F486737
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 956 | 328 | 1912 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100031872|Ga0070684_1000318722 |
| Length | 132 |
| Sequence | MIPSALDGIKCRVYDSDMTSRELDLLQGTLDVLVLRALSWGSMHGYAVARFIRAGSDNTFKVLDGALYTSLHRMEERGWVESEWGASDKKKRAKFYRLTAAGRRALRSETESWNDYVAAVGRVMTATPEAAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 303 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.05 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 96.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070684_100031872 | 3300005535 | Bacteria | 4490 |
| 2 | JGI25406J46586_10049714 | 3300003203 | Bacteria | 1413 |
| 3 | rootH1_10324040 | 3300003323 | Bacteria | 1008 |
| 4 | Ga0065712_10071943 | 3300005290 | Unclassified | 4976 |
| 5 | Ga0065712_10353962 | 3300005290 | Bacteria | 784 |
| 6 | Ga0065712_10675278 | 3300005290 | Unclassified | 557 |
| 7 | Ga0070658_10416465 | 3300005327 | Bacteria | 1155 |
| 8 | Ga0070658_11070524 | 3300005327 | Unclassified | 701 |
| 9 | Ga0070676_10708376 | 3300005328 | Bacteria | 736 |
| 10 | Ga0070683_100018417 | 3300005329 | Bacteria | 6186 |
| 11 | Ga0070683_100019090 | 3300005329 | Bacteria | 6083 |
| 12 | Ga0070683_100020750 | 3300005329 | Bacteria | 5852 |
| 13 | Ga0070683_100031481 | 3300005329 | Bacteria | 4824 |
| 14 | Ga0070683_100059446 | 3300005329 | Bacteria | 3551 |
| 15 | Ga0070683_100070682 | 3300005329 | Bacteria | 3256 |
| 16 | Ga0070683_100098223 | 3300005329 | Unclassified | 2755 |
| 17 | Ga0070683_100114587 | 3300005329 | Unclassified | 2544 |
| 18 | Ga0070683_100177316 | 3300005329 | Bacteria | 2023 |
| 19 | Ga0070683_102299957 | 3300005329 | Unclassified | 517 |
| 20 | Ga0070683_102385081 | 3300005329 | Unclassified | 507 |
| 21 | Ga0070690_100012432 | 3300005330 | Bacteria | 5009 |
| 22 | Ga0070690_100023235 | 3300005330 | Bacteria | 3801 |
| 23 | Ga0070690_100088751 | 3300005330 | Bacteria | 2033 |
| 24 | Ga0070670_100006749 | 3300005331 | Bacteria | 9728 |
| 25 | Ga0070670_100141338 | 3300005331 | Bacteria | 2082 |
| 26 | Ga0070670_100897421 | 3300005331 | Unclassified | 803 |
| 27 | Ga0070677_10499716 | 3300005333 | Bacteria | 659 |
| 28 | Ga0068869_100003425 | 3300005334 | Bacteria | 9695 |
| 29 | Ga0068869_100100627 | 3300005334 | Bacteria | 2186 |
| 30 | Ga0070666_10538142 | 3300005335 | Bacteria | 849 |
| 31 | Ga0070680_100000097 | 3300005336 | Bacteria | 50005 |
| 32 | Ga0070680_100001723 | 3300005336 | Bacteria | 16057 |
| 33 | Ga0070680_100004718 | 3300005336 | Bacteria | 10257 |
| 34 | Ga0070680_100038351 | 3300005336 | Bacteria | 3875 |
| 35 | Ga0070680_100370077 | 3300005336 | Bacteria | 1219 |
| 36 | Ga0070680_100560826 | 3300005336 | Unclassified | 979 |
| 37 | Ga0070680_100657946 | 3300005336 | Unclassified | 900 |
| 38 | Ga0070680_101906129 | 3300005336 | Unclassified | 515 |
| 39 | Ga0070682_100002777 | 3300005337 | Bacteria | 9697 |
| 40 | Ga0070682_101831392 | 3300005337 | Bacteria | 530 |
| 41 | Ga0068868_100105702 | 3300005338 | Bacteria | 2283 |
| 42 | Ga0068868_101007467 | 3300005338 | Bacteria | 762 |
| 43 | Ga0070660_100021143 | 3300005339 | Bacteria | 4794 |
| 44 | Ga0070660_100501108 | 3300005339 | Unclassified | 1010 |
| 45 | Ga0070660_100726285 | 3300005339 | Bacteria | 833 |
| 46 | Ga0070689_100068372 | 3300005340 | Bacteria | 2771 |
| 47 | Ga0070689_100694190 | 3300005340 | Unclassified | 888 |
| 48 | Ga0070691_10325942 | 3300005341 | Unclassified | 846 |
| 49 | Ga0070687_100023637 | 3300005343 | Bacteria | 2922 |
| 50 | Ga0070687_100102409 | 3300005343 | Bacteria | 1606 |
| 51 | Ga0070661_100000874 | 3300005344 | Bacteria | 21640 |
| 52 | Ga0070661_100422985 | 3300005344 | Bacteria | 1056 |
| 53 | Ga0070661_100495646 | 3300005344 | Bacteria | 977 |
| 54 | Ga0070661_100718999 | 3300005344 | Bacteria | 815 |
| 55 | Ga0070692_10044946 | 3300005345 | Bacteria | 2277 |
| 56 | Ga0070692_10498481 | 3300005345 | Bacteria | 789 |
| 57 | Ga0070668_100162886 | 3300005347 | Bacteria | 1811 |
| 58 | Ga0070668_100271815 | 3300005347 | Bacteria | 1413 |
| 59 | Ga0070668_100336690 | 3300005347 | Unclassified | 1274 |
| 60 | Ga0070669_100026132 | 3300005353 | Bacteria | 4199 |
| 61 | Ga0070669_101049075 | 3300005353 | Unclassified | 701 |
| 62 | Ga0070675_100007979 | 3300005354 | Bacteria | 8202 |
| 63 | Ga0070675_100605443 | 3300005354 | Bacteria | 994 |
| 64 | Ga0070675_100773994 | 3300005354 | Bacteria | 877 |
| 65 | Ga0070675_100913635 | 3300005354 | Unclassified | 805 |
| 66 | Ga0070675_101066634 | 3300005354 | Unclassified | 742 |
| 67 | Ga0070671_100007789 | 3300005355 | Bacteria | 8555 |
| 68 | Ga0070671_100154049 | 3300005355 | Bacteria | 1941 |
| 69 | Ga0070671_100165973 | 3300005355 | Bacteria | 1867 |
| 70 | Ga0070671_101582214 | 3300005355 | Unclassified | 581 |
| 71 | Ga0070674_100533845 | 3300005356 | Unclassified | 982 |
| 72 | Ga0070674_101401397 | 3300005356 | Bacteria | 626 |
| 73 | Ga0070673_100149793 | 3300005364 | Unclassified | 1975 |
| 74 | Ga0070673_100329695 | 3300005364 | Bacteria | 1350 |
| 75 | Ga0070688_100025366 | 3300005365 | Bacteria | 3509 |
| 76 | Ga0070659_100001208 | 3300005366 | Bacteria | 18774 |
| 77 | Ga0070667_100014949 | 3300005367 | Bacteria | 6411 |
| 78 | Ga0070667_101086435 | 3300005367 | Bacteria | 748 |
| 79 | Ga0070703_10180602 | 3300005406 | Bacteria | 815 |
| 80 | Ga0070709_10001029 | 3300005434 | Bacteria | 15432 |
| 81 | Ga0070709_10427254 | 3300005434 | Bacteria | 994 |
| 82 | Ga0070709_11491240 | 3300005434 | Bacteria | 549 |
| 83 | Ga0070714_100024663 | 3300005435 | Bacteria | 4955 |
| 84 | Ga0070714_100030581 | 3300005435 | Bacteria | 4484 |
| 85 | Ga0070714_101441917 | 3300005435 | Unclassified | 672 |
| 86 | Ga0070713_100002277 | 3300005436 | Bacteria | 12475 |
| 87 | Ga0070713_100049800 | 3300005436 | Unclassified | 3458 |
| 88 | Ga0070713_101174688 | 3300005436 | Unclassified | 743 |
| 89 | Ga0070713_101248060 | 3300005436 | Unclassified | 720 |
| 90 | Ga0070710_10060033 | 3300005437 | Bacteria | 2162 |
| 91 | Ga0070710_10094287 | 3300005437 | Bacteria | 1771 |
| 92 | Ga0070710_11145110 | 3300005437 | Unclassified | 573 |
| 93 | Ga0070701_10048188 | 3300005438 | Bacteria | 2198 |
| 94 | Ga0070701_10273998 | 3300005438 | Bacteria | 1028 |
| 95 | Ga0070711_100193649 | 3300005439 | Unclassified | 1564 |
| 96 | Ga0070711_100530349 | 3300005439 | Bacteria | 974 |
| 97 | Ga0070711_100613607 | 3300005439 | Bacteria | 909 |
| 98 | Ga0070705_100713637 | 3300005440 | Bacteria | 789 |
| 99 | Ga0070700_101051665 | 3300005441 | Unclassified | 672 |
| 100 | Ga0070708_100000073 | 3300005445 | Bacteria | 64587 |
| 101 | Ga0070708_100309178 | 3300005445 | Bacteria | 1489 |
| 102 | Ga0070708_101401209 | 3300005445 | Bacteria | 652 |
| 103 | Ga0070663_100426384 | 3300005455 | Bacteria | 1089 |
| 104 | Ga0070663_100822980 | 3300005455 | Bacteria | 797 |
| 105 | Ga0070662_100027218 | 3300005457 | Unclassified | 3966 |
| 106 | Ga0070681_10000719 | 3300005458 | Bacteria | 27400 |
| 107 | Ga0070681_10012671 | 3300005458 | Bacteria | 8365 |
| 108 | Ga0070681_10056842 | 3300005458 | Bacteria | 3893 |
| 109 | Ga0070681_10879158 | 3300005458 | Unclassified | 814 |
| 110 | Ga0070681_11067049 | 3300005458 | Unclassified | 728 |
| 111 | Ga0068867_100349234 | 3300005459 | Bacteria | 1234 |
| 112 | Ga0068867_100375016 | 3300005459 | Unclassified | 1194 |
| 113 | Ga0068867_100535226 | 3300005459 | Bacteria | 1012 |
| 114 | Ga0068867_100959894 | 3300005459 | Bacteria | 773 |
| 115 | Ga0070685_10464449 | 3300005466 | Bacteria | 889 |
| 116 | Ga0070706_100583244 | 3300005467 | Bacteria | 1039 |
| 117 | Ga0070706_100798331 | 3300005467 | Unclassified | 874 |
| 118 | Ga0070707_100003187 | 3300005468 | Bacteria | 15518 |
| 119 | Ga0070707_100248218 | 3300005468 | Unclassified | 1732 |
| 120 | Ga0070707_100892534 | 3300005468 | Unclassified | 853 |
| 121 | Ga0070698_100025250 | 3300005471 | Bacteria | 6191 |
| 122 | Ga0070698_100066554 | 3300005471 | Bacteria | 3626 |
| 123 | Ga0070698_100148368 | 3300005471 | Bacteria | 2294 |
| 124 | Ga0070698_100155537 | 3300005471 | Bacteria | 2232 |
| 125 | Ga0070698_100366279 | 3300005471 | Unclassified | 1373 |
| 126 | Ga0070698_100872296 | 3300005471 | Bacteria | 845 |
| 127 | Ga0070698_100887420 | 3300005471 | Bacteria | 837 |
| 128 | Ga0070698_101109572 | 3300005471 | Bacteria | 740 |
| 129 | Ga0070699_100208350 | 3300005518 | Unclassified | 1740 |
| 130 | Ga0070699_100243180 | 3300005518 | Bacteria | 1607 |
| 131 | Ga0070699_100417872 | 3300005518 | Bacteria | 1214 |
| 132 | Ga0070699_101744821 | 3300005518 | Bacteria | 570 |
| 133 | Ga0070679_100000324 | 3300005530 | Bacteria | 40356 |
| 134 | Ga0070679_100003088 | 3300005530 | Bacteria | 15217 |
| 135 | Ga0070679_100031101 | 3300005530 | Bacteria | 5272 |
| 136 | Ga0070679_100033292 | 3300005530 | Bacteria | 5103 |
| 137 | Ga0070679_100749841 | 3300005530 | Bacteria | 919 |
| 138 | Ga0070679_100995704 | 3300005530 | Unclassified | 782 |
| 139 | Ga0070679_101428929 | 3300005530 | Unclassified | 638 |
| 140 | Ga0070679_101718559 | 3300005530 | Bacteria | 575 |
| 141 | Ga0070684_100008695 | 3300005535 | Bacteria | 7960 |
| 142 | Ga0070684_100009879 | 3300005535 | Bacteria | 7540 |
| 143 | Ga0070684_100019647 | 3300005535 | Bacteria | 5591 |
| 144 | Ga0070684_100020262 | 3300005535 | Bacteria | 5517 |
| 145 | Ga0070684_100037730 | 3300005535 | Bacteria | 4147 |
| 146 | Ga0070684_100052208 | 3300005535 | Unclassified | 3554 |
| 147 | Ga0070684_100087850 | 3300005535 | Bacteria | 2761 |
| 148 | Ga0070684_100121929 | 3300005535 | Unclassified | 2346 |
| 149 | Ga0070684_100154345 | 3300005535 | Bacteria | 2081 |
| 150 | Ga0070684_100221074 | 3300005535 | Unclassified | 1728 |
| 151 | Ga0070697_101137770 | 3300005536 | Unclassified | 695 |
| 152 | Ga0070697_101380040 | 3300005536 | Unclassified | 629 |
| 153 | Ga0068853_100129827 | 3300005539 | Unclassified | 2255 |
| 154 | Ga0068853_100458388 | 3300005539 | Bacteria | 1200 |
| 155 | Ga0068853_101291806 | 3300005539 | Unclassified | 705 |
| 156 | Ga0070672_100103985 | 3300005543 | Bacteria | 2307 |
| 157 | Ga0070672_101099765 | 3300005543 | Bacteria | 706 |
| 158 | Ga0070672_101331168 | 3300005543 | Unclassified | 641 |
| 159 | Ga0070686_101297342 | 3300005544 | Unclassified | 608 |
| 160 | Ga0070695_100512723 | 3300005545 | Bacteria | 929 |
| 161 | Ga0070696_100034134 | 3300005546 | Bacteria | 3499 |
| 162 | Ga0070696_101081063 | 3300005546 | Unclassified | 673 |
| 163 | Ga0070693_100001328 | 3300005547 | Bacteria | 11130 |
| 164 | Ga0070693_100002384 | 3300005547 | Bacteria | 8642 |
| 165 | Ga0070693_100232490 | 3300005547 | Bacteria | 1214 |
| 166 | Ga0070693_100658607 | 3300005547 | Unclassified | 762 |
| 167 | Ga0070665_100187490 | 3300005548 | Bacteria | 2069 |
| 168 | Ga0070665_100589931 | 3300005548 | Bacteria | 1124 |
| 169 | Ga0070704_101480747 | 3300005549 | Bacteria | 624 |
| 170 | Ga0068855_100244380 | 3300005563 | Bacteria | 2004 |
| 171 | Ga0068855_100867358 | 3300005563 | Bacteria | 955 |
| 172 | Ga0070664_100012975 | 3300005564 | Bacteria | 6779 |
| 173 | Ga0070664_100554352 | 3300005564 | Bacteria | 1063 |
| 174 | Ga0070664_100711986 | 3300005564 | Bacteria | 936 |
| 175 | Ga0070664_101084057 | 3300005564 | Bacteria | 754 |
| 176 | Ga0070664_101577425 | 3300005564 | Bacteria | 622 |
| 177 | Ga0068857_100007684 | 3300005577 | Bacteria | 9287 |
| 178 | Ga0068857_100056503 | 3300005577 | Bacteria | 3483 |
| 179 | Ga0068857_100339363 | 3300005577 | Unclassified | 1390 |
| 180 | Ga0068857_100339664 | 3300005577 | Unclassified | 1389 |
