F486666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 953 | 395 | 1906 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0176840|Ga0466958_0176840_240_839 |
| Length | 188 |
| Sequence | MPRPVVYYIRHGETDWNVAGRLQGRRDVPLNARGRGQGAHCGRVLRDLFARDGRDPAALDYVSSPLMRARETMALYRLEQRLSEIAFGDWEGCTIAQLKTRDPQGIAAREHDKYRFVPPNGESYEAVTMRMAEWYGSLRRDTVACAHGGTARGLIAHLKIAQAAAAPLIDIAQGVVYVFADGTLSRYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.3 |
| Nodule | 0 |
| Rhizoplane | 6.3 |
| Rhizosphere | 89.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466958_0176840 | 3300045836 | Bacteria | 1353 |
| 2 | JGI24032J14994_100964 | 3300001430 | Bacteria | 1367 |
| 3 | JGI24746J21847_1000620 | 3300001977 | Bacteria | 5412 |
| 4 | JGI24747J21853_1000939 | 3300001978 | Bacteria | 2039 |
| 5 | JGI24747J21853_1008755 | 3300001978 | Bacteria | 992 |
| 6 | JGI24739J22299_10001041 | 3300001989 | Bacteria | 10288 |
| 7 | JGI24745J21846_1000131 | 3300002073 | Bacteria | 5781 |
| 8 | JGI24748J21848_1001208 | 3300002074 | Bacteria | 2822 |
| 9 | JGI24738J21930_10000571 | 3300002075 | Bacteria | 10549 |
| 10 | JGI24749J21850_1000415 | 3300002076 | Bacteria | 6366 |
| 11 | JGI24749J21850_1006197 | 3300002076 | Bacteria | 1667 |
| 12 | JGI24744J21845_10001089 | 3300002077 | Bacteria | 5257 |
| 13 | JGI24034J26672_10001679 | 3300002239 | Bacteria | 2975 |
| 14 | JGI24742J22300_10000080 | 3300002244 | Bacteria | 13750 |
| 15 | JGI25405J52794_10003705 | 3300003911 | Bacteria | 2695 |
| 16 | Ga0070658_10050265 | 3300005327 | Bacteria | 3379 |
| 17 | Ga0070676_10000128 | 3300005328 | Bacteria | 28446 |
| 18 | Ga0070676_10444281 | 3300005328 | Unclassified | 911 |
| 19 | Ga0070683_100000289 | 3300005329 | Bacteria | 34698 |
| 20 | Ga0070683_100080750 | 3300005329 | Bacteria | 3044 |
| 21 | Ga0070683_100400166 | 3300005329 | Bacteria | 1309 |
| 22 | Ga0070690_100000935 | 3300005330 | Bacteria | 14900 |
| 23 | Ga0070690_100066908 | 3300005330 | Bacteria | 2327 |
| 24 | Ga0070670_100003173 | 3300005331 | Bacteria | 13581 |
| 25 | Ga0070677_10000043 | 3300005333 | Bacteria | 39363 |
| 26 | Ga0070666_10005381 | 3300005335 | Bacteria | 7846 |
| 27 | Ga0070666_10136061 | 3300005335 | Bacteria | 1709 |
| 28 | Ga0070680_100002347 | 3300005336 | Bacteria | 13977 |
| 29 | Ga0070680_100009986 | 3300005336 | Bacteria | 7311 |
| 30 | Ga0070680_100092243 | 3300005336 | Bacteria | 2508 |
| 31 | Ga0070680_100224788 | 3300005336 | Bacteria | 1584 |
| 32 | Ga0070680_100459248 | 3300005336 | Bacteria | 1088 |
| 33 | Ga0070680_100624880 | 3300005336 | Bacteria | 925 |
| 34 | Ga0070682_100000528 | 3300005337 | Bacteria | 23870 |
| 35 | Ga0070682_100037063 | 3300005337 | Bacteria | 2983 |
| 36 | Ga0068868_100000408 | 3300005338 | Bacteria | 29034 |
| 37 | Ga0068868_100133583 | 3300005338 | Bacteria | 2032 |
| 38 | Ga0070660_100010085 | 3300005339 | Bacteria | 6665 |
| 39 | Ga0070660_100011422 | 3300005339 | Bacteria | 6308 |
| 40 | Ga0070689_100000819 | 3300005340 | Bacteria | 19235 |
| 41 | Ga0070689_100039120 | 3300005340 | Bacteria | 3630 |
| 42 | Ga0070691_10015622 | 3300005341 | Bacteria | 3487 |
| 43 | Ga0070687_100000950 | 3300005343 | Bacteria | 9837 |
| 44 | Ga0070687_100050490 | 3300005343 | Bacteria | 2148 |
| 45 | Ga0070661_100000314 | 3300005344 | Bacteria | 39090 |
| 46 | Ga0070661_100059190 | 3300005344 | Bacteria | 2808 |
| 47 | Ga0070661_100073243 | 3300005344 | Bacteria | 2521 |
| 48 | Ga0070661_100266880 | 3300005344 | Bacteria | 1324 |
| 49 | Ga0070692_10000310 | 3300005345 | Bacteria | 13896 |
| 50 | Ga0070668_100000857 | 3300005347 | Bacteria | 21127 |
| 51 | Ga0070668_100126421 | 3300005347 | Bacteria | 2048 |
| 52 | Ga0070668_100168165 | 3300005347 | Bacteria | 1783 |
| 53 | Ga0070675_100002240 | 3300005354 | Bacteria | 14349 |
| 54 | Ga0070671_100000598 | 3300005355 | Bacteria | 25820 |
| 55 | Ga0070671_100034340 | 3300005355 | Bacteria | 4198 |
| 56 | Ga0070674_100006534 | 3300005356 | Bacteria | 6811 |
| 57 | Ga0070674_100011212 | 3300005356 | Bacteria | 5448 |
| 58 | Ga0070673_100000289 | 3300005364 | Bacteria | 26187 |
| 59 | Ga0070673_100010566 | 3300005364 | Bacteria | 6253 |
| 60 | Ga0070688_100000189 | 3300005365 | Bacteria | 32631 |
| 61 | Ga0070688_100011682 | 3300005365 | Bacteria | 4889 |
| 62 | Ga0070659_100034177 | 3300005366 | Bacteria | 3953 |
| 63 | Ga0070659_100100339 | 3300005366 | Bacteria | 2329 |
| 64 | Ga0070659_100138140 | 3300005366 | Bacteria | 1983 |
| 65 | Ga0070667_100000436 | 3300005367 | Bacteria | 43897 |
| 66 | Ga0070667_100016498 | 3300005367 | Bacteria | 6113 |
| 67 | Ga0070703_10025825 | 3300005406 | Bacteria | 1744 |
| 68 | Ga0070709_10001788 | 3300005434 | Bacteria | 11676 |
| 69 | Ga0070709_10099368 | 3300005434 | Bacteria | 1935 |
| 70 | Ga0070709_10357448 | 3300005434 | Bacteria | 1081 |
| 71 | Ga0070714_100037701 | 3300005435 | Bacteria | 4063 |
| 72 | Ga0070714_100043964 | 3300005435 | Bacteria | 3780 |
| 73 | Ga0070714_100829782 | 3300005435 | Bacteria | 896 |
| 74 | Ga0070713_100001448 | 3300005436 | Bacteria | 15190 |
| 75 | Ga0070713_100618982 | 3300005436 | Bacteria | 1030 |
| 76 | Ga0070710_10012602 | 3300005437 | Bacteria | 4205 |
| 77 | Ga0070710_10079652 | 3300005437 | Bacteria | 1909 |
| 78 | Ga0070711_100017964 | 3300005439 | Bacteria | 4508 |
| 79 | Ga0070711_100037273 | 3300005439 | Bacteria | 3262 |
| 80 | Ga0070711_100086719 | 3300005439 | Bacteria | 2245 |
| 81 | Ga0070711_100110447 | 3300005439 | Bacteria | 2017 |
| 82 | Ga0070711_100222275 | 3300005439 | Bacteria | 1468 |
| 83 | Ga0070711_100342080 | 3300005439 | Bacteria | 1200 |
| 84 | Ga0070711_100544809 | 3300005439 | Bacteria | 962 |
| 85 | Ga0070705_100000781 | 3300005440 | Bacteria | 17954 |
| 86 | Ga0070705_100034313 | 3300005440 | Bacteria | 2835 |
| 87 | Ga0070705_100100485 | 3300005440 | Bacteria | 1825 |
| 88 | Ga0070700_100001610 | 3300005441 | Bacteria | 11254 |
| 89 | Ga0070708_100320014 | 3300005445 | Bacteria | 1461 |
| 90 | Ga0070663_100000297 | 3300005455 | Bacteria | 25442 |
| 91 | Ga0070663_100102460 | 3300005455 | Bacteria | 2138 |
| 92 | Ga0070663_100289653 | 3300005455 | Bacteria | 1307 |
| 93 | Ga0070678_100011789 | 3300005456 | Bacteria | 5407 |
| 94 | Ga0070678_100104777 | 3300005456 | Bacteria | 2200 |
| 95 | Ga0070662_100032794 | 3300005457 | Bacteria | 3652 |
| 96 | Ga0070662_100085677 | 3300005457 | Bacteria | 2355 |
| 97 | Ga0070662_100529872 | 3300005457 | Bacteria | 985 |
| 98 | Ga0070681_10022181 | 3300005458 | Bacteria | 6373 |
| 99 | Ga0070681_10148718 | 3300005458 | Bacteria | 2270 |
| 100 | Ga0070681_10241732 | 3300005458 | Bacteria | 1719 |
| 101 | Ga0068867_100003318 | 3300005459 | Bacteria | 11338 |
| 102 | Ga0068867_100238130 | 3300005459 | Bacteria | 1474 |
| 103 | Ga0068867_100269566 | 3300005459 | Bacteria | 1391 |
| 104 | Ga0070685_10001152 | 3300005466 | Bacteria | 14147 |
| 105 | Ga0070685_10019022 | 3300005466 | Bacteria | 3701 |
| 106 | Ga0070707_100477815 | 3300005468 | Bacteria | 1208 |
| 107 | Ga0070679_100003016 | 3300005530 | Bacteria | 15378 |
| 108 | Ga0070679_100066275 | 3300005530 | Bacteria | 3599 |
| 109 | Ga0070679_100082823 | 3300005530 | Bacteria | 3197 |
| 110 | Ga0070679_100329755 | 3300005530 | Bacteria | 1475 |
| 111 | Ga0070679_100335289 | 3300005530 | Bacteria | 1461 |
| 112 | Ga0070679_100364379 | 3300005530 | Bacteria | 1392 |
| 113 | Ga0070679_100418442 | 3300005530 | Bacteria | 1285 |
| 114 | Ga0070684_100002293 | 3300005535 | Bacteria | 14101 |
| 115 | Ga0070684_100233479 | 3300005535 | Bacteria | 1680 |
| 116 | Ga0070672_100000106 | 3300005543 | Bacteria | 41858 |
| 117 | Ga0070686_100000615 | 3300005544 | Bacteria | 20904 |
| 118 | Ga0070686_100013219 | 3300005544 | Bacteria | 4720 |
| 119 | Ga0070695_100001248 | 3300005545 | Bacteria | 13985 |
| 120 | Ga0070696_100663534 | 3300005546 | Bacteria | 847 |
| 121 | Ga0070693_100001863 | 3300005547 | Bacteria | 9633 |
| 122 | Ga0070693_100050332 | 3300005547 | Bacteria | 2381 |
| 123 | Ga0070665_100469924 | 3300005548 | Bacteria | 1268 |
| 124 | Ga0070665_100851724 | 3300005548 | Bacteria | 925 |
| 125 | Ga0070704_100094818 | 3300005549 | Bacteria | 2234 |
| 126 | Ga0070704_100404242 | 3300005549 | Bacteria | 1166 |
| 127 | Ga0068855_100111919 | 3300005563 | Bacteria | 3133 |
| 128 | Ga0068855_100154833 | 3300005563 | Bacteria | 2604 |
| 129 | Ga0068855_100875141 | 3300005563 | Bacteria | 950 |
| 130 | Ga0070664_100009338 | 3300005564 | Bacteria | 7954 |
| 131 | Ga0070664_100108430 | 3300005564 | Bacteria | 2421 |
| 132 | Ga0070664_101266167 | 3300005564 | Bacteria | 696 |
| 133 | Ga0068857_100000047 | 3300005577 | Bacteria | 67784 |
| 134 | Ga0068857_100957013 | 3300005577 | Bacteria | 823 |
| 135 | Ga0068854_100003161 | 3300005578 | Bacteria | 10266 |
| 136 | Ga0068854_100308470 | 3300005578 | Bacteria | 1283 |
| 137 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 138 | Ga0068856_100001905 | 3300005614 | Bacteria | 21761 |
| 139 | Ga0068856_100253550 | 3300005614 | Bacteria | 1774 |
| 140 | Ga0068856_100510238 | 3300005614 | Bacteria | 1223 |
| 141 | Ga0068856_100582167 | 3300005614 | Bacteria | 1140 |
| 142 | Ga0070702_100004825 | 3300005615 | Bacteria | 6199 |
| 143 | Ga0070702_100031024 | 3300005615 | Bacteria | 2920 |
| 144 | Ga0068852_100011300 | 3300005616 | Bacteria | 6716 |
| 145 | Ga0068852_100445886 | 3300005616 | Bacteria | 1280 |
| 146 | Ga0068859_100005879 | 3300005617 | Bacteria | 12451 |
| 147 | Ga0068859_100061450 | 3300005617 | Bacteria | 3786 |
| 148 | Ga0068859_100666543 | 3300005617 | Bacteria | 1132 |
| 149 | Ga0068864_100000931 | 3300005618 | Bacteria | 24535 |
| 150 | Ga0068864_100265640 | 3300005618 | Bacteria | 1597 |
| 151 | Ga0068866_10000077 | 3300005718 | Bacteria | 39340 |
| 152 | Ga0068866_10100282 | 3300005718 | Bacteria | 1596 |
| 153 | Ga0068866_10225940 | 3300005718 | Bacteria | 1132 |
| 154 | Ga0068861_100004701 | 3300005719 | Bacteria | 9180 |
| 155 | Ga0068861_100164001 | 3300005719 | Bacteria | 1836 |
| 156 | Ga0068861_100328706 | 3300005719 | Bacteria | 1334 |
| 157 | Ga0068870_10001017 | 3300005840 | Bacteria | 11098 |
| 158 | Ga0068863_100000543 | 3300005841 | Bacteria | 38366 |
| 159 | Ga0068858_100002073 | 3300005842 | Bacteria | 20401 |
| 160 | Ga0068858_100418566 | 3300005842 | Bacteria | 1288 |
| 161 | Ga0068860_100005115 | 3300005843 | Bacteria | 13336 |
| 162 | Ga0068860_100466387 | 3300005843 | Bacteria | 1257 |
| 163 | Ga0068862_100000879 | 3300005844 | Bacteria | 29265 |
| 164 | Ga0068862_100030509 | 3300005844 | Bacteria | 4544 |
| 165 | Ga0081455_10009848 | 3300005937 | Bacteria | 9788 |
| 166 | Ga0081538_10055356 | 3300005981 | Bacteria | 2337 |
| 167 | Ga0070717_10000287 | 3300006028 | Bacteria | 34051 |
| 168 | Ga0075365_10001551 | 3300006038 | Bacteria | 10507 |
| 169 | Ga0075365_10003415 | 3300006038 | Bacteria | 8176 |
| 170 | Ga0075368_10001935 | 3300006042 | Bacteria | 6662 |
| 171 | Ga0075368_10014056 | 3300006042 | Bacteria | 2950 |
| 172 | Ga0075363_100051029 | 3300006048 | Bacteria | 2205 |
| 173 | Ga0075363_100505628 | 3300006048 | Bacteria | 718 |
| 174 | Ga0075364_10003383 | 3300006051 | Bacteria | 9061 |
| 175 | Ga0075364_10027881 | 3300006051 | Bacteria | 3611 |
| 176 | Ga0075432_10000660 | 3300006058 | Bacteria | 10552 |
| 177 | Ga0070715_10000989 | 3300006163 | Bacteria | 7957 |
| 178 | Ga0070715_10206773 | 3300006163 | Bacteria | 1001 |
| 179 | Ga0070715_10328605 | 3300006163 | Unclassified | 828 |
| 180 | Ga0070712_100018234 | 3300006175 | Bacteria | 4555 |
