F486666

General Info

Members Datasets Scaffolds Average Seq Length
953 395 1906 200

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0176840|Ga0466958_0176840_240_839
Length 188
Sequence MPRPVVYYIRHGETDWNVAGRLQGRRDVPLNARGRGQGAHCGRVLRDLFARDGRDPAALDYVSSPLMRARETMALYRLEQRLSEIAFGDWEGCTIAQLKTRDPQGIAAREHDKYRFVPPNGESYEAVTMRMAEWYGSLRRDTVACAHGGTARGLIAHLKIAQAAAAPLIDIAQGVVYVFADGTLSRYA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
220 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
391 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 6.3
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0176840 3300045836 Bacteria 1353
2 JGI24032J14994_100964 3300001430 Bacteria 1367
3 JGI24746J21847_1000620 3300001977 Bacteria 5412
4 JGI24747J21853_1000939 3300001978 Bacteria 2039
5 JGI24747J21853_1008755 3300001978 Bacteria 992
6 JGI24739J22299_10001041 3300001989 Bacteria 10288
7 JGI24745J21846_1000131 3300002073 Bacteria 5781
8 JGI24748J21848_1001208 3300002074 Bacteria 2822
9 JGI24738J21930_10000571 3300002075 Bacteria 10549
10 JGI24749J21850_1000415 3300002076 Bacteria 6366
11 JGI24749J21850_1006197 3300002076 Bacteria 1667
12 JGI24744J21845_10001089 3300002077 Bacteria 5257
13 JGI24034J26672_10001679 3300002239 Bacteria 2975
14 JGI24742J22300_10000080 3300002244 Bacteria 13750
15 JGI25405J52794_10003705 3300003911 Bacteria 2695
16 Ga0070658_10050265 3300005327 Bacteria 3379
17 Ga0070676_10000128 3300005328 Bacteria 28446
18 Ga0070676_10444281 3300005328 Unclassified 911
19 Ga0070683_100000289 3300005329 Bacteria 34698
20 Ga0070683_100080750 3300005329 Bacteria 3044
21 Ga0070683_100400166 3300005329 Bacteria 1309
22 Ga0070690_100000935 3300005330 Bacteria 14900
23 Ga0070690_100066908 3300005330 Bacteria 2327
24 Ga0070670_100003173 3300005331 Bacteria 13581
25 Ga0070677_10000043 3300005333 Bacteria 39363
26 Ga0070666_10005381 3300005335 Bacteria 7846
27 Ga0070666_10136061 3300005335 Bacteria 1709
28 Ga0070680_100002347 3300005336 Bacteria 13977
29 Ga0070680_100009986 3300005336 Bacteria 7311
30 Ga0070680_100092243 3300005336 Bacteria 2508
31 Ga0070680_100224788 3300005336 Bacteria 1584
32 Ga0070680_100459248 3300005336 Bacteria 1088
33 Ga0070680_100624880 3300005336 Bacteria 925
34 Ga0070682_100000528 3300005337 Bacteria 23870
35 Ga0070682_100037063 3300005337 Bacteria 2983
36 Ga0068868_100000408 3300005338 Bacteria 29034
37 Ga0068868_100133583 3300005338 Bacteria 2032
38 Ga0070660_100010085 3300005339 Bacteria 6665
39 Ga0070660_100011422 3300005339 Bacteria 6308
40 Ga0070689_100000819 3300005340 Bacteria 19235
41 Ga0070689_100039120 3300005340 Bacteria 3630
42 Ga0070691_10015622 3300005341 Bacteria 3487
43 Ga0070687_100000950 3300005343 Bacteria 9837
44 Ga0070687_100050490 3300005343 Bacteria 2148
45 Ga0070661_100000314 3300005344 Bacteria 39090
46 Ga0070661_100059190 3300005344 Bacteria 2808
47 Ga0070661_100073243 3300005344 Bacteria 2521
48 Ga0070661_100266880 3300005344 Bacteria 1324
49 Ga0070692_10000310 3300005345 Bacteria 13896
50 Ga0070668_100000857 3300005347 Bacteria 21127
51 Ga0070668_100126421 3300005347 Bacteria 2048
52 Ga0070668_100168165 3300005347 Bacteria 1783
53 Ga0070675_100002240 3300005354 Bacteria 14349
54 Ga0070671_100000598 3300005355 Bacteria 25820
55 Ga0070671_100034340 3300005355 Bacteria 4198
56 Ga0070674_100006534 3300005356 Bacteria 6811
57 Ga0070674_100011212 3300005356 Bacteria 5448
58 Ga0070673_100000289 3300005364 Bacteria 26187
59 Ga0070673_100010566 3300005364 Bacteria 6253
60 Ga0070688_100000189 3300005365 Bacteria 32631
61 Ga0070688_100011682 3300005365 Bacteria 4889
62 Ga0070659_100034177 3300005366 Bacteria 3953
63 Ga0070659_100100339 3300005366 Bacteria 2329
64 Ga0070659_100138140 3300005366 Bacteria 1983
65 Ga0070667_100000436 3300005367 Bacteria 43897
66 Ga0070667_100016498 3300005367 Bacteria 6113
67 Ga0070703_10025825 3300005406 Bacteria 1744
68 Ga0070709_10001788 3300005434 Bacteria 11676
69 Ga0070709_10099368 3300005434 Bacteria 1935
70 Ga0070709_10357448 3300005434 Bacteria 1081
71 Ga0070714_100037701 3300005435 Bacteria 4063
72 Ga0070714_100043964 3300005435 Bacteria 3780
73 Ga0070714_100829782 3300005435 Bacteria 896
74 Ga0070713_100001448 3300005436 Bacteria 15190
75 Ga0070713_100618982 3300005436 Bacteria 1030
76 Ga0070710_10012602 3300005437 Bacteria 4205
77 Ga0070710_10079652 3300005437 Bacteria 1909
78 Ga0070711_100017964 3300005439 Bacteria 4508
79 Ga0070711_100037273 3300005439 Bacteria 3262
80 Ga0070711_100086719 3300005439 Bacteria 2245
81 Ga0070711_100110447 3300005439 Bacteria 2017
82 Ga0070711_100222275 3300005439 Bacteria 1468
83 Ga0070711_100342080 3300005439 Bacteria 1200
84 Ga0070711_100544809 3300005439 Bacteria 962
85 Ga0070705_100000781 3300005440 Bacteria 17954
86 Ga0070705_100034313 3300005440 Bacteria 2835
87 Ga0070705_100100485 3300005440 Bacteria 1825
88 Ga0070700_100001610 3300005441 Bacteria 11254
89 Ga0070708_100320014 3300005445 Bacteria 1461
90 Ga0070663_100000297 3300005455 Bacteria 25442
91 Ga0070663_100102460 3300005455 Bacteria 2138
92 Ga0070663_100289653 3300005455 Bacteria 1307
93 Ga0070678_100011789 3300005456 Bacteria 5407
94 Ga0070678_100104777 3300005456 Bacteria 2200
95 Ga0070662_100032794 3300005457 Bacteria 3652
96 Ga0070662_100085677 3300005457 Bacteria 2355
97 Ga0070662_100529872 3300005457 Bacteria 985
98 Ga0070681_10022181 3300005458 Bacteria 6373
99 Ga0070681_10148718 3300005458 Bacteria 2270
100 Ga0070681_10241732 3300005458 Bacteria 1719
101 Ga0068867_100003318 3300005459 Bacteria 11338
102 Ga0068867_100238130 3300005459 Bacteria 1474
103 Ga0068867_100269566 3300005459 Bacteria 1391
104 Ga0070685_10001152 3300005466 Bacteria 14147
105 Ga0070685_10019022 3300005466 Bacteria 3701
106 Ga0070707_100477815 3300005468 Bacteria 1208
107 Ga0070679_100003016 3300005530 Bacteria 15378
108 Ga0070679_100066275 3300005530 Bacteria 3599
109 Ga0070679_100082823 3300005530 Bacteria 3197
110 Ga0070679_100329755 3300005530 Bacteria 1475
111 Ga0070679_100335289 3300005530 Bacteria 1461
112 Ga0070679_100364379 3300005530 Bacteria 1392
113 Ga0070679_100418442 3300005530 Bacteria 1285
114 Ga0070684_100002293 3300005535 Bacteria 14101
115 Ga0070684_100233479 3300005535 Bacteria 1680
116 Ga0070672_100000106 3300005543 Bacteria 41858
117 Ga0070686_100000615 3300005544 Bacteria 20904
118 Ga0070686_100013219 3300005544 Bacteria 4720
119 Ga0070695_100001248 3300005545 Bacteria 13985
120 Ga0070696_100663534 3300005546 Bacteria 847
121 Ga0070693_100001863 3300005547 Bacteria 9633
122 Ga0070693_100050332 3300005547 Bacteria 2381
123 Ga0070665_100469924 3300005548 Bacteria 1268
124 Ga0070665_100851724 3300005548 Bacteria 925
125 Ga0070704_100094818 3300005549 Bacteria 2234
126 Ga0070704_100404242 3300005549 Bacteria 1166
127 Ga0068855_100111919 3300005563 Bacteria 3133
128 Ga0068855_100154833 3300005563 Bacteria 2604
129 Ga0068855_100875141 3300005563 Bacteria 950
130 Ga0070664_100009338 3300005564 Bacteria 7954
131 Ga0070664_100108430 3300005564 Bacteria 2421
132 Ga0070664_101266167 3300005564 Bacteria 696
133 Ga0068857_100000047 3300005577 Bacteria 67784
134 Ga0068857_100957013 3300005577 Bacteria 823
135 Ga0068854_100003161 3300005578 Bacteria 10266
136 Ga0068854_100308470 3300005578 Bacteria 1283
137 Ga0068856_100000505 3300005614 Bacteria 43297
138 Ga0068856_100001905 3300005614 Bacteria 21761
139 Ga0068856_100253550 3300005614 Bacteria 1774
140 Ga0068856_100510238 3300005614 Bacteria 1223
141 Ga0068856_100582167 3300005614 Bacteria 1140
142 Ga0070702_100004825 3300005615 Bacteria 6199
143 Ga0070702_100031024 3300005615 Bacteria 2920
144 Ga0068852_100011300 3300005616 Bacteria 6716
145 Ga0068852_100445886 3300005616 Bacteria 1280
146 Ga0068859_100005879 3300005617 Bacteria 12451