| 181 | Ga0068857_100585897 | 3300005577 | Bacteria | 1053 |
| 182 | Ga0068857_101411462 | 3300005577 | Unclassified | 677 |
| 183 | Ga0068854_100027930 | 3300005578 | Bacteria | 3893 |
| 184 | Ga0068854_100205544 | 3300005578 | Bacteria | 1550 |
| 185 | Ga0068856_100006312 | 3300005614 | Bacteria | 11631 |
| 186 | Ga0068856_100012657 | 3300005614 | Bacteria | 8168 |
| 187 | Ga0068856_100065719 | 3300005614 | Bacteria | 3585 |
| 188 | Ga0068856_100102402 | 3300005614 | Bacteria | 2857 |
| 189 | Ga0068856_100242472 | 3300005614 | Bacteria | 1818 |
| 190 | Ga0070702_100004109 | 3300005615 | Bacteria | 6604 |
| 191 | Ga0068852_100003985 | 3300005616 | Bacteria | 10379 |
| 192 | Ga0068852_100101234 | 3300005616 | Bacteria | 2601 |
| 193 | Ga0068852_101824343 | 3300005616 | Bacteria | 630 |
| 194 | Ga0068859_100031530 | 3300005617 | Bacteria | 5323 |
| 195 | Ga0068859_100054066 | 3300005617 | Bacteria | 4038 |
| 196 | Ga0068859_100510121 | 3300005617 | Bacteria | 1298 |
| 197 | Ga0068859_100562515 | 3300005617 | Bacteria | 1234 |
| 198 | Ga0068859_100723186 | 3300005617 | Bacteria | 1085 |
| 199 | Ga0068864_100024727 | 3300005618 | Bacteria | 5053 |
| 200 | Ga0068864_100205354 | 3300005618 | Bacteria | 1812 |
| 201 | Ga0068864_100905945 | 3300005618 | Unclassified | 871 |
| 202 | Ga0068866_10458768 | 3300005718 | Bacteria | 835 |
| 203 | Ga0068861_100317359 | 3300005719 | Bacteria | 1356 |
| 204 | Ga0068861_100453297 | 3300005719 | Bacteria | 1150 |
| 205 | Ga0068861_101195628 | 3300005719 | Unclassified | 735 |
| 206 | Ga0068861_101287762 | 3300005719 | Bacteria | 710 |
| 207 | Ga0068870_10021362 | 3300005840 | Bacteria | 3165 |
| 208 | Ga0068870_10067816 | 3300005840 | Unclassified | 1937 |
| 209 | Ga0068870_10520040 | 3300005840 | Unclassified | 796 |
| 210 | Ga0068863_100006853 | 3300005841 | Bacteria | 11169 |
| 211 | Ga0068863_100117994 | 3300005841 | Bacteria | 2529 |
| 212 | Ga0068863_100276010 | 3300005841 | Unclassified | 1628 |
| 213 | Ga0068863_101828901 | 3300005841 | Unclassified | 617 |
| 214 | Ga0068858_100106428 | 3300005842 | Bacteria | 2618 |
| 215 | Ga0068858_100657397 | 3300005842 | Bacteria | 1019 |
| 216 | Ga0068860_100061141 | 3300005843 | Bacteria | 3579 |
| 217 | Ga0068860_100859733 | 3300005843 | Bacteria | 922 |
| 218 | Ga0068860_101166786 | 3300005843 | Unclassified | 790 |
| 219 | Ga0068862_100028830 | 3300005844 | Bacteria | 4676 |
| 220 | Ga0068862_100092395 | 3300005844 | Bacteria | 2638 |
| 221 | Ga0068862_100904684 | 3300005844 | Bacteria | 868 |
| 222 | Ga0081455_10004725 | 3300005937 | Bacteria | 15141 |
| 223 | Ga0081455_10120825 | 3300005937 | Bacteria | 2064 |
| 224 | Ga0081455_10593650 | 3300005937 | Bacteria | 723 |
| 225 | Ga0081538_10271871 | 3300005981 | Unclassified | 634 |
| 226 | Ga0081539_10000107 | 3300005985 | Bacteria | 195503 |
| 227 | Ga0075368_10018959 | 3300006042 | Bacteria | 2593 |
| 228 | Ga0075368_10372684 | 3300006042 | Unclassified | 624 |
| 229 | Ga0075363_100779089 | 3300006048 | Unclassified | 581 |
| 230 | Ga0075364_10026322 | 3300006051 | Bacteria | 3710 |
| 231 | Ga0075432_10425780 | 3300006058 | Bacteria | 578 |
| 232 | Ga0070715_10790507 | 3300006163 | Archaea | 575 |
| 233 | Ga0070716_100074830 | 3300006173 | Bacteria | 2002 |
| 234 | Ga0070716_100377546 | 3300006173 | Bacteria | 1012 |
| 235 | Ga0070712_100002494 | 3300006175 | Bacteria | 11354 |
| 236 | Ga0070712_100534025 | 3300006175 | Archaea | 987 |
| 237 | Ga0070712_100688012 | 3300006175 | Unclassified | 871 |
| 238 | Ga0070712_100776970 | 3300006175 | Archaea | 821 |
| 239 | Ga0075362_10088586 | 3300006177 | Bacteria | 1434 |
| 240 | Ga0075367_10038095 | 3300006178 | Bacteria | 2797 |
| 241 | Ga0075367_10411566 | 3300006178 | Bacteria | 856 |
| 242 | Ga0075427_10039799 | 3300006194 | Unclassified | 790 |
| 243 | Ga0075366_10011850 | 3300006195 | Bacteria | 4933 |
| 244 | Ga0097621_100162595 | 3300006237 | Unclassified | 1920 |
| 245 | Ga0068871_100025960 | 3300006358 | Bacteria | 4565 |
| 246 | Ga0068871_100285413 | 3300006358 | Bacteria | 1445 |
| 247 | Ga0075428_100020760 | 3300006844 | Bacteria | 7272 |
| 248 | Ga0075428_100177866 | 3300006844 | Bacteria | 2304 |
| 249 | Ga0075428_100323663 | 3300006844 | Bacteria | 1656 |
| 250 | Ga0075428_100611008 | 3300006844 | Bacteria | 1164 |
| 251 | Ga0075428_102079146 | 3300006844 | Unclassified | 588 |
| 252 | Ga0075430_100118559 | 3300006846 | Unclassified | 2206 |
| 253 | Ga0075430_100202171 | 3300006846 | Bacteria | 1649 |
| 254 | Ga0075430_100327327 | 3300006846 | Bacteria | 1267 |
| 255 | Ga0075430_100538014 | 3300006846 | Bacteria | 963 |
| 256 | Ga0075430_100769273 | 3300006846 | Unclassified | 794 |
| 257 | Ga0075430_100842752 | 3300006846 | Unclassified | 755 |
| 258 | Ga0075430_101686943 | 3300006846 | Unclassified | 520 |
| 259 | Ga0075431_100053258 | 3300006847 | Bacteria | 4172 |
| 260 | Ga0075431_100226728 | 3300006847 | Bacteria | 1905 |
| 261 | Ga0075431_100230602 | 3300006847 | Bacteria | 1887 |
| 262 | Ga0075431_100267999 | 3300006847 | Unclassified | 1732 |
| 263 | Ga0075431_100396378 | 3300006847 | Unclassified | 1382 |
| 264 | Ga0075431_100682016 | 3300006847 | Bacteria | 1006 |
| 265 | Ga0075431_100982854 | 3300006847 | Bacteria | 811 |
| 266 | Ga0075431_101093791 | 3300006847 | Unclassified | 762 |
| 267 | Ga0075431_101358088 | 3300006847 | Unclassified | 671 |
| 268 | Ga0075431_102039689 | 3300006847 | Bacteria | 529 |
| 269 | Ga0075434_100620024 | 3300006871 | Bacteria | 1100 |
| 270 | Ga0075429_100025053 | 3300006880 | Bacteria | 5178 |
| 271 | Ga0075429_100220016 | 3300006880 | Bacteria | 1663 |
| 272 | Ga0075429_100509393 | 3300006880 | Bacteria | 1055 |
| 273 | Ga0075429_100680249 | 3300006880 | Bacteria | 901 |
| 274 | Ga0075429_100900490 | 3300006880 | Unclassified | 774 |
| 275 | Ga0075429_101363457 | 3300006880 | Unclassified | 618 |
| 276 | Ga0068865_100305534 | 3300006881 | Bacteria | 1275 |
| 277 | Ga0097620_100031530 | 3300006931 | Bacteria | 5323 |
| 278 | Ga0097620_100054062 | 3300006931 | Bacteria | 4038 |
| 279 | Ga0097620_100510126 | 3300006931 | Bacteria | 1298 |
| 280 | Ga0097620_100562502 | 3300006931 | Bacteria | 1234 |
| 281 | Ga0097620_100587344 | 3300006931 | Bacteria | 1207 |
| 282 | Ga0097620_100723152 | 3300006931 | Bacteria | 1085 |
| 283 | Ga0075435_100567702 | 3300007076 | Unclassified | 983 |
| 284 | Ga0105250_10478615 | 3300009092 | Unclassified | 562 |
| 285 | Ga0105240_10061480 | 3300009093 | Bacteria | 4680 |
| 286 | Ga0105240_10289675 | 3300009093 | Bacteria | 1878 |
| 287 | Ga0105240_11177790 | 3300009093 | Unclassified | 812 |
| 288 | Ga0105240_11215814 | 3300009093 | Bacteria | 797 |
| 289 | Ga0105240_11343744 | 3300009093 | Unclassified | 753 |
| 290 | Ga0111539_10073471 | 3300009094 | Bacteria | 4032 |
| 291 | Ga0111539_10535316 | 3300009094 | Unclassified | 1365 |
| 292 | Ga0111539_10844173 | 3300009094 | Bacteria | 1066 |
| 293 | Ga0105245_10001632 | 3300009098 | Bacteria | 20415 |
| 294 | Ga0105245_10100561 | 3300009098 | Bacteria | 2675 |
| 295 | Ga0105245_10152827 | 3300009098 | Bacteria | 2184 |
| 296 | Ga0105245_10416389 | 3300009098 | Bacteria | 1346 |
| 297 | Ga0105245_12264014 | 3300009098 | Unclassified | 597 |
| 298 | Ga0105247_11112220 | 3300009101 | Unclassified | 624 |
| 299 | Ga0114129_10496292 | 3300009147 | Bacteria | 1595 |
| 300 | Ga0114129_10567250 | 3300009147 | Bacteria | 1474 |
| 301 | Ga0114129_10774529 | 3300009147 | Bacteria | 1226 |
| 302 | Ga0114129_12743264 | 3300009147 | Bacteria | 586 |
| 303 | Ga0105243_10236791 | 3300009148 | Bacteria | 1622 |
| 304 | Ga0105243_11343211 | 3300009148 | Bacteria | 733 |
| 305 | Ga0105243_12308718 | 3300009148 | Unclassified | 576 |
| 306 | Ga0105241_10005052 | 3300009174 | Bacteria | 9731 |
| 307 | Ga0105241_10015542 | 3300009174 | Bacteria | 5579 |
| 308 | Ga0105241_10112196 | 3300009174 | Bacteria | 2184 |
| 309 | Ga0105241_11486034 | 3300009174 | Unclassified | 651 |
| 310 | Ga0105241_12153388 | 3300009174 | Unclassified | 552 |
| 311 | Ga0105242_10373338 | 3300009176 | Bacteria | 1323 |
| 312 | Ga0105248_10004151 | 3300009177 | Bacteria | 16022 |
| 313 | Ga0105248_10032866 | 3300009177 | Bacteria | 5796 |
| 314 | Ga0105248_10275598 | 3300009177 | Bacteria | 1894 |
| 315 | Ga0105248_11088984 | 3300009177 | Unclassified | 903 |
| 316 | Ga0105237_10234653 | 3300009545 | Unclassified | 1836 |
| 317 | Ga0105238_10043384 | 3300009551 | Bacteria | 4551 |
| 318 | Ga0105238_10051012 | 3300009551 | Bacteria | 4163 |
| 319 | Ga0105238_10091528 | 3300009551 | Unclassified | 3028 |
| 320 | Ga0105238_10094171 | 3300009551 | Unclassified | 2983 |
| 321 | Ga0105238_10707627 | 3300009551 | Unclassified | 1019 |
| 322 | Ga0105249_10052953 | 3300009553 | Bacteria | 3708 |
| 323 | Ga0105249_10528721 | 3300009553 | Unclassified | 1228 |
| 324 | Ga0105249_10958874 | 3300009553 | Bacteria | 923 |
| 325 | Ga0105249_12631652 | 3300009553 | Unclassified | 575 |
| 326 | Ga0105239_10024044 | 3300010375 | Bacteria | 6712 |
| 327 | Ga0105239_10737060 | 3300010375 | Bacteria | 1127 |
| 328 | Ga0105246_10029204 | 3300011119 | Unclassified | 3630 |
| 329 | Ga0105246_10110529 | 3300011119 | Unclassified | 2018 |
| 330 | Ga0157373_10081340 | 3300013100 | Bacteria | 2283 |
| 331 | Ga0157373_10133031 | 3300013100 | Unclassified | 1749 |
| 332 | Ga0157371_10013862 | 3300013102 | Bacteria | 6107 |
| 333 | Ga0157370_10001778 | 3300013104 | Bacteria | 26589 |
| 334 | Ga0157370_10011127 | 3300013104 | Bacteria | 9432 |
| 335 | Ga0157370_10020822 | 3300013104 | Bacteria | 6543 |
| 336 | Ga0157370_10039916 | 3300013104 | Unclassified | 4534 |
| 337 | Ga0157370_10062810 | 3300013104 | Bacteria | 3521 |
| 338 | Ga0157370_10138219 | 3300013104 | Unclassified | 2270 |
| 339 | Ga0157370_10428000 | 3300013104 | Unclassified | 1217 |
| 340 | Ga0157369_10048959 | 3300013105 | Bacteria | 4583 |
| 341 | Ga0157369_10115557 | 3300013105 | Bacteria | 2850 |
| 342 | Ga0157369_10339211 | 3300013105 | Bacteria | 1561 |
| 343 | Ga0157369_10451928 | 3300013105 | Bacteria | 1331 |
| 344 | Ga0157369_10681941 | 3300013105 | Bacteria | 1059 |
| 345 | Ga0157369_10830411 | 3300013105 | Bacteria | 949 |
| 346 | Ga0157369_11523212 | 3300013105 | Bacteria | 680 |
| 347 | Ga0157374_10004077 | 3300013296 | Bacteria | 12266 |
| 348 | Ga0157374_10042795 | 3300013296 | Unclassified | 4180 |
| 349 | Ga0157374_11680131 | 3300013296 | Bacteria | 660 |
| 350 | Ga0157374_12733592 | 3300013296 | Unclassified | 521 |
| 351 | Ga0163162_10443457 | 3300013306 | Bacteria | 1430 |
| 352 | Ga0163162_13416007 | 3300013306 | Unclassified | 506 |
| 353 | Ga0157372_10005007 | 3300013307 | Bacteria | 14074 |
| 354 | Ga0157372_10038332 | 3300013307 | Bacteria | 5288 |
| 355 | Ga0157372_10041086 | 3300013307 | Bacteria | 5112 |
| 356 | Ga0157372_10073408 | 3300013307 | Unclassified | 3856 |
| 357 | Ga0157372_10085721 | 3300013307 | Bacteria | 3573 |
| 358 | Ga0157372_10102836 | 3300013307 | Unclassified | 3264 |
| 359 | Ga0157372_10176564 | 3300013307 | Bacteria | 2472 |
| 360 | Ga0157372_10310025 | 3300013307 | Bacteria | 1837 |
| 361 | Ga0157372_10411612 | 3300013307 | Unclassified | 1576 |
| 362 | Ga0157372_10456862 | 3300013307 | Unclassified | 1488 |
| 363 | Ga0157372_10477709 | 3300013307 | Bacteria | 1453 |
| 364 | Ga0157372_11466329 | 3300013307 | Unclassified | 786 |
| 365 | Ga0157372_12083461 | 3300013307 | Bacteria | 652 |
| 366 | Ga0157372_12652118 | 3300013307 | Bacteria | 575 |
| 367 | Ga0157375_10008426 | 3300013308 | Bacteria | 9030 |
| 368 | Ga0157375_10066285 | 3300013308 | Bacteria | 3604 |
| 369 | Ga0157375_10142251 | 3300013308 | Bacteria | 2527 |