| 181 | Ga0070712_100112774 | 3300006175 | Bacteria | 2032 |
| 182 | Ga0070712_100120042 | 3300006175 | Bacteria | 1977 |
| 183 | Ga0070712_100122974 | 3300006175 | Bacteria | 1955 |
| 184 | Ga0070712_100169434 | 3300006175 | Bacteria | 1693 |
| 185 | Ga0070712_100948197 | 3300006175 | Unclassified | 743 |
| 186 | Ga0075362_10046636 | 3300006177 | Bacteria | 1928 |
| 187 | Ga0075367_10006859 | 3300006178 | Bacteria | 5792 |
| 188 | Ga0075367_10031403 | 3300006178 | Bacteria | 3050 |
| 189 | Ga0075367_10065248 | 3300006178 | Bacteria | 2179 |
| 190 | Ga0075367_10126955 | 3300006178 | Bacteria | 1575 |
| 191 | Ga0075369_10137941 | 3300006186 | Bacteria | 1111 |
| 192 | Ga0075366_10304577 | 3300006195 | Bacteria | 975 |
| 193 | Ga0097621_100000416 | 3300006237 | Bacteria | 29698 |
| 194 | Ga0097621_100007350 | 3300006237 | Bacteria | 7877 |
| 195 | Ga0097621_100069248 | 3300006237 | Bacteria | 2913 |
| 196 | Ga0075370_10090888 | 3300006353 | Bacteria | 1761 |
| 197 | Ga0068871_100000249 | 3300006358 | Bacteria | 37516 |
| 198 | Ga0068871_100004813 | 3300006358 | Bacteria | 9439 |
| 199 | Ga0068871_100048128 | 3300006358 | Bacteria | 3440 |
| 200 | Ga0075428_100042214 | 3300006844 | Bacteria | 5016 |
| 201 | Ga0075428_100062287 | 3300006844 | Bacteria | 4085 |
| 202 | Ga0075430_100002807 | 3300006846 | Bacteria | 14570 |
| 203 | Ga0075430_100020814 | 3300006846 | Bacteria | 5576 |
| 204 | Ga0075431_100016617 | 3300006847 | Bacteria | 7470 |
| 205 | Ga0075431_100022318 | 3300006847 | Bacteria | 6469 |
| 206 | Ga0075433_10001150 | 3300006852 | Bacteria | 19214 |
| 207 | Ga0075433_10017415 | 3300006852 | Bacteria | 5950 |
| 208 | Ga0075434_100003092 | 3300006871 | Bacteria | 14816 |
| 209 | Ga0075434_100003158 | 3300006871 | Bacteria | 14688 |
| 210 | Ga0075434_100073362 | 3300006871 | Bacteria | 3415 |
| 211 | Ga0075429_100001089 | 3300006880 | Bacteria | 21839 |
| 212 | Ga0068865_100000248 | 3300006881 | Bacteria | 30110 |
| 213 | Ga0068865_100348128 | 3300006881 | Bacteria | 1199 |
| 214 | Ga0075436_100283221 | 3300006914 | Bacteria | 1185 |
| 215 | Ga0075436_100362632 | 3300006914 | Bacteria | 1046 |
| 216 | Ga0097620_100005879 | 3300006931 | Bacteria | 12451 |
| 217 | Ga0097620_100061449 | 3300006931 | Bacteria | 3786 |
| 218 | Ga0097620_100666622 | 3300006931 | Bacteria | 1132 |
| 219 | Ga0075435_100017893 | 3300007076 | Bacteria | 5372 |
| 220 | Ga0075435_100141912 | 3300007076 | Bacteria | 2016 |
| 221 | Ga0099794_10182799 | 3300007265 | Bacteria | 1070 |
| 222 | Ga0105251_10011683 | 3300009011 | Bacteria | 5006 |
| 223 | Ga0105244_10020578 | 3300009036 | Bacteria | 3663 |
| 224 | Ga0105240_10034168 | 3300009093 | Bacteria | 6562 |
| 225 | Ga0111539_10002489 | 3300009094 | Bacteria | 24423 |
| 226 | Ga0111539_10002685 | 3300009094 | Bacteria | 23545 |
| 227 | Ga0111539_10004243 | 3300009094 | Bacteria | 18781 |
| 228 | Ga0111539_10071809 | 3300009094 | Bacteria | 4084 |
| 229 | Ga0111539_10474430 | 3300009094 | Bacteria | 1457 |
| 230 | Ga0111539_10951192 | 3300009094 | Bacteria | 999 |
| 231 | Ga0105245_10115039 | 3300009098 | Bacteria | 2506 |
| 232 | Ga0105245_10125883 | 3300009098 | Bacteria | 2399 |
| 233 | Ga0105245_10180261 | 3300009098 | Bacteria | 2018 |
| 234 | Ga0105247_10000908 | 3300009101 | Bacteria | 22289 |
| 235 | Ga0105247_10287315 | 3300009101 | Bacteria | 1136 |
| 236 | Ga0114129_10018021 | 3300009147 | Bacteria | 10057 |
| 237 | Ga0114129_10019253 | 3300009147 | Bacteria | 9723 |
| 238 | Ga0114129_10107955 | 3300009147 | Bacteria | 3844 |
| 239 | Ga0105243_10001705 | 3300009148 | Bacteria | 18936 |
| 240 | Ga0105243_10359390 | 3300009148 | Bacteria | 1340 |
| 241 | Ga0105243_10518315 | 3300009148 | Bacteria | 1133 |
| 242 | Ga0105241_10002306 | 3300009174 | Bacteria | 14330 |
| 243 | Ga0105241_10448240 | 3300009174 | Bacteria | 1141 |
| 244 | Ga0105241_10507727 | 3300009174 | Bacteria | 1076 |
| 245 | Ga0105242_10001376 | 3300009176 | Bacteria | 19167 |
| 246 | Ga0105242_10069731 | 3300009176 | Bacteria | 2912 |
| 247 | Ga0105248_10005936 | 3300009177 | Bacteria | 13420 |
| 248 | Ga0105248_10132244 | 3300009177 | Bacteria | 2815 |
| 249 | Ga0105248_10299658 | 3300009177 | Bacteria | 1810 |
| 250 | Ga0105248_10964103 | 3300009177 | Bacteria | 963 |
| 251 | Ga0105237_10002245 | 3300009545 | Bacteria | 24070 |
| 252 | Ga0105237_10260701 | 3300009545 | Bacteria | 1736 |
| 253 | Ga0105238_10115503 | 3300009551 | Bacteria | 2664 |
| 254 | Ga0105238_10122582 | 3300009551 | Bacteria | 2579 |
| 255 | Ga0105238_10177386 | 3300009551 | Bacteria | 2107 |
| 256 | Ga0105249_10000476 | 3300009553 | Bacteria | 37263 |
| 257 | Ga0105239_10352320 | 3300010375 | Bacteria | 1662 |
| 258 | Ga0105239_10659661 | 3300010375 | Bacteria | 1195 |
| 259 | Ga0105239_10716743 | 3300010375 | Bacteria | 1144 |
| 260 | Ga0105246_10000057 | 3300011119 | Bacteria | 44951 |
| 261 | Ga0105246_10008212 | 3300011119 | Bacteria | 6413 |
| 262 | Ga0157373_10033593 | 3300013100 | Bacteria | 3689 |
| 263 | Ga0157373_10049870 | 3300013100 | Bacteria | 2982 |
| 264 | Ga0157371_10013856 | 3300013102 | Bacteria | 6108 |
| 265 | Ga0157370_10106417 | 3300013104 | Bacteria | 2625 |
| 266 | Ga0157370_10160543 | 3300013104 | Bacteria | 2091 |
| 267 | Ga0157369_10652341 | 3300013105 | Bacteria | 1085 |
| 268 | Ga0157369_10897955 | 3300013105 | Bacteria | 909 |
| 269 | Ga0157369_11106781 | 3300013105 | Bacteria | 810 |
| 270 | Ga0157374_10304404 | 3300013296 | Bacteria | 1577 |
| 271 | Ga0157374_10407080 | 3300013296 | Bacteria | 1358 |
| 272 | Ga0157378_10006604 | 3300013297 | Bacteria | 10133 |
| 273 | Ga0157378_10036611 | 3300013297 | Bacteria | 4343 |
| 274 | Ga0157378_10139163 | 3300013297 | Bacteria | 2253 |
| 275 | Ga0157378_10516555 | 3300013297 | Bacteria | 1195 |
| 276 | Ga0163162_10001937 | 3300013306 | Bacteria | 19439 |
| 277 | Ga0157372_10009498 | 3300013307 | Bacteria | 10344 |
| 278 | Ga0157372_10055438 | 3300013307 | Bacteria | 4427 |
| 279 | Ga0157372_10231439 | 3300013307 | Bacteria | 2143 |
| 280 | Ga0157372_10806576 | 3300013307 | Bacteria | 1090 |
| 281 | Ga0157375_10079527 | 3300013308 | Bacteria | 3314 |
| 282 | Ga0157375_10459908 | 3300013308 | Bacteria | 1438 |
| 283 | Ga0157375_10792671 | 3300013308 | Bacteria | 1096 |
| 284 | Ga0163163_10003757 | 3300014325 | Bacteria | 12927 |
| 285 | Ga0157380_10088614 | 3300014326 | Bacteria | 2547 |
| 286 | Ga0157380_10191901 | 3300014326 | Bacteria | 1804 |
| 287 | Ga0157377_10009792 | 3300014745 | Bacteria | 4721 |
| 288 | Ga0157377_10075461 | 3300014745 | Bacteria | 1958 |
| 289 | Ga0157379_10000293 | 3300014968 | Bacteria | 39625 |
| 290 | Ga0157379_10404041 | 3300014968 | Unclassified | 1256 |
| 291 | Ga0157379_10511275 | 3300014968 | Bacteria | 1114 |
| 292 | Ga0157376_10000531 | 3300014969 | Bacteria | 24495 |
| 293 | Ga0157376_10041358 | 3300014969 | Bacteria | 3773 |
| 294 | Ga0157376_10392082 | 3300014969 | Bacteria | 1340 |
| 295 | Ga0157376_10509077 | 3300014969 | Bacteria | 1184 |
| 296 | Ga0163161_10000209 | 3300017792 | Bacteria | 53534 |
| 297 | Ga0206356_10827474 | 3300020070 | Bacteria | 1216 |
| 298 | Ga0207673_1000294 | 3300025290 | Bacteria | 5034 |
| 299 | Ga0207697_10000044 | 3300025315 | Bacteria | 48337 |
| 300 | Ga0207713_1025555 | 3300025735 | Bacteria | 2723 |
| 301 | Ga0207682_10000260 | 3300025893 | Bacteria | 23782 |
| 302 | Ga0207692_10022379 | 3300025898 | Bacteria | 2907 |
| 303 | Ga0207692_10358001 | 3300025898 | Bacteria | 901 |
| 304 | Ga0207692_10604413 | 3300025898 | Bacteria | 705 |
| 305 | Ga0207710_10003110 | 3300025900 | Bacteria | 7435 |
| 306 | Ga0207710_10003890 | 3300025900 | Bacteria | 6598 |
| 307 | Ga0207688_10000723 | 3300025901 | Bacteria | 16367 |
| 308 | Ga0207680_10018440 | 3300025903 | Bacteria | 3709 |
| 309 | Ga0207680_10060435 | 3300025903 | Bacteria | 2307 |
| 310 | Ga0207685_10070599 | 3300025905 | Bacteria | 1414 |
| 311 | Ga0207685_10087856 | 3300025905 | Bacteria | 1302 |
| 312 | Ga0207685_10454172 | 3300025905 | Unclassified | 667 |
| 313 | Ga0207699_10003904 | 3300025906 | Bacteria | 7122 |
| 314 | Ga0207699_10006701 | 3300025906 | Bacteria | 5590 |
| 315 | Ga0207645_10092651 | 3300025907 | Bacteria | 1944 |
| 316 | Ga0207645_10173285 | 3300025907 | Bacteria | 1415 |
| 317 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 318 | Ga0207705_10035014 | 3300025909 | Bacteria | 3592 |
| 319 | Ga0207705_10051690 | 3300025909 | Bacteria | 2958 |
| 320 | Ga0207654_10028155 | 3300025911 | Bacteria | 3062 |
| 321 | Ga0207654_10253295 | 3300025911 | Bacteria | 1181 |
| 322 | Ga0207707_10000551 | 3300025912 | Bacteria | 38020 |
| 323 | Ga0207707_10071564 | 3300025912 | Bacteria | 3022 |
| 324 | Ga0207707_10103791 | 3300025912 | Bacteria | 2484 |
| 325 | Ga0207707_10249273 | 3300025912 | Bacteria | 1543 |
| 326 | Ga0207707_10298593 | 3300025912 | Bacteria | 1393 |
| 327 | Ga0207707_10348411 | 3300025912 | Bacteria | 1276 |
| 328 | Ga0207695_10232716 | 3300025913 | Bacteria | 1746 |
| 329 | Ga0207695_10290133 | 3300025913 | Bacteria | 1528 |
| 330 | Ga0207695_10292090 | 3300025913 | Bacteria | 1522 |
| 331 | Ga0207671_10059138 | 3300025914 | Bacteria | 2841 |
| 332 | Ga0207693_10000861 | 3300025915 | Bacteria | 27070 |
| 333 | Ga0207693_10002835 | 3300025915 | Bacteria | 15018 |
| 334 | Ga0207693_10130885 | 3300025915 | Bacteria | 1972 |
| 335 | Ga0207693_10137269 | 3300025915 | Bacteria | 1923 |
| 336 | Ga0207693_10292608 | 3300025915 | Bacteria | 1276 |
| 337 | Ga0207693_10382750 | 3300025915 | Bacteria | 1100 |
| 338 | Ga0207663_10020213 | 3300025916 | Bacteria | 3768 |
| 339 | Ga0207663_10042456 | 3300025916 | Bacteria | 2778 |
| 340 | Ga0207663_10078827 | 3300025916 | Bacteria | 2149 |
| 341 | Ga0207663_10213612 | 3300025916 | Bacteria | 1400 |
| 342 | Ga0207663_10329840 | 3300025916 | Bacteria | 1149 |
| 343 | Ga0207663_10353226 | 3300025916 | Bacteria | 1113 |
| 344 | Ga0207660_10000992 | 3300025917 | Bacteria | 18816 |
| 345 | Ga0207660_10049332 | 3300025917 | Bacteria | 2983 |
| 346 | Ga0207660_10251974 | 3300025917 | Bacteria | 1394 |
| 347 | Ga0207662_10155117 | 3300025918 | Bacteria | 1459 |
| 348 | Ga0207657_10000358 | 3300025919 | Bacteria | 48238 |
| 349 | Ga0207657_10013894 | 3300025919 | Bacteria | 7879 |
| 350 | Ga0207657_10138740 | 3300025919 | Bacteria | 1988 |
| 351 | Ga0207649_10000545 | 3300025920 | Bacteria | 26032 |
| 352 | Ga0207649_10038207 | 3300025920 | Bacteria | 2905 |
| 353 | Ga0207649_10065685 | 3300025920 | Bacteria | 2297 |
| 354 | Ga0207649_10069769 | 3300025920 | Bacteria | 2239 |
| 355 | Ga0207652_10012964 | 3300025921 | Bacteria | 6745 |
| 356 | Ga0207652_10020676 | 3300025921 | Bacteria | 5424 |
| 357 | Ga0207652_10241213 | 3300025921 | Bacteria | 1629 |
| 358 | Ga0207652_10313606 | 3300025921 | Bacteria | 1416 |
| 359 | Ga0207694_10025186 | 3300025924 | Bacteria | 4520 |
| 360 | Ga0207694_10088687 | 3300025924 | Bacteria | 2438 |
| 361 | Ga0207694_10159813 | 3300025924 | Bacteria | 1819 |
| 362 | Ga0207694_11011883 | 3300025924 | Bacteria | 703 |
| 363 | Ga0207650_10016372 | 3300025925 | Bacteria | 5183 |
| 364 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 365 | Ga0207687_10000149 | 3300025927 | Bacteria | 46713 |
| 366 | Ga0207687_10016797 | 3300025927 | Bacteria | 4811 |
| 367 | Ga0207687_10099594 | 3300025927 | Bacteria | 2136 |
| 368 | Ga0207687_10101533 | 3300025927 | Bacteria | 2117 |
| 369 | Ga0207700_10006638 | 3300025928 | Bacteria | 7014 |
| 370 | Ga0207700_10069749 | 3300025928 | Bacteria | 2699 |