147 Ga0068859_100061450 3300005617 Bacteria 3786
148 Ga0068859_100666543 3300005617 Bacteria 1132
149 Ga0068864_100000931 3300005618 Bacteria 24535
150 Ga0068864_100265640 3300005618 Bacteria 1597
151 Ga0068866_10000077 3300005718 Bacteria 39340
152 Ga0068866_10100282 3300005718 Bacteria 1596
153 Ga0068866_10225940 3300005718 Bacteria 1132
154 Ga0068861_100004701 3300005719 Bacteria 9180
155 Ga0068861_100164001 3300005719 Bacteria 1836
156 Ga0068861_100328706 3300005719 Bacteria 1334
157 Ga0068870_10001017 3300005840 Bacteria 11098
158 Ga0068863_100000543 3300005841 Bacteria 38366
159 Ga0068858_100002073 3300005842 Bacteria 20401
160 Ga0068858_100418566 3300005842 Bacteria 1288
161 Ga0068860_100005115 3300005843 Bacteria 13336
162 Ga0068860_100466387 3300005843 Bacteria 1257
163 Ga0068862_100000879 3300005844 Bacteria 29265
164 Ga0068862_100030509 3300005844 Bacteria 4544
165 Ga0081455_10009848 3300005937 Bacteria 9788
166 Ga0081538_10055356 3300005981 Bacteria 2337
167 Ga0070717_10000287 3300006028 Bacteria 34051
168 Ga0075365_10001551 3300006038 Bacteria 10507
169 Ga0075365_10003415 3300006038 Bacteria 8176
170 Ga0075368_10001935 3300006042 Bacteria 6662
171 Ga0075368_10014056 3300006042 Bacteria 2950
172 Ga0075363_100051029 3300006048 Bacteria 2205
173 Ga0075363_100505628 3300006048 Bacteria 718
174 Ga0075364_10003383 3300006051 Bacteria 9061
175 Ga0075364_10027881 3300006051 Bacteria 3611
176 Ga0075432_10000660 3300006058 Bacteria 10552
177 Ga0070715_10000989 3300006163 Bacteria 7957
178 Ga0070715_10206773 3300006163 Bacteria 1001
179 Ga0070715_10328605 3300006163 Unclassified 828
180 Ga0070712_100018234 3300006175 Bacteria 4555
181 Ga0070712_100112774 3300006175 Bacteria 2032
182 Ga0070712_100120042 3300006175 Bacteria 1977
183 Ga0070712_100122974 3300006175 Bacteria 1955
184 Ga0070712_100169434 3300006175 Bacteria 1693
185 Ga0070712_100948197 3300006175 Unclassified 743
186 Ga0075362_10046636 3300006177 Bacteria 1928
187 Ga0075367_10006859 3300006178 Bacteria 5792
188 Ga0075367_10031403 3300006178 Bacteria 3050
189 Ga0075367_10065248 3300006178 Bacteria 2179
190 Ga0075367_10126955 3300006178 Bacteria 1575
191 Ga0075369_10137941 3300006186 Bacteria 1111
192 Ga0075366_10304577 3300006195 Bacteria 975
193 Ga0097621_100000416 3300006237 Bacteria 29698
194 Ga0097621_100007350 3300006237 Bacteria 7877
195 Ga0097621_100069248 3300006237 Bacteria 2913
196 Ga0075370_10090888 3300006353 Bacteria 1761
197 Ga0068871_100000249 3300006358 Bacteria 37516
198 Ga0068871_100004813 3300006358 Bacteria 9439
199 Ga0068871_100048128 3300006358 Bacteria 3440
200 Ga0075428_100042214 3300006844 Bacteria 5016
201 Ga0075428_100062287 3300006844 Bacteria 4085
202 Ga0075430_100002807 3300006846 Bacteria 14570
203 Ga0075430_100020814 3300006846 Bacteria 5576
204 Ga0075431_100016617 3300006847 Bacteria 7470
205 Ga0075431_100022318 3300006847 Bacteria 6469
206 Ga0075433_10001150 3300006852 Bacteria 19214
207 Ga0075433_10017415 3300006852 Bacteria 5950
208 Ga0075434_100003092 3300006871 Bacteria 14816
209 Ga0075434_100003158 3300006871 Bacteria 14688
210 Ga0075434_100073362 3300006871 Bacteria 3415
211 Ga0075429_100001089 3300006880 Bacteria 21839
212 Ga0068865_100000248 3300006881 Bacteria 30110
213 Ga0068865_100348128 3300006881 Bacteria 1199
214 Ga0075436_100283221 3300006914 Bacteria 1185
215 Ga0075436_100362632 3300006914 Bacteria 1046
216 Ga0097620_100005879 3300006931 Bacteria 12451
217 Ga0097620_100061449 3300006931 Bacteria 3786
218 Ga0097620_100666622 3300006931 Bacteria 1132
219 Ga0075435_100017893 3300007076 Bacteria 5372
220 Ga0075435_100141912 3300007076 Bacteria 2016
221 Ga0099794_10182799 3300007265 Bacteria 1070
222 Ga0105251_10011683 3300009011 Bacteria 5006
223 Ga0105244_10020578 3300009036 Bacteria 3663
224 Ga0105240_10034168 3300009093 Bacteria 6562
225 Ga0111539_10002489 3300009094 Bacteria 24423
226 Ga0111539_10002685 3300009094 Bacteria 23545
227 Ga0111539_10004243 3300009094 Bacteria 18781
228 Ga0111539_10071809 3300009094 Bacteria 4084
229 Ga0111539_10474430 3300009094 Bacteria 1457
230 Ga0111539_10951192 3300009094 Bacteria 999
231 Ga0105245_10115039 3300009098 Bacteria 2506
232 Ga0105245_10125883 3300009098 Bacteria 2399
233 Ga0105245_10180261 3300009098 Bacteria 2018
234 Ga0105247_10000908 3300009101 Bacteria 22289
235 Ga0105247_10287315 3300009101 Bacteria 1136
236 Ga0114129_10018021 3300009147 Bacteria 10057
237 Ga0114129_10019253 3300009147 Bacteria 9723
238 Ga0114129_10107955 3300009147 Bacteria 3844
239 Ga0105243_10001705 3300009148 Bacteria 18936
240 Ga0105243_10359390 3300009148 Bacteria 1340
241 Ga0105243_10518315 3300009148 Bacteria 1133
242 Ga0105241_10002306 3300009174 Bacteria 14330
243 Ga0105241_10448240 3300009174 Bacteria 1141
244 Ga0105241_10507727 3300009174 Bacteria 1076
245 Ga0105242_10001376 3300009176 Bacteria 19167
246 Ga0105242_10069731 3300009176 Bacteria 2912
247 Ga0105248_10005936 3300009177 Bacteria 13420
248 Ga0105248_10132244 3300009177 Bacteria 2815
249 Ga0105248_10299658 3300009177 Bacteria 1810
250 Ga0105248_10964103 3300009177 Bacteria 963
251 Ga0105237_10002245 3300009545 Bacteria 24070
252 Ga0105237_10260701 3300009545 Bacteria 1736
253 Ga0105238_10115503 3300009551 Bacteria 2664
254 Ga0105238_10122582 3300009551 Bacteria 2579
255 Ga0105238_10177386 3300009551 Bacteria 2107
256 Ga0105249_10000476 3300009553 Bacteria 37263
257 Ga0105239_10352320 3300010375 Bacteria 1662
258 Ga0105239_10659661 3300010375 Bacteria 1195
259 Ga0105239_10716743 3300010375 Bacteria 1144
260 Ga0105246_10000057 3300011119 Bacteria 44951
261 Ga0105246_10008212 3300011119 Bacteria 6413
262 Ga0157373_10033593 3300013100 Bacteria 3689
263 Ga0157373_10049870 3300013100 Bacteria 2982
264 Ga0157371_10013856 3300013102 Bacteria 6108
265 Ga0157370_10106417 3300013104 Bacteria 2625
266 Ga0157370_10160543 3300013104 Bacteria 2091
267 Ga0157369_10652341 3300013105 Bacteria 1085
268 Ga0157369_10897955 3300013105 Bacteria 909
269 Ga0157369_11106781 3300013105 Bacteria 810
270 Ga0157374_10304404 3300013296 Bacteria 1577
271 Ga0157374_10407080 3300013296 Bacteria 1358
272 Ga0157378_10006604 3300013297 Bacteria 10133
273 Ga0157378_10036611 3300013297 Bacteria 4343
274 Ga0157378_10139163 3300013297 Bacteria 2253
275 Ga0157378_10516555 3300013297 Bacteria 1195
276 Ga0163162_10001937 3300013306 Bacteria 19439
277 Ga0157372_10009498 3300013307 Bacteria 10344
278 Ga0157372_10055438 3300013307 Bacteria 4427
279 Ga0157372_10231439 3300013307 Bacteria 2143
280 Ga0157372_10806576 3300013307 Bacteria 1090
281 Ga0157375_10079527 3300013308 Bacteria 3314
282 Ga0157375_10459908 3300013308 Bacteria 1438
283 Ga0157375_10792671 3300013308 Bacteria 1096
284 Ga0163163_10003757 3300014325 Bacteria 12927
285 Ga0157380_10088614 3300014326 Bacteria 2547
286 Ga0157380_10191901 3300014326 Bacteria 1804
287 Ga0157377_10009792 3300014745 Bacteria 4721
288 Ga0157377_10075461 3300014745 Bacteria 1958
289 Ga0157379_10000293 3300014968 Bacteria 39625
290 Ga0157379_10404041 3300014968 Unclassified 1256
291 Ga0157379_10511275 3300014968 Bacteria 1114
292 Ga0157376_10000531 3300014969 Bacteria 24495
293 Ga0157376_10041358 3300014969 Bacteria 3773
294 Ga0157376_10392082 3300014969 Bacteria 1340
295 Ga0157376_10509077 3300014969 Bacteria 1184
296 Ga0163161_10000209 3300017792 Bacteria 53534
297 Ga0206356_10827474 3300020070 Bacteria 1216
298 Ga0207673_1000294 3300025290 Bacteria 5034
299 Ga0207697_10000044 3300025315 Bacteria 48337
300 Ga0207713_1025555 3300025735 Bacteria 2723
301 Ga0207682_10000260 3300025893 Bacteria 23782
302 Ga0207692_10022379 3300025898 Bacteria 2907
303 Ga0207692_10358001 3300025898 Bacteria 901
304 Ga0207692_10604413 3300025898 Bacteria 705
305 Ga0207710_10003110 3300025900 Bacteria 7435