| 370 | Ga0157375_10311973 | 3300013308 | Unclassified | 1737 |
| 371 | Ga0157375_10442056 | 3300013308 | Bacteria | 1466 |
| 372 | Ga0157375_11931839 | 3300013308 | Unclassified | 701 |
| 373 | Ga0157375_13093956 | 3300013308 | Unclassified | 555 |
| 374 | Ga0163163_10008889 | 3300014325 | Bacteria | 8946 |
| 375 | Ga0163163_10171235 | 3300014325 | Bacteria | 2218 |
| 376 | Ga0157380_10037158 | 3300014326 | Bacteria | 3771 |
| 377 | Ga0157380_10255716 | 3300014326 | Unclassified | 1588 |
| 378 | Ga0157380_10358517 | 3300014326 | Unclassified | 1367 |
| 379 | Ga0157380_10911170 | 3300014326 | Bacteria | 906 |
| 380 | Ga0157380_11967827 | 3300014326 | Bacteria | 646 |
| 381 | Ga0157380_12688504 | 3300014326 | Unclassified | 564 |
| 382 | Ga0157377_10003078 | 3300014745 | Bacteria | 7488 |
| 383 | Ga0157377_10460729 | 3300014745 | Bacteria | 880 |
| 384 | Ga0157379_10406837 | 3300014968 | Bacteria | 1251 |
| 385 | Ga0157379_10611869 | 3300014968 | Bacteria | 1018 |
| 386 | Ga0157379_10771802 | 3300014968 | Bacteria | 906 |
| 387 | Ga0157376_10197259 | 3300014969 | Bacteria | 1850 |
| 388 | Ga0182007_10176977 | 3300015262 | Bacteria | 736 |
| 389 | Ga0182007_10200790 | 3300015262 | Viruses | 697 |
| 390 | Ga0182007_10203650 | 3300015262 | Bacteria | 693 |
| 391 | Ga0163161_10834187 | 3300017792 | Bacteria | 777 |
| 392 | Ga0213876_10002367 | 3300021384 | Bacteria | 11096 |
| 393 | Ga0213876_10105025 | 3300021384 | Bacteria | 1499 |
| 394 | Ga0213876_10172046 | 3300021384 | Bacteria | 1152 |
| 395 | Ga0213876_10263687 | 3300021384 | Bacteria | 916 |
| 396 | Ga0213876_10449776 | 3300021384 | Bacteria | 685 |
| 397 | Ga0207697_10003546 | 3300025315 | Bacteria | 7685 |
| 398 | Ga0207697_10412706 | 3300025315 | Bacteria | 600 |
| 399 | Ga0207656_10462879 | 3300025321 | Bacteria | 641 |
| 400 | Ga0207653_10023614 | 3300025885 | Bacteria | 1959 |
| 401 | Ga0207692_10050796 | 3300025898 | Bacteria | 2099 |
| 402 | Ga0207692_10546334 | 3300025898 | Unclassified | 740 |
| 403 | Ga0207692_10787451 | 3300025898 | Unclassified | 621 |
| 404 | Ga0207642_10172813 | 3300025899 | Bacteria | 1171 |
| 405 | Ga0207688_10682678 | 3300025901 | Unclassified | 649 |
| 406 | Ga0207680_10474296 | 3300025903 | Bacteria | 889 |
| 407 | Ga0207680_11306591 | 3300025903 | Bacteria | 516 |
| 408 | Ga0207647_10073309 | 3300025904 | Bacteria | 2063 |
| 409 | Ga0207647_10283839 | 3300025904 | Bacteria | 945 |
| 410 | Ga0207699_10019530 | 3300025906 | Bacteria | 3616 |
| 411 | Ga0207699_10038219 | 3300025906 | Bacteria | 2749 |
| 412 | Ga0207699_10144874 | 3300025906 | Bacteria | 1565 |
| 413 | Ga0207699_10299341 | 3300025906 | Bacteria | 1123 |
| 414 | Ga0207645_10008299 | 3300025907 | Bacteria | 7255 |
| 415 | Ga0207643_10020488 | 3300025908 | Bacteria | 3629 |
| 416 | Ga0207643_10027275 | 3300025908 | Bacteria | 3166 |
| 417 | Ga0207654_10055572 | 3300025911 | Bacteria | 2292 |
| 418 | Ga0207654_10159814 | 3300025911 | Bacteria | 1454 |
| 419 | Ga0207654_10235603 | 3300025911 | Bacteria | 1221 |
| 420 | Ga0207654_11118167 | 3300025911 | Unclassified | 574 |
| 421 | Ga0207707_10015646 | 3300025912 | Bacteria | 6608 |
| 422 | Ga0207707_10021534 | 3300025912 | Bacteria | 5635 |
| 423 | Ga0207707_10336784 | 3300025912 | Unclassified | 1301 |
| 424 | Ga0207695_10009415 | 3300025913 | Bacteria | 12081 |
| 425 | Ga0207695_10029463 | 3300025913 | Bacteria | 6064 |
| 426 | Ga0207695_10072580 | 3300025913 | Bacteria | 3511 |
| 427 | Ga0207695_10082363 | 3300025913 | Bacteria | 3254 |
| 428 | Ga0207695_11268244 | 3300025913 | Unclassified | 617 |
| 429 | Ga0207671_11036950 | 3300025914 | Unclassified | 646 |
| 430 | Ga0207693_10004728 | 3300025915 | Bacteria | 11452 |
| 431 | Ga0207693_10226292 | 3300025915 | Bacteria | 1469 |
| 432 | Ga0207693_10841670 | 3300025915 | Unclassified | 706 |
| 433 | Ga0207663_10031396 | 3300025916 | Bacteria | 3144 |
| 434 | Ga0207663_10377039 | 3300025916 | Unclassified | 1080 |
| 435 | Ga0207660_10000125 | 3300025917 | Bacteria | 45245 |
| 436 | Ga0207660_10006752 | 3300025917 | Bacteria | 7431 |
| 437 | Ga0207660_10008506 | 3300025917 | Bacteria | 6638 |
| 438 | Ga0207660_10021795 | 3300025917 | Bacteria | 4312 |
| 439 | Ga0207660_10034479 | 3300025917 | Bacteria | 3509 |
| 440 | Ga0207660_10935989 | 3300025917 | Bacteria | 707 |
| 441 | Ga0207660_10955134 | 3300025917 | Bacteria | 699 |
| 442 | Ga0207660_11606638 | 3300025917 | Unclassified | 524 |
| 443 | Ga0207662_10002734 | 3300025918 | Bacteria | 8899 |
| 444 | Ga0207662_10425584 | 3300025918 | Bacteria | 904 |
| 445 | Ga0207657_10041916 | 3300025919 | Unclassified | 4043 |
| 446 | Ga0207657_10068870 | 3300025919 | Bacteria | 3005 |
| 447 | Ga0207657_10550599 | 3300025919 | Bacteria | 902 |
| 448 | Ga0207657_10731045 | 3300025919 | Bacteria | 767 |
| 449 | Ga0207649_10002072 | 3300025920 | Bacteria | 11405 |
| 450 | Ga0207649_10152389 | 3300025920 | Unclassified | 1594 |
| 451 | Ga0207649_10597298 | 3300025920 | Bacteria | 848 |
| 452 | Ga0207649_10985539 | 3300025920 | Bacteria | 663 |
| 453 | Ga0207649_11236432 | 3300025920 | Bacteria | 590 |
| 454 | Ga0207652_10002437 | 3300025921 | Bacteria | 15709 |
| 455 | Ga0207652_10004272 | 3300025921 | Bacteria | 11656 |
| 456 | Ga0207652_10015782 | 3300025921 | Bacteria | 6153 |
| 457 | Ga0207652_10022380 | 3300025921 | Bacteria | 5229 |
| 458 | Ga0207652_10041904 | 3300025921 | Bacteria | 3894 |
| 459 | Ga0207652_10178376 | 3300025921 | Unclassified | 1908 |
| 460 | Ga0207652_10248355 | 3300025921 | Bacteria | 1604 |
| 461 | Ga0207652_10462802 | 3300025921 | Unclassified | 1143 |
| 462 | Ga0207652_11084688 | 3300025921 | Unclassified | 701 |
| 463 | Ga0207646_10175902 | 3300025922 | Bacteria | 1933 |
| 464 | Ga0207646_10759714 | 3300025922 | Unclassified | 865 |
| 465 | Ga0207646_10872335 | 3300025922 | Bacteria | 799 |
| 466 | Ga0207681_10109325 | 3300025923 | Unclassified | 2008 |
| 467 | Ga0207681_10512401 | 3300025923 | Bacteria | 983 |
| 468 | Ga0207694_10045387 | 3300025924 | Bacteria | 3395 |
| 469 | Ga0207694_10119900 | 3300025924 | Bacteria | 2099 |
| 470 | Ga0207694_10712543 | 3300025924 | Unclassified | 846 |
| 471 | Ga0207650_10066983 | 3300025925 | Unclassified | 2693 |
| 472 | Ga0207650_10136695 | 3300025925 | Unclassified | 1923 |
| 473 | Ga0207650_10616067 | 3300025925 | Unclassified | 913 |
| 474 | Ga0207650_10714237 | 3300025925 | Unclassified | 847 |
| 475 | Ga0207650_10895813 | 3300025925 | Unclassified | 753 |
| 476 | Ga0207650_10966159 | 3300025925 | Bacteria | 724 |
| 477 | Ga0207650_10996385 | 3300025925 | Bacteria | 713 |
| 478 | Ga0207659_10035565 | 3300025926 | Bacteria | 3444 |
| 479 | Ga0207659_10175648 | 3300025926 | Bacteria | 1693 |
| 480 | Ga0207659_10258705 | 3300025926 | Bacteria | 1415 |
| 481 | Ga0207659_10329219 | 3300025926 | Bacteria | 1262 |
| 482 | Ga0207659_10689681 | 3300025926 | Unclassified | 874 |
| 483 | Ga0207659_10853246 | 3300025926 | Bacteria | 783 |
| 484 | Ga0207687_10015005 | 3300025927 | Bacteria | 5075 |
| 485 | Ga0207687_10199478 | 3300025927 | Unclassified | 1563 |
| 486 | Ga0207687_10380276 | 3300025927 | Bacteria | 1157 |
| 487 | Ga0207687_10683173 | 3300025927 | Bacteria | 870 |
| 488 | Ga0207687_11874040 | 3300025927 | Unclassified | 513 |
| 489 | Ga0207700_10000677 | 3300025928 | Bacteria | 19822 |
| 490 | Ga0207700_11613492 | 3300025928 | Unclassified | 574 |
| 491 | Ga0207664_10092197 | 3300025929 | Bacteria | 2486 |
| 492 | Ga0207664_10160623 | 3300025929 | Bacteria | 1916 |
| 493 | Ga0207644_10005945 | 3300025931 | Bacteria | 7955 |
| 494 | Ga0207644_10285996 | 3300025931 | Bacteria | 1325 |
| 495 | Ga0207644_11807282 | 3300025931 | Unclassified | 511 |
| 496 | Ga0207690_10022978 | 3300025932 | Bacteria | 3886 |
| 497 | Ga0207690_10079734 | 3300025932 | Bacteria | 2282 |
| 498 | Ga0207690_10308053 | 3300025932 | Bacteria | 1241 |
| 499 | Ga0207706_10001438 | 3300025933 | Bacteria | 23820 |
| 500 | Ga0207706_10001946 | 3300025933 | Bacteria | 20277 |
| 501 | Ga0207706_10078194 | 3300025933 | Bacteria | 2910 |
| 502 | Ga0207686_10025717 | 3300025934 | Bacteria | 3428 |
| 503 | Ga0207686_10109855 | 3300025934 | Bacteria | 1857 |
| 504 | Ga0207686_10162093 | 3300025934 | Bacteria | 1568 |
| 505 | Ga0207686_10362396 | 3300025934 | Bacteria | 1094 |
| 506 | Ga0207709_10228169 | 3300025935 | Bacteria | 1347 |
| 507 | Ga0207670_10147939 | 3300025936 | Bacteria | 1739 |
| 508 | Ga0207670_10210326 | 3300025936 | Bacteria | 1483 |
| 509 | Ga0207670_10941849 | 3300025936 | Bacteria | 725 |
| 510 | Ga0207670_11578068 | 3300025936 | Unclassified | 558 |
| 511 | Ga0207669_10354369 | 3300025937 | Bacteria | 1135 |
| 512 | Ga0207669_11057138 | 3300025937 | Unclassified | 684 |
| 513 | Ga0207669_11110635 | 3300025937 | Unclassified | 668 |
| 514 | Ga0207704_10089889 | 3300025938 | Unclassified | 2013 |
| 515 | Ga0207665_10042233 | 3300025939 | Unclassified | 3048 |
| 516 | Ga0207665_10171612 | 3300025939 | Bacteria | 1567 |
| 517 | Ga0207665_10497011 | 3300025939 | Bacteria | 942 |
| 518 | Ga0207691_10002778 | 3300025940 | Bacteria | 17069 |
| 519 | Ga0207691_10095357 | 3300025940 | Bacteria | 2661 |
| 520 | Ga0207691_10417487 | 3300025940 | Bacteria | 1143 |
| 521 | Ga0207691_11404737 | 3300025940 | Bacteria | 573 |
| 522 | Ga0207711_10015343 | 3300025941 | Bacteria | 6359 |
| 523 | Ga0207711_10469551 | 3300025941 | Bacteria | 1172 |
| 524 | Ga0207689_10012567 | 3300025942 | Bacteria | 7233 |
| 525 | Ga0207689_10013117 | 3300025942 | Bacteria | 7074 |
| 526 | Ga0207689_10019669 | 3300025942 | Bacteria | 5690 |
| 527 | Ga0207689_10645289 | 3300025942 | Bacteria | 892 |
| 528 | Ga0207661_10001069 | 3300025944 | Bacteria | 18229 |
| 529 | Ga0207661_10004658 | 3300025944 | Bacteria | 9607 |
| 530 | Ga0207661_10007254 | 3300025944 | Bacteria | 7884 |
| 531 | Ga0207661_10010780 | 3300025944 | Bacteria | 6590 |
| 532 | Ga0207661_10026981 | 3300025944 | Unclassified | 4383 |
| 533 | Ga0207661_10028616 | 3300025944 | Bacteria | 4270 |
| 534 | Ga0207661_10101216 | 3300025944 | Bacteria | 2420 |
| 535 | Ga0207661_10155307 | 3300025944 | Bacteria | 1981 |
| 536 | Ga0207661_10155686 | 3300025944 | Unclassified | 1979 |
| 537 | Ga0207661_10386441 | 3300025944 | Unclassified | 1267 |
| 538 | Ga0207661_10434734 | 3300025944 | Bacteria | 1193 |
| 539 | Ga0207661_10611064 | 3300025944 | Bacteria | 1001 |
| 540 | Ga0207661_10633455 | 3300025944 | Bacteria | 982 |
| 541 | Ga0207661_10742534 | 3300025944 | Bacteria | 903 |
| 542 | Ga0207661_10895460 | 3300025944 | Bacteria | 817 |
| 543 | Ga0207679_10024364 | 3300025945 | Unclassified | 4148 |
| 544 | Ga0207679_10098470 | 3300025945 | Bacteria | 2280 |
| 545 | Ga0207679_10305353 | 3300025945 | Bacteria | 1373 |
| 546 | Ga0207679_10658117 | 3300025945 | Bacteria | 948 |
| 547 | Ga0207679_10672010 | 3300025945 | Bacteria | 938 |
| 548 | Ga0207679_10699290 | 3300025945 | Unclassified | 920 |
| 549 | Ga0207679_11619154 | 3300025945 | Unclassified | 593 |
| 550 | Ga0207679_11874745 | 3300025945 | Bacteria | 547 |
| 551 | Ga0207667_10253880 | 3300025949 | Bacteria | 1799 |
| 552 | Ga0207667_10318590 | 3300025949 | Unclassified | 1588 |
| 553 | Ga0207667_10338306 | 3300025949 | Bacteria | 1536 |
| 554 | Ga0207651_10307759 | 3300025960 | Bacteria | 1320 |
| 555 | Ga0207651_10356518 | 3300025960 | Bacteria | 1233 |
| 556 | Ga0207651_11466347 | 3300025960 | Unclassified | 614 |
| 557 | Ga0207651_11916245 | 3300025960 | Unclassified | 533 |
| 558 | Ga0207712_10013492 | 3300025961 | Bacteria | 5240 |
| 559 | Ga0207712_10269362 | 3300025961 | Bacteria | 1385 |