| 371 | Ga0207700_10525959 | 3300025928 | Bacteria | 1048 |
| 372 | Ga0207664_10124748 | 3300025929 | Bacteria | 2160 |
| 373 | Ga0207664_10185409 | 3300025929 | Bacteria | 1789 |
| 374 | Ga0207664_10198260 | 3300025929 | Bacteria | 1731 |
| 375 | Ga0207644_10007018 | 3300025931 | Bacteria | 7334 |
| 376 | Ga0207644_10014986 | 3300025931 | Bacteria | 5198 |
| 377 | Ga0207644_10129318 | 3300025931 | Bacteria | 1931 |
| 378 | Ga0207690_10000203 | 3300025932 | Bacteria | 46451 |
| 379 | Ga0207690_10072033 | 3300025932 | Bacteria | 2386 |
| 380 | Ga0207706_10002188 | 3300025933 | Bacteria | 19056 |
| 381 | Ga0207706_10023762 | 3300025933 | Bacteria | 5500 |
| 382 | Ga0207686_10001306 | 3300025934 | Bacteria | 14268 |
| 383 | Ga0207686_10004009 | 3300025934 | Bacteria | 7903 |
| 384 | Ga0207686_10030861 | 3300025934 | Bacteria | 3178 |
| 385 | Ga0207709_10000852 | 3300025935 | Bacteria | 23321 |
| 386 | Ga0207670_10005646 | 3300025936 | Bacteria | 6883 |
| 387 | Ga0207669_10000357 | 3300025937 | Bacteria | 20792 |
| 388 | Ga0207704_10002400 | 3300025938 | Bacteria | 8418 |
| 389 | Ga0207704_10184785 | 3300025938 | Bacteria | 1510 |
| 390 | Ga0207704_10369626 | 3300025938 | Bacteria | 1122 |
| 391 | Ga0207665_10000259 | 3300025939 | Bacteria | 36733 |
| 392 | Ga0207665_10040542 | 3300025939 | Bacteria | 3107 |
| 393 | Ga0207691_10000256 | 3300025940 | Bacteria | 52748 |
| 394 | Ga0207711_10012598 | 3300025941 | Bacteria | 7023 |
| 395 | Ga0207711_10131169 | 3300025941 | Bacteria | 2247 |
| 396 | Ga0207711_10644614 | 3300025941 | Bacteria | 988 |
| 397 | Ga0207661_10000104 | 3300025944 | Bacteria | 53977 |
| 398 | Ga0207661_10084958 | 3300025944 | Bacteria | 2623 |
| 399 | Ga0207661_10125720 | 3300025944 | Bacteria | 2190 |
| 400 | Ga0207661_10692496 | 3300025944 | Unclassified | 937 |
| 401 | Ga0207679_10000196 | 3300025945 | Bacteria | 48433 |
| 402 | Ga0207679_10036592 | 3300025945 | Bacteria | 3482 |
| 403 | Ga0207679_10278182 | 3300025945 | Bacteria | 1434 |
| 404 | Ga0207667_10032029 | 3300025949 | Bacteria | 5668 |
| 405 | Ga0207667_10159306 | 3300025949 | Bacteria | 2322 |
| 406 | Ga0207667_10511420 | 3300025949 | Bacteria | 1217 |
| 407 | Ga0207651_10006894 | 3300025960 | Bacteria | 6000 |
| 408 | Ga0207651_10637699 | 3300025960 | Bacteria | 934 |
| 409 | Ga0207712_10000967 | 3300025961 | Bacteria | 20676 |
| 410 | Ga0207668_10000251 | 3300025972 | Bacteria | 35861 |
| 411 | Ga0207668_10259137 | 3300025972 | Bacteria | 1416 |
| 412 | Ga0207668_10357362 | 3300025972 | Bacteria | 1223 |
| 413 | Ga0207640_10000157 | 3300025981 | Bacteria | 49126 |
| 414 | Ga0207640_10213072 | 3300025981 | Bacteria | 1473 |
| 415 | Ga0207658_10008247 | 3300025986 | Bacteria | 7097 |
| 416 | Ga0207658_10010507 | 3300025986 | Bacteria | 6288 |
| 417 | Ga0207677_10000609 | 3300026023 | Bacteria | 22003 |
| 418 | Ga0207677_10063697 | 3300026023 | Bacteria | 2564 |
| 419 | Ga0207703_10028101 | 3300026035 | Bacteria | 4430 |
| 420 | Ga0207703_10104869 | 3300026035 | Bacteria | 2402 |
| 421 | Ga0207639_10002440 | 3300026041 | Bacteria | 12492 |
| 422 | Ga0207678_10033403 | 3300026067 | Bacteria | 4482 |
| 423 | Ga0207678_10046972 | 3300026067 | Bacteria | 3734 |
| 424 | Ga0207708_10321582 | 3300026075 | Bacteria | 1263 |
| 425 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 426 | Ga0207702_10003955 | 3300026078 | Bacteria | 13300 |
| 427 | Ga0207702_10035671 | 3300026078 | Bacteria | 4158 |
| 428 | Ga0207702_10116890 | 3300026078 | Bacteria | 2381 |
| 429 | Ga0207702_10771706 | 3300026078 | Unclassified | 950 |
| 430 | Ga0207641_10002938 | 3300026088 | Bacteria | 15413 |
| 431 | Ga0207641_10210093 | 3300026088 | Bacteria | 1799 |
| 432 | Ga0207648_10259123 | 3300026089 | Bacteria | 1551 |
| 433 | Ga0207648_10422334 | 3300026089 | Bacteria | 1211 |
| 434 | Ga0207676_10003560 | 3300026095 | Bacteria | 11004 |
| 435 | Ga0207676_10012794 | 3300026095 | Bacteria | 6021 |
| 436 | Ga0207674_10074021 | 3300026116 | Bacteria | 3419 |
| 437 | Ga0207675_100037598 | 3300026118 | Bacteria | 4514 |
| 438 | Ga0207675_100084741 | 3300026118 | Bacteria | 2974 |
| 439 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 440 | Ga0207683_10005678 | 3300026121 | Bacteria | 10699 |
| 441 | Ga0207683_10016442 | 3300026121 | Bacteria | 6297 |
| 442 | Ga0207683_10320367 | 3300026121 | Bacteria | 1420 |
| 443 | Ga0207698_10027501 | 3300026142 | Bacteria | 4039 |
| 444 | Ga0207698_10149586 | 3300026142 | Bacteria | 2024 |
| 445 | Ga0207698_10166421 | 3300026142 | Bacteria | 1935 |
| 446 | Ga0207698_10180134 | 3300026142 | Bacteria | 1871 |
| 447 | Ga0209966_1059297 | 3300027695 | Unclassified | 825 |
| 448 | Ga0209813_10001619 | 3300027866 | Bacteria | 5069 |
| 449 | Ga0209813_10184247 | 3300027866 | Bacteria | 765 |
| 450 | Ga0207428_10000165 | 3300027907 | Bacteria | 91701 |
| 451 | Ga0207428_10001251 | 3300027907 | Bacteria | 27203 |
| 452 | Ga0268266_10016010 | 3300028379 | Bacteria | 6413 |
| 453 | Ga0268266_10525072 | 3300028379 | Bacteria | 1132 |
| 454 | Ga0268265_10001687 | 3300028380 | Bacteria | 18006 |
| 455 | Ga0268265_10058369 | 3300028380 | Bacteria | 2946 |
| 456 | Ga0268264_10002029 | 3300028381 | Bacteria | 18124 |
| 457 | Ga0265337_1007401 | 3300028556 | Bacteria | 4109 |
| 458 | Ga0265325_10001335 | 3300031241 | Bacteria | 17486 |
| 459 | Ga0265340_10044955 | 3300031247 | Bacteria | 2159 |
| 460 | Ga0265340_10109002 | 3300031247 | Bacteria | 1281 |
| 461 | Ga0265331_10174125 | 3300031250 | Bacteria | 973 |
| 462 | Ga0307408_100255695 | 3300031548 | Bacteria | 1447 |
| 463 | Ga0265313_10000794 | 3300031595 | Bacteria | 31959 |
| 464 | Ga0265313_10014122 | 3300031595 | Bacteria | 4743 |
| 465 | Ga0265313_10025244 | 3300031595 | Bacteria | 3155 |
| 466 | Ga0265314_10015576 | 3300031711 | Bacteria | 6028 |
| 467 | Ga0265314_10090124 | 3300031711 | Bacteria | 1998 |
| 468 | Ga0265342_10000502 | 3300031712 | Bacteria | 41908 |
| 469 | Ga0265342_10160990 | 3300031712 | Bacteria | 1240 |
| 470 | Ga0307405_10275416 | 3300031731 | Bacteria | 1264 |
| 471 | Ga0307407_10263141 | 3300031903 | Bacteria | 1187 |
| 472 | Ga0307409_101140086 | 3300031995 | Bacteria | 802 |
| 473 | Ga0307416_100636320 | 3300032002 | Bacteria | 1150 |
| 474 | Ga0373948_0009967 | 3300034817 | Bacteria | 1649 |
| 475 | Ga0373950_0014085 | 3300034818 | Bacteria | 1342 |
| 476 | Ga0373950_0028790 | 3300034818 | Bacteria | 1020 |
| 477 | Ga0373938_0094212 | 3300034957 | Bacteria | 744 |
| 478 | Ga0373926_0003377 | 3300035083 | Bacteria | 5142 |
| 479 | Ga0373929_0000596 | 3300035085 | Bacteria | 6986 |
| 480 | Ga0373934_0090144 | 3300035086 | Bacteria | 1236 |
| 481 | Ga0373940_0096972 | 3300035088 | Bacteria | 891 |
| 482 | Ga0373944_0002920 | 3300035089 | Bacteria | 4390 |
| 483 | Ga0373949_0002185 | 3300035090 | Bacteria | 5118 |
| 484 | Ga0373949_0060919 | 3300035090 | Unclassified | 971 |
| 485 | Ga0373923_0001084 | 3300035111 | Bacteria | 7486 |
| 486 | Ga0373923_0011523 | 3300035111 | Bacteria | 3245 |
| 487 | Ga0373923_0217969 | 3300035111 | Bacteria | 886 |
| 488 | Ga0373932_0000763 | 3300035112 | Bacteria | 9537 |
| 489 | Ga0373932_0002786 | 3300035112 | Bacteria | 4339 |
| 490 | Ga0373936_0002079 | 3300035113 | Bacteria | 7426 |
| 491 | Ga0373939_0039401 | 3300035114 | Bacteria | 1414 |
| 492 | Ga0373941_0002411 | 3300035115 | Bacteria | 4111 |
| 493 | Ga0373941_0020841 | 3300035115 | Bacteria | 1842 |
| 494 | Ga0373941_0075895 | 3300035115 | Bacteria | 1126 |
| 495 | Ga0373945_0037427 | 3300035116 | Bacteria | 1741 |
| 496 | Ga0373953_0004398 | 3300035117 | Bacteria | 4490 |
| 497 | Ga0373953_0007220 | 3300035117 | Bacteria | 3710 |
| 498 | Ga0373953_0024252 | 3300035117 | Bacteria | 2305 |
| 499 | Ga0373953_0220635 | 3300035117 | Bacteria | 821 |
| 500 | Ga0373954_0021988 | 3300035118 | Bacteria | 2891 |
| 501 | Ga0373956_0145579 | 3300035119 | Bacteria | 1114 |
| 502 | Ga0373957_0001408 | 3300035120 | Bacteria | 6499 |
| 503 | Ga0373957_0010178 | 3300035120 | Bacteria | 3101 |
| 504 | Ga0373957_0077481 | 3300035120 | Bacteria | 1308 |
| 505 | Ga0373957_0106990 | 3300035120 | Bacteria | 1124 |
| 506 | Ga0373957_0129719 | 3300035120 | Bacteria | 1026 |
| 507 | Ga0373943_0100741 | 3300035170 | Bacteria | 1510 |
| 508 | Ga0373946_0000794 | 3300035171 | Bacteria | 10763 |
| 509 | Ga0373946_0016354 | 3300035171 | Bacteria | 2825 |
| 510 | Ga0373955_0001974 | 3300035172 | Bacteria | 8836 |
| 511 | Ga0373955_0003538 | 3300035172 | Bacteria | 6874 |
| 512 | Ga0373955_0371639 | 3300035172 | Bacteria | 867 |
| 513 | Ga0373942_0032731 | 3300035207 | Bacteria | 1382 |
| 514 | Ga0373961_0045249 | 3300035241 | Bacteria | 1287 |
| 515 | Ga0373961_0064737 | 3300035241 | Bacteria | 1118 |
| 516 | Ga0373961_0230357 | 3300035241 | Unclassified | 664 |
| 517 | Ga0373962_0000149 | 3300035242 | Bacteria | 14459 |
| 518 | Ga0373924_0013418 | 3300035410 | Bacteria | 3079 |
| 519 | Ga0373931_0004026 | 3300035691 | Bacteria | 6658 |
| 520 | Ga0373931_0030856 | 3300035691 | Bacteria | 2762 |
| 521 | Ga0373931_0036616 | 3300035691 | Bacteria | 2558 |
| 522 | Ga0373935_0003725 | 3300035692 | Bacteria | 8896 |
| 523 | Ga0373935_0025955 | 3300035692 | Bacteria | 3612 |
| 524 | Ga0373935_0100099 | 3300035692 | Bacteria | 1909 |
| 525 | Ga0373935_0135525 | 3300035692 | Bacteria | 1658 |
| 526 | Ga0373927_0035622 | 3300035695 | Bacteria | 3236 |
| 527 | Ga0373927_0207293 | 3300035695 | Bacteria | 1287 |
| 528 | Ga0373933_0003823 | 3300035724 | Bacteria | 8326 |
| 529 | Ga0373933_0128891 | 3300035724 | Bacteria | 1589 |
| 530 | Ga0373933_0140477 | 3300035724 | Bacteria | 1525 |
| 531 | Ga0373947_0001544 | 3300035725 | Bacteria | 14129 |
| 532 | Ga0373947_0024502 | 3300035725 | Bacteria | 3516 |
| 533 | Ga0373947_0102957 | 3300035725 | Bacteria | 1796 |
| 534 | Ga0373947_0116879 | 3300035725 | Bacteria | 1691 |
| 535 | Ga0373937_0001830 | 3300036401 | Bacteria | 17860 |
| 536 | Ga0373937_0007531 | 3300036401 | Bacteria | 9425 |
| 537 | Ga0373937_0009014 | 3300036401 | Bacteria | 8660 |
| 538 | Ga0373937_0024275 | 3300036401 | Bacteria | 5466 |
| 539 | Ga0373937_0293475 | 3300036401 | Bacteria | 1536 |
| 540 | Ga0373937_0588535 | 3300036401 | Bacteria | 1056 |
| 541 | Ga0373937_1165571 | 3300036401 | Bacteria | 719 |
| 542 | Ga0373925_0004912 | 3300037068 | Bacteria | 10054 |
| 543 | Ga0373925_0077311 | 3300037068 | Bacteria | 2525 |
| 544 | Ga0395900_0001539 | 3300037418 | Bacteria | 27389 |
| 545 | Ga0395900_0008197 | 3300037418 | Bacteria | 10753 |
| 546 | Ga0395900_0347092 | 3300037418 | Bacteria | 1458 |
| 547 | Ga0395898_0024475 | 3300037466 | Bacteria | 6090 |
| 548 | Ga0395898_0073723 | 3300037466 | Bacteria | 3297 |
| 549 | Ga0395898_0111152 | 3300037466 | Bacteria | 2626 |
| 550 | Ga0395901_0017251 | 3300038443 | Bacteria | 7368 |
| 551 | Ga0395901_0205285 | 3300038443 | Bacteria | 2065 |
| 552 | Ga0395901_0492157 | 3300038443 | Bacteria | 1249 |
| 553 | Ga0395901_0699406 | 3300038443 | Bacteria | 1011 |
| 554 | Ga0395901_0845343 | 3300038443 | Bacteria | 901 |
| 555 | Ga0436365_0197525 | 3300039437 | Bacteria | 2203 |
| 556 | Ga0436365_0910431 | 3300039437 | Bacteria | 1523 |
| 557 | Ga0439448_0139987 | 3300042005 | Bacteria | 837 |
| 558 | Ga0439448_0172487 | 3300042005 | Unclassified | 755 |
| 559 | Ga0439463_039328 | 3300042016 | Bacteria | 1201 |
| 560 | Ga0466966_0564115 | 3300044684 | Bacteria | 685 |
| 561 | Ga0466961_0356676 | 3300044693 | Bacteria | 890 |
| 562 | Ga0466963_0075106 | 3300044694 | Bacteria | 2280 |