306 Ga0207710_10003890 3300025900 Bacteria 6598
307 Ga0207688_10000723 3300025901 Bacteria 16367
308 Ga0207680_10018440 3300025903 Bacteria 3709
309 Ga0207680_10060435 3300025903 Bacteria 2307
310 Ga0207685_10070599 3300025905 Bacteria 1414
311 Ga0207685_10087856 3300025905 Bacteria 1302
312 Ga0207685_10454172 3300025905 Unclassified 667
313 Ga0207699_10003904 3300025906 Bacteria 7122
314 Ga0207699_10006701 3300025906 Bacteria 5590
315 Ga0207645_10092651 3300025907 Bacteria 1944
316 Ga0207645_10173285 3300025907 Bacteria 1415
317 Ga0207643_10000012 3300025908 Bacteria 133318
318 Ga0207705_10035014 3300025909 Bacteria 3592
319 Ga0207705_10051690 3300025909 Bacteria 2958
320 Ga0207654_10028155 3300025911 Bacteria 3062
321 Ga0207654_10253295 3300025911 Bacteria 1181
322 Ga0207707_10000551 3300025912 Bacteria 38020
323 Ga0207707_10071564 3300025912 Bacteria 3022
324 Ga0207707_10103791 3300025912 Bacteria 2484
325 Ga0207707_10249273 3300025912 Bacteria 1543
326 Ga0207707_10298593 3300025912 Bacteria 1393
327 Ga0207707_10348411 3300025912 Bacteria 1276
328 Ga0207695_10232716 3300025913 Bacteria 1746
329 Ga0207695_10290133 3300025913 Bacteria 1528
330 Ga0207695_10292090 3300025913 Bacteria 1522
331 Ga0207671_10059138 3300025914 Bacteria 2841
332 Ga0207693_10000861 3300025915 Bacteria 27070
333 Ga0207693_10002835 3300025915 Bacteria 15018
334 Ga0207693_10130885 3300025915 Bacteria 1972
335 Ga0207693_10137269 3300025915 Bacteria 1923
336 Ga0207693_10292608 3300025915 Bacteria 1276
337 Ga0207693_10382750 3300025915 Bacteria 1100
338 Ga0207663_10020213 3300025916 Bacteria 3768
339 Ga0207663_10042456 3300025916 Bacteria 2778
340 Ga0207663_10078827 3300025916 Bacteria 2149
341 Ga0207663_10213612 3300025916 Bacteria 1400
342 Ga0207663_10329840 3300025916 Bacteria 1149
343 Ga0207663_10353226 3300025916 Bacteria 1113
344 Ga0207660_10000992 3300025917 Bacteria 18816
345 Ga0207660_10049332 3300025917 Bacteria 2983
346 Ga0207660_10251974 3300025917 Bacteria 1394
347 Ga0207662_10155117 3300025918 Bacteria 1459
348 Ga0207657_10000358 3300025919 Bacteria 48238
349 Ga0207657_10013894 3300025919 Bacteria 7879
350 Ga0207657_10138740 3300025919 Bacteria 1988
351 Ga0207649_10000545 3300025920 Bacteria 26032
352 Ga0207649_10038207 3300025920 Bacteria 2905
353 Ga0207649_10065685 3300025920 Bacteria 2297
354 Ga0207649_10069769 3300025920 Bacteria 2239
355 Ga0207652_10012964 3300025921 Bacteria 6745
356 Ga0207652_10020676 3300025921 Bacteria 5424
357 Ga0207652_10241213 3300025921 Bacteria 1629
358 Ga0207652_10313606 3300025921 Bacteria 1416
359 Ga0207694_10025186 3300025924 Bacteria 4520
360 Ga0207694_10088687 3300025924 Bacteria 2438
361 Ga0207694_10159813 3300025924 Bacteria 1819
362 Ga0207694_11011883 3300025924 Bacteria 703
363 Ga0207650_10016372 3300025925 Bacteria 5183
364 Ga0207659_10000023 3300025926 Bacteria 142947
365 Ga0207687_10000149 3300025927 Bacteria 46713
366 Ga0207687_10016797 3300025927 Bacteria 4811
367 Ga0207687_10099594 3300025927 Bacteria 2136
368 Ga0207687_10101533 3300025927 Bacteria 2117
369 Ga0207700_10006638 3300025928 Bacteria 7014
370 Ga0207700_10069749 3300025928 Bacteria 2699
371 Ga0207700_10525959 3300025928 Bacteria 1048
372 Ga0207664_10124748 3300025929 Bacteria 2160
373 Ga0207664_10185409 3300025929 Bacteria 1789
374 Ga0207664_10198260 3300025929 Bacteria 1731
375 Ga0207644_10007018 3300025931 Bacteria 7334
376 Ga0207644_10014986 3300025931 Bacteria 5198
377 Ga0207644_10129318 3300025931 Bacteria 1931
378 Ga0207690_10000203 3300025932 Bacteria 46451
379 Ga0207690_10072033 3300025932 Bacteria 2386
380 Ga0207706_10002188 3300025933 Bacteria 19056
381 Ga0207706_10023762 3300025933 Bacteria 5500
382 Ga0207686_10001306 3300025934 Bacteria 14268
383 Ga0207686_10004009 3300025934 Bacteria 7903
384 Ga0207686_10030861 3300025934 Bacteria 3178
385 Ga0207709_10000852 3300025935 Bacteria 23321
386 Ga0207670_10005646 3300025936 Bacteria 6883
387 Ga0207669_10000357 3300025937 Bacteria 20792
388 Ga0207704_10002400 3300025938 Bacteria 8418
389 Ga0207704_10184785 3300025938 Bacteria 1510
390 Ga0207704_10369626 3300025938 Bacteria 1122
391 Ga0207665_10000259 3300025939 Bacteria 36733
392 Ga0207665_10040542 3300025939 Bacteria 3107
393 Ga0207691_10000256 3300025940 Bacteria 52748
394 Ga0207711_10012598 3300025941 Bacteria 7023
395 Ga0207711_10131169 3300025941 Bacteria 2247
396 Ga0207711_10644614 3300025941 Bacteria 988
397 Ga0207661_10000104 3300025944 Bacteria 53977
398 Ga0207661_10084958 3300025944 Bacteria 2623
399 Ga0207661_10125720 3300025944 Bacteria 2190
400 Ga0207661_10692496 3300025944 Unclassified 937
401 Ga0207679_10000196 3300025945 Bacteria 48433
402 Ga0207679_10036592 3300025945 Bacteria 3482
403 Ga0207679_10278182 3300025945 Bacteria 1434
404 Ga0207667_10032029 3300025949 Bacteria 5668
405 Ga0207667_10159306 3300025949 Bacteria 2322
406 Ga0207667_10511420 3300025949 Bacteria 1217
407 Ga0207651_10006894 3300025960 Bacteria 6000
408 Ga0207651_10637699 3300025960 Bacteria 934
409 Ga0207712_10000967 3300025961 Bacteria 20676
410 Ga0207668_10000251 3300025972 Bacteria 35861
411 Ga0207668_10259137 3300025972 Bacteria 1416
412 Ga0207668_10357362 3300025972 Bacteria 1223
413 Ga0207640_10000157 3300025981 Bacteria 49126
414 Ga0207640_10213072 3300025981 Bacteria 1473
415 Ga0207658_10008247 3300025986 Bacteria 7097
416 Ga0207658_10010507 3300025986 Bacteria 6288
417 Ga0207677_10000609 3300026023 Bacteria 22003
418 Ga0207677_10063697 3300026023 Bacteria 2564
419 Ga0207703_10028101 3300026035 Bacteria 4430
420 Ga0207703_10104869 3300026035 Bacteria 2402
421 Ga0207639_10002440 3300026041 Bacteria 12492
422 Ga0207678_10033403 3300026067 Bacteria 4482
423 Ga0207678_10046972 3300026067 Bacteria 3734
424 Ga0207708_10321582 3300026075 Bacteria 1263
425 Ga0207702_10000127 3300026078 Bacteria 89755
426 Ga0207702_10003955 3300026078 Bacteria 13300
427 Ga0207702_10035671 3300026078 Bacteria 4158
428 Ga0207702_10116890 3300026078 Bacteria 2381
429 Ga0207702_10771706 3300026078 Unclassified 950
430 Ga0207641_10002938 3300026088 Bacteria 15413
431 Ga0207641_10210093 3300026088 Bacteria 1799
432 Ga0207648_10259123 3300026089 Bacteria 1551
433 Ga0207648_10422334 3300026089 Bacteria 1211
434 Ga0207676_10003560 3300026095 Bacteria 11004
435 Ga0207676_10012794 3300026095 Bacteria 6021
436 Ga0207674_10074021 3300026116 Bacteria 3419
437 Ga0207675_100037598 3300026118 Bacteria 4514
438 Ga0207675_100084741 3300026118 Bacteria 2974
439 Ga0207683_10000006 3300026121 Bacteria 181260
440 Ga0207683_10005678 3300026121 Bacteria 10699
441 Ga0207683_10016442 3300026121 Bacteria 6297
442 Ga0207683_10320367 3300026121 Bacteria 1420
443 Ga0207698_10027501 3300026142 Bacteria 4039
444 Ga0207698_10149586 3300026142 Bacteria 2024
445 Ga0207698_10166421 3300026142 Bacteria 1935
446 Ga0207698_10180134 3300026142 Bacteria 1871
447 Ga0209966_1059297 3300027695 Unclassified 825
448 Ga0209813_10001619 3300027866 Bacteria 5069
449 Ga0209813_10184247 3300027866 Bacteria 765
450 Ga0207428_10000165 3300027907 Bacteria 91701
451 Ga0207428_10001251 3300027907 Bacteria 27203
452 Ga0268266_10016010 3300028379 Bacteria 6413
453 Ga0268266_10525072 3300028379 Bacteria 1132
454 Ga0268265_10001687 3300028380 Bacteria 18006
455 Ga0268265_10058369 3300028380 Bacteria 2946
456 Ga0268264_10002029 3300028381 Bacteria 18124
457 Ga0265337_1007401 3300028556 Bacteria 4109
458 Ga0265325_10001335 3300031241 Bacteria 17486
459 Ga0265340_10044955 3300031247 Bacteria 2159
460 Ga0265340_10109002 3300031247 Bacteria 1281
461 Ga0265331_10174125 3300031250 Bacteria 973
462 Ga0307408_100255695 3300031548 Bacteria 1447
463 Ga0265313_10000794 3300031595 Bacteria 31959
464 Ga0265313_10014122 3300031595 Bacteria 4743
465 Ga0265313_10025244 3300031595 Bacteria 3155
