga0495645_0010754
1771 Ga0495645_0212507
1772 Ga0495667_0002562
1773 Ga0495667_0009476
1774 Ga0495667_0015721
1775 Ga0495667_0103897
1776 Ga0495634_0367478
1777 Ga0495635_0021269
1778 Ga0495659_0140650
1779 Ga0495588_0135995
1780 Ga0495588_0156746
1781 Ga0495657_0006488
1782 Ga0495657_0063012
1783 Ga0495657_0746718
1784 Ga0495599_0000483
1785 Ga0495599_0045547
1786 Ga0495599_0288653
1787 Ga0495623_0006091
1788 Ga0495623_0029365
1789 Ga0495623_0036034
1790 Ga0495623_0038465
1791 Ga0495623_0074989
1792 Ga0495658_0222030
1793 Ga0495613_0221577
1794 Ga0495613_0415382
1795 Ga0495613_0788331
1796 Ga0495600_0015013
1797 Ga0495604_0021481
1798 Ga0495604_0111915
1799 Ga0495636_0290110
1800 Ga0495674_0034841
1801 Ga0495674_0402287
1802 Ga0495672_0004266
1803 Ga0495672_0004304
1804 Ga0495675_0011709
1805 Ga0495675_0057652
1806 Ga0495675_0095200
1807 Ga0495675_0817687
1808 Ga0495677_0365203
1809 Ga0495684_0027194
1810 Ga0495684_0083394
1811 Ga0495684_0106657
1812 Ga0495684_0129666
1813 Ga0495684_0145064
1814 Ga0495602_0002867
1815 Ga0495602_0094024
1816 Ga0495602_0238628
1817 Ga0495602_0263766
1818 Ga0496104_0053249
1819 Ga0496107_1210595
1820 Ga0496109_1824925
1821 Ga0496110_0886602
1822 Ga0496112_0033280
1823 Ga0496112_0187720
1824 Ga0496115_0242298
1825 Ga0496115_0673762
1826 Ga0501299_084135
1827 Ga0501032_0350579
1828 Ga0501033_0007466
1829 Ga0501033_0224158
1830 Ga0501034_0208110
1831 Ga0501034_0211231
1832 Ga0501034_1229768
1833 Ga0501036_0149629
1834 Ga0501038_0119536
1835 Ga0501039_0515486
1836 Ga0501040_0120503
1837 Ga0501043_0125464
1838 Ga0501043_0686317
1839 Ga0501046_0556546
1840 Ga0501047_0232395
1841 Ga0501047_0651307
1842 Ga0501070_0218731
1843 Ga0501070_0809027
1844 Ga0501071_1407673
1845 Ga0501072_0163537
1846 Ga0501073_0044836
1847 Ga0501073_0127863
1848 Ga0501075_0550009
1849 Ga0501077_0070005
1850 Ga0501077_0248191
1851 Ga0501223_039199
1852 Ga0501247_038141
1853 Ga0501247_078125
1854 Ga0501253_107377
1855 Ga0501259_089663
1856 Ga0501234_072894
1857 Ga0501079_0548852
1858 Ga0501083_0414735
1859 Ga0501083_0809697
1860 Ga0501268_039602
1861 Ga0501035_0026537
1862 Ga0501044_0032563
1863 Ga0501044_0350090
1864 nmdc:mga03n38_332214_c1
1865 nmdc:mga06z11_243599_c1
1866 nmdc:mga05p37_1438142_c1
1867 nmdc:mga05p37_28216_c1
1868 nmdc:mga05p37_58133_c1
1869 nmdc:mga09592_282056_c1
1870 nmdc:mga09592_420045_c1
1871 nmdc:mga09592_71968_c1
1872 nmdc:mga0qj67_16474_c1
1873 nmdc:mga0qj67_463110_c1
1874 nmdc:mga0qj67_977515_c1
1875 nmdc:mga06r32_1035340_c1
1876 nmdc:mga06r32_1892906_c1
1877 nmdc:mga06r32_245537_c1
1878 nmdc:mga06r32_284669_c1
1879 nmdc:mga06r32_66351_c1
1880 nmdc:mga06r32_733556_c1
1881 nmdc:mga06r32_772287_c1
1882 nmdc:mga06r32_77445_c1
1883 nmdc:mga06r32_81326_c1
1884 nmdc:mga06r32_976814_c1
1885 nmdc:mga08y16_1091241_c1
1886 nmdc:mga08y16_125746_c1
1887 nmdc:mga08y16_177417_c1
1888 nmdc:mga08y16_340403_c1
1889 nmdc:mga08y16_46297_c1
1890 nmdc:mga0n895_182554_c1
1891 nmdc:mga0n895_6412_c1
1892 nmdc:mga0n895_723796_c1
1893 nmdc:mga0rr50_1698838_c1
1894 nmdc:mga0rr50_460956_c1
1895 nmdc:mga0a205_1143260_c1
1896 nmdc:mga0a205_16117_c1
1897 nmdc:mga0a205_56331_c1
1898 Ga0495601_0099099
1899 Ga0495601_0217866
1900 Ga0495612_0009892
1901 Ga0495612_0120026
1902 Ga0495595_0032497
1903 Ga0495595_0142607
1904 Ga0495595_0147043
1905 Ga0495619_0202489
1906 Ga0495619_0803549
1907 Ga0501084_0217478
1908 Ga0590071_050782
1909 Ga0501082_0799539
1910 Ga0501082_1383188
1911 Ga0530510_0330025
1912 Ga0530510_0454148

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

34

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9363 11 108
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9185 10 105
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9103 10 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9102 9 109
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9078 9 106
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9131 10 112 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9103 10 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9059 10 109 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8795 17 82 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8775 6 114 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9974 10 88
AF-A0A2V8HL98-F1-model_v4 PadR family transcriptional regulator 0.9948 10 110
AF-A0A1F2TUG0-F1-model_v4 PadR family transcriptional regulator 0.9919 9 110
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9903 16 110
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9892 5 107

Map