| 563 | Ga0466963_0161557 | 3300044694 | Bacteria | 1559 |
| 564 | Ga0466971_0079758 | 3300044719 | Bacteria | 1492 |
| 565 | Ga0466957_0052705 | 3300044842 | Bacteria | 2478 |
| 566 | Ga0466957_0441155 | 3300044842 | Bacteria | 896 |
| 567 | Ga0466959_0419787 | 3300045049 | Bacteria | 908 |
| 568 | Ga0466958_0090675 | 3300045836 | Bacteria | 1892 |
| 569 | Ga0466967_0007437 | 3300045976 | Bacteria | 7900 |
| 570 | Ga0466967_0544427 | 3300045976 | Bacteria | 1142 |
| 571 | Ga0495627_059622 | 3300046453 | Bacteria | 1132 |
| 572 | Ga0495592_0002092 | 3300046454 | Bacteria | 14074 |
| 573 | Ga0495592_0002638 | 3300046454 | Bacteria | 12675 |
| 574 | Ga0495592_0010694 | 3300046454 | Bacteria | 6919 |
| 575 | Ga0495603_0006676 | 3300046455 | Bacteria | 6923 |
| 576 | Ga0495603_0036586 | 3300046455 | Bacteria | 2947 |
| 577 | Ga0495629_0000908 | 3300046459 | Bacteria | 23774 |
| 578 | Ga0495629_0230211 | 3300046459 | Bacteria | 1277 |
| 579 | Ga0495641_0013745 | 3300046461 | Bacteria | 4424 |
| 580 | Ga0495641_0017916 | 3300046461 | Bacteria | 3670 |
| 581 | Ga0495651_0008043 | 3300046462 | Bacteria | 8085 |
| 582 | Ga0495651_0023214 | 3300046462 | Bacteria | 4824 |
| 583 | Ga0495651_0046872 | 3300046462 | Bacteria | 3344 |
| 584 | Ga0495653_0026709 | 3300046463 | Bacteria | 4627 |
| 585 | Ga0495653_0039786 | 3300046463 | Bacteria | 3680 |
| 586 | Ga0495653_0127908 | 3300046463 | Bacteria | 1802 |
| 587 | Ga0495580_0046387 | 3300046472 | Bacteria | 3083 |
| 588 | Ga0495580_0351202 | 3300046472 | Bacteria | 999 |
| 589 | Ga0495582_0007835 | 3300046473 | Bacteria | 5902 |
| 590 | Ga0495582_0198100 | 3300046473 | Bacteria | 1146 |
| 591 | Ga0495639_0022182 | 3300046475 | Bacteria | 2783 |
| 592 | Ga0495639_0218075 | 3300046475 | Bacteria | 937 |
| 593 | Ga0495662_0002314 | 3300046476 | Bacteria | 9607 |
| 594 | Ga0495664_0022985 | 3300046477 | Bacteria | 3615 |
| 595 | Ga0495664_0049096 | 3300046477 | Bacteria | 2505 |
| 596 | Ga0495664_0050039 | 3300046477 | Bacteria | 2480 |
| 597 | Ga0495664_0069188 | 3300046477 | Bacteria | 2107 |
| 598 | Ga0495585_0004760 | 3300046492 | Bacteria | 8737 |
| 599 | Ga0495594_0009558 | 3300046499 | Bacteria | 5013 |
| 600 | Ga0495608_0010237 | 3300046511 | Bacteria | 6544 |
| 601 | Ga0495608_0025637 | 3300046511 | Bacteria | 4025 |
| 602 | Ga0495608_0089899 | 3300046511 | Bacteria | 1987 |
| 603 | Ga0495618_0061261 | 3300046514 | Bacteria | 2386 |
| 604 | Ga0495628_0000115 | 3300046516 | Bacteria | 65159 |
| 605 | Ga0495628_0016357 | 3300046516 | Bacteria | 6189 |
| 606 | Ga0495628_0064058 | 3300046516 | Bacteria | 2878 |
| 607 | Ga0495628_0327182 | 3300046516 | Bacteria | 1130 |
| 608 | Ga0495630_0017488 | 3300046517 | Bacteria | 5253 |
| 609 | Ga0495644_0000983 | 3300046523 | Bacteria | 11834 |
| 610 | Ga0495666_0035219 | 3300046526 | Bacteria | 2441 |
| 611 | Ga0495652_0007929 | 3300046529 | Bacteria | 9747 |
| 612 | Ga0495652_0027254 | 3300046529 | Bacteria | 5036 |
| 613 | Ga0495652_0335797 | 3300046529 | Bacteria | 1087 |
| 614 | Ga0495652_0511103 | 3300046529 | Bacteria | 831 |
| 615 | Ga0495665_0010075 | 3300046531 | Bacteria | 5121 |
| 616 | Ga0495665_0223525 | 3300046531 | Bacteria | 973 |
| 617 | Ga0495640_0021892 | 3300046533 | Bacteria | 4682 |
| 618 | Ga0495640_0222347 | 3300046533 | Bacteria | 1190 |
| 619 | Ga0495586_0016534 | 3300046535 | Bacteria | 3925 |
| 620 | Ga0495587_0006245 | 3300046536 | Bacteria | 7779 |
| 621 | Ga0495587_0025876 | 3300046536 | Bacteria | 3582 |
| 622 | Ga0495645_0010751 | 3300046543 | Bacteria | 6431 |
| 623 | Ga0495645_0040599 | 3300046543 | Bacteria | 3394 |
| 624 | Ga0495645_0242017 | 3300046543 | Bacteria | 1203 |
| 625 | Ga0495622_0003333 | 3300046557 | Bacteria | 7587 |
| 626 | Ga0495633_0008234 | 3300046558 | Bacteria | 5898 |
| 627 | Ga0495667_0000674 | 3300046559 | Bacteria | 21859 |
| 628 | Ga0495667_0003600 | 3300046559 | Bacteria | 10422 |
| 629 | Ga0495667_0004340 | 3300046559 | Bacteria | 9572 |
| 630 | Ga0495667_0024150 | 3300046559 | Bacteria | 4094 |
| 631 | Ga0495667_0202007 | 3300046559 | Bacteria | 1272 |
| 632 | Ga0495656_0000789 | 3300046615 | Bacteria | 10214 |
| 633 | Ga0495668_0030913 | 3300046616 | Bacteria | 3019 |
| 634 | Ga0495634_0048425 | 3300046642 | Bacteria | 2861 |
| 635 | Ga0495634_0556800 | 3300046642 | Bacteria | 668 |
| 636 | Ga0495635_0002598 | 3300046663 | Bacteria | 12359 |
| 637 | Ga0495635_0009000 | 3300046663 | Bacteria | 6965 |
| 638 | Ga0495635_0088484 | 3300046663 | Bacteria | 2119 |
| 639 | Ga0495588_0056271 | 3300046674 | Bacteria | 2030 |
| 640 | Ga0495588_0253592 | 3300046674 | Unclassified | 927 |
| 641 | Ga0495657_0011216 | 3300046675 | Bacteria | 6713 |
| 642 | Ga0495657_0025756 | 3300046675 | Bacteria | 4174 |
| 643 | Ga0495657_0249931 | 3300046675 | Bacteria | 1068 |
| 644 | Ga0495599_0007173 | 3300046678 | Bacteria | 6749 |
| 645 | Ga0495599_0076743 | 3300046678 | Bacteria | 2086 |
| 646 | Ga0495623_0002539 | 3300046679 | Bacteria | 12066 |
| 647 | Ga0495623_0156511 | 3300046679 | Bacteria | 1343 |
| 648 | Ga0495646_0002845 | 3300046680 | Bacteria | 10710 |
| 649 | Ga0495646_0006467 | 3300046680 | Bacteria | 7435 |
| 650 | Ga0495647_0004015 | 3300046681 | Bacteria | 4746 |
| 651 | Ga0495647_0052362 | 3300046681 | Bacteria | 1589 |
| 652 | Ga0495658_0000673 | 3300046683 | Bacteria | 18551 |
| 653 | Ga0495658_0008094 | 3300046683 | Bacteria | 5204 |
| 654 | Ga0495658_0476925 | 3300046683 | Bacteria | 797 |
| 655 | Ga0495613_0014051 | 3300046689 | Bacteria | 5941 |
| 656 | Ga0495613_0081632 | 3300046689 | Bacteria | 2348 |
| 657 | Ga0495613_0172715 | 3300046689 | Bacteria | 1533 |
| 658 | Ga0495624_0004039 | 3300046690 | Bacteria | 10793 |
| 659 | Ga0495624_0016763 | 3300046690 | Bacteria | 4930 |
| 660 | Ga0495670_0000479 | 3300046691 | Bacteria | 18937 |
| 661 | Ga0495600_0000876 | 3300046809 | Bacteria | 16075 |
| 662 | Ga0495600_0023738 | 3300046809 | Bacteria | 3945 |
| 663 | Ga0495600_0117715 | 3300046809 | Bacteria | 1729 |
| 664 | Ga0495600_0176759 | 3300046809 | Bacteria | 1376 |
| 665 | Ga0495600_0608250 | 3300046809 | Unclassified | 663 |
| 666 | Ga0495581_0006390 | 3300047315 | Bacteria | 6837 |
| 667 | Ga0495581_0246275 | 3300047315 | Bacteria | 1045 |
| 668 | Ga0495604_0001990 | 3300047317 | Bacteria | 16501 |
| 669 | Ga0495604_0011545 | 3300047317 | Bacteria | 7020 |
| 670 | Ga0495604_0034521 | 3300047317 | Bacteria | 4001 |
| 671 | Ga0495604_0042890 | 3300047317 | Bacteria | 3544 |
| 672 | Ga0495674_0058181 | 3300047319 | Bacteria | 3380 |
| 673 | Ga0495674_0086291 | 3300047319 | Bacteria | 2687 |
| 674 | Ga0495676_0096041 | 3300047321 | Bacteria | 2204 |
| 675 | Ga0495676_0589490 | 3300047321 | Unclassified | 724 |
| 676 | Ga0495680_0002967 | 3300047322 | Bacteria | 16971 |
| 677 | Ga0495680_0012672 | 3300047322 | Bacteria | 7404 |
| 678 | Ga0495680_0067212 | 3300047322 | Bacteria | 2741 |
| 679 | Ga0495680_0388493 | 3300047322 | Bacteria | 965 |
| 680 | Ga0495675_0004560 | 3300047444 | Bacteria | 8399 |
| 681 | Ga0495677_0147721 | 3300047445 | Bacteria | 904 |
| 682 | Ga0495684_0003464 | 3300047471 | Bacteria | 12344 |
| 683 | Ga0495684_0062460 | 3300047471 | Bacteria | 2833 |
| 684 | Ga0495684_0104043 | 3300047471 | Bacteria | 2146 |
| 685 | Ga0495593_0003537 | 3300047673 | Bacteria | 9347 |
| 686 | Ga0495593_0013225 | 3300047673 | Bacteria | 4710 |
| 687 | Ga0495602_0003665 | 3300048088 | Bacteria | 15920 |
| 688 | Ga0495602_0004959 | 3300048088 | Bacteria | 13949 |
| 689 | Ga0495602_0467081 | 3300048088 | Bacteria | 888 |
| 690 | Ga0495614_0017736 | 3300048089 | Bacteria | 3090 |
| 691 | Ga0496100_0004411 | 3300048903 | Bacteria | 7456 |
| 692 | Ga0496100_0006203 | 3300048903 | Bacteria | 6501 |
| 693 | Ga0496100_0686985 | 3300048903 | Bacteria | 798 |
| 694 | Ga0496101_0000464 | 3300048904 | Bacteria | 25674 |
| 695 | Ga0496101_0009586 | 3300048904 | Bacteria | 6368 |
| 696 | Ga0496101_0011897 | 3300048904 | Bacteria | 5794 |
| 697 | Ga0496102_0001120 | 3300048905 | Bacteria | 24582 |
| 698 | Ga0496102_0070158 | 3300048905 | Bacteria | 3217 |
| 699 | Ga0496102_0103831 | 3300048905 | Bacteria | 2643 |
| 700 | Ga0496102_0190383 | 3300048905 | Bacteria | 1933 |
| 701 | Ga0496103_0000611 | 3300048906 | Bacteria | 27883 |
| 702 | Ga0496103_0354485 | 3300048906 | Bacteria | 943 |
| 703 | Ga0496104_0000299 | 3300048907 | Bacteria | 43965 |
| 704 | Ga0496104_0062993 | 3300048907 | Bacteria | 3516 |
| 705 | Ga0496104_0172417 | 3300048907 | Bacteria | 2074 |
| 706 | Ga0496104_0292657 | 3300048907 | Bacteria | 1541 |
| 707 | Ga0496104_0381274 | 3300048907 | Bacteria | 1322 |
| 708 | Ga0496104_0510295 | 3300048907 | Bacteria | 1113 |
| 709 | Ga0496105_0001270 | 3300048908 | Bacteria | 17643 |
| 710 | Ga0496105_0127114 | 3300048908 | Bacteria | 2101 |
| 711 | Ga0496105_0631148 | 3300048908 | Bacteria | 828 |
| 712 | Ga0496105_0682173 | 3300048908 | Bacteria | 790 |
| 713 | Ga0496106_0000541 | 3300048909 | Bacteria | 26824 |
| 714 | Ga0496106_0020520 | 3300048909 | Bacteria | 4904 |
| 715 | Ga0496106_0028919 | 3300048909 | Bacteria | 4130 |
| 716 | Ga0496106_0176585 | 3300048909 | Bacteria | 1694 |
| 717 | Ga0496107_0001684 | 3300048910 | Bacteria | 13835 |
| 718 | Ga0496107_0013772 | 3300048910 | Bacteria | 5655 |
| 719 | Ga0496107_0092543 | 3300048910 | Bacteria | 2210 |
| 720 | Ga0496107_0174072 | 3300048910 | Bacteria | 1597 |
| 721 | Ga0496107_0180927 | 3300048910 | Bacteria | 1565 |
| 722 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 723 | Ga0496108_0111444 | 3300048911 | Bacteria | 2340 |
| 724 | Ga0496108_0187033 | 3300048911 | Bacteria | 1794 |
| 725 | Ga0496108_0189039 | 3300048911 | Bacteria | 1784 |
| 726 | Ga0496109_0000696 | 3300048912 | Bacteria | 27921 |
| 727 | Ga0496109_0000977 | 3300048912 | Bacteria | 23646 |
| 728 | Ga0496109_0187871 | 3300048912 | Bacteria | 1941 |
| 729 | Ga0496109_0194713 | 3300048912 | Bacteria | 1905 |
| 730 | Ga0496109_0480097 | 3300048912 | Bacteria | 1173 |
| 731 | Ga0496109_0527287 | 3300048912 | Bacteria | 1114 |
| 732 | Ga0496110_0046716 | 3300048913 | Bacteria | 3788 |
| 733 | Ga0496110_0120100 | 3300048913 | Bacteria | 2367 |
| 734 | Ga0496110_0219369 | 3300048913 | Bacteria | 1729 |
| 735 | Ga0496111_0011837 | 3300048914 | Bacteria | 5890 |
| 736 | Ga0496111_0462631 | 3300048914 | Bacteria | 935 |
| 737 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 738 | Ga0496112_0015661 | 3300048915 | Bacteria | 7081 |
| 739 | Ga0496112_0165902 | 3300048915 | Bacteria | 2174 |
| 740 | Ga0496112_0429242 | 3300048915 | Bacteria | 1260 |
| 741 | Ga0496113_0029056 | 3300048916 | Bacteria | 3986 |
| 742 | Ga0496114_0014713 | 3300048917 | Bacteria | 6287 |
| 743 | Ga0496114_0020001 | 3300048917 | Bacteria | 5430 |
| 744 | Ga0496114_0249352 | 3300048917 | Bacteria | 1562 |
| 745 | Ga0496115_0012499 | 3300048918 | Bacteria | 6391 |
| 746 | Ga0496115_0041394 | 3300048918 | Bacteria | 3667 |
| 747 | Ga0496115_0088266 | 3300048918 | Bacteria | 2531 |
| 748 | Ga0496115_0192589 | 3300048918 | Bacteria | 1684 |
| 749 | Ga0496115_0214971 | 3300048918 | Bacteria | 1587 |
| 750 | Ga0496115_0500917 | 3300048918 | Bacteria | 976 |
| 751 | Ga0496125_0340828 | 3300048928 | Unclassified | 899 |
| 752 | Ga0501031_0132204 | 3300049568 | Bacteria | 1630 |
| 753 | Ga0501032_0013787 | 3300049569 | Bacteria | 5735 |
| 754 | Ga0501032_0016304 | 3300049569 | Bacteria | 5228 |
| 755 | Ga0501032_0042076 | 3300049569 | Bacteria | 3100 |