466 Ga0265314_10015576 3300031711 Bacteria 6028
467 Ga0265314_10090124 3300031711 Bacteria 1998
468 Ga0265342_10000502 3300031712 Bacteria 41908
469 Ga0265342_10160990 3300031712 Bacteria 1240
470 Ga0307405_10275416 3300031731 Bacteria 1264
471 Ga0307407_10263141 3300031903 Bacteria 1187
472 Ga0307409_101140086 3300031995 Bacteria 802
473 Ga0307416_100636320 3300032002 Bacteria 1150
474 Ga0373948_0009967 3300034817 Bacteria 1649
475 Ga0373950_0014085 3300034818 Bacteria 1342
476 Ga0373950_0028790 3300034818 Bacteria 1020
477 Ga0373938_0094212 3300034957 Bacteria 744
478 Ga0373926_0003377 3300035083 Bacteria 5142
479 Ga0373929_0000596 3300035085 Bacteria 6986
480 Ga0373934_0090144 3300035086 Bacteria 1236
481 Ga0373940_0096972 3300035088 Bacteria 891
482 Ga0373944_0002920 3300035089 Bacteria 4390
483 Ga0373949_0002185 3300035090 Bacteria 5118
484 Ga0373949_0060919 3300035090 Unclassified 971
485 Ga0373923_0001084 3300035111 Bacteria 7486
486 Ga0373923_0011523 3300035111 Bacteria 3245
487 Ga0373923_0217969 3300035111 Bacteria 886
488 Ga0373932_0000763 3300035112 Bacteria 9537
489 Ga0373932_0002786 3300035112 Bacteria 4339
490 Ga0373936_0002079 3300035113 Bacteria 7426
491 Ga0373939_0039401 3300035114 Bacteria 1414
492 Ga0373941_0002411 3300035115 Bacteria 4111
493 Ga0373941_0020841 3300035115 Bacteria 1842
494 Ga0373941_0075895 3300035115 Bacteria 1126
495 Ga0373945_0037427 3300035116 Bacteria 1741
496 Ga0373953_0004398 3300035117 Bacteria 4490
497 Ga0373953_0007220 3300035117 Bacteria 3710
498 Ga0373953_0024252 3300035117 Bacteria 2305
499 Ga0373953_0220635 3300035117 Bacteria 821
500 Ga0373954_0021988 3300035118 Bacteria 2891
501 Ga0373956_0145579 3300035119 Bacteria 1114
502 Ga0373957_0001408 3300035120 Bacteria 6499
503 Ga0373957_0010178 3300035120 Bacteria 3101
504 Ga0373957_0077481 3300035120 Bacteria 1308
505 Ga0373957_0106990 3300035120 Bacteria 1124
506 Ga0373957_0129719 3300035120 Bacteria 1026
507 Ga0373943_0100741 3300035170 Bacteria 1510
508 Ga0373946_0000794 3300035171 Bacteria 10763
509 Ga0373946_0016354 3300035171 Bacteria 2825
510 Ga0373955_0001974 3300035172 Bacteria 8836
511 Ga0373955_0003538 3300035172 Bacteria 6874
512 Ga0373955_0371639 3300035172 Bacteria 867
513 Ga0373942_0032731 3300035207 Bacteria 1382
514 Ga0373961_0045249 3300035241 Bacteria 1287
515 Ga0373961_0064737 3300035241 Bacteria 1118
516 Ga0373961_0230357 3300035241 Unclassified 664
517 Ga0373962_0000149 3300035242 Bacteria 14459
518 Ga0373924_0013418 3300035410 Bacteria 3079
519 Ga0373931_0004026 3300035691 Bacteria 6658
520 Ga0373931_0030856 3300035691 Bacteria 2762
521 Ga0373931_0036616 3300035691 Bacteria 2558
522 Ga0373935_0003725 3300035692 Bacteria 8896
523 Ga0373935_0025955 3300035692 Bacteria 3612
524 Ga0373935_0100099 3300035692 Bacteria 1909
525 Ga0373935_0135525 3300035692 Bacteria 1658
526 Ga0373927_0035622 3300035695 Bacteria 3236
527 Ga0373927_0207293 3300035695 Bacteria 1287
528 Ga0373933_0003823 3300035724 Bacteria 8326
529 Ga0373933_0128891 3300035724 Bacteria 1589
530 Ga0373933_0140477 3300035724 Bacteria 1525
531 Ga0373947_0001544 3300035725 Bacteria 14129
532 Ga0373947_0024502 3300035725 Bacteria 3516
533 Ga0373947_0102957 3300035725 Bacteria 1796
534 Ga0373947_0116879 3300035725 Bacteria 1691
535 Ga0373937_0001830 3300036401 Bacteria 17860
536 Ga0373937_0007531 3300036401 Bacteria 9425
537 Ga0373937_0009014 3300036401 Bacteria 8660
538 Ga0373937_0024275 3300036401 Bacteria 5466
539 Ga0373937_0293475 3300036401 Bacteria 1536
540 Ga0373937_0588535 3300036401 Bacteria 1056
541 Ga0373937_1165571 3300036401 Bacteria 719
542 Ga0373925_0004912 3300037068 Bacteria 10054
543 Ga0373925_0077311 3300037068 Bacteria 2525
544 Ga0395900_0001539 3300037418 Bacteria 27389
545 Ga0395900_0008197 3300037418 Bacteria 10753
546 Ga0395900_0347092 3300037418 Bacteria 1458
547 Ga0395898_0024475 3300037466 Bacteria 6090
548 Ga0395898_0073723 3300037466 Bacteria 3297
549 Ga0395898_0111152 3300037466 Bacteria 2626
550 Ga0395901_0017251 3300038443 Bacteria 7368
551 Ga0395901_0205285 3300038443 Bacteria 2065
552 Ga0395901_0492157 3300038443 Bacteria 1249
553 Ga0395901_0699406 3300038443 Bacteria 1011
554 Ga0395901_0845343 3300038443 Bacteria 901
555 Ga0436365_0197525 3300039437 Bacteria 2203
556 Ga0436365_0910431 3300039437 Bacteria 1523
557 Ga0439448_0139987 3300042005 Bacteria 837
558 Ga0439448_0172487 3300042005 Unclassified 755
559 Ga0439463_039328 3300042016 Bacteria 1201
560 Ga0466966_0564115 3300044684 Bacteria 685
561 Ga0466961_0356676 3300044693 Bacteria 890
562 Ga0466963_0075106 3300044694 Bacteria 2280
563 Ga0466963_0161557 3300044694 Bacteria 1559
564 Ga0466971_0079758 3300044719 Bacteria 1492
565 Ga0466957_0052705 3300044842 Bacteria 2478
566 Ga0466957_0441155 3300044842 Bacteria 896
567 Ga0466959_0419787 3300045049 Bacteria 908
568 Ga0466958_0090675 3300045836 Bacteria 1892
569 Ga0466967_0007437 3300045976 Bacteria 7900
570 Ga0466967_0544427 3300045976 Bacteria 1142
571 Ga0495627_059622 3300046453 Bacteria 1132
572 Ga0495592_0002092 3300046454 Bacteria 14074
573 Ga0495592_0002638 3300046454 Bacteria 12675
574 Ga0495592_0010694 3300046454 Bacteria 6919
575 Ga0495603_0006676 3300046455 Bacteria 6923
576 Ga0495603_0036586 3300046455 Bacteria 2947
577 Ga0495629_0000908 3300046459 Bacteria 23774
578 Ga0495629_0230211 3300046459 Bacteria 1277
579 Ga0495641_0013745 3300046461 Bacteria 4424
580 Ga0495641_0017916 3300046461 Bacteria 3670
581 Ga0495651_0008043 3300046462 Bacteria 8085
582 Ga0495651_0023214 3300046462 Bacteria 4824
583 Ga0495651_0046872 3300046462 Bacteria 3344
584 Ga0495653_0026709 3300046463 Bacteria 4627
585 Ga0495653_0039786 3300046463 Bacteria 3680
586 Ga0495653_0127908 3300046463 Bacteria 1802
587 Ga0495580_0046387 3300046472 Bacteria 3083
588 Ga0495580_0351202 3300046472 Bacteria 999
589 Ga0495582_0007835 3300046473 Bacteria 5902
590 Ga0495582_0198100 3300046473 Bacteria 1146
591 Ga0495639_0022182 3300046475 Bacteria 2783
592 Ga0495639_0218075 3300046475 Bacteria 937
593 Ga0495662_0002314 3300046476 Bacteria 9607
594 Ga0495664_0022985 3300046477 Bacteria 3615
595 Ga0495664_0049096 3300046477 Bacteria 2505
596 Ga0495664_0050039 3300046477 Bacteria 2480
597 Ga0495664_0069188 3300046477 Bacteria 2107
598 Ga0495585_0004760 3300046492 Bacteria 8737
599 Ga0495594_0009558 3300046499 Bacteria 5013
600 Ga0495608_0010237 3300046511 Bacteria 6544
601 Ga0495608_0025637 3300046511 Bacteria 4025
602 Ga0495608_0089899 3300046511 Bacteria 1987
603 Ga0495618_0061261 3300046514 Bacteria 2386
604 Ga0495628_0000115 3300046516 Bacteria 65159
605 Ga0495628_0016357 3300046516 Bacteria 6189
606 Ga0495628_0064058 3300046516 Bacteria 2878
607 Ga0495628_0327182 3300046516 Bacteria 1130
608 Ga0495630_0017488 3300046517 Bacteria 5253
609 Ga0495644_0000983 3300046523 Bacteria 11834
610 Ga0495666_0035219 3300046526 Bacteria 2441
611 Ga0495652_0007929 3300046529 Bacteria 9747
612 Ga0495652_0027254 3300046529 Bacteria 5036
613 Ga0495652_0335797 3300046529 Bacteria 1087
614 Ga0495652_0511103 3300046529 Bacteria 831
615 Ga0495665_0010075 3300046531 Bacteria 5121
616 Ga0495665_0223525 3300046531 Bacteria 973
617 Ga0495640_0021892 3300046533 Bacteria 4682
618 Ga0495640_0222347 3300046533 Bacteria 1190
619 Ga0495586_0016534 3300046535 Bacteria 3925
620 Ga0495587_0006245 3300046536 Bacteria 7779
621 Ga0495587_0025876 3300046536 Bacteria 3582
622 Ga0495645_0010751 3300046543 Bacteria 6431
623 Ga0495645_0040599 3300046543 Bacteria 3394
624 Ga0495645_0242017 3300046543 Bacteria 1203
625 Ga0495622_0003333 3300046557 Bacteria 7587
626 Ga0495633_0008234 3300046558 Bacteria 5898
627 Ga0495667_0000674 3300046559 Bacteria 21859
628 Ga0495667_0003600 3300046559 Bacteria 10422
629 Ga0495667_0004340 3300046559 Bacteria 9572