| 560 | Ga0207712_11633266 | 3300025961 | Unclassified | 578 |
| 561 | Ga0207668_10065543 | 3300025972 | Bacteria | 2571 |
| 562 | Ga0207668_10175927 | 3300025972 | Unclassified | 1683 |
| 563 | Ga0207668_10375211 | 3300025972 | Bacteria | 1196 |
| 564 | Ga0207668_10412845 | 3300025972 | Bacteria | 1144 |
| 565 | Ga0207668_11370852 | 3300025972 | Unclassified | 637 |
| 566 | Ga0207640_10037807 | 3300025981 | Bacteria | 3040 |
| 567 | Ga0207640_10323324 | 3300025981 | Bacteria | 1229 |
| 568 | Ga0207640_12130164 | 3300025981 | Unclassified | 509 |
| 569 | Ga0207658_10119403 | 3300025986 | Bacteria | 2099 |
| 570 | Ga0207658_10145665 | 3300025986 | Bacteria | 1923 |
| 571 | Ga0207658_10165610 | 3300025986 | Bacteria | 1816 |
| 572 | Ga0207658_11361505 | 3300025986 | Unclassified | 649 |
| 573 | Ga0207677_10064425 | 3300026023 | Bacteria | 2552 |
| 574 | Ga0207677_10065972 | 3300026023 | Bacteria | 2528 |
| 575 | Ga0207703_10056394 | 3300026035 | Bacteria | 3200 |
| 576 | Ga0207703_10504854 | 3300026035 | Bacteria | 1136 |
| 577 | Ga0207639_10797993 | 3300026041 | Bacteria | 880 |
| 578 | Ga0207639_11907401 | 3300026041 | Bacteria | 555 |
| 579 | Ga0207678_10028798 | 3300026067 | Bacteria | 4849 |
| 580 | Ga0207678_10770968 | 3300026067 | Bacteria | 848 |
| 581 | Ga0207678_11329888 | 3300026067 | Bacteria | 636 |
| 582 | Ga0207708_10098309 | 3300026075 | Bacteria | 2262 |
| 583 | Ga0207708_10118272 | 3300026075 | Bacteria | 2063 |
| 584 | Ga0207708_10937526 | 3300026075 | Bacteria | 750 |
| 585 | Ga0207702_10021029 | 3300026078 | Bacteria | 5399 |
| 586 | Ga0207702_10049102 | 3300026078 | Unclassified | 3560 |
| 587 | Ga0207702_10122516 | 3300026078 | Bacteria | 2329 |
| 588 | Ga0207702_10268145 | 3300026078 | Bacteria | 1610 |
| 589 | Ga0207702_10386363 | 3300026078 | Bacteria | 1347 |
| 590 | Ga0207702_11057419 | 3300026078 | Bacteria | 805 |
| 591 | Ga0207702_11161478 | 3300026078 | Unclassified | 766 |
| 592 | Ga0207702_11229024 | 3300026078 | Bacteria | 743 |
| 593 | Ga0207641_10006735 | 3300026088 | Bacteria | 9629 |
| 594 | Ga0207641_10304785 | 3300026088 | Unclassified | 1506 |
| 595 | Ga0207641_10676552 | 3300026088 | Bacteria | 1015 |
| 596 | Ga0207641_11183550 | 3300026088 | Bacteria | 764 |
| 597 | Ga0207641_11905791 | 3300026088 | Unclassified | 596 |
| 598 | Ga0207648_10067873 | 3300026089 | Unclassified | 3108 |
| 599 | Ga0207648_10278989 | 3300026089 | Bacteria | 1494 |
| 600 | Ga0207648_10330095 | 3300026089 | Unclassified | 1372 |
| 601 | Ga0207648_10561578 | 3300026089 | Bacteria | 1049 |
| 602 | Ga0207648_10589394 | 3300026089 | Unclassified | 1024 |
| 603 | Ga0207676_10003700 | 3300026095 | Bacteria | 10811 |
| 604 | Ga0207676_10068045 | 3300026095 | Bacteria | 2847 |
| 605 | Ga0207676_11247915 | 3300026095 | Unclassified | 737 |
| 606 | Ga0207676_11399384 | 3300026095 | Unclassified | 695 |
| 607 | Ga0207674_10000013 | 3300026116 | Bacteria | 187953 |
| 608 | Ga0207674_10011483 | 3300026116 | Bacteria | 9950 |
| 609 | Ga0207674_10089072 | 3300026116 | Bacteria | 3079 |
| 610 | Ga0207674_10431586 | 3300026116 | Bacteria | 1273 |
| 611 | Ga0207674_10510380 | 3300026116 | Unclassified | 1161 |
| 612 | Ga0207674_10655031 | 3300026116 | Unclassified | 1014 |
| 613 | Ga0207674_11091001 | 3300026116 | Unclassified | 768 |
| 614 | Ga0207674_11331888 | 3300026116 | Unclassified | 687 |
| 615 | Ga0207675_100000197 | 3300026118 | Bacteria | 55600 |
| 616 | Ga0207675_100373052 | 3300026118 | Bacteria | 1402 |
| 617 | Ga0207675_100793253 | 3300026118 | Bacteria | 960 |
| 618 | Ga0207675_102017396 | 3300026118 | Bacteria | 594 |
| 619 | Ga0207683_10272354 | 3300026121 | Bacteria | 1547 |
| 620 | Ga0207698_10002825 | 3300026142 | Bacteria | 10395 |
| 621 | Ga0207698_10020146 | 3300026142 | Bacteria | 4586 |
| 622 | Ga0207698_10028729 | 3300026142 | Bacteria | 3970 |
| 623 | Ga0207698_10082339 | 3300026142 | Bacteria | 2601 |
| 624 | Ga0207698_10426926 | 3300026142 | Bacteria | 1273 |
| 625 | Ga0209995_1025033 | 3300027471 | Bacteria | 994 |
| 626 | Ga0207428_10032517 | 3300027907 | Bacteria | 4289 |
| 627 | Ga0207428_10563647 | 3300027907 | Unclassified | 823 |
| 628 | Ga0207428_10637499 | 3300027907 | Unclassified | 765 |
| 629 | Ga0268266_10935734 | 3300028379 | Bacteria | 838 |
| 630 | Ga0268265_10044736 | 3300028380 | Bacteria | 3298 |
| 631 | Ga0268265_10127006 | 3300028380 | Bacteria | 2112 |
| 632 | Ga0268265_10156081 | 3300028380 | Unclassified | 1931 |
| 633 | Ga0268265_10246921 | 3300028380 | Bacteria | 1578 |
| 634 | Ga0268264_10033854 | 3300028381 | Bacteria | 4200 |
| 635 | Ga0268264_10825923 | 3300028381 | Unclassified | 927 |
| 636 | Ga0265332_10061825 | 3300031238 | Bacteria | 1600 |
| 637 | Ga0265327_10056319 | 3300031251 | Bacteria | 2026 |
| 638 | Ga0307408_100020829 | 3300031548 | Bacteria | 4430 |
| 639 | Ga0307408_100176679 | 3300031548 | Bacteria | 1709 |
| 640 | Ga0307408_100240210 | 3300031548 | Bacteria | 1488 |
| 641 | Ga0307408_100319807 | 3300031548 | Bacteria | 1307 |
| 642 | Ga0307408_100447095 | 3300031548 | Unclassified | 1120 |
| 643 | Ga0307408_100739135 | 3300031548 | Bacteria | 888 |
| 644 | Ga0307408_100875138 | 3300031548 | Bacteria | 820 |
| 645 | Ga0265314_10033130 | 3300031711 | Bacteria | 3792 |
| 646 | Ga0307405_10002340 | 3300031731 | Bacteria | 8331 |
| 647 | Ga0307405_10121822 | 3300031731 | Unclassified | 1786 |
| 648 | Ga0307405_10202340 | 3300031731 | Bacteria | 1443 |
| 649 | Ga0307405_10376813 | 3300031731 | Bacteria | 1103 |
| 650 | Ga0307413_10122775 | 3300031824 | Bacteria | 1762 |
| 651 | Ga0307413_10148424 | 3300031824 | Bacteria | 1630 |
| 652 | Ga0307413_10327175 | 3300031824 | Bacteria | 1173 |
| 653 | Ga0307413_10403828 | 3300031824 | Bacteria | 1071 |
| 654 | Ga0307413_10408827 | 3300031824 | Unclassified | 1066 |
| 655 | Ga0307413_11592791 | 3300031824 | Bacteria | 580 |
| 656 | Ga0307410_10000113 | 3300031852 | Bacteria | 28226 |
| 657 | Ga0307410_10598599 | 3300031852 | Bacteria | 919 |
| 658 | Ga0307410_11112383 | 3300031852 | Bacteria | 685 |
| 659 | Ga0307410_11479951 | 3300031852 | Unclassified | 598 |
| 660 | Ga0307406_10001742 | 3300031901 | Bacteria | 11928 |
| 661 | Ga0307406_10019235 | 3300031901 | Bacteria | 4005 |
| 662 | Ga0307406_10024566 | 3300031901 | Bacteria | 3601 |
| 663 | Ga0307406_10472345 | 3300031901 | Bacteria | 1011 |
| 664 | Ga0307406_11438652 | 3300031901 | Unclassified | 605 |
| 665 | Ga0307406_11885800 | 3300031901 | Bacteria | 533 |
| 666 | Ga0307407_10002675 | 3300031903 | Bacteria | 7061 |
| 667 | Ga0307407_10003744 | 3300031903 | Bacteria | 6315 |
| 668 | Ga0307407_10156346 | 3300031903 | Bacteria | 1487 |
| 669 | Ga0307407_11181047 | 3300031903 | Bacteria | 597 |
| 670 | Ga0307412_10065380 | 3300031911 | Bacteria | 2461 |
| 671 | Ga0307412_10096468 | 3300031911 | Bacteria | 2081 |
| 672 | Ga0307412_10202943 | 3300031911 | Bacteria | 1507 |
| 673 | Ga0307412_10334915 | 3300031911 | Bacteria | 1209 |
| 674 | Ga0307412_10628487 | 3300031911 | Bacteria | 913 |
| 675 | Ga0307409_100044182 | 3300031995 | Bacteria | 3353 |
| 676 | Ga0307409_100084586 | 3300031995 | Bacteria | 2576 |
| 677 | Ga0307409_100088407 | 3300031995 | Bacteria | 2529 |
| 678 | Ga0307409_100120034 | 3300031995 | Bacteria | 2224 |
| 679 | Ga0307409_100124105 | 3300031995 | Bacteria | 2193 |
| 680 | Ga0307409_100445518 | 3300031995 | Bacteria | 1248 |
| 681 | Ga0307409_101466908 | 3300031995 | Bacteria | 709 |
| 682 | Ga0307409_101694565 | 3300031995 | Unclassified | 661 |
| 683 | Ga0307409_101743100 | 3300031995 | Bacteria | 652 |
| 684 | Ga0307416_100035530 | 3300032002 | Bacteria | 3807 |
| 685 | Ga0307416_100047843 | 3300032002 | Bacteria | 3388 |
| 686 | Ga0307416_100221494 | 3300032002 | Bacteria | 1815 |
| 687 | Ga0307416_100275416 | 3300032002 | Unclassified | 1655 |
| 688 | Ga0307414_10063483 | 3300032004 | Bacteria | 2625 |
| 689 | Ga0307414_11129550 | 3300032004 | Bacteria | 724 |
| 690 | Ga0307414_12010564 | 3300032004 | Bacteria | 540 |
| 691 | Ga0307411_10003115 | 3300032005 | Bacteria | 7595 |
| 692 | Ga0307411_10139848 | 3300032005 | Bacteria | 1783 |
| 693 | Ga0307411_10346635 | 3300032005 | Unclassified | 1209 |
| 694 | Ga0307411_10542120 | 3300032005 | Bacteria | 991 |
| 695 | Ga0307411_10858675 | 3300032005 | Bacteria | 803 |
| 696 | Ga0307411_11153115 | 3300032005 | Bacteria | 701 |
| 697 | Ga0307411_11481657 | 3300032005 | Bacteria | 623 |
| 698 | Ga0307415_100002414 | 3300032126 | Bacteria | 9314 |
| 699 | Ga0307415_100003797 | 3300032126 | Bacteria | 7740 |
| 700 | Ga0307415_100159889 | 3300032126 | Bacteria | 1745 |
| 701 | Ga0307415_101621936 | 3300032126 | Bacteria | 622 |
| 702 | Ga0307415_101666298 | 3300032126 | Bacteria | 614 |
| 703 | Ga0307415_102073366 | 3300032126 | Bacteria | 555 |
| 704 | Ga0373934_0000881 | 3300035086 | Bacteria | 10826 |
| 705 | Ga0373934_0004308 | 3300035086 | Bacteria | 5253 |
| 706 | Ga0373934_0059403 | 3300035086 | Bacteria | 1522 |
| 707 | Ga0373923_0042004 | 3300035111 | Unclassified | 1887 |
| 708 | Ga0373945_0027103 | 3300035116 | Bacteria | 2001 |
| 709 | Ga0373953_0119380 | 3300035117 | Bacteria | 1119 |
| 710 | Ga0373953_0202587 | 3300035117 | Unclassified | 858 |
| 711 | Ga0373954_0046112 | 3300035118 | Bacteria | 2037 |
| 712 | Ga0373954_0349814 | 3300035118 | Unclassified | 730 |
| 713 | Ga0373956_0015144 | 3300035119 | Bacteria | 3227 |
| 714 | Ga0373956_0129674 | 3300035119 | Bacteria | 1180 |
| 715 | Ga0373956_0378157 | 3300035119 | Bacteria | 675 |
| 716 | Ga0373943_0205184 | 3300035170 | Unclassified | 1092 |
| 717 | Ga0373946_0319199 | 3300035171 | Bacteria | 771 |
| 718 | Ga0373955_0239198 | 3300035172 | Unclassified | 1087 |
| 719 | Ga0373955_0264714 | 3300035172 | Bacteria | 1032 |
| 720 | Ga0373924_0108933 | 3300035410 | Bacteria | 1196 |
| 721 | Ga0373924_0583313 | 3300035410 | Bacteria | 504 |
| 722 | Ga0373931_0021274 | 3300035691 | Bacteria | 3253 |
| 723 | Ga0373931_0610711 | 3300035691 | Bacteria | 714 |
| 724 | Ga0373935_0988214 | 3300035692 | Bacteria | 625 |
| 725 | Ga0373933_0017865 | 3300035724 | Bacteria | 3983 |
| 726 | Ga0373933_0164186 | 3300035724 | Bacteria | 1411 |
| 727 | Ga0373933_0524484 | 3300035724 | Unclassified | 776 |
| 728 | Ga0373947_0015708 | 3300035725 | Bacteria | 4349 |
| 729 | Ga0373947_0269944 | 3300035725 | Bacteria | 1129 |
| 730 | Ga0373937_0002454 | 3300036401 | Bacteria | 15410 |
| 731 | Ga0373937_0004785 | 3300036401 | Bacteria | 11498 |
| 732 | Ga0373937_0041478 | 3300036401 | Bacteria | 4197 |
| 733 | Ga0373937_0153941 | 3300036401 | Bacteria | 2154 |
| 734 | Ga0373937_0848927 | 3300036401 | Bacteria | 861 |
| 735 | Ga0373925_0348004 | 3300037068 | Bacteria | 1203 |
| 736 | Ga0395905_0533449 | 3300037471 | Bacteria | 1074 |
| 737 | Ga0395905_0872912 | 3300037471 | Bacteria | 803 |
| 738 | Ga0436364_0114030 | 3300037853 | Bacteria | 659 |
| 739 | Ga0436365_0284014 | 3300039437 | Bacteria | 4178 |
| 740 | Ga0436365_0306410 | 3300039437 | Bacteria | 1586 |
| 741 | Ga0436365_0335369 | 3300039437 | Bacteria | 1612 |
| 742 | Ga0436365_1213574 | 3300039437 | Bacteria | 1819 |
| 743 | Ga0436365_1221399 | 3300039437 | Unclassified | 605 |
| 744 | Ga0436365_1467046 | 3300039437 | Bacteria | 9175 |
| 745 | Ga0436365_1734924 | 3300039437 | Bacteria | 23675 |
| 746 | Ga0436365_1758490 | 3300039437 | Bacteria | 2822 |
| 747 | Ga0439439_0039418 | 3300041406 | Unclassified | 1221 |
| 748 | Ga0451797_1057055 | 3300041453 | Bacteria | 862 |
| 749 | Ga0439449_0310378 | 3300042007 | Unclassified | 596 |
| 750 | Ga0453683_1225930 | 3300044673 | Unclassified | 503 |
| 751 | Ga0466966_0045910 | 3300044684 | Unclassified | 2792 |