| 756 | Ga0501032_0082027 | 3300049569 | Bacteria | 2145 |
| 757 | Ga0501033_0064262 | 3300049570 | Bacteria | 2701 |
| 758 | Ga0501033_0066788 | 3300049570 | Bacteria | 2644 |
| 759 | Ga0501033_0371647 | 3300049570 | Bacteria | 999 |
| 760 | Ga0501033_0591870 | 3300049570 | Bacteria | 761 |
| 761 | Ga0501034_0000229 | 3300049571 | Bacteria | 105030 |
| 762 | Ga0501034_0013020 | 3300049571 | Bacteria | 8573 |
| 763 | Ga0501034_0032378 | 3300049571 | Bacteria | 5310 |
| 764 | Ga0501034_0059044 | 3300049571 | Bacteria | 3853 |
| 765 | Ga0501034_0070747 | 3300049571 | Bacteria | 3499 |
| 766 | Ga0501034_0121920 | 3300049571 | Bacteria | 2593 |
| 767 | Ga0501034_0222208 | 3300049571 | Bacteria | 1841 |
| 768 | Ga0501034_0243108 | 3300049571 | Bacteria | 1745 |
| 769 | Ga0501034_0399864 | 3300049571 | Bacteria | 1296 |
| 770 | Ga0501034_0419237 | 3300049571 | Bacteria | 1260 |
| 771 | Ga0501036_0001657 | 3300049572 | Bacteria | 17249 |
| 772 | Ga0501036_0015136 | 3300049572 | Bacteria | 6441 |
| 773 | Ga0501036_0097906 | 3300049572 | Bacteria | 2479 |
| 774 | Ga0501036_0435262 | 3300049572 | Bacteria | 1093 |
| 775 | Ga0501037_0005935 | 3300049573 | Bacteria | 8917 |
| 776 | Ga0501037_0018906 | 3300049573 | Bacteria | 5078 |
| 777 | Ga0501037_0122082 | 3300049573 | Bacteria | 1872 |
| 778 | Ga0501038_0013215 | 3300049574 | Bacteria | 7529 |
| 779 | Ga0501038_0151456 | 3300049574 | Bacteria | 1890 |
| 780 | Ga0501038_0352757 | 3300049574 | Bacteria | 1145 |
| 781 | Ga0501039_0009233 | 3300049575 | Bacteria | 7515 |
| 782 | Ga0501039_0041434 | 3300049575 | Bacteria | 3557 |
| 783 | Ga0501040_0666518 | 3300049576 | Bacteria | 752 |
| 784 | Ga0501041_0062732 | 3300049577 | Bacteria | 2276 |
| 785 | Ga0501041_0645122 | 3300049577 | Bacteria | 677 |
| 786 | Ga0501041_0690995 | 3300049577 | Bacteria | 653 |
| 787 | Ga0501042_0093056 | 3300049578 | Bacteria | 2165 |
| 788 | Ga0501042_0336662 | 3300049578 | Bacteria | 1091 |
| 789 | Ga0501043_0002225 | 3300049579 | Bacteria | 16540 |
| 790 | Ga0501043_0007079 | 3300049579 | Bacteria | 8927 |
| 791 | Ga0501043_0011946 | 3300049579 | Bacteria | 6794 |
| 792 | Ga0501043_0339742 | 3300049579 | Bacteria | 1142 |
| 793 | Ga0501046_0015198 | 3300049580 | Bacteria | 6473 |
| 794 | Ga0501046_0015379 | 3300049580 | Bacteria | 6432 |
| 795 | Ga0501046_0083680 | 3300049580 | Bacteria | 2462 |
| 796 | Ga0501046_0116620 | 3300049580 | Bacteria | 2035 |
| 797 | Ga0501046_0284946 | 3300049580 | Bacteria | 1209 |
| 798 | Ga0501047_0000314 | 3300049581 | Bacteria | 55906 |
| 799 | Ga0501047_0020621 | 3300049581 | Bacteria | 6329 |
| 800 | Ga0501047_0078071 | 3300049581 | Bacteria | 3184 |
| 801 | Ga0501047_0078943 | 3300049581 | Bacteria | 3165 |
| 802 | Ga0501047_0639787 | 3300049581 | Bacteria | 883 |
| 803 | Ga0501048_0002000 | 3300049582 | Bacteria | 15488 |
| 804 | Ga0501048_0066703 | 3300049582 | Bacteria | 2544 |
| 805 | Ga0501048_0685812 | 3300049582 | Bacteria | 735 |
| 806 | Ga0501067_0016018 | 3300049583 | Bacteria | 4146 |
| 807 | Ga0501067_0163639 | 3300049583 | Unclassified | 1239 |
| 808 | Ga0501067_0204963 | 3300049583 | Bacteria | 1098 |
| 809 | Ga0501068_0021225 | 3300049584 | Bacteria | 3791 |
| 810 | Ga0501068_0223643 | 3300049584 | Bacteria | 1196 |
| 811 | Ga0501069_0020383 | 3300049585 | Bacteria | 3592 |
| 812 | Ga0501069_0124614 | 3300049585 | Bacteria | 1473 |
| 813 | Ga0501069_0164709 | 3300049585 | Bacteria | 1277 |
| 814 | Ga0501069_0265866 | 3300049585 | Bacteria | 1002 |
| 815 | Ga0501070_0007677 | 3300049586 | Bacteria | 9150 |
| 816 | Ga0501070_0021163 | 3300049586 | Bacteria | 5458 |
| 817 | Ga0501070_0036638 | 3300049586 | Bacteria | 4096 |
| 818 | Ga0501070_0068451 | 3300049586 | Bacteria | 2939 |
| 819 | Ga0501070_0078829 | 3300049586 | Bacteria | 2725 |
| 820 | Ga0501070_0121095 | 3300049586 | Bacteria | 2162 |
| 821 | Ga0501070_0175488 | 3300049586 | Bacteria | 1764 |
| 822 | Ga0501070_0556253 | 3300049586 | Bacteria | 918 |
| 823 | Ga0501071_0137072 | 3300049587 | Bacteria | 1821 |
| 824 | Ga0501071_0385393 | 3300049587 | Bacteria | 1069 |
| 825 | Ga0501071_0583521 | 3300049587 | Bacteria | 859 |
| 826 | Ga0501072_0045302 | 3300049588 | Bacteria | 3458 |
| 827 | Ga0501072_0222722 | 3300049588 | Bacteria | 1503 |
| 828 | Ga0501072_0260323 | 3300049588 | Bacteria | 1381 |
| 829 | Ga0501072_0509623 | 3300049588 | Bacteria | 951 |
| 830 | Ga0501073_0007118 | 3300049589 | Bacteria | 8331 |
| 831 | Ga0501073_0032059 | 3300049589 | Bacteria | 3748 |
| 832 | Ga0501073_0033635 | 3300049589 | Bacteria | 3649 |
| 833 | Ga0501073_0356355 | 3300049589 | Bacteria | 1010 |
| 834 | Ga0501074_0012343 | 3300049590 | Bacteria | 6210 |
| 835 | Ga0501074_0015285 | 3300049590 | Bacteria | 5578 |
| 836 | Ga0501074_0036703 | 3300049590 | Bacteria | 3549 |
| 837 | Ga0501074_0051749 | 3300049590 | Bacteria | 2964 |
| 838 | Ga0501074_0097631 | 3300049590 | Bacteria | 2103 |
| 839 | Ga0501075_0168132 | 3300049591 | Bacteria | 1673 |
| 840 | Ga0501076_0117848 | 3300049592 | Bacteria | 2149 |
| 841 | Ga0501076_0249678 | 3300049592 | Bacteria | 1452 |
| 842 | Ga0501076_0337725 | 3300049592 | Bacteria | 1236 |
| 843 | Ga0501077_0156958 | 3300049593 | Bacteria | 1444 |
| 844 | Ga0501077_0161794 | 3300049593 | Bacteria | 1421 |
| 845 | Ga0501079_0023277 | 3300049741 | Bacteria | 4755 |
| 846 | Ga0501079_0184882 | 3300049741 | Bacteria | 1627 |
| 847 | Ga0501079_0320540 | 3300049741 | Bacteria | 1213 |
| 848 | Ga0501079_0361069 | 3300049741 | Bacteria | 1138 |
| 849 | Ga0501080_0005419 | 3300049742 | Bacteria | 11382 |
| 850 | Ga0501080_0048972 | 3300049742 | Bacteria | 3932 |
| 851 | Ga0501080_0214905 | 3300049742 | Bacteria | 1761 |
| 852 | Ga0501080_0276721 | 3300049742 | Bacteria | 1527 |
| 853 | Ga0501080_0282549 | 3300049742 | Bacteria | 1508 |
| 854 | Ga0501081_0098757 | 3300049743 | Bacteria | 2062 |
| 855 | Ga0501083_0001743 | 3300049744 | Bacteria | 14830 |
| 856 | Ga0501083_0090411 | 3300049744 | Bacteria | 2022 |
| 857 | Ga0501083_0240287 | 3300049744 | Bacteria | 1179 |
| 858 | Ga0501083_0260794 | 3300049744 | Bacteria | 1127 |
| 859 | Ga0501035_0012411 | 3300049822 | Bacteria | 7875 |
| 860 | Ga0501035_0221399 | 3300049822 | Bacteria | 1616 |
| 861 | Ga0501035_0319539 | 3300049822 | Bacteria | 1304 |
| 862 | Ga0501035_0343266 | 3300049822 | Bacteria | 1251 |
| 863 | Ga0501035_0373755 | 3300049822 | Bacteria | 1189 |
| 864 | Ga0501044_0026016 | 3300049823 | Bacteria | 6198 |
| 865 | Ga0501044_0029583 | 3300049823 | Bacteria | 5774 |
| 866 | Ga0501044_0030329 | 3300049823 | Bacteria | 5700 |
| 867 | Ga0501044_0042476 | 3300049823 | Bacteria | 4728 |
| 868 | Ga0501044_0075111 | 3300049823 | Bacteria | 3432 |
| 869 | Ga0501044_0168287 | 3300049823 | Bacteria | 2164 |
| 870 | Ga0501044_0243311 | 3300049823 | Bacteria | 1742 |
| 871 | Ga0501044_0291385 | 3300049823 | Bacteria | 1563 |
| 872 | Ga0501044_0517374 | 3300049823 | Bacteria | 1093 |
| 873 | Ga0501044_0948085 | 3300049823 | Bacteria | 734 |
| 874 | Ga0501045_0123442 | 3300049824 | Bacteria | 1923 |
| 875 | nmdc:mga03n38_453050_c1 | 3300050490 | Bacteria | 714 |
| 876 | nmdc:mga03n38_8356_c1 | 3300050490 | Bacteria | 3713 |
| 877 | nmdc:mga03n38_92874_c1 | 3300050490 | Bacteria | 1440 |
| 878 | nmdc:mga00v17_2703_c1 | 3300050491 | Bacteria | 9099 |
| 879 | nmdc:mga00v17_481408_c1 | 3300050491 | Bacteria | 805 |
| 880 | nmdc:mga0yw44_147276_c1 | 3300050492 | Bacteria | 1534 |
| 881 | nmdc:mga0yw44_2990_c1 | 3300050492 | Bacteria | 7376 |
| 882 | nmdc:mga0yw44_39217_c1 | 3300050492 | Bacteria | 2807 |
| 883 | nmdc:mga06z11_11933_c1 | 3300050494 | Bacteria | 3764 |
| 884 | nmdc:mga06z11_124640_c1 | 3300050494 | Bacteria | 1440 |
| 885 | nmdc:mga06z11_13594_c1 | 3300050494 | Bacteria | 3581 |
| 886 | nmdc:mga06z11_542205_c1 | 3300050494 | Bacteria | 706 |
| 887 | nmdc:mga06z11_813_c1 | 3300050494 | Bacteria | 11419 |
| 888 | nmdc:mga06z11_8820_c1 | 3300050494 | Bacteria | 4224 |
| 889 | nmdc:mga04h51_1434_c1 | 3300050495 | Bacteria | 5521 |
| 890 | nmdc:mga04h51_1837_c1 | 3300050495 | Bacteria | 4964 |
| 891 | nmdc:mga04h51_210397_c1 | 3300050495 | Bacteria | 767 |
| 892 | nmdc:mga04h51_35394_c1 | 3300050495 | Bacteria | 1600 |
| 893 | nmdc:mga05p37_177673_c1 | 3300050507 | Bacteria | 2593 |
| 894 | nmdc:mga05p37_2697_c1 | 3300050507 | Bacteria | 19225 |
| 895 | nmdc:mga05p37_490392_c1 | 3300050507 | Bacteria | 1413 |
| 896 | nmdc:mga05p37_82000_c1 | 3300050507 | Bacteria | 3973 |
| 897 | nmdc:mga09592_14093_c1 | 3300050508 | Bacteria | 6526 |
| 898 | nmdc:mga09592_369726_c1 | 3300050508 | Bacteria | 1240 |
| 899 | nmdc:mga0qj67_693_c1 | 3300050509 | Bacteria | 22941 |
| 900 | nmdc:mga0qj67_9904_c1 | 3300050509 | Bacteria | 7108 |
| 901 | nmdc:mga06r32_1056_c1 | 3300050510 | Bacteria | 24895 |
| 902 | nmdc:mga06r32_11208_c1 | 3300050510 | Bacteria | 8076 |
| 903 | nmdc:mga06r32_3021_c1 | 3300050510 | Bacteria | 15083 |
| 904 | nmdc:mga08y16_3846_c1 | 3300050511 | Bacteria | 15611 |
| 905 | nmdc:mga08y16_86942_c1 | 3300050511 | Bacteria | 3257 |
| 906 | nmdc:mga0n895_1654_c1 | 3300050512 | Bacteria | 16850 |
| 907 | nmdc:mga0n895_291_c1 | 3300050512 | Bacteria | 33000 |
| 908 | nmdc:mga0n895_787849_c1 | 3300050512 | Bacteria | 942 |
| 909 | nmdc:mga0rr50_1013_c1 | 3300050513 | Bacteria | 15240 |
| 910 | nmdc:mga0rr50_479234_c1 | 3300050513 | Bacteria | 1057 |
| 911 | nmdc:mga08x19_106529_c1 | 3300050514 | Bacteria | 1865 |
| 912 | nmdc:mga08x19_136597_c1 | 3300050514 | Unclassified | 1653 |
| 913 | nmdc:mga08x19_53923_c1 | 3300050514 | Bacteria | 2587 |
| 914 | nmdc:mga0a205_151212_c1 | 3300050515 | Bacteria | 2221 |
| 915 | nmdc:mga0a205_467_c1 | 3300050515 | Bacteria | 29468 |
| 916 | nmdc:mga0a205_581998_c1 | 3300050515 | Bacteria | 973 |
| 917 | nmdc:mga0a205_6139_c1 | 3300050515 | Bacteria | 10841 |
| 918 | nmdc:mga0sz30_117808_c1 | 3300050516 | Bacteria | 1166 |
| 919 | Ga0495601_0000701 | 3300053077 | Bacteria | 17998 |
| 920 | Ga0495601_0003725 | 3300053077 | Bacteria | 8772 |
| 921 | Ga0495601_0034176 | 3300053077 | Bacteria | 3170 |
| 922 | Ga0495601_0042664 | 3300053077 | Bacteria | 2846 |
| 923 | Ga0495612_0000569 | 3300053078 | Bacteria | 14847 |
| 924 | Ga0495612_0001410 | 3300053078 | Bacteria | 9882 |
| 925 | Ga0495612_0008471 | 3300053078 | Bacteria | 4169 |
| 926 | Ga0495612_0057632 | 3300053078 | Bacteria | 1604 |
| 927 | Ga0495595_0001815 | 3300053084 | Bacteria | 8313 |
| 928 | Ga0495595_0002638 | 3300053084 | Bacteria | 7037 |
| 929 | Ga0495595_0010175 | 3300053084 | Bacteria | 3907 |
| 930 | Ga0495595_0011206 | 3300053084 | Bacteria | 3745 |
| 931 | Ga0495595_0080904 | 3300053084 | Bacteria | 1547 |
| 932 | Ga0495595_0216773 | 3300053084 | Bacteria | 955 |
| 933 | Ga0495595_0284191 | 3300053084 | Unclassified | 831 |
| 934 | Ga0495619_0000159 | 3300053085 | Bacteria | 49689 |
| 935 | Ga0495619_0000300 | 3300053085 | Bacteria | 34873 |
| 936 | Ga0495619_0004640 | 3300053085 | Bacteria | 8756 |
| 937 | Ga0495619_0008242 | 3300053085 | Bacteria | 6594 |
| 938 | Ga0495619_0009949 | 3300053085 | Bacteria | 5989 |
| 939 | Ga0500566_0331176 | 3300053094 | Bacteria | 705 |
| 940 | Ga0500593_031273 | 3300053117 | Bacteria | 2380 |
| 941 | Ga0500586_000409 | 3300053145 | Bacteria | 8597 |
| 942 | Ga0500636_0001477 | 3300053177 | Bacteria | 12758 |
| 943 | Ga0501084_0088980 | 3300054114 | Bacteria | 2592 |
| 944 | Ga0501084_0372953 | 3300054114 | Bacteria | 1206 |
| 945 | Ga0501084_0529620 | 3300054114 | Bacteria | 996 |
| 946 | Ga0501082_0040790 | 3300060353 | Bacteria | 4003 |