630 Ga0495667_0024150 3300046559 Bacteria 4094
631 Ga0495667_0202007 3300046559 Bacteria 1272
632 Ga0495656_0000789 3300046615 Bacteria 10214
633 Ga0495668_0030913 3300046616 Bacteria 3019
634 Ga0495634_0048425 3300046642 Bacteria 2861
635 Ga0495634_0556800 3300046642 Bacteria 668
636 Ga0495635_0002598 3300046663 Bacteria 12359
637 Ga0495635_0009000 3300046663 Bacteria 6965
638 Ga0495635_0088484 3300046663 Bacteria 2119
639 Ga0495588_0056271 3300046674 Bacteria 2030
640 Ga0495588_0253592 3300046674 Unclassified 927
641 Ga0495657_0011216 3300046675 Bacteria 6713
642 Ga0495657_0025756 3300046675 Bacteria 4174
643 Ga0495657_0249931 3300046675 Bacteria 1068
644 Ga0495599_0007173 3300046678 Bacteria 6749
645 Ga0495599_0076743 3300046678 Bacteria 2086
646 Ga0495623_0002539 3300046679 Bacteria 12066
647 Ga0495623_0156511 3300046679 Bacteria 1343
648 Ga0495646_0002845 3300046680 Bacteria 10710
649 Ga0495646_0006467 3300046680 Bacteria 7435
650 Ga0495647_0004015 3300046681 Bacteria 4746
651 Ga0495647_0052362 3300046681 Bacteria 1589
652 Ga0495658_0000673 3300046683 Bacteria 18551
653 Ga0495658_0008094 3300046683 Bacteria 5204
654 Ga0495658_0476925 3300046683 Bacteria 797
655 Ga0495613_0014051 3300046689 Bacteria 5941
656 Ga0495613_0081632 3300046689 Bacteria 2348
657 Ga0495613_0172715 3300046689 Bacteria 1533
658 Ga0495624_0004039 3300046690 Bacteria 10793
659 Ga0495624_0016763 3300046690 Bacteria 4930
660 Ga0495670_0000479 3300046691 Bacteria 18937
661 Ga0495600_0000876 3300046809 Bacteria 16075
662 Ga0495600_0023738 3300046809 Bacteria 3945
663 Ga0495600_0117715 3300046809 Bacteria 1729
664 Ga0495600_0176759 3300046809 Bacteria 1376
665 Ga0495600_0608250 3300046809 Unclassified 663
666 Ga0495581_0006390 3300047315 Bacteria 6837
667 Ga0495581_0246275 3300047315 Bacteria 1045
668 Ga0495604_0001990 3300047317 Bacteria 16501
669 Ga0495604_0011545 3300047317 Bacteria 7020
670 Ga0495604_0034521 3300047317 Bacteria 4001
671 Ga0495604_0042890 3300047317 Bacteria 3544
672 Ga0495674_0058181 3300047319 Bacteria 3380
673 Ga0495674_0086291 3300047319 Bacteria 2687
674 Ga0495676_0096041 3300047321 Bacteria 2204
675 Ga0495676_0589490 3300047321 Unclassified 724
676 Ga0495680_0002967 3300047322 Bacteria 16971
677 Ga0495680_0012672 3300047322 Bacteria 7404
678 Ga0495680_0067212 3300047322 Bacteria 2741
679 Ga0495680_0388493 3300047322 Bacteria 965
680 Ga0495675_0004560 3300047444 Bacteria 8399
681 Ga0495677_0147721 3300047445 Bacteria 904
682 Ga0495684_0003464 3300047471 Bacteria 12344
683 Ga0495684_0062460 3300047471 Bacteria 2833
684 Ga0495684_0104043 3300047471 Bacteria 2146
685 Ga0495593_0003537 3300047673 Bacteria 9347
686 Ga0495593_0013225 3300047673 Bacteria 4710
687 Ga0495602_0003665 3300048088 Bacteria 15920
688 Ga0495602_0004959 3300048088 Bacteria 13949
689 Ga0495602_0467081 3300048088 Bacteria 888
690 Ga0495614_0017736 3300048089 Bacteria 3090
691 Ga0496100_0004411 3300048903 Bacteria 7456
692 Ga0496100_0006203 3300048903 Bacteria 6501
693 Ga0496100_0686985 3300048903 Bacteria 798
694 Ga0496101_0000464 3300048904 Bacteria 25674
695 Ga0496101_0009586 3300048904 Bacteria 6368
696 Ga0496101_0011897 3300048904 Bacteria 5794
697 Ga0496102_0001120 3300048905 Bacteria 24582
698 Ga0496102_0070158 3300048905 Bacteria 3217
699 Ga0496102_0103831 3300048905 Bacteria 2643
700 Ga0496102_0190383 3300048905 Bacteria 1933
701 Ga0496103_0000611 3300048906 Bacteria 27883
702 Ga0496103_0354485 3300048906 Bacteria 943
703 Ga0496104_0000299 3300048907 Bacteria 43965
704 Ga0496104_0062993 3300048907 Bacteria 3516
705 Ga0496104_0172417 3300048907 Bacteria 2074
706 Ga0496104_0292657 3300048907 Bacteria 1541
707 Ga0496104_0381274 3300048907 Bacteria 1322
708 Ga0496104_0510295 3300048907 Bacteria 1113
709 Ga0496105_0001270 3300048908 Bacteria 17643
710 Ga0496105_0127114 3300048908 Bacteria 2101
711 Ga0496105_0631148 3300048908 Bacteria 828
712 Ga0496105_0682173 3300048908 Bacteria 790
713 Ga0496106_0000541 3300048909 Bacteria 26824
714 Ga0496106_0020520 3300048909 Bacteria 4904
715 Ga0496106_0028919 3300048909 Bacteria 4130
716 Ga0496106_0176585 3300048909 Bacteria 1694
717 Ga0496107_0001684 3300048910 Bacteria 13835
718 Ga0496107_0013772 3300048910 Bacteria 5655
719 Ga0496107_0092543 3300048910 Bacteria 2210
720 Ga0496107_0174072 3300048910 Bacteria 1597
721 Ga0496107_0180927 3300048910 Bacteria 1565
722 Ga0496108_0000938 3300048911 Bacteria 22748
723 Ga0496108_0111444 3300048911 Bacteria 2340
724 Ga0496108_0187033 3300048911 Bacteria 1794
725 Ga0496108_0189039 3300048911 Bacteria 1784
726 Ga0496109_0000696 3300048912 Bacteria 27921
727 Ga0496109_0000977 3300048912 Bacteria 23646
728 Ga0496109_0187871 3300048912 Bacteria 1941
729 Ga0496109_0194713 3300048912 Bacteria 1905
730 Ga0496109_0480097 3300048912 Bacteria 1173
731 Ga0496109_0527287 3300048912 Bacteria 1114
732 Ga0496110_0046716 3300048913 Bacteria 3788
733 Ga0496110_0120100 3300048913 Bacteria 2367
734 Ga0496110_0219369 3300048913 Bacteria 1729
735 Ga0496111_0011837 3300048914 Bacteria 5890
736 Ga0496111_0462631 3300048914 Bacteria 935
737 Ga0496112_0000590 3300048915 Bacteria 24921
738 Ga0496112_0015661 3300048915 Bacteria 7081
739 Ga0496112_0165902 3300048915 Bacteria 2174
740 Ga0496112_0429242 3300048915 Bacteria 1260
741 Ga0496113_0029056 3300048916 Bacteria 3986
742 Ga0496114_0014713 3300048917 Bacteria 6287
743 Ga0496114_0020001 3300048917 Bacteria 5430
744 Ga0496114_0249352 3300048917 Bacteria 1562
745 Ga0496115_0012499 3300048918 Bacteria 6391
746 Ga0496115_0041394 3300048918 Bacteria 3667
747 Ga0496115_0088266 3300048918 Bacteria 2531
748 Ga0496115_0192589 3300048918 Bacteria 1684
749 Ga0496115_0214971 3300048918 Bacteria 1587
750 Ga0496115_0500917 3300048918 Bacteria 976
751 Ga0496125_0340828 3300048928 Unclassified 899
752 Ga0501031_0132204 3300049568 Bacteria 1630
753 Ga0501032_0013787 3300049569 Bacteria 5735
754 Ga0501032_0016304 3300049569 Bacteria 5228
755 Ga0501032_0042076 3300049569 Bacteria 3100
756 Ga0501032_0082027 3300049569 Bacteria 2145
757 Ga0501033_0064262 3300049570 Bacteria 2701
758 Ga0501033_0066788 3300049570 Bacteria 2644
759 Ga0501033_0371647 3300049570 Bacteria 999
760 Ga0501033_0591870 3300049570 Bacteria 761
761 Ga0501034_0000229 3300049571 Bacteria 105030
762 Ga0501034_0013020 3300049571 Bacteria 8573
763 Ga0501034_0032378 3300049571 Bacteria 5310
764 Ga0501034_0059044 3300049571 Bacteria 3853
765 Ga0501034_0070747 3300049571 Bacteria 3499
766 Ga0501034_0121920 3300049571 Bacteria 2593
767 Ga0501034_0222208 3300049571 Bacteria 1841
768 Ga0501034_0243108 3300049571 Bacteria 1745
769 Ga0501034_0399864 3300049571 Bacteria 1296
770 Ga0501034_0419237 3300049571 Bacteria 1260
771 Ga0501036_0001657 3300049572 Bacteria 17249
772 Ga0501036_0015136 3300049572 Bacteria 6441
773 Ga0501036_0097906 3300049572 Bacteria 2479
774 Ga0501036_0435262 3300049572 Bacteria 1093
775 Ga0501037_0005935 3300049573 Bacteria 8917
776 Ga0501037_0018906 3300049573 Bacteria 5078
777 Ga0501037_0122082 3300049573 Bacteria 1872
778 Ga0501038_0013215 3300049574 Bacteria 7529
779 Ga0501038_0151456 3300049574 Bacteria 1890
780 Ga0501038_0352757 3300049574 Bacteria 1145
781 Ga0501039_0009233 3300049575 Bacteria 7515
782 Ga0501039_0041434 3300049575 Bacteria 3557
783 Ga0501040_0666518 3300049576 Bacteria 752
784 Ga0501041_0062732 3300049577 Bacteria 2276
785 Ga0501041_0645122 3300049577 Bacteria 677
786 Ga0501041_0690995 3300049577 Bacteria 653
787 Ga0501042_0093056 3300049578 Bacteria 2165
788 Ga0501042_0336662 3300049578 Bacteria 1091
789 Ga0501043_0002225 3300049579 Bacteria 16540
790 Ga0501043_0007079 3300049579 Bacteria 8927
791 Ga0501043_0011946 3300049579 Bacteria 6794
792 Ga0501043_0339742 3300049579 Bacteria 1142