| 752 | Ga0466963_0085191 | 3300044694 | Bacteria | 2145 |
| 753 | Ga0466963_0162877 | 3300044694 | Bacteria | 1553 |
| 754 | Ga0466963_0644964 | 3300044694 | Unclassified | 747 |
| 755 | Ga0466963_1143280 | 3300044694 | Bacteria | 547 |
| 756 | Ga0466957_0360763 | 3300044842 | Bacteria | 987 |
| 757 | Ga0466957_0379502 | 3300044842 | Bacteria | 964 |
| 758 | Ga0466957_1022693 | 3300044842 | Bacteria | 594 |
| 759 | Ga0466957_1165816 | 3300044842 | Bacteria | 557 |
| 760 | Ga0451576_0047630 | 3300045051 | Bacteria | 4506 |
| 761 | Ga0451576_0363861 | 3300045051 | Bacteria | 1515 |
| 762 | Ga0466967_0032967 | 3300045976 | Bacteria | 4380 |
| 763 | Ga0466967_0124076 | 3300045976 | Bacteria | 2390 |
| 764 | Ga0466967_0187709 | 3300045976 | Bacteria | 1952 |
| 765 | Ga0466967_0209304 | 3300045976 | Bacteria | 1849 |
| 766 | Ga0466967_0297537 | 3300045976 | Bacteria | 1552 |
| 767 | Ga0466967_0310993 | 3300045976 | Bacteria | 1518 |
| 768 | Ga0495629_0545934 | 3300046459 | Unclassified | 778 |
| 769 | Ga0495651_0004902 | 3300046462 | Bacteria | 10236 |
| 770 | Ga0495651_0010243 | 3300046462 | Bacteria | 7197 |
| 771 | Ga0495651_0171585 | 3300046462 | Bacteria | 1544 |
| 772 | Ga0495651_0500406 | 3300046462 | Bacteria | 778 |
| 773 | Ga0495653_0012480 | 3300046463 | Bacteria | 6937 |
| 774 | Ga0495653_0056264 | 3300046463 | Bacteria | 2999 |
| 775 | Ga0495580_0150627 | 3300046472 | Unclassified | 1612 |
| 776 | Ga0495582_0043911 | 3300046473 | Bacteria | 2461 |
| 777 | Ga0495639_0013357 | 3300046475 | Unclassified | 3545 |
| 778 | Ga0495639_0253615 | 3300046475 | Bacteria | 870 |
| 779 | Ga0495662_0074216 | 3300046476 | Unclassified | 1650 |
| 780 | Ga0495594_0033924 | 3300046499 | Bacteria | 2776 |
| 781 | Ga0495594_0039739 | 3300046499 | Bacteria | 2573 |
| 782 | Ga0495594_0047435 | 3300046499 | Bacteria | 2359 |
| 783 | Ga0495594_0100229 | 3300046499 | Unclassified | 1629 |
| 784 | Ga0495594_0166977 | 3300046499 | Bacteria | 1252 |
| 785 | Ga0495594_0629725 | 3300046499 | Bacteria | 608 |
| 786 | Ga0495594_0735252 | 3300046499 | Bacteria | 557 |
| 787 | Ga0495608_0020747 | 3300046511 | Bacteria | 4514 |
| 788 | Ga0495608_0028866 | 3300046511 | Unclassified | 3769 |
| 789 | Ga0495628_0005987 | 3300046516 | Bacteria | 10639 |
| 790 | Ga0495628_0054405 | 3300046516 | Bacteria | 3156 |
| 791 | Ga0495630_0013715 | 3300046517 | Bacteria | 5893 |
| 792 | Ga0495630_0350414 | 3300046517 | Bacteria | 1130 |
| 793 | Ga0495630_0386704 | 3300046517 | Bacteria | 1072 |
| 794 | Ga0495666_0022927 | 3300046526 | Unclassified | 3090 |
| 795 | Ga0495666_0040900 | 3300046526 | Bacteria | 2247 |
| 796 | Ga0495652_0001660 | 3300046529 | Bacteria | 24160 |
| 797 | Ga0495652_0027548 | 3300046529 | Bacteria | 5005 |
| 798 | Ga0495652_0088730 | 3300046529 | Bacteria | 2534 |
| 799 | Ga0495652_0343734 | 3300046529 | Bacteria | 1071 |
| 800 | Ga0495665_0069509 | 3300046531 | Unclassified | 1856 |
| 801 | Ga0495665_0072233 | 3300046531 | Unclassified | 1817 |
| 802 | Ga0495665_0216913 | 3300046531 | Bacteria | 990 |
| 803 | Ga0495586_0009104 | 3300046535 | Bacteria | 5281 |
| 804 | Ga0495586_0020548 | 3300046535 | Bacteria | 3516 |
| 805 | Ga0495586_0131603 | 3300046535 | Unclassified | 1401 |
| 806 | Ga0495586_0206626 | 3300046535 | Unclassified | 1114 |
| 807 | Ga0495586_0503144 | 3300046535 | Bacteria | 699 |
| 808 | Ga0495587_0008335 | 3300046536 | Bacteria | 6673 |
| 809 | Ga0495587_0013275 | 3300046536 | Bacteria | 5179 |
| 810 | Ga0495587_0025782 | 3300046536 | Bacteria | 3591 |
| 811 | Ga0495587_0030824 | 3300046536 | Bacteria | 3251 |
| 812 | Ga0495645_0000135 | 3300046543 | Bacteria | 50272 |
| 813 | Ga0495645_0000968 | 3300046543 | Bacteria | 19580 |
| 814 | Ga0495645_0010754 | 3300046543 | Bacteria | 6431 |
| 815 | Ga0495645_0212507 | 3300046543 | Bacteria | 1305 |
| 816 | Ga0495667_0002562 | 3300046559 | Bacteria | 12138 |
| 817 | Ga0495667_0009476 | 3300046559 | Bacteria | 6598 |
| 818 | Ga0495667_0015721 | 3300046559 | Bacteria | 5116 |
| 819 | Ga0495667_0103897 | 3300046559 | Bacteria | 1837 |
| 820 | Ga0495634_0367478 | 3300046642 | Bacteria | 859 |
| 821 | Ga0495635_0021269 | 3300046663 | Bacteria | 4522 |
| 822 | Ga0495659_0140650 | 3300046664 | Unclassified | 963 |
| 823 | Ga0495588_0135995 | 3300046674 | Bacteria | 1297 |
| 824 | Ga0495588_0156746 | 3300046674 | Bacteria | 1204 |
| 825 | Ga0495657_0006488 | 3300046675 | Bacteria | 9145 |
| 826 | Ga0495657_0063012 | 3300046675 | Bacteria | 2448 |
| 827 | Ga0495657_0746718 | 3300046675 | Bacteria | 561 |
| 828 | Ga0495599_0000483 | 3300046678 | Bacteria | 22701 |
| 829 | Ga0495599_0045547 | 3300046678 | Bacteria | 2751 |
| 830 | Ga0495599_0288653 | 3300046678 | Bacteria | 992 |
| 831 | Ga0495623_0006091 | 3300046679 | Bacteria | 7847 |
| 832 | Ga0495623_0029365 | 3300046679 | Bacteria | 3538 |
| 833 | Ga0495623_0036034 | 3300046679 | Unclassified | 3170 |
| 834 | Ga0495623_0038465 | 3300046679 | Bacteria | 3059 |
| 835 | Ga0495623_0074989 | 3300046679 | Bacteria | 2101 |
| 836 | Ga0495658_0222030 | 3300046683 | Bacteria | 1183 |
| 837 | Ga0495613_0221577 | 3300046689 | Unclassified | 1328 |
| 838 | Ga0495613_0415382 | 3300046689 | Bacteria | 916 |
| 839 | Ga0495613_0788331 | 3300046689 | Bacteria | 621 |
| 840 | Ga0495600_0015013 | 3300046809 | Bacteria | 4892 |
| 841 | Ga0495604_0021481 | 3300047317 | Bacteria | 5153 |
| 842 | Ga0495604_0111915 | 3300047317 | Bacteria | 1990 |
| 843 | Ga0495636_0290110 | 3300047318 | Bacteria | 764 |
| 844 | Ga0495674_0034841 | 3300047319 | Unclassified | 4548 |
| 845 | Ga0495674_0402287 | 3300047319 | Unclassified | 1105 |
| 846 | Ga0495672_0004266 | 3300047320 | Bacteria | 11804 |
| 847 | Ga0495672_0004304 | 3300047320 | Bacteria | 11732 |
| 848 | Ga0495675_0011709 | 3300047444 | Bacteria | 5508 |
| 849 | Ga0495675_0057652 | 3300047444 | Bacteria | 2463 |
| 850 | Ga0495675_0095200 | 3300047444 | Unclassified | 1867 |
| 851 | Ga0495675_0817687 | 3300047444 | Unclassified | 515 |
| 852 | Ga0495677_0365203 | 3300047445 | Unclassified | 570 |
| 853 | Ga0495684_0027194 | 3300047471 | Bacteria | 4392 |
| 854 | Ga0495684_0083394 | 3300047471 | Bacteria | 2424 |
| 855 | Ga0495684_0106657 | 3300047471 | Bacteria | 2116 |
| 856 | Ga0495684_0129666 | 3300047471 | Bacteria | 1895 |
| 857 | Ga0495684_0145064 | 3300047471 | Bacteria | 1778 |
| 858 | Ga0495602_0002867 | 3300048088 | Bacteria | 17654 |
| 859 | Ga0495602_0094024 | 3300048088 | Bacteria | 2479 |
| 860 | Ga0495602_0238628 | 3300048088 | Bacteria | 1361 |
| 861 | Ga0495602_0263766 | 3300048088 | Bacteria | 1276 |
| 862 | Ga0496104_0053249 | 3300048907 | Bacteria | 3823 |
| 863 | Ga0496107_1210595 | 3300048910 | Unclassified | 543 |
| 864 | Ga0496109_1824925 | 3300048912 | Unclassified | 541 |
| 865 | Ga0496110_0886602 | 3300048913 | Unclassified | 798 |
| 866 | Ga0496112_0033280 | 3300048915 | Bacteria | 5009 |
| 867 | Ga0496112_0187720 | 3300048915 | Bacteria | 2030 |
| 868 | Ga0496115_0242298 | 3300048918 | Unclassified | 1486 |
| 869 | Ga0496115_0673762 | 3300048918 | Bacteria | 815 |
| 870 | Ga0501299_084135 | 3300049522 | Bacteria | 712 |
| 871 | Ga0501032_0350579 | 3300049569 | Bacteria | 951 |
| 872 | Ga0501033_0007466 | 3300049570 | Bacteria | 8512 |
| 873 | Ga0501033_0224158 | 3300049570 | Bacteria | 1337 |
| 874 | Ga0501034_0208110 | 3300049571 | Bacteria | 1912 |
| 875 | Ga0501034_0211231 | 3300049571 | Bacteria | 1896 |
| 876 | Ga0501034_1229768 | 3300049571 | Unclassified | 627 |
| 877 | Ga0501036_0149629 | 3300049572 | Bacteria | 1969 |
| 878 | Ga0501038_0119536 | 3300049574 | Bacteria | 2175 |
| 879 | Ga0501039_0515486 | 3300049575 | Bacteria | 939 |
| 880 | Ga0501040_0120503 | 3300049576 | Bacteria | 1841 |
| 881 | Ga0501043_0125464 | 3300049579 | Bacteria | 2013 |
| 882 | Ga0501043_0686317 | 3300049579 | Bacteria | 749 |
| 883 | Ga0501046_0556546 | 3300049580 | Bacteria | 817 |
| 884 | Ga0501047_0232395 | 3300049581 | Bacteria | 1697 |
| 885 | Ga0501047_0651307 | 3300049581 | Bacteria | 873 |
| 886 | Ga0501070_0218731 | 3300049586 | Bacteria | 1562 |
| 887 | Ga0501070_0809027 | 3300049586 | Unclassified | 735 |
| 888 | Ga0501071_1407673 | 3300049587 | Bacteria | 538 |
| 889 | Ga0501072_0163537 | 3300049588 | Unclassified | 1776 |
| 890 | Ga0501073_0044836 | 3300049589 | Bacteria | 3117 |
| 891 | Ga0501073_0127863 | 3300049589 | Bacteria | 1761 |
| 892 | Ga0501075_0550009 | 3300049591 | Bacteria | 881 |
| 893 | Ga0501077_0070005 | 3300049593 | Bacteria | 2223 |
| 894 | Ga0501077_0248191 | 3300049593 | Bacteria | 1132 |
| 895 | Ga0501223_039199 | 3300049663 | Bacteria | 920 |
| 896 | Ga0501247_038141 | 3300049677 | Bacteria | 679 |
| 897 | Ga0501247_078125 | 3300049677 | Bacteria | 531 |
| 898 | Ga0501253_107377 | 3300049683 | Bacteria | 662 |
| 899 | Ga0501259_089663 | 3300049688 | Bacteria | 689 |
| 900 | Ga0501234_072894 | 3300049707 | Bacteria | 596 |
| 901 | Ga0501079_0548852 | 3300049741 | Bacteria | 909 |
| 902 | Ga0501083_0414735 | 3300049744 | Bacteria | 876 |
| 903 | Ga0501083_0809697 | 3300049744 | Bacteria | 610 |
| 904 | Ga0501268_039602 | 3300049765 | Bacteria | 883 |
| 905 | Ga0501035_0026537 | 3300049822 | Bacteria | 5299 |
| 906 | Ga0501044_0032563 | 3300049823 | Bacteria | 5479 |
| 907 | Ga0501044_0350090 | 3300049823 | Bacteria | 1397 |
| 908 | nmdc:mga03n38_332214_c1 | 3300050490 | Unclassified | 823 |
| 909 | nmdc:mga06z11_243599_c1 | 3300050494 | Bacteria | 1057 |
| 910 | nmdc:mga05p37_1438142_c1 | 3300050507 | Bacteria | 691 |
| 911 | nmdc:mga05p37_28216_c1 | 3300050507 | Bacteria | 6842 |
| 912 | nmdc:mga05p37_58133_c1 | 3300050507 | Bacteria | 4762 |
| 913 | nmdc:mga09592_282056_c1 | 3300050508 | Unclassified | 1441 |
| 914 | nmdc:mga09592_420045_c1 | 3300050508 | Unclassified | 1155 |
| 915 | nmdc:mga09592_71968_c1 | 3300050508 | Unclassified | 2935 |
| 916 | nmdc:mga0qj67_16474_c1 | 3300050509 | Bacteria | 5607 |
| 917 | nmdc:mga0qj67_463110_c1 | 3300050509 | Unclassified | 1021 |
| 918 | nmdc:mga0qj67_977515_c1 | 3300050509 | Unclassified | 665 |
| 919 | nmdc:mga06r32_1035340_c1 | 3300050510 | Bacteria | 772 |
| 920 | nmdc:mga06r32_1892906_c1 | 3300050510 | Bacteria | 531 |
| 921 | nmdc:mga06r32_245537_c1 | 3300050510 | Bacteria | 1778 |
| 922 | nmdc:mga06r32_284669_c1 | 3300050510 | Bacteria | 1640 |
| 923 | nmdc:mga06r32_66351_c1 | 3300050510 | Unclassified | 3482 |
| 924 | nmdc:mga06r32_733556_c1 | 3300050510 | Bacteria | 952 |
| 925 | nmdc:mga06r32_772287_c1 | 3300050510 | Unclassified | 923 |
| 926 | nmdc:mga06r32_77445_c1 | 3300050510 | Bacteria | 3230 |
| 927 | nmdc:mga06r32_81326_c1 | 3300050510 | Unclassified | 3155 |
| 928 | nmdc:mga06r32_976814_c1 | 3300050510 | Bacteria | 800 |
| 929 | nmdc:mga08y16_1091241_c1 | 3300050511 | Unclassified | 774 |
| 930 | nmdc:mga08y16_125746_c1 | 3300050511 | Bacteria | 2667 |
| 931 | nmdc:mga08y16_177417_c1 | 3300050511 | Unclassified | 2212 |
| 932 | nmdc:mga08y16_340403_c1 | 3300050511 | Unclassified | 1542 |
| 933 | nmdc:mga08y16_46297_c1 | 3300050511 | Bacteria | 4554 |
| 934 | nmdc:mga0n895_182554_c1 | 3300050512 | Unclassified | 2130 |
| 935 | nmdc:mga0n895_6412_c1 | 3300050512 | Bacteria | 9985 |
| 936 | nmdc:mga0n895_723796_c1 | 3300050512 | Bacteria | 990 |
| 937 | nmdc:mga0rr50_1698838_c1 | 3300050513 | Unclassified | 532 |
| 938 | nmdc:mga0rr50_460956_c1 | 3300050513 | Bacteria | 1078 |
| 939 | nmdc:mga0a205_1143260_c1 | 3300050515 | Bacteria | 626 |
| 940 | nmdc:mga0a205_16117_c1 | 3300050515 | Bacteria | 6997 |
| 941 | nmdc:mga0a205_56331_c1 | 3300050515 | Bacteria | 3795 |
| 942 | Ga0495601_0099099 | 3300053077 | Bacteria | 1881 |