| 947 | Ga0501082_0125083 | 3300060353 | Bacteria | 2230 |
| 948 | Ga0501082_0234824 | 3300060353 | Bacteria | 1596 |
| 949 | Ga0501082_0247403 | 3300060353 | Bacteria | 1552 |
| 950 | Ga0501082_0275176 | 3300060353 | Bacteria | 1466 |
| 951 | Ga0501082_0404388 | 3300060353 | Bacteria | 1191 |
| 952 | Ga0530510_0250296 | 3300061734 | Bacteria | 1320 |
| 953 | Ga0530510_0404625 | 3300061734 | Bacteria | 1029 |
| 954 | Ga0466958_0176840 | |||
| 955 | JGI24032J14994_100964 | |||
| 956 | JGI24746J21847_1000620 | |||
| 957 | JGI24747J21853_1000939 | |||
| 958 | JGI24747J21853_1008755 | |||
| 959 | JGI24739J22299_10001041 | |||
| 960 | JGI24745J21846_1000131 | |||
| 961 | JGI24748J21848_1001208 | |||
| 962 | JGI24738J21930_10000571 | |||
| 963 | JGI24749J21850_1000415 | |||
| 964 | JGI24749J21850_1006197 | |||
| 965 | JGI24744J21845_10001089 | |||
| 966 | JGI24034J26672_10001679 | |||
| 967 | JGI24742J22300_10000080 | |||
| 968 | JGI25405J52794_10003705 | |||
| 969 | Ga0070658_10050265 | |||
| 970 | Ga0070676_10000128 | |||
| 971 | Ga0070676_10444281 | |||
| 972 | Ga0070683_100000289 | |||
| 973 | Ga0070683_100080750 | |||
| 974 | Ga0070683_100400166 | |||
| 975 | Ga0070690_100000935 | |||
| 976 | Ga0070690_100066908 | |||
| 977 | Ga0070670_100003173 | |||
| 978 | Ga0070677_10000043 | |||
| 979 | Ga0070666_10005381 | |||
| 980 | Ga0070666_10136061 | |||
| 981 | Ga0070680_100002347 | |||
| 982 | Ga0070680_100009986 | |||
| 983 | Ga0070680_100092243 | |||
| 984 | Ga0070680_100224788 | |||
| 985 | Ga0070680_100459248 | |||
| 986 | Ga0070680_100624880 | |||
| 987 | Ga0070682_100000528 | |||
| 988 | Ga0070682_100037063 | |||
| 989 | Ga0068868_100000408 | |||
| 990 | Ga0068868_100133583 | |||
| 991 | Ga0070660_100010085 | |||
| 992 | Ga0070660_100011422 | |||
| 993 | Ga0070689_100000819 | |||
| 994 | Ga0070689_100039120 | |||
| 995 | Ga0070691_10015622 | |||
| 996 | Ga0070687_100000950 | |||
| 997 | Ga0070687_100050490 | |||
| 998 | Ga0070661_100000314 | |||
| 999 | Ga0070661_100059190 | |||
| 1000 | Ga0070661_100073243 | |||
| 1001 | Ga0070661_100266880 | |||
| 1002 | Ga0070692_10000310 | |||
| 1003 | Ga0070668_100000857 | |||
| 1004 | Ga0070668_100126421 | |||
| 1005 | Ga0070668_100168165 | |||
| 1006 | Ga0070675_100002240 | |||
| 1007 | Ga0070671_100000598 | |||
| 1008 | Ga0070671_100034340 | |||
| 1009 | Ga0070674_100006534 | |||
| 1010 | Ga0070674_100011212 | |||
| 1011 | Ga0070673_100000289 | |||
| 1012 | Ga0070673_100010566 | |||
| 1013 | Ga0070688_100000189 | |||
| 1014 | Ga0070688_100011682 | |||
| 1015 | Ga0070659_100034177 | |||
| 1016 | Ga0070659_100100339 | |||
| 1017 | Ga0070659_100138140 | |||
| 1018 | Ga0070667_100000436 | |||
| 1019 | Ga0070667_100016498 | |||
| 1020 | Ga0070703_10025825 | |||
| 1021 | Ga0070709_10001788 | |||
| 1022 | Ga0070709_10099368 | |||
| 1023 | Ga0070709_10357448 | |||
| 1024 | Ga0070714_100037701 | |||
| 1025 | Ga0070714_100043964 | |||
| 1026 | Ga0070714_100829782 | |||
| 1027 | Ga0070713_100001448 | |||
| 1028 | Ga0070713_100618982 | |||
| 1029 | Ga0070710_10012602 | |||
| 1030 | Ga0070710_10079652 | |||
| 1031 | Ga0070711_100017964 | |||
| 1032 | Ga0070711_100037273 | |||
| 1033 | Ga0070711_100086719 | |||
| 1034 | Ga0070711_100110447 | |||
| 1035 | Ga0070711_100222275 | |||
| 1036 | Ga0070711_100342080 | |||
| 1037 | Ga0070711_100544809 | |||
| 1038 | Ga0070705_100000781 | |||
| 1039 | Ga0070705_100034313 | |||
| 1040 | Ga0070705_100100485 | |||
| 1041 | Ga0070700_100001610 | |||
| 1042 | Ga0070708_100320014 | |||
| 1043 | Ga0070663_100000297 | |||
| 1044 | Ga0070663_100102460 | |||
| 1045 | Ga0070663_100289653 | |||
| 1046 | Ga0070678_100011789 | |||
| 1047 | Ga0070678_100104777 | |||
| 1048 | Ga0070662_100032794 | |||
| 1049 | Ga0070662_100085677 | |||
| 1050 | Ga0070662_100529872 | |||
| 1051 | Ga0070681_10022181 | |||
| 1052 | Ga0070681_10148718 | |||
| 1053 | Ga0070681_10241732 | |||
| 1054 | Ga0068867_100003318 | |||
| 1055 | Ga0068867_100238130 | |||
| 1056 | Ga0068867_100269566 | |||
| 1057 | Ga0070685_10001152 | |||
| 1058 | Ga0070685_10019022 | |||
| 1059 | Ga0070707_100477815 | |||
| 1060 | Ga0070679_100003016 | |||
| 1061 | Ga0070679_100066275 | |||
| 1062 | Ga0070679_100082823 | |||
| 1063 | Ga0070679_100329755 | |||
| 1064 | Ga0070679_100335289 | |||
| 1065 | Ga0070679_100364379 | |||
| 1066 | Ga0070679_100418442 | |||
| 1067 | Ga0070684_100002293 | |||
| 1068 | Ga0070684_100233479 | |||
| 1069 | Ga0070672_100000106 | |||
| 1070 | Ga0070686_100000615 | |||
| 1071 | Ga0070686_100013219 | |||
| 1072 | Ga0070695_100001248 | |||
| 1073 | Ga0070696_100663534 | |||
| 1074 | Ga0070693_100001863 | |||
| 1075 | Ga0070693_100050332 | |||
| 1076 | Ga0070665_100469924 | |||
| 1077 | Ga0070665_100851724 | |||
| 1078 | Ga0070704_100094818 | |||
| 1079 | Ga0070704_100404242 | |||
| 1080 | Ga0068855_100111919 | |||
| 1081 | Ga0068855_100154833 | |||
| 1082 | Ga0068855_100875141 | |||
| 1083 | Ga0070664_100009338 | |||
| 1084 | Ga0070664_100108430 | |||
| 1085 | Ga0070664_101266167 | |||
| 1086 | Ga0068857_100000047 | |||
| 1087 | Ga0068857_100957013 | |||
| 1088 | Ga0068854_100003161 | |||
| 1089 | Ga0068854_100308470 | |||
| 1090 | Ga0068856_100000505 | |||
| 1091 | Ga0068856_100001905 | |||
| 1092 | Ga0068856_100253550 | |||
| 1093 | Ga0068856_100510238 | |||
| 1094 | Ga0068856_100582167 | |||
| 1095 | Ga0070702_100004825 | |||
| 1096 | Ga0070702_100031024 | |||
| 1097 | Ga0068852_100011300 | |||
| 1098 | Ga0068852_100445886 | |||
| 1099 | Ga0068859_100005879 | |||
| 1100 | Ga0068859_100061450 | |||
| 1101 | Ga0068859_100666543 | |||
| 1102 | Ga0068864_100000931 | |||
| 1103 | Ga0068864_100265640 | |||
| 1104 | Ga0068866_10000077 | |||
| 1105 | Ga0068866_10100282 | |||
| 1106 | Ga0068866_10225940 | |||
| 1107 | Ga0068861_100004701 | |||
| 1108 | Ga0068861_100164001 | |||
| 1109 | Ga0068861_100328706 | |||
| 1110 | Ga0068870_10001017 | |||
| 1111 | Ga0068863_100000543 | |||
| 1112 | Ga0068858_100002073 | |||
| 1113 | Ga0068858_100418566 | |||
| 1114 | Ga0068860_100005115 | |||
| 1115 | Ga0068860_100466387 | |||
| 1116 | Ga0068862_100000879 | |||
| 1117 | Ga0068862_100030509 | |||
| 1118 | Ga0081455_10009848 | |||
| 1119 | Ga0081538_10055356 | |||
| 1120 | Ga0070717_10000287 | |||
| 1121 | Ga0075365_10001551 | |||
| 1122 | Ga0075365_10003415 | |||
| 1123 | Ga0075368_10001935 | |||
| 1124 | Ga0075368_10014056 | |||
| 1125 | Ga0075363_100051029 | |||
| 1126 | Ga0075363_100505628 | |||
| 1127 | Ga0075364_10003383 | |||
| 1128 | Ga0075364_10027881 | |||
| 1129 | Ga0075432_10000660 | |||
| 1130 | Ga0070715_10000989 | |||
| 1131 | Ga0070715_10206773 | |||
| 1132 | Ga0070715_10328605 | |||
| 1133 | Ga0070712_100018234 | |||
| 1134 | Ga0070712_100112774 | |||
| 1135 | Ga0070712_100120042 | |||
| 1136 | Ga0070712_100122974 | |||
| 1137 | Ga0070712_100169434 | |||
| 1138 | Ga0070712_100948197 | |||
| 1139 | Ga0075362_10046636 | |||
| 1140 | Ga0075367_10006859 | |||
| 1141 | Ga0075367_10031403 | |||
| 1142 | Ga0075367_10065248 | |||
| 1143 | Ga0075367_10126955 | |||
| 1144 | Ga0075369_10137941 | |||
| 1145 | Ga0075366_10304577 | |||
| 1146 | Ga0097621_100000416 | |||
| 1147 | Ga0097621_100007350 | |||
| 1148 | Ga0097621_100069248 | |||
| 1149 | Ga0075370_10090888 | |||
| 1150 | Ga0068871_100000249 | |||
| 1151 | Ga0068871_100004813 | |||
| 1152 | Ga0068871_100048128 | |||
| 1153 | Ga0075428_100042214 | |||
| 1154 | Ga0075428_100062287 | |||
| 1155 | Ga0075430_100002807 | |||
| 1156 | Ga0075430_100020814 | |||
| 1157 | Ga0075431_100016617 | |||
| 1158 | Ga0075431_100022318 | |||
| 1159 | Ga0075433_10001150 | |||
| 1160 | Ga0075433_10017415 | |||
| 1161 | Ga0075434_100003092 | |||
| 1162 | Ga0075434_100003158 | |||
| 1163 | Ga0075434_100073362 | |||
| 1164 | Ga0075429_100001089 | |||
| 1165 | Ga0068865_100000248 | |||
| 1166 | Ga0068865_100348128 | |||
| 1167 | Ga0075436_100283221 | |||
| 1168 | Ga0075436_100362632 | |||
| 1169 | Ga0097620_100005879 | |||
| 1170 | Ga0097620_100061449 | |||
| 1171 | Ga0097620_100666622 | |||
| 1172 | Ga0075435_100017893 | |||
| 1173 | Ga0075435_100141912 | |||
| 1174 | Ga0099794_10182799 | |||
| 1175 | Ga0105251_10011683 | |||
| 1176 | Ga0105244_10020578 | |||
| 1177 | Ga0105240_10034168 | |||
| 1178 | Ga0111539_10002489 | |||
| 1179 | Ga0111539_10002685 | |||
| 1180 | Ga0111539_10004243 | |||
| 1181 | Ga0111539_10071809 | |||
| 1182 | Ga0111539_10474430 | |||
| 1183 | Ga0111539_10951192 | |||
| 1184 | Ga0105245_10115039 | |||
| 1185 | Ga0105245_10125883 | |||
| 1186 | Ga0105245_10180261 | |||
| 1187 | Ga0105247_10000908 | |||
| 1188 | Ga0105247_10287315 | |||
| 1189 | Ga0114129_10018021 | |||
| 1190 | Ga0114129_10019253 | |||
| 1191 | Ga0114129_10107955 | |||
| 1192 | Ga0105243_10001705 | |||
| 1193 | Ga0105243_10359390 | |||
| 1194 | Ga0105243_10518315 | |||
| 1195 | Ga0105241_10002306 | |||
| 1196 | Ga0105241_10448240 | |||
| 1197 | Ga0105241_10507727 | |||
| 1198 | Ga0105242_10001376 | |||
| 1199 | Ga0105242_10069731 | |||
| 1200 | Ga0105248_10005936 | |||
| 1201 | Ga0105248_10132244 | |||
| 1202 | Ga0105248_10299658 | |||
| 1203 | Ga0105248_10964103 | |||
| 1204 | Ga0105237_10002245 | |||
| 1205 | Ga0105237_10260701 | |||
| 1206 | Ga0105238_10115503 | |||
| 1207 | Ga0105238_10122582 | |||
| 1208 | Ga0105238_10177386 | |||
| 1209 | Ga0105249_10000476 | |||
| 1210 | Ga0105239_10352320 | |||
| 1211 | Ga0105239_10659661 | |||
| 1212 | Ga0105239_10716743 | |||
| 1213 | Ga0105246_10000057 | |||
| 1214 | Ga0105246_10008212 | |||
| 1215 | Ga0157373_10033593 | |||
| 1216 | Ga0157373_10049870 | |||
| 1217 | Ga0157371_10013856 | |||
| 1218 | Ga0157370_10106417 | |||
| 1219 | Ga0157370_10160543 | |||
| 1220 | Ga0157369_10652341 | |||
| 1221 | Ga0157369_10897955 | |||
| 1222 | Ga0157369_11106781 | |||
| 1223 | Ga0157374_10304404 | |||
| 1224 | Ga0157374_10407080 | |||
| 1225 | Ga0157378_10006604 | |||
| 1226 | Ga0157378_10036611 | |||
| 1227 | Ga0157378_10139163 | |||
| 1228 | Ga0157378_10516555 | |||
| 1229 | Ga0163162_10001937 | |||
| 1230 | Ga0157372_10009498 | |||
| 1231 | Ga0157372_10055438 | |||
| 1232 | Ga0157372_10231439 | |||
| 1233 | Ga0157372_10806576 | |||
| 1234 | Ga0157375_10079527 | |||
| 1235 | Ga0157375_10459908 | |||
| 1236 | Ga0157375_10792671 | |||
| 1237 | Ga0163163_10003757 | |||
| 1238 | Ga0157380_10088614 | |||
| 1239 | Ga0157380_10191901 | |||
| 1240 | Ga0157377_10009792 | |||
| 1241 | Ga0157377_10075461 | |||
| 1242 | Ga0157379_10000293 | |||
| 1243 | Ga0157379_10404041 | |||
| 1244 | Ga0157379_10511275 | |||
| 1245 | Ga0157376_10000531 | |||
| 1246 | Ga0157376_10041358 | |||
| 1247 | Ga0157376_10392082 | |||
| 1248 | Ga0157376_10509077 | |||
| 1249 | Ga0163161_10000209 | |||
| 1250 | Ga0206356_10827474 | |||
| 1251 | Ga0207673_1000294 | |||
| 1252 | Ga0207697_10000044 | |||
| 1253 | Ga0207713_1025555 | |||
| 1254 | Ga0207682_10000260 | |||
| 1255 | Ga0207692_10022379 | |||
| 1256 | Ga0207692_10358001 | |||
| 1257 | Ga0207692_10604413 | |||
| 1258 | Ga0207710_10003110 | |||
| 1259 | Ga0207710_10003890 | |||
| 1260 | Ga0207688_10000723 | |||
| 1261 | Ga0207680_10018440 | |||
| 1262 | Ga0207680_10060435 | |||
| 1263 | Ga0207685_10070599 | |||
| 1264 | Ga0207685_10087856 | |||
| 1265 | Ga0207685_10454172 | |||
| 1266 | Ga0207699_10003904 | |||
| 1267 | Ga0207699_10006701 | |||
| 1268 | Ga0207645_10092651 | |||
| 1269 | Ga0207645_10173285 | |||
| 1270 | Ga0207643_10000012 | |||
| 1271 | Ga0207705_10035014 | |||
| 1272 | Ga0207705_10051690 | |||