793 Ga0501046_0015198 3300049580 Bacteria 6473
794 Ga0501046_0015379 3300049580 Bacteria 6432
795 Ga0501046_0083680 3300049580 Bacteria 2462
796 Ga0501046_0116620 3300049580 Bacteria 2035
797 Ga0501046_0284946 3300049580 Bacteria 1209
798 Ga0501047_0000314 3300049581 Bacteria 55906
799 Ga0501047_0020621 3300049581 Bacteria 6329
800 Ga0501047_0078071 3300049581 Bacteria 3184
801 Ga0501047_0078943 3300049581 Bacteria 3165
802 Ga0501047_0639787 3300049581 Bacteria 883
803 Ga0501048_0002000 3300049582 Bacteria 15488
804 Ga0501048_0066703 3300049582 Bacteria 2544
805 Ga0501048_0685812 3300049582 Bacteria 735
806 Ga0501067_0016018 3300049583 Bacteria 4146
807 Ga0501067_0163639 3300049583 Unclassified 1239
808 Ga0501067_0204963 3300049583 Bacteria 1098
809 Ga0501068_0021225 3300049584 Bacteria 3791
810 Ga0501068_0223643 3300049584 Bacteria 1196
811 Ga0501069_0020383 3300049585 Bacteria 3592
812 Ga0501069_0124614 3300049585 Bacteria 1473
813 Ga0501069_0164709 3300049585 Bacteria 1277
814 Ga0501069_0265866 3300049585 Bacteria 1002
815 Ga0501070_0007677 3300049586 Bacteria 9150
816 Ga0501070_0021163 3300049586 Bacteria 5458
817 Ga0501070_0036638 3300049586 Bacteria 4096
818 Ga0501070_0068451 3300049586 Bacteria 2939
819 Ga0501070_0078829 3300049586 Bacteria 2725
820 Ga0501070_0121095 3300049586 Bacteria 2162
821 Ga0501070_0175488 3300049586 Bacteria 1764
822 Ga0501070_0556253 3300049586 Bacteria 918
823 Ga0501071_0137072 3300049587 Bacteria 1821
824 Ga0501071_0385393 3300049587 Bacteria 1069
825 Ga0501071_0583521 3300049587 Bacteria 859
826 Ga0501072_0045302 3300049588 Bacteria 3458
827 Ga0501072_0222722 3300049588 Bacteria 1503
828 Ga0501072_0260323 3300049588 Bacteria 1381
829 Ga0501072_0509623 3300049588 Bacteria 951
830 Ga0501073_0007118 3300049589 Bacteria 8331
831 Ga0501073_0032059 3300049589 Bacteria 3748
832 Ga0501073_0033635 3300049589 Bacteria 3649
833 Ga0501073_0356355 3300049589 Bacteria 1010
834 Ga0501074_0012343 3300049590 Bacteria 6210
835 Ga0501074_0015285 3300049590 Bacteria 5578
836 Ga0501074_0036703 3300049590 Bacteria 3549
837 Ga0501074_0051749 3300049590 Bacteria 2964
838 Ga0501074_0097631 3300049590 Bacteria 2103
839 Ga0501075_0168132 3300049591 Bacteria 1673
840 Ga0501076_0117848 3300049592 Bacteria 2149
841 Ga0501076_0249678 3300049592 Bacteria 1452
842 Ga0501076_0337725 3300049592 Bacteria 1236
843 Ga0501077_0156958 3300049593 Bacteria 1444
844 Ga0501077_0161794 3300049593 Bacteria 1421
845 Ga0501079_0023277 3300049741 Bacteria 4755
846 Ga0501079_0184882 3300049741 Bacteria 1627
847 Ga0501079_0320540 3300049741 Bacteria 1213
848 Ga0501079_0361069 3300049741 Bacteria 1138
849 Ga0501080_0005419 3300049742 Bacteria 11382
850 Ga0501080_0048972 3300049742 Bacteria 3932
851 Ga0501080_0214905 3300049742 Bacteria 1761
852 Ga0501080_0276721 3300049742 Bacteria 1527
853 Ga0501080_0282549 3300049742 Bacteria 1508
854 Ga0501081_0098757 3300049743 Bacteria 2062
855 Ga0501083_0001743 3300049744 Bacteria 14830
856 Ga0501083_0090411 3300049744 Bacteria 2022
857 Ga0501083_0240287 3300049744 Bacteria 1179
858 Ga0501083_0260794 3300049744 Bacteria 1127
859 Ga0501035_0012411 3300049822 Bacteria 7875
860 Ga0501035_0221399 3300049822 Bacteria 1616
861 Ga0501035_0319539 3300049822 Bacteria 1304
862 Ga0501035_0343266 3300049822 Bacteria 1251
863 Ga0501035_0373755 3300049822 Bacteria 1189
864 Ga0501044_0026016 3300049823 Bacteria 6198
865 Ga0501044_0029583 3300049823 Bacteria 5774
866 Ga0501044_0030329 3300049823 Bacteria 5700
867 Ga0501044_0042476 3300049823 Bacteria 4728
868 Ga0501044_0075111 3300049823 Bacteria 3432
869 Ga0501044_0168287 3300049823 Bacteria 2164
870 Ga0501044_0243311 3300049823 Bacteria 1742
871 Ga0501044_0291385 3300049823 Bacteria 1563
872 Ga0501044_0517374 3300049823 Bacteria 1093
873 Ga0501044_0948085 3300049823 Bacteria 734
874 Ga0501045_0123442 3300049824 Bacteria 1923
875 nmdc:mga03n38_453050_c1 3300050490 Bacteria 714
876 nmdc:mga03n38_8356_c1 3300050490 Bacteria 3713
877 nmdc:mga03n38_92874_c1 3300050490 Bacteria 1440
878 nmdc:mga00v17_2703_c1 3300050491 Bacteria 9099
879 nmdc:mga00v17_481408_c1 3300050491 Bacteria 805
880 nmdc:mga0yw44_147276_c1 3300050492 Bacteria 1534
881 nmdc:mga0yw44_2990_c1 3300050492 Bacteria 7376
882 nmdc:mga0yw44_39217_c1 3300050492 Bacteria 2807
883 nmdc:mga06z11_11933_c1 3300050494 Bacteria 3764
884 nmdc:mga06z11_124640_c1 3300050494 Bacteria 1440
885 nmdc:mga06z11_13594_c1 3300050494 Bacteria 3581
886 nmdc:mga06z11_542205_c1 3300050494 Bacteria 706
887 nmdc:mga06z11_813_c1 3300050494 Bacteria 11419
888 nmdc:mga06z11_8820_c1 3300050494 Bacteria 4224
889 nmdc:mga04h51_1434_c1 3300050495 Bacteria 5521
890 nmdc:mga04h51_1837_c1 3300050495 Bacteria 4964
891 nmdc:mga04h51_210397_c1 3300050495 Bacteria 767
892 nmdc:mga04h51_35394_c1 3300050495 Bacteria 1600
893 nmdc:mga05p37_177673_c1 3300050507 Bacteria 2593
894 nmdc:mga05p37_2697_c1 3300050507 Bacteria 19225
895 nmdc:mga05p37_490392_c1 3300050507 Bacteria 1413
896 nmdc:mga05p37_82000_c1 3300050507 Bacteria 3973
897 nmdc:mga09592_14093_c1 3300050508 Bacteria 6526
898 nmdc:mga09592_369726_c1 3300050508 Bacteria 1240
899 nmdc:mga0qj67_693_c1 3300050509 Bacteria 22941
900 nmdc:mga0qj67_9904_c1 3300050509 Bacteria 7108
901 nmdc:mga06r32_1056_c1 3300050510 Bacteria 24895
902 nmdc:mga06r32_11208_c1 3300050510 Bacteria 8076
903 nmdc:mga06r32_3021_c1 3300050510 Bacteria 15083
904 nmdc:mga08y16_3846_c1 3300050511 Bacteria 15611
905 nmdc:mga08y16_86942_c1 3300050511 Bacteria 3257
906 nmdc:mga0n895_1654_c1 3300050512 Bacteria 16850
907 nmdc:mga0n895_291_c1 3300050512 Bacteria 33000
908 nmdc:mga0n895_787849_c1 3300050512 Bacteria 942
909 nmdc:mga0rr50_1013_c1 3300050513 Bacteria 15240
910 nmdc:mga0rr50_479234_c1 3300050513 Bacteria 1057
911 nmdc:mga08x19_106529_c1 3300050514 Bacteria 1865
912 nmdc:mga08x19_136597_c1 3300050514 Unclassified 1653
913 nmdc:mga08x19_53923_c1 3300050514 Bacteria 2587
914 nmdc:mga0a205_151212_c1 3300050515 Bacteria 2221
915 nmdc:mga0a205_467_c1 3300050515 Bacteria 29468
916 nmdc:mga0a205_581998_c1 3300050515 Bacteria 973
917 nmdc:mga0a205_6139_c1 3300050515 Bacteria 10841
918 nmdc:mga0sz30_117808_c1 3300050516 Bacteria 1166
919 Ga0495601_0000701 3300053077 Bacteria 17998
920 Ga0495601_0003725 3300053077 Bacteria 8772
921 Ga0495601_0034176 3300053077 Bacteria 3170
922 Ga0495601_0042664 3300053077 Bacteria 2846
923 Ga0495612_0000569 3300053078 Bacteria 14847
924 Ga0495612_0001410 3300053078 Bacteria 9882
925 Ga0495612_0008471 3300053078 Bacteria 4169
926 Ga0495612_0057632 3300053078 Bacteria 1604
927 Ga0495595_0001815 3300053084 Bacteria 8313
928 Ga0495595_0002638 3300053084 Bacteria 7037
929 Ga0495595_0010175 3300053084 Bacteria 3907
930 Ga0495595_0011206 3300053084 Bacteria 3745
931 Ga0495595_0080904 3300053084 Bacteria 1547
932 Ga0495595_0216773 3300053084 Bacteria 955
933 Ga0495595_0284191 3300053084 Unclassified 831
934 Ga0495619_0000159 3300053085 Bacteria 49689
935 Ga0495619_0000300 3300053085 Bacteria 34873
936 Ga0495619_0004640 3300053085 Bacteria 8756
937 Ga0495619_0008242 3300053085 Bacteria 6594
938 Ga0495619_0009949 3300053085 Bacteria 5989
939 Ga0500566_0331176 3300053094 Bacteria 705
940 Ga0500593_031273 3300053117 Bacteria 2380
941 Ga0500586_000409 3300053145 Bacteria 8597
942 Ga0500636_0001477 3300053177 Bacteria 12758
943 Ga0501084_0088980 3300054114 Bacteria 2592
944 Ga0501084_0372953 3300054114 Bacteria 1206
945 Ga0501084_0529620 3300054114 Bacteria 996
946 Ga0501082_0040790 3300060353 Bacteria 4003
947 Ga0501082_0125083 3300060353 Bacteria 2230
948 Ga0501082_0234824 3300060353 Bacteria 1596
949 Ga0501082_0247403 3300060353 Bacteria 1552
950 Ga0501082_0275176 3300060353 Bacteria 1466
951 Ga0501082_0404388 3300060353 Bacteria 1191
952 Ga0530510_0250296 3300061734 Bacteria 1320