| 943 | Ga0495601_0217866 | 3300053077 | Bacteria | 1247 |
| 944 | Ga0495612_0009892 | 3300053078 | Bacteria | 3862 |
| 945 | Ga0495612_0120026 | 3300053078 | Bacteria | 1130 |
| 946 | Ga0495595_0032497 | 3300053084 | Bacteria | 2351 |
| 947 | Ga0495595_0142607 | 3300053084 | Unclassified | 1176 |
| 948 | Ga0495595_0147043 | 3300053084 | Bacteria | 1158 |
| 949 | Ga0495619_0202489 | 3300053085 | Unclassified | 1374 |
| 950 | Ga0495619_0803549 | 3300053085 | Unclassified | 636 |
| 951 | Ga0501084_0217478 | 3300054114 | Bacteria | 1612 |
| 952 | Ga0590071_050782 | 3300059421 | Bacteria | 1005 |
| 953 | Ga0501082_0799539 | 3300060353 | Unclassified | 825 |
| 954 | Ga0501082_1383188 | 3300060353 | Bacteria | 615 |
| 955 | Ga0530510_0330025 | 3300061734 | Bacteria | 1144 |
| 956 | Ga0530510_0454148 | 3300061734 | Unclassified | 969 |
| 957 | Ga0070684_100031872 | |||
| 958 | JGI25406J46586_10049714 | |||
| 959 | rootH1_10324040 | |||
| 960 | Ga0065712_10071943 | |||
| 961 | Ga0065712_10353962 | |||
| 962 | Ga0065712_10675278 | |||
| 963 | Ga0070658_10416465 | |||
| 964 | Ga0070658_11070524 | |||
| 965 | Ga0070676_10708376 | |||
| 966 | Ga0070683_100018417 | |||
| 967 | Ga0070683_100019090 | |||
| 968 | Ga0070683_100020750 | |||
| 969 | Ga0070683_100031481 | |||
| 970 | Ga0070683_100059446 | |||
| 971 | Ga0070683_100070682 | |||
| 972 | Ga0070683_100098223 | |||
| 973 | Ga0070683_100114587 | |||
| 974 | Ga0070683_100177316 | |||
| 975 | Ga0070683_102299957 | |||
| 976 | Ga0070683_102385081 | |||
| 977 | Ga0070690_100012432 | |||
| 978 | Ga0070690_100023235 | |||
| 979 | Ga0070690_100088751 | |||
| 980 | Ga0070670_100006749 | |||
| 981 | Ga0070670_100141338 | |||
| 982 | Ga0070670_100897421 | |||
| 983 | Ga0070677_10499716 | |||
| 984 | Ga0068869_100003425 | |||
| 985 | Ga0068869_100100627 | |||
| 986 | Ga0070666_10538142 | |||
| 987 | Ga0070680_100000097 | |||
| 988 | Ga0070680_100001723 | |||
| 989 | Ga0070680_100004718 | |||
| 990 | Ga0070680_100038351 | |||
| 991 | Ga0070680_100370077 | |||
| 992 | Ga0070680_100560826 | |||
| 993 | Ga0070680_100657946 | |||
| 994 | Ga0070680_101906129 | |||
| 995 | Ga0070682_100002777 | |||
| 996 | Ga0070682_101831392 | |||
| 997 | Ga0068868_100105702 | |||
| 998 | Ga0068868_101007467 | |||
| 999 | Ga0070660_100021143 | |||
| 1000 | Ga0070660_100501108 | |||
| 1001 | Ga0070660_100726285 | |||
| 1002 | Ga0070689_100068372 | |||
| 1003 | Ga0070689_100694190 | |||
| 1004 | Ga0070691_10325942 | |||
| 1005 | Ga0070687_100023637 | |||
| 1006 | Ga0070687_100102409 | |||
| 1007 | Ga0070661_100000874 | |||
| 1008 | Ga0070661_100422985 | |||
| 1009 | Ga0070661_100495646 | |||
| 1010 | Ga0070661_100718999 | |||
| 1011 | Ga0070692_10044946 | |||
| 1012 | Ga0070692_10498481 | |||
| 1013 | Ga0070668_100162886 | |||
| 1014 | Ga0070668_100271815 | |||
| 1015 | Ga0070668_100336690 | |||
| 1016 | Ga0070669_100026132 | |||
| 1017 | Ga0070669_101049075 | |||
| 1018 | Ga0070675_100007979 | |||
| 1019 | Ga0070675_100605443 | |||
| 1020 | Ga0070675_100773994 | |||
| 1021 | Ga0070675_100913635 | |||
| 1022 | Ga0070675_101066634 | |||
| 1023 | Ga0070671_100007789 | |||
| 1024 | Ga0070671_100154049 | |||
| 1025 | Ga0070671_100165973 | |||
| 1026 | Ga0070671_101582214 | |||
| 1027 | Ga0070674_100533845 | |||
| 1028 | Ga0070674_101401397 | |||
| 1029 | Ga0070673_100149793 | |||
| 1030 | Ga0070673_100329695 | |||
| 1031 | Ga0070688_100025366 | |||
| 1032 | Ga0070659_100001208 | |||
| 1033 | Ga0070667_100014949 | |||
| 1034 | Ga0070667_101086435 | |||
| 1035 | Ga0070703_10180602 | |||
| 1036 | Ga0070709_10001029 | |||
| 1037 | Ga0070709_10427254 | |||
| 1038 | Ga0070709_11491240 | |||
| 1039 | Ga0070714_100024663 | |||
| 1040 | Ga0070714_100030581 | |||
| 1041 | Ga0070714_101441917 | |||
| 1042 | Ga0070713_100002277 | |||
| 1043 | Ga0070713_100049800 | |||
| 1044 | Ga0070713_101174688 | |||
| 1045 | Ga0070713_101248060 | |||
| 1046 | Ga0070710_10060033 | |||
| 1047 | Ga0070710_10094287 | |||
| 1048 | Ga0070710_11145110 | |||
| 1049 | Ga0070701_10048188 | |||
| 1050 | Ga0070701_10273998 | |||
| 1051 | Ga0070711_100193649 | |||
| 1052 | Ga0070711_100530349 | |||
| 1053 | Ga0070711_100613607 | |||
| 1054 | Ga0070705_100713637 | |||
| 1055 | Ga0070700_101051665 | |||
| 1056 | Ga0070708_100000073 | |||
| 1057 | Ga0070708_100309178 | |||
| 1058 | Ga0070708_101401209 | |||
| 1059 | Ga0070663_100426384 | |||
| 1060 | Ga0070663_100822980 | |||
| 1061 | Ga0070662_100027218 | |||
| 1062 | Ga0070681_10000719 | |||
| 1063 | Ga0070681_10012671 | |||
| 1064 | Ga0070681_10056842 | |||
| 1065 | Ga0070681_10879158 | |||
| 1066 | Ga0070681_11067049 | |||
| 1067 | Ga0068867_100349234 | |||
| 1068 | Ga0068867_100375016 | |||
| 1069 | Ga0068867_100535226 | |||
| 1070 | Ga0068867_100959894 | |||
| 1071 | Ga0070685_10464449 | |||
| 1072 | Ga0070706_100583244 | |||
| 1073 | Ga0070706_100798331 | |||
| 1074 | Ga0070707_100003187 | |||
| 1075 | Ga0070707_100248218 | |||
| 1076 | Ga0070707_100892534 | |||
| 1077 | Ga0070698_100025250 | |||
| 1078 | Ga0070698_100066554 | |||
| 1079 | Ga0070698_100148368 | |||
| 1080 | Ga0070698_100155537 | |||
| 1081 | Ga0070698_100366279 | |||
| 1082 | Ga0070698_100872296 | |||
| 1083 | Ga0070698_100887420 | |||
| 1084 | Ga0070698_101109572 | |||
| 1085 | Ga0070699_100208350 | |||
| 1086 | Ga0070699_100243180 | |||
| 1087 | Ga0070699_100417872 | |||
| 1088 | Ga0070699_101744821 | |||
| 1089 | Ga0070679_100000324 | |||
| 1090 | Ga0070679_100003088 | |||
| 1091 | Ga0070679_100031101 | |||
| 1092 | Ga0070679_100033292 | |||
| 1093 | Ga0070679_100749841 | |||
| 1094 | Ga0070679_100995704 | |||
| 1095 | Ga0070679_101428929 | |||
| 1096 | Ga0070679_101718559 | |||
| 1097 | Ga0070684_100008695 | |||
| 1098 | Ga0070684_100009879 | |||
| 1099 | Ga0070684_100019647 | |||
| 1100 | Ga0070684_100020262 | |||
| 1101 | Ga0070684_100037730 | |||
| 1102 | Ga0070684_100052208 | |||
| 1103 | Ga0070684_100087850 | |||
| 1104 | Ga0070684_100121929 | |||
| 1105 | Ga0070684_100154345 | |||
| 1106 | Ga0070684_100221074 | |||
| 1107 | Ga0070697_101137770 | |||
| 1108 | Ga0070697_101380040 | |||
| 1109 | Ga0068853_100129827 | |||
| 1110 | Ga0068853_100458388 | |||
| 1111 | Ga0068853_101291806 | |||
| 1112 | Ga0070672_100103985 | |||
| 1113 | Ga0070672_101099765 | |||
| 1114 | Ga0070672_101331168 | |||
| 1115 | Ga0070686_101297342 | |||
| 1116 | Ga0070695_100512723 | |||
| 1117 | Ga0070696_100034134 | |||
| 1118 | Ga0070696_101081063 | |||
| 1119 | Ga0070693_100001328 | |||
| 1120 | Ga0070693_100002384 | |||
| 1121 | Ga0070693_100232490 | |||
| 1122 | Ga0070693_100658607 | |||
| 1123 | Ga0070665_100187490 | |||
| 1124 | Ga0070665_100589931 | |||
| 1125 | Ga0070704_101480747 | |||
| 1126 | Ga0068855_100244380 | |||
| 1127 | Ga0068855_100867358 | |||
| 1128 | Ga0070664_100012975 | |||
| 1129 | Ga0070664_100554352 | |||
| 1130 | Ga0070664_100711986 | |||
| 1131 | Ga0070664_101084057 | |||
| 1132 | Ga0070664_101577425 | |||
| 1133 | Ga0068857_100007684 | |||
| 1134 | Ga0068857_100056503 | |||
| 1135 | Ga0068857_100339363 | |||
| 1136 | Ga0068857_100339664 | |||
| 1137 | Ga0068857_100585897 | |||
| 1138 | Ga0068857_101411462 | |||
| 1139 | Ga0068854_100027930 | |||
| 1140 | Ga0068854_100205544 | |||
| 1141 | Ga0068856_100006312 | |||
| 1142 | Ga0068856_100012657 | |||
| 1143 | Ga0068856_100065719 | |||
| 1144 | Ga0068856_100102402 | |||
| 1145 | Ga0068856_100242472 | |||
| 1146 | Ga0070702_100004109 | |||
| 1147 | Ga0068852_100003985 | |||
| 1148 | Ga0068852_100101234 | |||
| 1149 | Ga0068852_101824343 | |||
| 1150 | Ga0068859_100031530 | |||
| 1151 | Ga0068859_100054066 | |||
| 1152 | Ga0068859_100510121 | |||
| 1153 | Ga0068859_100562515 | |||
| 1154 | Ga0068859_100723186 | |||
| 1155 | Ga0068864_100024727 | |||
| 1156 | Ga0068864_100205354 | |||
| 1157 | Ga0068864_100905945 | |||
| 1158 | Ga0068866_10458768 | |||
| 1159 | Ga0068861_100317359 | |||
| 1160 | Ga0068861_100453297 | |||
| 1161 | Ga0068861_101195628 | |||
| 1162 | Ga0068861_101287762 | |||
| 1163 | Ga0068870_10021362 | |||
| 1164 | Ga0068870_10067816 | |||
| 1165 | Ga0068870_10520040 | |||
| 1166 | Ga0068863_100006853 | |||
| 1167 | Ga0068863_100117994 | |||
| 1168 | Ga0068863_100276010 | |||
| 1169 | Ga0068863_101828901 | |||
| 1170 | Ga0068858_100106428 | |||
| 1171 | Ga0068858_100657397 | |||
| 1172 | Ga0068860_100061141 | |||
| 1173 | Ga0068860_100859733 | |||
| 1174 | Ga0068860_101166786 | |||
| 1175 | Ga0068862_100028830 | |||
| 1176 | Ga0068862_100092395 | |||
| 1177 | Ga0068862_100904684 | |||
| 1178 | Ga0081455_10004725 | |||
| 1179 | Ga0081455_10120825 | |||
| 1180 | Ga0081455_10593650 | |||
| 1181 | Ga0081538_10271871 | |||
| 1182 | Ga0081539_10000107 | |||
| 1183 | Ga0075368_10018959 | |||
| 1184 | Ga0075368_10372684 | |||
| 1185 | Ga0075363_100779089 | |||
| 1186 | Ga0075364_10026322 | |||
| 1187 | Ga0075432_10425780 | |||
| 1188 | Ga0070715_10790507 | |||
| 1189 | Ga0070716_100074830 | |||
| 1190 | Ga0070716_100377546 | |||
| 1191 | Ga0070712_100002494 | |||
| 1192 | Ga0070712_100534025 | |||
| 1193 | Ga0070712_100688012 | |||
| 1194 | Ga0070712_100776970 | |||
| 1195 | Ga0075362_10088586 | |||
| 1196 | Ga0075367_10038095 | |||
| 1197 | Ga0075367_10411566 | |||
| 1198 | Ga0075427_10039799 | |||
| 1199 | Ga0075366_10011850 | |||
| 1200 | Ga0097621_100162595 | |||
| 1201 | Ga0068871_100025960 | |||
| 1202 | Ga0068871_100285413 | |||
| 1203 | Ga0075428_100020760 | |||
| 1204 | Ga0075428_100177866 | |||
| 1205 | Ga0075428_100323663 | |||
| 1206 | Ga0075428_100611008 | |||
| 1207 | Ga0075428_102079146 | |||
| 1208 | Ga0075430_100118559 | |||
| 1209 | Ga0075430_100202171 | |||
| 1210 | Ga0075430_100327327 | |||
| 1211 | Ga0075430_100538014 | |||
| 1212 | Ga0075430_100769273 | |||
| 1213 | Ga0075430_100842752 | |||
| 1214 | Ga0075430_101686943 | |||
| 1215 | Ga0075431_100053258 | |||
| 1216 | Ga0075431_100226728 | |||
| 1217 | Ga0075431_100230602 | |||
| 1218 | Ga0075431_100267999 | |||
| 1219 | Ga0075431_100396378 | |||
| 1220 | Ga0075431_100682016 | |||
| 1221 | Ga0075431_100982854 | |||
| 1222 | Ga0075431_101093791 | |||
| 1223 | Ga0075431_101358088 | |||
| 1224 | Ga0075431_102039689 | |||
| 1225 | Ga0075434_100620024 | |||
| 1226 | Ga0075429_100025053 | |||
| 1227 | Ga0075429_100220016 | |||
| 1228 | Ga0075429_100509393 | |||
| 1229 | Ga0075429_100680249 | |||
| 1230 | Ga0075429_100900490 | |||
| 1231 | Ga0075429_101363457 | |||
| 1232 | Ga0068865_100305534 | |||
| 1233 | Ga0097620_100031530 | |||
| 1234 | Ga0097620_100054062 | |||
| 1235 | Ga0097620_100510126 | |||
| 1236 | Ga0097620_100562502 | |||
| 1237 | Ga0097620_100587344 | |||
| 1238 | Ga0097620_100723152 | |||
| 1239 | Ga0075435_100567702 | |||
| 1240 | Ga0105250_10478615 | |||
| 1241 | Ga0105240_10061480 | |||
| 1242 | Ga0105240_10289675 | |||
| 1243 | Ga0105240_11177790 | |||
| 1244 | Ga0105240_11215814 | |||
| 1245 | Ga0105240_11343744 | |||
| 1246 | Ga0111539_10073471 | |||
| 1247 | Ga0111539_10535316 | |||
| 1248 | Ga0111539_10844173 | |||
| 1249 | Ga0105245_10001632 | |||
| 1250 | Ga0105245_10100561 | |||
| 1251 | Ga0105245_10152827 | |||
| 1252 | Ga0105245_10416389 | |||
| 1253 | Ga0105245_12264014 | |||
| 1254 | Ga0105247_11112220 | |||
| 1255 | Ga0114129_10496292 | |||
| 1256 | Ga0114129_10567250 | |||
| 1257 | Ga0114129_10774529 | |||
| 1258 | Ga0114129_12743264 | |||
| 1259 | Ga0105243_10236791 | |||
| 1260 | Ga0105243_11343211 | |||
| 1261 | Ga0105243_12308718 | |||
| 1262 | Ga0105241_10005052 | |||
| 1263 | Ga0105241_10015542 | |||
| 1264 | Ga0105241_10112196 | |||
| 1265 | Ga0105241_11486034 | |||