| 1273 | Ga0207654_10028155 | |||
| 1274 | Ga0207654_10253295 | |||
| 1275 | Ga0207707_10000551 | |||
| 1276 | Ga0207707_10071564 | |||
| 1277 | Ga0207707_10103791 | |||
| 1278 | Ga0207707_10249273 | |||
| 1279 | Ga0207707_10298593 | |||
| 1280 | Ga0207707_10348411 | |||
| 1281 | Ga0207695_10232716 | |||
| 1282 | Ga0207695_10290133 | |||
| 1283 | Ga0207695_10292090 | |||
| 1284 | Ga0207671_10059138 | |||
| 1285 | Ga0207693_10000861 | |||
| 1286 | Ga0207693_10002835 | |||
| 1287 | Ga0207693_10130885 | |||
| 1288 | Ga0207693_10137269 | |||
| 1289 | Ga0207693_10292608 | |||
| 1290 | Ga0207693_10382750 | |||
| 1291 | Ga0207663_10020213 | |||
| 1292 | Ga0207663_10042456 | |||
| 1293 | Ga0207663_10078827 | |||
| 1294 | Ga0207663_10213612 | |||
| 1295 | Ga0207663_10329840 | |||
| 1296 | Ga0207663_10353226 | |||
| 1297 | Ga0207660_10000992 | |||
| 1298 | Ga0207660_10049332 | |||
| 1299 | Ga0207660_10251974 | |||
| 1300 | Ga0207662_10155117 | |||
| 1301 | Ga0207657_10000358 | |||
| 1302 | Ga0207657_10013894 | |||
| 1303 | Ga0207657_10138740 | |||
| 1304 | Ga0207649_10000545 | |||
| 1305 | Ga0207649_10038207 | |||
| 1306 | Ga0207649_10065685 | |||
| 1307 | Ga0207649_10069769 | |||
| 1308 | Ga0207652_10012964 | |||
| 1309 | Ga0207652_10020676 | |||
| 1310 | Ga0207652_10241213 | |||
| 1311 | Ga0207652_10313606 | |||
| 1312 | Ga0207694_10025186 | |||
| 1313 | Ga0207694_10088687 | |||
| 1314 | Ga0207694_10159813 | |||
| 1315 | Ga0207694_11011883 | |||
| 1316 | Ga0207650_10016372 | |||
| 1317 | Ga0207659_10000023 | |||
| 1318 | Ga0207687_10000149 | |||
| 1319 | Ga0207687_10016797 | |||
| 1320 | Ga0207687_10099594 | |||
| 1321 | Ga0207687_10101533 | |||
| 1322 | Ga0207700_10006638 | |||
| 1323 | Ga0207700_10069749 | |||
| 1324 | Ga0207700_10525959 | |||
| 1325 | Ga0207664_10124748 | |||
| 1326 | Ga0207664_10185409 | |||
| 1327 | Ga0207664_10198260 | |||
| 1328 | Ga0207644_10007018 | |||
| 1329 | Ga0207644_10014986 | |||
| 1330 | Ga0207644_10129318 | |||
| 1331 | Ga0207690_10000203 | |||
| 1332 | Ga0207690_10072033 | |||
| 1333 | Ga0207706_10002188 | |||
| 1334 | Ga0207706_10023762 | |||
| 1335 | Ga0207686_10001306 | |||
| 1336 | Ga0207686_10004009 | |||
| 1337 | Ga0207686_10030861 | |||
| 1338 | Ga0207709_10000852 | |||
| 1339 | Ga0207670_10005646 | |||
| 1340 | Ga0207669_10000357 | |||
| 1341 | Ga0207704_10002400 | |||
| 1342 | Ga0207704_10184785 | |||
| 1343 | Ga0207704_10369626 | |||
| 1344 | Ga0207665_10000259 | |||
| 1345 | Ga0207665_10040542 | |||
| 1346 | Ga0207691_10000256 | |||
| 1347 | Ga0207711_10012598 | |||
| 1348 | Ga0207711_10131169 | |||
| 1349 | Ga0207711_10644614 | |||
| 1350 | Ga0207661_10000104 | |||
| 1351 | Ga0207661_10084958 | |||
| 1352 | Ga0207661_10125720 | |||
| 1353 | Ga0207661_10692496 | |||
| 1354 | Ga0207679_10000196 | |||
| 1355 | Ga0207679_10036592 | |||
| 1356 | Ga0207679_10278182 | |||
| 1357 | Ga0207667_10032029 | |||
| 1358 | Ga0207667_10159306 | |||
| 1359 | Ga0207667_10511420 | |||
| 1360 | Ga0207651_10006894 | |||
| 1361 | Ga0207651_10637699 | |||
| 1362 | Ga0207712_10000967 | |||
| 1363 | Ga0207668_10000251 | |||
| 1364 | Ga0207668_10259137 | |||
| 1365 | Ga0207668_10357362 | |||
| 1366 | Ga0207640_10000157 | |||
| 1367 | Ga0207640_10213072 | |||
| 1368 | Ga0207658_10008247 | |||
| 1369 | Ga0207658_10010507 | |||
| 1370 | Ga0207677_10000609 | |||
| 1371 | Ga0207677_10063697 | |||
| 1372 | Ga0207703_10028101 | |||
| 1373 | Ga0207703_10104869 | |||
| 1374 | Ga0207639_10002440 | |||
| 1375 | Ga0207678_10033403 | |||
| 1376 | Ga0207678_10046972 | |||
| 1377 | Ga0207708_10321582 | |||
| 1378 | Ga0207702_10000127 | |||
| 1379 | Ga0207702_10003955 | |||
| 1380 | Ga0207702_10035671 | |||
| 1381 | Ga0207702_10116890 | |||
| 1382 | Ga0207702_10771706 | |||
| 1383 | Ga0207641_10002938 | |||
| 1384 | Ga0207641_10210093 | |||
| 1385 | Ga0207648_10259123 | |||
| 1386 | Ga0207648_10422334 | |||
| 1387 | Ga0207676_10003560 | |||
| 1388 | Ga0207676_10012794 | |||
| 1389 | Ga0207674_10074021 | |||
| 1390 | Ga0207675_100037598 | |||
| 1391 | Ga0207675_100084741 | |||
| 1392 | Ga0207683_10000006 | |||
| 1393 | Ga0207683_10005678 | |||
| 1394 | Ga0207683_10016442 | |||
| 1395 | Ga0207683_10320367 | |||
| 1396 | Ga0207698_10027501 | |||
| 1397 | Ga0207698_10149586 | |||
| 1398 | Ga0207698_10166421 | |||
| 1399 | Ga0207698_10180134 | |||
| 1400 | Ga0209966_1059297 | |||
| 1401 | Ga0209813_10001619 | |||
| 1402 | Ga0209813_10184247 | |||
| 1403 | Ga0207428_10000165 | |||
| 1404 | Ga0207428_10001251 | |||
| 1405 | Ga0268266_10016010 | |||
| 1406 | Ga0268266_10525072 | |||
| 1407 | Ga0268265_10001687 | |||
| 1408 | Ga0268265_10058369 | |||
| 1409 | Ga0268264_10002029 | |||
| 1410 | Ga0265337_1007401 | |||
| 1411 | Ga0265325_10001335 | |||
| 1412 | Ga0265340_10044955 | |||
| 1413 | Ga0265340_10109002 | |||
| 1414 | Ga0265331_10174125 | |||
| 1415 | Ga0307408_100255695 | |||
| 1416 | Ga0265313_10000794 | |||
| 1417 | Ga0265313_10014122 | |||
| 1418 | Ga0265313_10025244 | |||
| 1419 | Ga0265314_10015576 | |||
| 1420 | Ga0265314_10090124 | |||
| 1421 | Ga0265342_10000502 | |||
| 1422 | Ga0265342_10160990 | |||
| 1423 | Ga0307405_10275416 | |||
| 1424 | Ga0307407_10263141 | |||
| 1425 | Ga0307409_101140086 | |||
| 1426 | Ga0307416_100636320 | |||
| 1427 | Ga0373948_0009967 | |||
| 1428 | Ga0373950_0014085 | |||
| 1429 | Ga0373950_0028790 | |||
| 1430 | Ga0373938_0094212 | |||
| 1431 | Ga0373926_0003377 | |||
| 1432 | Ga0373929_0000596 | |||
| 1433 | Ga0373934_0090144 | |||
| 1434 | Ga0373940_0096972 | |||
| 1435 | Ga0373944_0002920 | |||
| 1436 | Ga0373949_0002185 | |||
| 1437 | Ga0373949_0060919 | |||
| 1438 | Ga0373923_0001084 | |||
| 1439 | Ga0373923_0011523 | |||
| 1440 | Ga0373923_0217969 | |||
| 1441 | Ga0373932_0000763 | |||
| 1442 | Ga0373932_0002786 | |||
| 1443 | Ga0373936_0002079 | |||
| 1444 | Ga0373939_0039401 | |||
| 1445 | Ga0373941_0002411 | |||
| 1446 | Ga0373941_0020841 | |||
| 1447 | Ga0373941_0075895 | |||
| 1448 | Ga0373945_0037427 | |||
| 1449 | Ga0373953_0004398 | |||
| 1450 | Ga0373953_0007220 | |||
| 1451 | Ga0373953_0024252 | |||
| 1452 | Ga0373953_0220635 | |||
| 1453 | Ga0373954_0021988 | |||
| 1454 | Ga0373956_0145579 | |||
| 1455 | Ga0373957_0001408 | |||
| 1456 | Ga0373957_0010178 | |||
| 1457 | Ga0373957_0077481 | |||
| 1458 | Ga0373957_0106990 | |||
| 1459 | Ga0373957_0129719 | |||
| 1460 | Ga0373943_0100741 | |||
| 1461 | Ga0373946_0000794 | |||
| 1462 | Ga0373946_0016354 | |||
| 1463 | Ga0373955_0001974 | |||
| 1464 | Ga0373955_0003538 | |||
| 1465 | Ga0373955_0371639 | |||
| 1466 | Ga0373942_0032731 | |||
| 1467 | Ga0373961_0045249 | |||
| 1468 | Ga0373961_0064737 | |||
| 1469 | Ga0373961_0230357 | |||
| 1470 | Ga0373962_0000149 | |||
| 1471 | Ga0373924_0013418 | |||
| 1472 | Ga0373931_0004026 | |||
| 1473 | Ga0373931_0030856 | |||
| 1474 | Ga0373931_0036616 | |||
| 1475 | Ga0373935_0003725 | |||
| 1476 | Ga0373935_0025955 | |||
| 1477 | Ga0373935_0100099 | |||
| 1478 | Ga0373935_0135525 | |||
| 1479 | Ga0373927_0035622 | |||
| 1480 | Ga0373927_0207293 | |||
| 1481 | Ga0373933_0003823 | |||
| 1482 | Ga0373933_0128891 | |||
| 1483 | Ga0373933_0140477 | |||
| 1484 | Ga0373947_0001544 | |||
| 1485 | Ga0373947_0024502 | |||
| 1486 | Ga0373947_0102957 | |||
| 1487 | Ga0373947_0116879 | |||
| 1488 | Ga0373937_0001830 | |||
| 1489 | Ga0373937_0007531 | |||
| 1490 | Ga0373937_0009014 | |||
| 1491 | Ga0373937_0024275 | |||
| 1492 | Ga0373937_0293475 | |||
| 1493 | Ga0373937_0588535 | |||
| 1494 | Ga0373937_1165571 | |||
| 1495 | Ga0373925_0004912 | |||
| 1496 | Ga0373925_0077311 | |||
| 1497 | Ga0395900_0001539 | |||
| 1498 | Ga0395900_0008197 | |||
| 1499 | Ga0395900_0347092 | |||
| 1500 | Ga0395898_0024475 | |||
| 1501 | Ga0395898_0073723 | |||
| 1502 | Ga0395898_0111152 | |||
| 1503 | Ga0395901_0017251 | |||
| 1504 | Ga0395901_0205285 | |||
| 1505 | Ga0395901_0492157 | |||
| 1506 | Ga0395901_0699406 | |||
| 1507 | Ga0395901_0845343 | |||
| 1508 | Ga0436365_0197525 | |||
| 1509 | Ga0436365_0910431 | |||
| 1510 | Ga0439448_0139987 | |||
| 1511 | Ga0439448_0172487 | |||
| 1512 | Ga0439463_039328 | |||
| 1513 | Ga0466966_0564115 | |||
| 1514 | Ga0466961_0356676 | |||
| 1515 | Ga0466963_0075106 | |||
| 1516 | Ga0466963_0161557 | |||
| 1517 | Ga0466971_0079758 | |||
| 1518 | Ga0466957_0052705 | |||
| 1519 | Ga0466957_0441155 | |||
| 1520 | Ga0466959_0419787 | |||
| 1521 | Ga0466958_0090675 | |||
| 1522 | Ga0466967_0007437 | |||
| 1523 | Ga0466967_0544427 | |||
| 1524 | Ga0495627_059622 | |||
| 1525 | Ga0495592_0002092 | |||
| 1526 | Ga0495592_0002638 | |||
| 1527 | Ga0495592_0010694 | |||
| 1528 | Ga0495603_0006676 | |||
| 1529 | Ga0495603_0036586 | |||
| 1530 | Ga0495629_0000908 | |||
| 1531 | Ga0495629_0230211 | |||
| 1532 | Ga0495641_0013745 | |||
| 1533 | Ga0495641_0017916 | |||
| 1534 | Ga0495651_0008043 | |||
| 1535 | Ga0495651_0023214 | |||
| 1536 | Ga0495651_0046872 | |||
| 1537 | Ga0495653_0026709 | |||
| 1538 | Ga0495653_0039786 | |||
| 1539 | Ga0495653_0127908 | |||
| 1540 | Ga0495580_0046387 | |||
| 1541 | Ga0495580_0351202 | |||
| 1542 | Ga0495582_0007835 | |||
| 1543 | Ga0495582_0198100 | |||
| 1544 | Ga0495639_0022182 | |||
| 1545 | Ga0495639_0218075 | |||
| 1546 | Ga0495662_0002314 | |||
| 1547 | Ga0495664_0022985 | |||
| 1548 | Ga0495664_0049096 | |||
| 1549 | Ga0495664_0050039 | |||
| 1550 | Ga0495664_0069188 | |||
| 1551 | Ga0495585_0004760 | |||
| 1552 | Ga0495594_0009558 | |||
| 1553 | Ga0495608_0010237 | |||
| 1554 | Ga0495608_0025637 | |||
| 1555 | Ga0495608_0089899 | |||
| 1556 | Ga0495618_0061261 | |||
| 1557 | Ga0495628_0000115 | |||
| 1558 | Ga0495628_0016357 | |||
| 1559 | Ga0495628_0064058 | |||
| 1560 | Ga0495628_0327182 | |||
| 1561 | Ga0495630_0017488 | |||
| 1562 | Ga0495644_0000983 | |||
| 1563 | Ga0495666_0035219 | |||
| 1564 | Ga0495652_0007929 | |||
| 1565 | Ga0495652_0027254 | |||
| 1566 | Ga0495652_0335797 | |||
| 1567 | Ga0495652_0511103 | |||
| 1568 | Ga0495665_0010075 | |||
| 1569 | Ga0495665_0223525 | |||
| 1570 | Ga0495640_0021892 | |||
| 1571 | Ga0495640_0222347 | |||
| 1572 | Ga0495586_0016534 | |||
| 1573 | Ga0495587_0006245 | |||
| 1574 | Ga0495587_0025876 | |||
| 1575 | Ga0495645_0010751 | |||
| 1576 | Ga0495645_0040599 | |||
| 1577 | Ga0495645_0242017 | |||
| 1578 | Ga0495622_0003333 | |||
| 1579 | Ga0495633_0008234 | |||
| 1580 | Ga0495667_0000674 | |||
| 1581 | Ga0495667_0003600 | |||
| 1582 | Ga0495667_0004340 | |||
| 1583 | Ga0495667_0024150 | |||
| 1584 | Ga0495667_0202007 | |||
| 1585 | Ga0495656_0000789 | |||
| 1586 | Ga0495668_0030913 | |||
| 1587 | Ga0495634_0048425 | |||
| 1588 | Ga0495634_0556800 | |||
| 1589 | Ga0495635_0002598 | |||
| 1590 | Ga0495635_0009000 | |||
| 1591 | Ga0495635_0088484 | |||
| 1592 | Ga0495588_0056271 | |||
| 1593 | Ga0495588_0253592 | |||
| 1594 | Ga0495657_0011216 | |||
| 1595 | Ga0495657_0025756 | |||
| 1596 | Ga0495657_0249931 | |||
| 1597 | Ga0495599_0007173 | |||
| 1598 | Ga0495599_0076743 | |||
| 1599 | Ga0495623_0002539 | |||
| 1600 | Ga0495623_0156511 | |||
| 1601 | Ga0495646_0002845 | |||
| 1602 | Ga0495646_0006467 | |||
| 1603 | Ga0495647_0004015 | |||
| 1604 | Ga0495647_0052362 | |||
| 1605 | Ga0495658_0000673 | |||
| 1606 | Ga0495658_0008094 | |||
| 1607 | Ga0495658_0476925 | |||
| 1608 | Ga0495613_0014051 | |||
| 1609 | Ga0495613_0081632 | |||
| 1610 | Ga0495613_0172715 | |||
| 1611 | Ga0495624_0004039 | |||
| 1612 | Ga0495624_0016763 | |||
| 1613 | Ga0495670_0000479 | |||
| 1614 | Ga0495600_0000876 | |||