953 Ga0530510_0404625 3300061734 Bacteria 1029
954 Ga0466958_0176840
955 JGI24032J14994_100964
956 JGI24746J21847_1000620
957 JGI24747J21853_1000939
958 JGI24747J21853_1008755
959 JGI24739J22299_10001041
960 JGI24745J21846_1000131
961 JGI24748J21848_1001208
962 JGI24738J21930_10000571
963 JGI24749J21850_1000415
964 JGI24749J21850_1006197
965 JGI24744J21845_10001089
966 JGI24034J26672_10001679
967 JGI24742J22300_10000080
968 JGI25405J52794_10003705
969 Ga0070658_10050265
970 Ga0070676_10000128
971 Ga0070676_10444281
972 Ga0070683_100000289
973 Ga0070683_100080750
974 Ga0070683_100400166
975 Ga0070690_100000935
976 Ga0070690_100066908
977 Ga0070670_100003173
978 Ga0070677_10000043
979 Ga0070666_10005381
980 Ga0070666_10136061
981 Ga0070680_100002347
982 Ga0070680_100009986
983 Ga0070680_100092243
984 Ga0070680_100224788
985 Ga0070680_100459248
986 Ga0070680_100624880
987 Ga0070682_100000528
988 Ga0070682_100037063
989 Ga0068868_100000408
990 Ga0068868_100133583
991 Ga0070660_100010085
992 Ga0070660_100011422
993 Ga0070689_100000819
994 Ga0070689_100039120
995 Ga0070691_10015622
996 Ga0070687_100000950
997 Ga0070687_100050490
998 Ga0070661_100000314
999 Ga0070661_100059190
1000 Ga0070661_100073243
1001 Ga0070661_100266880
1002 Ga0070692_10000310
1003 Ga0070668_100000857
1004 Ga0070668_100126421
1005 Ga0070668_100168165
1006 Ga0070675_100002240
1007 Ga0070671_100000598
1008 Ga0070671_100034340
1009 Ga0070674_100006534
1010 Ga0070674_100011212
1011 Ga0070673_100000289
1012 Ga0070673_100010566
1013 Ga0070688_100000189
1014 Ga0070688_100011682
1015 Ga0070659_100034177
1016 Ga0070659_100100339
1017 Ga0070659_100138140
1018 Ga0070667_100000436
1019 Ga0070667_100016498
1020 Ga0070703_10025825
1021 Ga0070709_10001788
1022 Ga0070709_10099368
1023 Ga0070709_10357448
1024 Ga0070714_100037701
1025 Ga0070714_100043964
1026 Ga0070714_100829782
1027 Ga0070713_100001448
1028 Ga0070713_100618982
1029 Ga0070710_10012602
1030 Ga0070710_10079652
1031 Ga0070711_100017964
1032 Ga0070711_100037273
1033 Ga0070711_100086719
1034 Ga0070711_100110447
1035 Ga0070711_100222275
1036 Ga0070711_100342080
1037 Ga0070711_100544809
1038 Ga0070705_100000781
1039 Ga0070705_100034313
1040 Ga0070705_100100485
1041 Ga0070700_100001610
1042 Ga0070708_100320014
1043 Ga0070663_100000297
1044 Ga0070663_100102460
1045 Ga0070663_100289653
1046 Ga0070678_100011789
1047 Ga0070678_100104777
1048 Ga0070662_100032794
1049 Ga0070662_100085677
1050 Ga0070662_100529872
1051 Ga0070681_10022181
1052 Ga0070681_10148718
1053 Ga0070681_10241732
1054 Ga0068867_100003318
1055 Ga0068867_100238130
1056 Ga0068867_100269566
1057 Ga0070685_10001152
1058 Ga0070685_10019022
1059 Ga0070707_100477815
1060 Ga0070679_100003016
1061 Ga0070679_100066275
1062 Ga0070679_100082823
1063 Ga0070679_100329755
1064 Ga0070679_100335289
1065 Ga0070679_100364379
1066 Ga0070679_100418442
1067 Ga0070684_100002293
1068 Ga0070684_100233479
1069 Ga0070672_100000106
1070 Ga0070686_100000615
1071 Ga0070686_100013219
1072 Ga0070695_100001248
1073 Ga0070696_100663534
1074 Ga0070693_100001863
1075 Ga0070693_100050332
1076 Ga0070665_100469924
1077 Ga0070665_100851724
1078 Ga0070704_100094818
1079 Ga0070704_100404242
1080 Ga0068855_100111919
1081 Ga0068855_100154833
1082 Ga0068855_100875141
1083 Ga0070664_100009338
1084 Ga0070664_100108430
1085 Ga0070664_101266167
1086 Ga0068857_100000047
1087 Ga0068857_100957013
1088 Ga0068854_100003161
1089 Ga0068854_100308470
1090 Ga0068856_100000505
1091 Ga0068856_100001905
1092 Ga0068856_100253550
1093 Ga0068856_100510238
1094 Ga0068856_100582167
1095 Ga0070702_100004825
1096 Ga0070702_100031024
1097 Ga0068852_100011300
1098 Ga0068852_100445886
1099 Ga0068859_100005879
1100 Ga0068859_100061450
1101 Ga0068859_100666543
1102 Ga0068864_100000931
1103 Ga0068864_100265640
1104 Ga0068866_10000077
1105 Ga0068866_10100282
1106 Ga0068866_10225940
1107 Ga0068861_100004701
1108 Ga0068861_100164001
1109 Ga0068861_100328706
1110 Ga0068870_10001017
1111 Ga0068863_100000543
1112 Ga0068858_100002073
1113 Ga0068858_100418566
1114 Ga0068860_100005115
1115 Ga0068860_100466387
1116 Ga0068862_100000879
1117 Ga0068862_100030509
1118 Ga0081455_10009848
1119 Ga0081538_10055356
1120 Ga0070717_10000287
1121 Ga0075365_10001551
1122 Ga0075365_10003415
1123 Ga0075368_10001935
1124 Ga0075368_10014056
1125 Ga0075363_100051029
1126 Ga0075363_100505628
1127 Ga0075364_10003383
1128 Ga0075364_10027881
1129 Ga0075432_10000660
1130 Ga0070715_10000989
1131 Ga0070715_10206773
1132 Ga0070715_10328605
1133 Ga0070712_100018234
1134 Ga0070712_100112774
1135 Ga0070712_100120042
1136 Ga0070712_100122974
1137 Ga0070712_100169434
1138 Ga0070712_100948197
1139 Ga0075362_10046636
1140 Ga0075367_10006859
1141 Ga0075367_10031403
1142 Ga0075367_10065248
1143 Ga0075367_10126955
1144 Ga0075369_10137941
1145 Ga0075366_10304577
1146 Ga0097621_100000416
1147 Ga0097621_100007350
1148 Ga0097621_100069248
1149 Ga0075370_10090888
1150 Ga0068871_100000249
1151 Ga0068871_100004813
1152 Ga0068871_100048128
1153 Ga0075428_100042214
1154 Ga0075428_100062287
1155 Ga0075430_100002807
1156 Ga0075430_100020814
1157 Ga0075431_100016617
1158 Ga0075431_100022318
1159 Ga0075433_10001150
1160 Ga0075433_10017415
1161 Ga0075434_100003092
1162 Ga0075434_100003158
1163 Ga0075434_100073362
1164 Ga0075429_100001089
1165 Ga0068865_100000248
1166 Ga0068865_100348128
1167 Ga0075436_100283221
1168 Ga0075436_100362632
1169 Ga0097620_100005879
1170 Ga0097620_100061449
1171 Ga0097620_100666622
1172 Ga0075435_100017893
1173 Ga0075435_100141912
1174 Ga0099794_10182799
1175 Ga0105251_10011683
1176 Ga0105244_10020578
1177 Ga0105240_10034168
1178 Ga0111539_10002489
1179 Ga0111539_10002685
1180 Ga0111539_10004243
1181 Ga0111539_10071809
1182 Ga0111539_10474430
1183 Ga0111539_10951192
1184 Ga0105245_10115039
1185 Ga0105245_10125883
1186 Ga0105245_10180261
1187 Ga0105247_10000908
1188 Ga0105247_10287315
1189 Ga0114129_10018021
1190 Ga0114129_10019253
1191 Ga0114129_10107955
1192 Ga0105243_10001705
1193 Ga0105243_10359390
1194 Ga0105243_10518315
1195 Ga0105241_10002306
1196 Ga0105241_10448240
1197 Ga0105241_10507727
1198 Ga0105242_10001376
1199 Ga0105242_10069731
1200 Ga0105248_10005936
1201 Ga0105248_10132244
1202 Ga0105248_10299658
1203 Ga0105248_10964103
1204 Ga0105237_10002245
1205 Ga0105237_10260701
1206 Ga0105238_10115503
1207 Ga0105238_10122582
1208 Ga0105238_10177386
1209 Ga0105249_10000476
1210 Ga0105239_10352320
1211 Ga0105239_10659661
1212 Ga0105239_10716743
1213 Ga0105246_10000057
1214 Ga0105246_10008212
1215 Ga0157373_10033593
1216 Ga0157373_10049870
1217 Ga0157371_10013856
1218 Ga0157370_10106417
1219 Ga0157370_10160543
1220 Ga0157369_10652341
1221 Ga0157369_10897955
1222 Ga0157369_11106781
1223 Ga0157374_10304404
1224 Ga0157374_10407080
1225 Ga0157378_10006604
1226 Ga0157378_10036611
1227 Ga0157378_10139163
1228 Ga0157378_10516555
1229 Ga0163162_10001937
1230 Ga0157372_10009498
1231 Ga0157372_10055438
1232 Ga0157372_10231439
1233 Ga0157372_10806576
1234 Ga0157375_10079527
1235 Ga0157375_10459908
1236 Ga0157375_10792671
1237 Ga0163163_10003757
1238 Ga0157380_10088614
1239 Ga0157380_10191901
1240 Ga0157377_10009792
1241 Ga0157377_10075461
1242 Ga0157379_10000293
1243 Ga0157379_10404041
1244 Ga0157379_10511275
1245 Ga0157376_10000531
1246 Ga0157376_10041358
1247 Ga0157376_10392082
1248 Ga0157376_10509077
1249 Ga0163161_10000209
1250 Ga0206356_10827474
1251 Ga0207673_1000294
1252 Ga0207697_10000044
1253 Ga0207713_1025555
1254 Ga0207682_10000260
1255 Ga0207692_10022379
1256 Ga0207692_10358001
1257 Ga0207692_10604413
1258 Ga0207710_10003110
1259 Ga0207710_10003890
1260 Ga0207688_10000723
1261 Ga0207680_10018440
1262 Ga0207680_10060435
1263 Ga0207685_10070599
1264 Ga0207685_10087856