| 1266 | Ga0105241_12153388 | |||
| 1267 | Ga0105242_10373338 | |||
| 1268 | Ga0105248_10004151 | |||
| 1269 | Ga0105248_10032866 | |||
| 1270 | Ga0105248_10275598 | |||
| 1271 | Ga0105248_11088984 | |||
| 1272 | Ga0105237_10234653 | |||
| 1273 | Ga0105238_10043384 | |||
| 1274 | Ga0105238_10051012 | |||
| 1275 | Ga0105238_10091528 | |||
| 1276 | Ga0105238_10094171 | |||
| 1277 | Ga0105238_10707627 | |||
| 1278 | Ga0105249_10052953 | |||
| 1279 | Ga0105249_10528721 | |||
| 1280 | Ga0105249_10958874 | |||
| 1281 | Ga0105249_12631652 | |||
| 1282 | Ga0105239_10024044 | |||
| 1283 | Ga0105239_10737060 | |||
| 1284 | Ga0105246_10029204 | |||
| 1285 | Ga0105246_10110529 | |||
| 1286 | Ga0157373_10081340 | |||
| 1287 | Ga0157373_10133031 | |||
| 1288 | Ga0157371_10013862 | |||
| 1289 | Ga0157370_10001778 | |||
| 1290 | Ga0157370_10011127 | |||
| 1291 | Ga0157370_10020822 | |||
| 1292 | Ga0157370_10039916 | |||
| 1293 | Ga0157370_10062810 | |||
| 1294 | Ga0157370_10138219 | |||
| 1295 | Ga0157370_10428000 | |||
| 1296 | Ga0157369_10048959 | |||
| 1297 | Ga0157369_10115557 | |||
| 1298 | Ga0157369_10339211 | |||
| 1299 | Ga0157369_10451928 | |||
| 1300 | Ga0157369_10681941 | |||
| 1301 | Ga0157369_10830411 | |||
| 1302 | Ga0157369_11523212 | |||
| 1303 | Ga0157374_10004077 | |||
| 1304 | Ga0157374_10042795 | |||
| 1305 | Ga0157374_11680131 | |||
| 1306 | Ga0157374_12733592 | |||
| 1307 | Ga0163162_10443457 | |||
| 1308 | Ga0163162_13416007 | |||
| 1309 | Ga0157372_10005007 | |||
| 1310 | Ga0157372_10038332 | |||
| 1311 | Ga0157372_10041086 | |||
| 1312 | Ga0157372_10073408 | |||
| 1313 | Ga0157372_10085721 | |||
| 1314 | Ga0157372_10102836 | |||
| 1315 | Ga0157372_10176564 | |||
| 1316 | Ga0157372_10310025 | |||
| 1317 | Ga0157372_10411612 | |||
| 1318 | Ga0157372_10456862 | |||
| 1319 | Ga0157372_10477709 | |||
| 1320 | Ga0157372_11466329 | |||
| 1321 | Ga0157372_12083461 | |||
| 1322 | Ga0157372_12652118 | |||
| 1323 | Ga0157375_10008426 | |||
| 1324 | Ga0157375_10066285 | |||
| 1325 | Ga0157375_10142251 | |||
| 1326 | Ga0157375_10311973 | |||
| 1327 | Ga0157375_10442056 | |||
| 1328 | Ga0157375_11931839 | |||
| 1329 | Ga0157375_13093956 | |||
| 1330 | Ga0163163_10008889 | |||
| 1331 | Ga0163163_10171235 | |||
| 1332 | Ga0157380_10037158 | |||
| 1333 | Ga0157380_10255716 | |||
| 1334 | Ga0157380_10358517 | |||
| 1335 | Ga0157380_10911170 | |||
| 1336 | Ga0157380_11967827 | |||
| 1337 | Ga0157380_12688504 | |||
| 1338 | Ga0157377_10003078 | |||
| 1339 | Ga0157377_10460729 | |||
| 1340 | Ga0157379_10406837 | |||
| 1341 | Ga0157379_10611869 | |||
| 1342 | Ga0157379_10771802 | |||
| 1343 | Ga0157376_10197259 | |||
| 1344 | Ga0182007_10176977 | |||
| 1345 | Ga0182007_10200790 | |||
| 1346 | Ga0182007_10203650 | |||
| 1347 | Ga0163161_10834187 | |||
| 1348 | Ga0213876_10002367 | |||
| 1349 | Ga0213876_10105025 | |||
| 1350 | Ga0213876_10172046 | |||
| 1351 | Ga0213876_10263687 | |||
| 1352 | Ga0213876_10449776 | |||
| 1353 | Ga0207697_10003546 | |||
| 1354 | Ga0207697_10412706 | |||
| 1355 | Ga0207656_10462879 | |||
| 1356 | Ga0207653_10023614 | |||
| 1357 | Ga0207692_10050796 | |||
| 1358 | Ga0207692_10546334 | |||
| 1359 | Ga0207692_10787451 | |||
| 1360 | Ga0207642_10172813 | |||
| 1361 | Ga0207688_10682678 | |||
| 1362 | Ga0207680_10474296 | |||
| 1363 | Ga0207680_11306591 | |||
| 1364 | Ga0207647_10073309 | |||
| 1365 | Ga0207647_10283839 | |||
| 1366 | Ga0207699_10019530 | |||
| 1367 | Ga0207699_10038219 | |||
| 1368 | Ga0207699_10144874 | |||
| 1369 | Ga0207699_10299341 | |||
| 1370 | Ga0207645_10008299 | |||
| 1371 | Ga0207643_10020488 | |||
| 1372 | Ga0207643_10027275 | |||
| 1373 | Ga0207654_10055572 | |||
| 1374 | Ga0207654_10159814 | |||
| 1375 | Ga0207654_10235603 | |||
| 1376 | Ga0207654_11118167 | |||
| 1377 | Ga0207707_10015646 | |||
| 1378 | Ga0207707_10021534 | |||
| 1379 | Ga0207707_10336784 | |||
| 1380 | Ga0207695_10009415 | |||
| 1381 | Ga0207695_10029463 | |||
| 1382 | Ga0207695_10072580 | |||
| 1383 | Ga0207695_10082363 | |||
| 1384 | Ga0207695_11268244 | |||
| 1385 | Ga0207671_11036950 | |||
| 1386 | Ga0207693_10004728 | |||
| 1387 | Ga0207693_10226292 | |||
| 1388 | Ga0207693_10841670 | |||
| 1389 | Ga0207663_10031396 | |||
| 1390 | Ga0207663_10377039 | |||
| 1391 | Ga0207660_10000125 | |||
| 1392 | Ga0207660_10006752 | |||
| 1393 | Ga0207660_10008506 | |||
| 1394 | Ga0207660_10021795 | |||
| 1395 | Ga0207660_10034479 | |||
| 1396 | Ga0207660_10935989 | |||
| 1397 | Ga0207660_10955134 | |||
| 1398 | Ga0207660_11606638 | |||
| 1399 | Ga0207662_10002734 | |||
| 1400 | Ga0207662_10425584 | |||
| 1401 | Ga0207657_10041916 | |||
| 1402 | Ga0207657_10068870 | |||
| 1403 | Ga0207657_10550599 | |||
| 1404 | Ga0207657_10731045 | |||
| 1405 | Ga0207649_10002072 | |||
| 1406 | Ga0207649_10152389 | |||
| 1407 | Ga0207649_10597298 | |||
| 1408 | Ga0207649_10985539 | |||
| 1409 | Ga0207649_11236432 | |||
| 1410 | Ga0207652_10002437 | |||
| 1411 | Ga0207652_10004272 | |||
| 1412 | Ga0207652_10015782 | |||
| 1413 | Ga0207652_10022380 | |||
| 1414 | Ga0207652_10041904 | |||
| 1415 | Ga0207652_10178376 | |||
| 1416 | Ga0207652_10248355 | |||
| 1417 | Ga0207652_10462802 | |||
| 1418 | Ga0207652_11084688 | |||
| 1419 | Ga0207646_10175902 | |||
| 1420 | Ga0207646_10759714 | |||
| 1421 | Ga0207646_10872335 | |||
| 1422 | Ga0207681_10109325 | |||
| 1423 | Ga0207681_10512401 | |||
| 1424 | Ga0207694_10045387 | |||
| 1425 | Ga0207694_10119900 | |||
| 1426 | Ga0207694_10712543 | |||
| 1427 | Ga0207650_10066983 | |||
| 1428 | Ga0207650_10136695 | |||
| 1429 | Ga0207650_10616067 | |||
| 1430 | Ga0207650_10714237 | |||
| 1431 | Ga0207650_10895813 | |||
| 1432 | Ga0207650_10966159 | |||
| 1433 | Ga0207650_10996385 | |||
| 1434 | Ga0207659_10035565 | |||
| 1435 | Ga0207659_10175648 | |||
| 1436 | Ga0207659_10258705 | |||
| 1437 | Ga0207659_10329219 | |||
| 1438 | Ga0207659_10689681 | |||
| 1439 | Ga0207659_10853246 | |||
| 1440 | Ga0207687_10015005 | |||
| 1441 | Ga0207687_10199478 | |||
| 1442 | Ga0207687_10380276 | |||
| 1443 | Ga0207687_10683173 | |||
| 1444 | Ga0207687_11874040 | |||
| 1445 | Ga0207700_10000677 | |||
| 1446 | Ga0207700_11613492 | |||
| 1447 | Ga0207664_10092197 | |||
| 1448 | Ga0207664_10160623 | |||
| 1449 | Ga0207644_10005945 | |||
| 1450 | Ga0207644_10285996 | |||
| 1451 | Ga0207644_11807282 | |||
| 1452 | Ga0207690_10022978 | |||
| 1453 | Ga0207690_10079734 | |||
| 1454 | Ga0207690_10308053 | |||
| 1455 | Ga0207706_10001438 | |||
| 1456 | Ga0207706_10001946 | |||
| 1457 | Ga0207706_10078194 | |||
| 1458 | Ga0207686_10025717 | |||
| 1459 | Ga0207686_10109855 | |||
| 1460 | Ga0207686_10162093 | |||
| 1461 | Ga0207686_10362396 | |||
| 1462 | Ga0207709_10228169 | |||
| 1463 | Ga0207670_10147939 | |||
| 1464 | Ga0207670_10210326 | |||
| 1465 | Ga0207670_10941849 | |||
| 1466 | Ga0207670_11578068 | |||
| 1467 | Ga0207669_10354369 | |||
| 1468 | Ga0207669_11057138 | |||
| 1469 | Ga0207669_11110635 | |||
| 1470 | Ga0207704_10089889 | |||
| 1471 | Ga0207665_10042233 | |||
| 1472 | Ga0207665_10171612 | |||
| 1473 | Ga0207665_10497011 | |||
| 1474 | Ga0207691_10002778 | |||
| 1475 | Ga0207691_10095357 | |||
| 1476 | Ga0207691_10417487 | |||
| 1477 | Ga0207691_11404737 | |||
| 1478 | Ga0207711_10015343 | |||
| 1479 | Ga0207711_10469551 | |||
| 1480 | Ga0207689_10012567 | |||
| 1481 | Ga0207689_10013117 | |||
| 1482 | Ga0207689_10019669 | |||
| 1483 | Ga0207689_10645289 | |||
| 1484 | Ga0207661_10001069 | |||
| 1485 | Ga0207661_10004658 | |||
| 1486 | Ga0207661_10007254 | |||
| 1487 | Ga0207661_10010780 | |||
| 1488 | Ga0207661_10026981 | |||
| 1489 | Ga0207661_10028616 | |||
| 1490 | Ga0207661_10101216 | |||
| 1491 | Ga0207661_10155307 | |||
| 1492 | Ga0207661_10155686 | |||
| 1493 | Ga0207661_10386441 | |||
| 1494 | Ga0207661_10434734 | |||
| 1495 | Ga0207661_10611064 | |||
| 1496 | Ga0207661_10633455 | |||
| 1497 | Ga0207661_10742534 | |||
| 1498 | Ga0207661_10895460 | |||
| 1499 | Ga0207679_10024364 | |||
| 1500 | Ga0207679_10098470 | |||
| 1501 | Ga0207679_10305353 | |||
| 1502 | Ga0207679_10658117 | |||
| 1503 | Ga0207679_10672010 | |||
| 1504 | Ga0207679_10699290 | |||
| 1505 | Ga0207679_11619154 | |||
| 1506 | Ga0207679_11874745 | |||
| 1507 | Ga0207667_10253880 | |||
| 1508 | Ga0207667_10318590 | |||
| 1509 | Ga0207667_10338306 | |||
| 1510 | Ga0207651_10307759 | |||
| 1511 | Ga0207651_10356518 | |||
| 1512 | Ga0207651_11466347 | |||
| 1513 | Ga0207651_11916245 | |||
| 1514 | Ga0207712_10013492 | |||
| 1515 | Ga0207712_10269362 | |||
| 1516 | Ga0207712_11633266 | |||
| 1517 | Ga0207668_10065543 | |||
| 1518 | Ga0207668_10175927 | |||
| 1519 | Ga0207668_10375211 | |||
| 1520 | Ga0207668_10412845 | |||
| 1521 | Ga0207668_11370852 | |||
| 1522 | Ga0207640_10037807 | |||
| 1523 | Ga0207640_10323324 | |||
| 1524 | Ga0207640_12130164 | |||
| 1525 | Ga0207658_10119403 | |||
| 1526 | Ga0207658_10145665 | |||
| 1527 | Ga0207658_10165610 | |||
| 1528 | Ga0207658_11361505 | |||
| 1529 | Ga0207677_10064425 | |||
| 1530 | Ga0207677_10065972 | |||
| 1531 | Ga0207703_10056394 | |||
| 1532 | Ga0207703_10504854 | |||
| 1533 | Ga0207639_10797993 | |||
| 1534 | Ga0207639_11907401 | |||
| 1535 | Ga0207678_10028798 | |||
| 1536 | Ga0207678_10770968 | |||
| 1537 | Ga0207678_11329888 | |||
| 1538 | Ga0207708_10098309 | |||
| 1539 | Ga0207708_10118272 | |||
| 1540 | Ga0207708_10937526 | |||
| 1541 | Ga0207702_10021029 | |||
| 1542 | Ga0207702_10049102 | |||
| 1543 | Ga0207702_10122516 | |||
| 1544 | Ga0207702_10268145 | |||
| 1545 | Ga0207702_10386363 | |||
| 1546 | Ga0207702_11057419 | |||
| 1547 | Ga0207702_11161478 | |||
| 1548 | Ga0207702_11229024 | |||
| 1549 | Ga0207641_10006735 | |||
| 1550 | Ga0207641_10304785 | |||
| 1551 | Ga0207641_10676552 | |||
| 1552 | Ga0207641_11183550 | |||
| 1553 | Ga0207641_11905791 | |||
| 1554 | Ga0207648_10067873 | |||
| 1555 | Ga0207648_10278989 | |||
| 1556 | Ga0207648_10330095 | |||
| 1557 | Ga0207648_10561578 | |||
| 1558 | Ga0207648_10589394 | |||
| 1559 | Ga0207676_10003700 | |||
| 1560 | Ga0207676_10068045 | |||
| 1561 | Ga0207676_11247915 | |||
| 1562 | Ga0207676_11399384 | |||
| 1563 | Ga0207674_10000013 | |||
| 1564 | Ga0207674_10011483 | |||
| 1565 | Ga0207674_10089072 | |||
| 1566 | Ga0207674_10431586 | |||
| 1567 | Ga0207674_10510380 | |||
| 1568 | Ga0207674_10655031 | |||
| 1569 | Ga0207674_11091001 | |||
| 1570 | Ga0207674_11331888 | |||
| 1571 | Ga0207675_100000197 | |||
| 1572 | Ga0207675_100373052 | |||
| 1573 | Ga0207675_100793253 | |||
| 1574 | Ga0207675_102017396 | |||
| 1575 | Ga0207683_10272354 | |||
| 1576 | Ga0207698_10002825 | |||
| 1577 | Ga0207698_10020146 | |||
| 1578 | Ga0207698_10028729 | |||
| 1579 | Ga0207698_10082339 | |||
| 1580 | Ga0207698_10426926 | |||
| 1581 | Ga0209995_1025033 | |||
| 1582 | Ga0207428_10032517 | |||
| 1583 | Ga0207428_10563647 | |||
| 1584 | Ga0207428_10637499 | |||
| 1585 | Ga0268266_10935734 | |||
| 1586 | Ga0268265_10044736 | |||
| 1587 | Ga0268265_10127006 | |||
| 1588 | Ga0268265_10156081 | |||
| 1589 | Ga0268265_10246921 | |||
| 1590 | Ga0268264_10033854 | |||
| 1591 | Ga0268264_10825923 | |||
| 1592 | Ga0265332_10061825 | |||
| 1593 | Ga0265327_10056319 | |||
| 1594 | Ga0307408_100020829 | |||
| 1595 | Ga0307408_100176679 | |||
| 1596 | Ga0307408_100240210 | |||
| 1597 | Ga0307408_100319807 | |||
| 1598 | Ga0307408_100447095 | |||
| 1599 | Ga0307408_100739135 | |||
| 1600 | Ga0307408_100875138 | |||
| 1601 | Ga0265314_10033130 | |||
| 1602 | Ga0307405_10002340 | |||
| 1603 | Ga0307405_10121822 | |||
| 1604 | Ga0307405_10202340 | |||
| 1605 | Ga0307405_10376813 | |||