| 1615 | Ga0495600_0023738 | |||
| 1616 | Ga0495600_0117715 | |||
| 1617 | Ga0495600_0176759 | |||
| 1618 | Ga0495600_0608250 | |||
| 1619 | Ga0495581_0006390 | |||
| 1620 | Ga0495581_0246275 | |||
| 1621 | Ga0495604_0001990 | |||
| 1622 | Ga0495604_0011545 | |||
| 1623 | Ga0495604_0034521 | |||
| 1624 | Ga0495604_0042890 | |||
| 1625 | Ga0495674_0058181 | |||
| 1626 | Ga0495674_0086291 | |||
| 1627 | Ga0495676_0096041 | |||
| 1628 | Ga0495676_0589490 | |||
| 1629 | Ga0495680_0002967 | |||
| 1630 | Ga0495680_0012672 | |||
| 1631 | Ga0495680_0067212 | |||
| 1632 | Ga0495680_0388493 | |||
| 1633 | Ga0495675_0004560 | |||
| 1634 | Ga0495677_0147721 | |||
| 1635 | Ga0495684_0003464 | |||
| 1636 | Ga0495684_0062460 | |||
| 1637 | Ga0495684_0104043 | |||
| 1638 | Ga0495593_0003537 | |||
| 1639 | Ga0495593_0013225 | |||
| 1640 | Ga0495602_0003665 | |||
| 1641 | Ga0495602_0004959 | |||
| 1642 | Ga0495602_0467081 | |||
| 1643 | Ga0495614_0017736 | |||
| 1644 | Ga0496100_0004411 | |||
| 1645 | Ga0496100_0006203 | |||
| 1646 | Ga0496100_0686985 | |||
| 1647 | Ga0496101_0000464 | |||
| 1648 | Ga0496101_0009586 | |||
| 1649 | Ga0496101_0011897 | |||
| 1650 | Ga0496102_0001120 | |||
| 1651 | Ga0496102_0070158 | |||
| 1652 | Ga0496102_0103831 | |||
| 1653 | Ga0496102_0190383 | |||
| 1654 | Ga0496103_0000611 | |||
| 1655 | Ga0496103_0354485 | |||
| 1656 | Ga0496104_0000299 | |||
| 1657 | Ga0496104_0062993 | |||
| 1658 | Ga0496104_0172417 | |||
| 1659 | Ga0496104_0292657 | |||
| 1660 | Ga0496104_0381274 | |||
| 1661 | Ga0496104_0510295 | |||
| 1662 | Ga0496105_0001270 | |||
| 1663 | Ga0496105_0127114 | |||
| 1664 | Ga0496105_0631148 | |||
| 1665 | Ga0496105_0682173 | |||
| 1666 | Ga0496106_0000541 | |||
| 1667 | Ga0496106_0020520 | |||
| 1668 | Ga0496106_0028919 | |||
| 1669 | Ga0496106_0176585 | |||
| 1670 | Ga0496107_0001684 | |||
| 1671 | Ga0496107_0013772 | |||
| 1672 | Ga0496107_0092543 | |||
| 1673 | Ga0496107_0174072 | |||
| 1674 | Ga0496107_0180927 | |||
| 1675 | Ga0496108_0000938 | |||
| 1676 | Ga0496108_0111444 | |||
| 1677 | Ga0496108_0187033 | |||
| 1678 | Ga0496108_0189039 | |||
| 1679 | Ga0496109_0000696 | |||
| 1680 | Ga0496109_0000977 | |||
| 1681 | Ga0496109_0187871 | |||
| 1682 | Ga0496109_0194713 | |||
| 1683 | Ga0496109_0480097 | |||
| 1684 | Ga0496109_0527287 | |||
| 1685 | Ga0496110_0046716 | |||
| 1686 | Ga0496110_0120100 | |||
| 1687 | Ga0496110_0219369 | |||
| 1688 | Ga0496111_0011837 | |||
| 1689 | Ga0496111_0462631 | |||
| 1690 | Ga0496112_0000590 | |||
| 1691 | Ga0496112_0015661 | |||
| 1692 | Ga0496112_0165902 | |||
| 1693 | Ga0496112_0429242 | |||
| 1694 | Ga0496113_0029056 | |||
| 1695 | Ga0496114_0014713 | |||
| 1696 | Ga0496114_0020001 | |||
| 1697 | Ga0496114_0249352 | |||
| 1698 | Ga0496115_0012499 | |||
| 1699 | Ga0496115_0041394 | |||
| 1700 | Ga0496115_0088266 | |||
| 1701 | Ga0496115_0192589 | |||
| 1702 | Ga0496115_0214971 | |||
| 1703 | Ga0496115_0500917 | |||
| 1704 | Ga0496125_0340828 | |||
| 1705 | Ga0501031_0132204 | |||
| 1706 | Ga0501032_0013787 | |||
| 1707 | Ga0501032_0016304 | |||
| 1708 | Ga0501032_0042076 | |||
| 1709 | Ga0501032_0082027 | |||
| 1710 | Ga0501033_0064262 | |||
| 1711 | Ga0501033_0066788 | |||
| 1712 | Ga0501033_0371647 | |||
| 1713 | Ga0501033_0591870 | |||
| 1714 | Ga0501034_0000229 | |||
| 1715 | Ga0501034_0013020 | |||
| 1716 | Ga0501034_0032378 | |||
| 1717 | Ga0501034_0059044 | |||
| 1718 | Ga0501034_0070747 | |||
| 1719 | Ga0501034_0121920 | |||
| 1720 | Ga0501034_0222208 | |||
| 1721 | Ga0501034_0243108 | |||
| 1722 | Ga0501034_0399864 | |||
| 1723 | Ga0501034_0419237 | |||
| 1724 | Ga0501036_0001657 | |||
| 1725 | Ga0501036_0015136 | |||
| 1726 | Ga0501036_0097906 | |||
| 1727 | Ga0501036_0435262 | |||
| 1728 | Ga0501037_0005935 | |||
| 1729 | Ga0501037_0018906 | |||
| 1730 | Ga0501037_0122082 | |||
| 1731 | Ga0501038_0013215 | |||
| 1732 | Ga0501038_0151456 | |||
| 1733 | Ga0501038_0352757 | |||
| 1734 | Ga0501039_0009233 | |||
| 1735 | Ga0501039_0041434 | |||
| 1736 | Ga0501040_0666518 | |||
| 1737 | Ga0501041_0062732 | |||
| 1738 | Ga0501041_0645122 | |||
| 1739 | Ga0501041_0690995 | |||
| 1740 | Ga0501042_0093056 | |||
| 1741 | Ga0501042_0336662 | |||
| 1742 | Ga0501043_0002225 | |||
| 1743 | Ga0501043_0007079 | |||
| 1744 | Ga0501043_0011946 | |||
| 1745 | Ga0501043_0339742 | |||
| 1746 | Ga0501046_0015198 | |||
| 1747 | Ga0501046_0015379 | |||
| 1748 | Ga0501046_0083680 | |||
| 1749 | Ga0501046_0116620 | |||
| 1750 | Ga0501046_0284946 | |||
| 1751 | Ga0501047_0000314 | |||
| 1752 | Ga0501047_0020621 | |||
| 1753 | Ga0501047_0078071 | |||
| 1754 | Ga0501047_0078943 | |||
| 1755 | Ga0501047_0639787 | |||
| 1756 | Ga0501048_0002000 | |||
| 1757 | Ga0501048_0066703 | |||
| 1758 | Ga0501048_0685812 | |||
| 1759 | Ga0501067_0016018 | |||
| 1760 | Ga0501067_0163639 | |||
| 1761 | Ga0501067_0204963 | |||
| 1762 | Ga0501068_0021225 | |||
| 1763 | Ga0501068_0223643 | |||
| 1764 | Ga0501069_0020383 | |||
| 1765 | Ga0501069_0124614 | |||
| 1766 | Ga0501069_0164709 | |||
| 1767 | Ga0501069_0265866 | |||
| 1768 | Ga0501070_0007677 | |||
| 1769 | Ga0501070_0021163 | |||
| 1770 | Ga0501070_0036638 | |||
| 1771 | Ga0501070_0068451 | |||
| 1772 | Ga0501070_0078829 | |||
| 1773 | Ga0501070_0121095 | |||
| 1774 | Ga0501070_0175488 | |||
| 1775 | Ga0501070_0556253 | |||
| 1776 | Ga0501071_0137072 | |||
| 1777 | Ga0501071_0385393 | |||
| 1778 | Ga0501071_0583521 | |||
| 1779 | Ga0501072_0045302 | |||
| 1780 | Ga0501072_0222722 | |||
| 1781 | Ga0501072_0260323 | |||
| 1782 | Ga0501072_0509623 | |||
| 1783 | Ga0501073_0007118 | |||
| 1784 | Ga0501073_0032059 | |||
| 1785 | Ga0501073_0033635 | |||
| 1786 | Ga0501073_0356355 | |||
| 1787 | Ga0501074_0012343 | |||
| 1788 | Ga0501074_0015285 | |||
| 1789 | Ga0501074_0036703 | |||
| 1790 | Ga0501074_0051749 | |||
| 1791 | Ga0501074_0097631 | |||
| 1792 | Ga0501075_0168132 | |||
| 1793 | Ga0501076_0117848 | |||
| 1794 | Ga0501076_0249678 | |||
| 1795 | Ga0501076_0337725 | |||
| 1796 | Ga0501077_0156958 | |||
| 1797 | Ga0501077_0161794 | |||
| 1798 | Ga0501079_0023277 | |||
| 1799 | Ga0501079_0184882 | |||
| 1800 | Ga0501079_0320540 | |||
| 1801 | Ga0501079_0361069 | |||
| 1802 | Ga0501080_0005419 | |||
| 1803 | Ga0501080_0048972 | |||
| 1804 | Ga0501080_0214905 | |||
| 1805 | Ga0501080_0276721 | |||
| 1806 | Ga0501080_0282549 | |||
| 1807 | Ga0501081_0098757 | |||
| 1808 | Ga0501083_0001743 | |||
| 1809 | Ga0501083_0090411 | |||
| 1810 | Ga0501083_0240287 | |||
| 1811 | Ga0501083_0260794 | |||
| 1812 | Ga0501035_0012411 | |||
| 1813 | Ga0501035_0221399 | |||
| 1814 | Ga0501035_0319539 | |||
| 1815 | Ga0501035_0343266 | |||
| 1816 | Ga0501035_0373755 | |||
| 1817 | Ga0501044_0026016 | |||
| 1818 | Ga0501044_0029583 | |||
| 1819 | Ga0501044_0030329 | |||
| 1820 | Ga0501044_0042476 | |||
| 1821 | Ga0501044_0075111 | |||
| 1822 | Ga0501044_0168287 | |||
| 1823 | Ga0501044_0243311 | |||
| 1824 | Ga0501044_0291385 | |||
| 1825 | Ga0501044_0517374 | |||
| 1826 | Ga0501044_0948085 | |||
| 1827 | Ga0501045_0123442 | |||
| 1828 | nmdc:mga03n38_453050_c1 | |||
| 1829 | nmdc:mga03n38_8356_c1 | |||
| 1830 | nmdc:mga03n38_92874_c1 | |||
| 1831 | nmdc:mga00v17_2703_c1 | |||
| 1832 | nmdc:mga00v17_481408_c1 | |||
| 1833 | nmdc:mga0yw44_147276_c1 | |||
| 1834 | nmdc:mga0yw44_2990_c1 | |||
| 1835 | nmdc:mga0yw44_39217_c1 | |||
| 1836 | nmdc:mga06z11_11933_c1 | |||
| 1837 | nmdc:mga06z11_124640_c1 | |||
| 1838 | nmdc:mga06z11_13594_c1 | |||
| 1839 | nmdc:mga06z11_542205_c1 | |||
| 1840 | nmdc:mga06z11_813_c1 | |||
| 1841 | nmdc:mga06z11_8820_c1 | |||
| 1842 | nmdc:mga04h51_1434_c1 | |||
| 1843 | nmdc:mga04h51_1837_c1 | |||
| 1844 | nmdc:mga04h51_210397_c1 | |||
| 1845 | nmdc:mga04h51_35394_c1 | |||
| 1846 | nmdc:mga05p37_177673_c1 | |||
| 1847 | nmdc:mga05p37_2697_c1 | |||
| 1848 | nmdc:mga05p37_490392_c1 | |||
| 1849 | nmdc:mga05p37_82000_c1 | |||
| 1850 | nmdc:mga09592_14093_c1 | |||
| 1851 | nmdc:mga09592_369726_c1 | |||
| 1852 | nmdc:mga0qj67_693_c1 | |||
| 1853 | nmdc:mga0qj67_9904_c1 | |||
| 1854 | nmdc:mga06r32_1056_c1 | |||
| 1855 | nmdc:mga06r32_11208_c1 | |||
| 1856 | nmdc:mga06r32_3021_c1 | |||
| 1857 | nmdc:mga08y16_3846_c1 | |||
| 1858 | nmdc:mga08y16_86942_c1 | |||
| 1859 | nmdc:mga0n895_1654_c1 | |||
| 1860 | nmdc:mga0n895_291_c1 | |||
| 1861 | nmdc:mga0n895_787849_c1 | |||
| 1862 | nmdc:mga0rr50_1013_c1 | |||
| 1863 | nmdc:mga0rr50_479234_c1 | |||
| 1864 | nmdc:mga08x19_106529_c1 | |||
| 1865 | nmdc:mga08x19_136597_c1 | |||
| 1866 | nmdc:mga08x19_53923_c1 | |||
| 1867 | nmdc:mga0a205_151212_c1 | |||
| 1868 | nmdc:mga0a205_467_c1 | |||
| 1869 | nmdc:mga0a205_581998_c1 | |||
| 1870 | nmdc:mga0a205_6139_c1 | |||
| 1871 | nmdc:mga0sz30_117808_c1 | |||
| 1872 | Ga0495601_0000701 | |||
| 1873 | Ga0495601_0003725 | |||
| 1874 | Ga0495601_0034176 | |||
| 1875 | Ga0495601_0042664 | |||
| 1876 | Ga0495612_0000569 | |||
| 1877 | Ga0495612_0001410 | |||
| 1878 | Ga0495612_0008471 | |||
| 1879 | Ga0495612_0057632 | |||
| 1880 | Ga0495595_0001815 | |||
| 1881 | Ga0495595_0002638 | |||
| 1882 | Ga0495595_0010175 | |||
| 1883 | Ga0495595_0011206 | |||
| 1884 | Ga0495595_0080904 | |||
| 1885 | Ga0495595_0216773 | |||
| 1886 | Ga0495595_0284191 | |||
| 1887 | Ga0495619_0000159 | |||
| 1888 | Ga0495619_0000300 | |||
| 1889 | Ga0495619_0004640 | |||
| 1890 | Ga0495619_0008242 | |||
| 1891 | Ga0495619_0009949 | |||
| 1892 | Ga0500566_0331176 | |||
| 1893 | Ga0500593_031273 | |||
| 1894 | Ga0500586_000409 | |||
| 1895 | Ga0500636_0001477 | |||
| 1896 | Ga0501084_0088980 | |||
| 1897 | Ga0501084_0372953 | |||
| 1898 | Ga0501084_0529620 | |||
| 1899 | Ga0501082_0040790 | |||
| 1900 | Ga0501082_0125083 | |||
| 1901 | Ga0501082_0234824 | |||
| 1902 | Ga0501082_0247403 | |||
| 1903 | Ga0501082_0275176 | |||
| 1904 | Ga0501082_0404388 | |||
| 1905 | Ga0530510_0250296 | |||
| 1906 | Ga0530510_0404625 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iby-assembly1.cif.gz_A | human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 | 0.8946 | 9 | 203 |
| 5ajv-assembly1.cif.gz_B | human pfkfb3 in complex with an indole inhibitor 1 | 0.8892 | 9 | 202 |
| 1tip-assembly1.cif.gz_B | the bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase | 0.8886 | 9 | 203 |
| 5ajz-assembly1.cif.gz_A-2 | human pfkfb3 in complex with an indole inhibitor 5 | 0.8844 | 9 | 203 |
| 5ajy-assembly1.cif.gz_A | human pfkfb3 in complex with an indole inhibitor 4 | 0.8838 | 9 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8792 | 9 | 194 | 3.40.50.1240 |
| af_Q54SI2_327_480_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.863 | 63 | 188 | 3.40.50.1240 |
| af_A0A1D6QHM8_37_228_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8622 | 9 | 195 | 3.40.50.1240 |
| af_Q9N590_245_450_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8619 | 9 | 203 | 3.40.50.1240 |
| 1ebbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8596 | 9 | 194 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A345ZVN2-F1-model_v4 | Histidine phosphatase family protein | 0.9998 | 7 | 204 |
GO:0005737
GO:0016791 |
| AF-A0A345ZVN2-F1-model_v4 | Histidine phosphatase family protein | 0.9898 | 7 | 204 |
GO:0005737
GO:0016791 |
| AF-A0A1H9LY98-F1-model_v4 | deleted | 0.9857 | 5 | 202 |
|
| AF-Q6NAI5-F1-model_v4 | Histidine phosphatase family protein (Possible phosphoglycerate mutase) | 0.9841 | 9 | 204 |
GO:0005737
GO:0016791 |
| AF-A0A1G8DQ38-F1-model_v4 | Probable phosphoglycerate mutase | 0.9814 | 8 | 202 |
GO:0005737
GO:0016791 |