| 1606 | Ga0307413_10122775 | |||
| 1607 | Ga0307413_10148424 | |||
| 1608 | Ga0307413_10327175 | |||
| 1609 | Ga0307413_10403828 | |||
| 1610 | Ga0307413_10408827 | |||
| 1611 | Ga0307413_11592791 | |||
| 1612 | Ga0307410_10000113 | |||
| 1613 | Ga0307410_10598599 | |||
| 1614 | Ga0307410_11112383 | |||
| 1615 | Ga0307410_11479951 | |||
| 1616 | Ga0307406_10001742 | |||
| 1617 | Ga0307406_10019235 | |||
| 1618 | Ga0307406_10024566 | |||
| 1619 | Ga0307406_10472345 | |||
| 1620 | Ga0307406_11438652 | |||
| 1621 | Ga0307406_11885800 | |||
| 1622 | Ga0307407_10002675 | |||
| 1623 | Ga0307407_10003744 | |||
| 1624 | Ga0307407_10156346 | |||
| 1625 | Ga0307407_11181047 | |||
| 1626 | Ga0307412_10065380 | |||
| 1627 | Ga0307412_10096468 | |||
| 1628 | Ga0307412_10202943 | |||
| 1629 | Ga0307412_10334915 | |||
| 1630 | Ga0307412_10628487 | |||
| 1631 | Ga0307409_100044182 | |||
| 1632 | Ga0307409_100084586 | |||
| 1633 | Ga0307409_100088407 | |||
| 1634 | Ga0307409_100120034 | |||
| 1635 | Ga0307409_100124105 | |||
| 1636 | Ga0307409_100445518 | |||
| 1637 | Ga0307409_101466908 | |||
| 1638 | Ga0307409_101694565 | |||
| 1639 | Ga0307409_101743100 | |||
| 1640 | Ga0307416_100035530 | |||
| 1641 | Ga0307416_100047843 | |||
| 1642 | Ga0307416_100221494 | |||
| 1643 | Ga0307416_100275416 | |||
| 1644 | Ga0307414_10063483 | |||
| 1645 | Ga0307414_11129550 | |||
| 1646 | Ga0307414_12010564 | |||
| 1647 | Ga0307411_10003115 | |||
| 1648 | Ga0307411_10139848 | |||
| 1649 | Ga0307411_10346635 | |||
| 1650 | Ga0307411_10542120 | |||
| 1651 | Ga0307411_10858675 | |||
| 1652 | Ga0307411_11153115 | |||
| 1653 | Ga0307411_11481657 | |||
| 1654 | Ga0307415_100002414 | |||
| 1655 | Ga0307415_100003797 | |||
| 1656 | Ga0307415_100159889 | |||
| 1657 | Ga0307415_101621936 | |||
| 1658 | Ga0307415_101666298 | |||
| 1659 | Ga0307415_102073366 | |||
| 1660 | Ga0373934_0000881 | |||
| 1661 | Ga0373934_0004308 | |||
| 1662 | Ga0373934_0059403 | |||
| 1663 | Ga0373923_0042004 | |||
| 1664 | Ga0373945_0027103 | |||
| 1665 | Ga0373953_0119380 | |||
| 1666 | Ga0373953_0202587 | |||
| 1667 | Ga0373954_0046112 | |||
| 1668 | Ga0373954_0349814 | |||
| 1669 | Ga0373956_0015144 | |||
| 1670 | Ga0373956_0129674 | |||
| 1671 | Ga0373956_0378157 | |||
| 1672 | Ga0373943_0205184 | |||
| 1673 | Ga0373946_0319199 | |||
| 1674 | Ga0373955_0239198 | |||
| 1675 | Ga0373955_0264714 | |||
| 1676 | Ga0373924_0108933 | |||
| 1677 | Ga0373924_0583313 | |||
| 1678 | Ga0373931_0021274 | |||
| 1679 | Ga0373931_0610711 | |||
| 1680 | Ga0373935_0988214 | |||
| 1681 | Ga0373933_0017865 | |||
| 1682 | Ga0373933_0164186 | |||
| 1683 | Ga0373933_0524484 | |||
| 1684 | Ga0373947_0015708 | |||
| 1685 | Ga0373947_0269944 | |||
| 1686 | Ga0373937_0002454 | |||
| 1687 | Ga0373937_0004785 | |||
| 1688 | Ga0373937_0041478 | |||
| 1689 | Ga0373937_0153941 | |||
| 1690 | Ga0373937_0848927 | |||
| 1691 | Ga0373925_0348004 | |||
| 1692 | Ga0395905_0533449 | |||
| 1693 | Ga0395905_0872912 | |||
| 1694 | Ga0436364_0114030 | |||
| 1695 | Ga0436365_0284014 | |||
| 1696 | Ga0436365_0306410 | |||
| 1697 | Ga0436365_0335369 | |||
| 1698 | Ga0436365_1213574 | |||
| 1699 | Ga0436365_1221399 | |||
| 1700 | Ga0436365_1467046 | |||
| 1701 | Ga0436365_1734924 | |||
| 1702 | Ga0436365_1758490 | |||
| 1703 | Ga0439439_0039418 | |||
| 1704 | Ga0451797_1057055 | |||
| 1705 | Ga0439449_0310378 | |||
| 1706 | Ga0453683_1225930 | |||
| 1707 | Ga0466966_0045910 | |||
| 1708 | Ga0466963_0085191 | |||
| 1709 | Ga0466963_0162877 | |||
| 1710 | Ga0466963_0644964 | |||
| 1711 | Ga0466963_1143280 | |||
| 1712 | Ga0466957_0360763 | |||
| 1713 | Ga0466957_0379502 | |||
| 1714 | Ga0466957_1022693 | |||
| 1715 | Ga0466957_1165816 | |||
| 1716 | Ga0451576_0047630 | |||
| 1717 | Ga0451576_0363861 | |||
| 1718 | Ga0466967_0032967 | |||
| 1719 | Ga0466967_0124076 | |||
| 1720 | Ga0466967_0187709 | |||
| 1721 | Ga0466967_0209304 | |||
| 1722 | Ga0466967_0297537 | |||
| 1723 | Ga0466967_0310993 | |||
| 1724 | Ga0495629_0545934 | |||
| 1725 | Ga0495651_0004902 | |||
| 1726 | Ga0495651_0010243 | |||
| 1727 | Ga0495651_0171585 | |||
| 1728 | Ga0495651_0500406 | |||
| 1729 | Ga0495653_0012480 | |||
| 1730 | Ga0495653_0056264 | |||
| 1731 | Ga0495580_0150627 | |||
| 1732 | Ga0495582_0043911 | |||
| 1733 | Ga0495639_0013357 | |||
| 1734 | Ga0495639_0253615 | |||
| 1735 | Ga0495662_0074216 | |||
| 1736 | Ga0495594_0033924 | |||
| 1737 | Ga0495594_0039739 | |||
| 1738 | Ga0495594_0047435 | |||
| 1739 | Ga0495594_0100229 | |||
| 1740 | Ga0495594_0166977 | |||
| 1741 | Ga0495594_0629725 | |||
| 1742 | Ga0495594_0735252 | |||
| 1743 | Ga0495608_0020747 | |||
| 1744 | Ga0495608_0028866 | |||
| 1745 | Ga0495628_0005987 | |||
| 1746 | Ga0495628_0054405 | |||
| 1747 | Ga0495630_0013715 | |||
| 1748 | Ga0495630_0350414 | |||
| 1749 | Ga0495630_0386704 | |||
| 1750 | Ga0495666_0022927 | |||
| 1751 | Ga0495666_0040900 | |||
| 1752 | Ga0495652_0001660 | |||
| 1753 | Ga0495652_0027548 | |||
| 1754 | Ga0495652_0088730 | |||
| 1755 | Ga0495652_0343734 | |||
| 1756 | Ga0495665_0069509 | |||
| 1757 | Ga0495665_0072233 | |||
| 1758 | Ga0495665_0216913 | |||
| 1759 | Ga0495586_0009104 | |||
| 1760 | Ga0495586_0020548 | |||
| 1761 | Ga0495586_0131603 | |||
| 1762 | Ga0495586_0206626 | |||
| 1763 | Ga0495586_0503144 | |||
| 1764 | Ga0495587_0008335 | |||
| 1765 | Ga0495587_0013275 | |||
| 1766 | Ga0495587_0025782 | |||
| 1767 | Ga0495587_0030824 | |||
| 1768 | Ga0495645_0000135 | |||
| 1769 | Ga0495645_0000968 | |||
| 1770 | Ga0495645_0010754 | |||
| 1771 | Ga0495645_0212507 | |||
| 1772 | Ga0495667_0002562 | |||
| 1773 | Ga0495667_0009476 | |||
| 1774 | Ga0495667_0015721 | |||
| 1775 | Ga0495667_0103897 | |||
| 1776 | Ga0495634_0367478 | |||
| 1777 | Ga0495635_0021269 | |||
| 1778 | Ga0495659_0140650 | |||
| 1779 | Ga0495588_0135995 | |||
| 1780 | Ga0495588_0156746 | |||
| 1781 | Ga0495657_0006488 | |||
| 1782 | Ga0495657_0063012 | |||
| 1783 | Ga0495657_0746718 | |||
| 1784 | Ga0495599_0000483 | |||
| 1785 | Ga0495599_0045547 | |||
| 1786 | Ga0495599_0288653 | |||
| 1787 | Ga0495623_0006091 | |||
| 1788 | Ga0495623_0029365 | |||
| 1789 | Ga0495623_0036034 | |||
| 1790 | Ga0495623_0038465 | |||
| 1791 | Ga0495623_0074989 | |||
| 1792 | Ga0495658_0222030 | |||
| 1793 | Ga0495613_0221577 | |||
| 1794 | Ga0495613_0415382 | |||
| 1795 | Ga0495613_0788331 | |||
| 1796 | Ga0495600_0015013 | |||
| 1797 | Ga0495604_0021481 | |||
| 1798 | Ga0495604_0111915 | |||
| 1799 | Ga0495636_0290110 | |||
| 1800 | Ga0495674_0034841 | |||
| 1801 | Ga0495674_0402287 | |||
| 1802 | Ga0495672_0004266 | |||
| 1803 | Ga0495672_0004304 | |||
| 1804 | Ga0495675_0011709 | |||
| 1805 | Ga0495675_0057652 | |||
| 1806 | Ga0495675_0095200 | |||
| 1807 | Ga0495675_0817687 | |||
| 1808 | Ga0495677_0365203 | |||
| 1809 | Ga0495684_0027194 | |||
| 1810 | Ga0495684_0083394 | |||
| 1811 | Ga0495684_0106657 | |||
| 1812 | Ga0495684_0129666 | |||
| 1813 | Ga0495684_0145064 | |||
| 1814 | Ga0495602_0002867 | |||
| 1815 | Ga0495602_0094024 | |||
| 1816 | Ga0495602_0238628 | |||
| 1817 | Ga0495602_0263766 | |||
| 1818 | Ga0496104_0053249 | |||
| 1819 | Ga0496107_1210595 | |||
| 1820 | Ga0496109_1824925 | |||
| 1821 | Ga0496110_0886602 | |||
| 1822 | Ga0496112_0033280 | |||
| 1823 | Ga0496112_0187720 | |||
| 1824 | Ga0496115_0242298 | |||
| 1825 | Ga0496115_0673762 | |||
| 1826 | Ga0501299_084135 | |||
| 1827 | Ga0501032_0350579 | |||
| 1828 | Ga0501033_0007466 | |||
| 1829 | Ga0501033_0224158 | |||
| 1830 | Ga0501034_0208110 | |||
| 1831 | Ga0501034_0211231 | |||
| 1832 | Ga0501034_1229768 | |||
| 1833 | Ga0501036_0149629 | |||
| 1834 | Ga0501038_0119536 | |||
| 1835 | Ga0501039_0515486 | |||
| 1836 | Ga0501040_0120503 | |||
| 1837 | Ga0501043_0125464 | |||
| 1838 | Ga0501043_0686317 | |||
| 1839 | Ga0501046_0556546 | |||
| 1840 | Ga0501047_0232395 | |||
| 1841 | Ga0501047_0651307 | |||
| 1842 | Ga0501070_0218731 | |||
| 1843 | Ga0501070_0809027 | |||
| 1844 | Ga0501071_1407673 | |||
| 1845 | Ga0501072_0163537 | |||
| 1846 | Ga0501073_0044836 | |||
| 1847 | Ga0501073_0127863 | |||
| 1848 | Ga0501075_0550009 | |||
| 1849 | Ga0501077_0070005 | |||
| 1850 | Ga0501077_0248191 | |||
| 1851 | Ga0501223_039199 | |||
| 1852 | Ga0501247_038141 | |||
| 1853 | Ga0501247_078125 | |||
| 1854 | Ga0501253_107377 | |||
| 1855 | Ga0501259_089663 | |||
| 1856 | Ga0501234_072894 | |||
| 1857 | Ga0501079_0548852 | |||
| 1858 | Ga0501083_0414735 | |||
| 1859 | Ga0501083_0809697 | |||
| 1860 | Ga0501268_039602 | |||
| 1861 | Ga0501035_0026537 | |||
| 1862 | Ga0501044_0032563 | |||
| 1863 | Ga0501044_0350090 | |||
| 1864 | nmdc:mga03n38_332214_c1 | |||
| 1865 | nmdc:mga06z11_243599_c1 | |||
| 1866 | nmdc:mga05p37_1438142_c1 | |||
| 1867 | nmdc:mga05p37_28216_c1 | |||
| 1868 | nmdc:mga05p37_58133_c1 | |||
| 1869 | nmdc:mga09592_282056_c1 | |||
| 1870 | nmdc:mga09592_420045_c1 | |||
| 1871 | nmdc:mga09592_71968_c1 | |||
| 1872 | nmdc:mga0qj67_16474_c1 | |||
| 1873 | nmdc:mga0qj67_463110_c1 | |||
| 1874 | nmdc:mga0qj67_977515_c1 | |||
| 1875 | nmdc:mga06r32_1035340_c1 | |||
| 1876 | nmdc:mga06r32_1892906_c1 | |||
| 1877 | nmdc:mga06r32_245537_c1 | |||
| 1878 | nmdc:mga06r32_284669_c1 | |||
| 1879 | nmdc:mga06r32_66351_c1 | |||
| 1880 | nmdc:mga06r32_733556_c1 | |||
| 1881 | nmdc:mga06r32_772287_c1 | |||
| 1882 | nmdc:mga06r32_77445_c1 | |||
| 1883 | nmdc:mga06r32_81326_c1 | |||
| 1884 | nmdc:mga06r32_976814_c1 | |||
| 1885 | nmdc:mga08y16_1091241_c1 | |||
| 1886 | nmdc:mga08y16_125746_c1 | |||
| 1887 | nmdc:mga08y16_177417_c1 | |||
| 1888 | nmdc:mga08y16_340403_c1 | |||
| 1889 | nmdc:mga08y16_46297_c1 | |||
| 1890 | nmdc:mga0n895_182554_c1 | |||
| 1891 | nmdc:mga0n895_6412_c1 | |||
| 1892 | nmdc:mga0n895_723796_c1 | |||
| 1893 | nmdc:mga0rr50_1698838_c1 | |||
| 1894 | nmdc:mga0rr50_460956_c1 | |||
| 1895 | nmdc:mga0a205_1143260_c1 | |||
| 1896 | nmdc:mga0a205_16117_c1 | |||
| 1897 | nmdc:mga0a205_56331_c1 | |||
| 1898 | Ga0495601_0099099 | |||
| 1899 | Ga0495601_0217866 | |||
| 1900 | Ga0495612_0009892 | |||
| 1901 | Ga0495612_0120026 | |||
| 1902 | Ga0495595_0032497 | |||
| 1903 | Ga0495595_0142607 | |||
| 1904 | Ga0495595_0147043 | |||
| 1905 | Ga0495619_0202489 | |||
| 1906 | Ga0495619_0803549 | |||
| 1907 | Ga0501084_0217478 | |||
| 1908 | Ga0590071_050782 | |||
| 1909 | Ga0501082_0799539 | |||
| 1910 | Ga0501082_1383188 | |||
| 1911 | Ga0530510_0330025 | |||
| 1912 | Ga0530510_0454148 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9363 | 11 | 108 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9185 | 10 | 105 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9103 | 10 | 105 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9102 | 9 | 109 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9078 | 9 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9131 | 10 | 112 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9103 | 10 | 105 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9059 | 10 | 109 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8795 | 17 | 82 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8775 | 6 | 114 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8EA09-F1-model_v4 | PadR family transcriptional regulator | 0.9974 | 10 | 88 |
|
| AF-A0A2V8HL98-F1-model_v4 | PadR family transcriptional regulator | 0.9948 | 10 | 110 |
|
| AF-A0A1F2TUG0-F1-model_v4 | PadR family transcriptional regulator | 0.9919 | 9 | 110 |
|
| AF-A0A7W0YJI2-F1-model_v4 | PadR family transcriptional regulator | 0.9903 | 16 | 110 |
|
| AF-A0A537T4U9-F1-model_v4 | PadR family transcriptional regulator | 0.9892 | 5 | 107 |
|