1265 Ga0207685_10454172
1266 Ga0207699_10003904
1267 Ga0207699_10006701
1268 Ga0207645_10092651
1269 Ga0207645_10173285
1270 Ga0207643_10000012
1271 Ga0207705_10035014
1272 Ga0207705_10051690
1273 Ga0207654_10028155
1274 Ga0207654_10253295
1275 Ga0207707_10000551
1276 Ga0207707_10071564
1277 Ga0207707_10103791
1278 Ga0207707_10249273
1279 Ga0207707_10298593
1280 Ga0207707_10348411
1281 Ga0207695_10232716
1282 Ga0207695_10290133
1283 Ga0207695_10292090
1284 Ga0207671_10059138
1285 Ga0207693_10000861
1286 Ga0207693_10002835
1287 Ga0207693_10130885
1288 Ga0207693_10137269
1289 Ga0207693_10292608
1290 Ga0207693_10382750
1291 Ga0207663_10020213
1292 Ga0207663_10042456
1293 Ga0207663_10078827
1294 Ga0207663_10213612
1295 Ga0207663_10329840
1296 Ga0207663_10353226
1297 Ga0207660_10000992
1298 Ga0207660_10049332
1299 Ga0207660_10251974
1300 Ga0207662_10155117
1301 Ga0207657_10000358
1302 Ga0207657_10013894
1303 Ga0207657_10138740
1304 Ga0207649_10000545
1305 Ga0207649_10038207
1306 Ga0207649_10065685
1307 Ga0207649_10069769
1308 Ga0207652_10012964
1309 Ga0207652_10020676
1310 Ga0207652_10241213
1311 Ga0207652_10313606
1312 Ga0207694_10025186
1313 Ga0207694_10088687
1314 Ga0207694_10159813
1315 Ga0207694_11011883
1316 Ga0207650_10016372
1317 Ga0207659_10000023
1318 Ga0207687_10000149
1319 Ga0207687_10016797
1320 Ga0207687_10099594
1321 Ga0207687_10101533
1322 Ga0207700_10006638
1323 Ga0207700_10069749
1324 Ga0207700_10525959
1325 Ga0207664_10124748
1326 Ga0207664_10185409
1327 Ga0207664_10198260
1328 Ga0207644_10007018
1329 Ga0207644_10014986
1330 Ga0207644_10129318
1331 Ga0207690_10000203
1332 Ga0207690_10072033
1333 Ga0207706_10002188
1334 Ga0207706_10023762
1335 Ga0207686_10001306
1336 Ga0207686_10004009
1337 Ga0207686_10030861
1338 Ga0207709_10000852
1339 Ga0207670_10005646
1340 Ga0207669_10000357
1341 Ga0207704_10002400
1342 Ga0207704_10184785
1343 Ga0207704_10369626
1344 Ga0207665_10000259
1345 Ga0207665_10040542
1346 Ga0207691_10000256
1347 Ga0207711_10012598
1348 Ga0207711_10131169
1349 Ga0207711_10644614
1350 Ga0207661_10000104
1351 Ga0207661_10084958
1352 Ga0207661_10125720
1353 Ga0207661_10692496
1354 Ga0207679_10000196
1355 Ga0207679_10036592
1356 Ga0207679_10278182
1357 Ga0207667_10032029
1358 Ga0207667_10159306
1359 Ga0207667_10511420
1360 Ga0207651_10006894
1361 Ga0207651_10637699
1362 Ga0207712_10000967
1363 Ga0207668_10000251
1364 Ga0207668_10259137
1365 Ga0207668_10357362
1366 Ga0207640_10000157
1367 Ga0207640_10213072
1368 Ga0207658_10008247
1369 Ga0207658_10010507
1370 Ga0207677_10000609
1371 Ga0207677_10063697
1372 Ga0207703_10028101
1373 Ga0207703_10104869
1374 Ga0207639_10002440
1375 Ga0207678_10033403
1376 Ga0207678_10046972
1377 Ga0207708_10321582
1378 Ga0207702_10000127
1379 Ga0207702_10003955
1380 Ga0207702_10035671
1381 Ga0207702_10116890
1382 Ga0207702_10771706
1383 Ga0207641_10002938
1384 Ga0207641_10210093
1385 Ga0207648_10259123
1386 Ga0207648_10422334
1387 Ga0207676_10003560
1388 Ga0207676_10012794
1389 Ga0207674_10074021
1390 Ga0207675_100037598
1391 Ga0207675_100084741
1392 Ga0207683_10000006
1393 Ga0207683_10005678
1394 Ga0207683_10016442
1395 Ga0207683_10320367
1396 Ga0207698_10027501
1397 Ga0207698_10149586
1398 Ga0207698_10166421
1399 Ga0207698_10180134
1400 Ga0209966_1059297
1401 Ga0209813_10001619
1402 Ga0209813_10184247
1403 Ga0207428_10000165
1404 Ga0207428_10001251
1405 Ga0268266_10016010
1406 Ga0268266_10525072
1407 Ga0268265_10001687
1408 Ga0268265_10058369
1409 Ga0268264_10002029
1410 Ga0265337_1007401
1411 Ga0265325_10001335
1412 Ga0265340_10044955
1413 Ga0265340_10109002
1414 Ga0265331_10174125
1415 Ga0307408_100255695
1416 Ga0265313_10000794
1417 Ga0265313_10014122
1418 Ga0265313_10025244
1419 Ga0265314_10015576
1420 Ga0265314_10090124
1421 Ga0265342_10000502
1422 Ga0265342_10160990
1423 Ga0307405_10275416
1424 Ga0307407_10263141
1425 Ga0307409_101140086
1426 Ga0307416_100636320
1427 Ga0373948_0009967
1428 Ga0373950_0014085
1429 Ga0373950_0028790
1430 Ga0373938_0094212
1431 Ga0373926_0003377
1432 Ga0373929_0000596
1433 Ga0373934_0090144
1434 Ga0373940_0096972
1435 Ga0373944_0002920
1436 Ga0373949_0002185
1437 Ga0373949_0060919
1438 Ga0373923_0001084
1439 Ga0373923_0011523
1440 Ga0373923_0217969
1441 Ga0373932_0000763
1442 Ga0373932_0002786
1443 Ga0373936_0002079
1444 Ga0373939_0039401
1445 Ga0373941_0002411
1446 Ga0373941_0020841
1447 Ga0373941_0075895
1448 Ga0373945_0037427
1449 Ga0373953_0004398
1450 Ga0373953_0007220
1451 Ga0373953_0024252
1452 Ga0373953_0220635
1453 Ga0373954_0021988
1454 Ga0373956_0145579
1455 Ga0373957_0001408
1456 Ga0373957_0010178
1457 Ga0373957_0077481
1458 Ga0373957_0106990
1459 Ga0373957_0129719
1460 Ga0373943_0100741
1461 Ga0373946_0000794
1462 Ga0373946_0016354
1463 Ga0373955_0001974
1464 Ga0373955_0003538
1465 Ga0373955_0371639
1466 Ga0373942_0032731
1467 Ga0373961_0045249
1468 Ga0373961_0064737
1469 Ga0373961_0230357
1470 Ga0373962_0000149
1471 Ga0373924_0013418
1472 Ga0373931_0004026
1473 Ga0373931_0030856
1474 Ga0373931_0036616
1475 Ga0373935_0003725
1476 Ga0373935_0025955
1477 Ga0373935_0100099
1478 Ga0373935_0135525
1479 Ga0373927_0035622
1480 Ga0373927_0207293
1481 Ga0373933_0003823
1482 Ga0373933_0128891
1483 Ga0373933_0140477
1484 Ga0373947_0001544
1485 Ga0373947_0024502
1486 Ga0373947_0102957
1487 Ga0373947_0116879
1488 Ga0373937_0001830
1489 Ga0373937_0007531
1490 Ga0373937_0009014
1491 Ga0373937_0024275
1492 Ga0373937_0293475
1493 Ga0373937_0588535
1494 Ga0373937_1165571
1495 Ga0373925_0004912
1496 Ga0373925_0077311
1497 Ga0395900_0001539
1498 Ga0395900_0008197
1499 Ga0395900_0347092
1500 Ga0395898_0024475
1501 Ga0395898_0073723
1502 Ga0395898_0111152
1503 Ga0395901_0017251
1504 Ga0395901_0205285
1505 Ga0395901_0492157
1506 Ga0395901_0699406
1507 Ga0395901_0845343
1508 Ga0436365_0197525
1509 Ga0436365_0910431
1510 Ga0439448_0139987
1511 Ga0439448_0172487
1512 Ga0439463_039328
1513 Ga0466966_0564115
1514 Ga0466961_0356676
1515 Ga0466963_0075106
1516 Ga0466963_0161557
1517 Ga0466971_0079758
1518 Ga0466957_0052705
1519 Ga0466957_0441155
1520 Ga0466959_0419787
1521 Ga0466958_0090675
1522 Ga0466967_0007437
1523 Ga0466967_0544427
1524 Ga0495627_059622
1525 Ga0495592_0002092
1526 Ga0495592_0002638
1527 Ga0495592_0010694
1528 Ga0495603_0006676
1529 Ga0495603_0036586
1530 Ga0495629_0000908
1531 Ga0495629_0230211
1532 Ga0495641_0013745
1533 Ga0495641_0017916
1534 Ga0495651_0008043
1535 Ga0495651_0023214
1536 Ga0495651_0046872
1537 Ga0495653_0026709
1538 Ga0495653_0039786
1539 Ga0495653_0127908
1540 Ga0495580_0046387
1541 Ga0495580_0351202
1542 Ga0495582_0007835
1543 Ga0495582_0198100
1544 Ga0495639_0022182
1545 Ga0495639_0218075
1546 Ga0495662_0002314
1547 Ga0495664_0022985
1548 Ga0495664_0049096
1549 Ga0495664_0050039
1550 Ga0495664_0069188
1551 Ga0495585_0004760
1552 Ga0495594_0009558
1553 Ga0495608_0010237
1554 Ga0495608_0025637
1555 Ga0495608_0089899
1556 Ga0495618_0061261
1557 Ga0495628_0000115
1558 Ga0495628_0016357
1559 Ga0495628_0064058
1560 Ga0495628_0327182
1561 Ga0495630_0017488
1562 Ga0495644_0000983
1563 Ga0495666_0035219
1564 Ga0495652_0007929
1565 Ga0495652_0027254
1566 Ga0495652_0335797
1567 Ga0495652_0511103
1568 Ga0495665_0010075
1569 Ga0495665_0223525
1570 Ga0495640_0021892
1571 Ga0495640_0222347
1572 Ga0495586_0016534
1573 Ga0495587_0006245
1574 Ga0495587_0025876
1575 Ga0495645_0010751
1576 Ga0495645_0040599
1577 Ga0495645_0242017
1578 Ga0495622_0003333
1579 Ga0495633_0008234
1580 Ga0495667_0000674
1581 Ga0495667_0003600
1582 Ga0495667_0004340
1583 Ga0495667_0024150
1584 Ga0495667_0202007
1585 Ga0495656_0000789
1586 Ga0495668_0030913
1587 Ga0495634_0048425
1588 Ga0495634_0556800
1589 Ga0495635_0002598
1590 Ga0495635_0009000
1591 Ga0495635_0088484
1592 Ga0495588_0056271
1593 Ga0495588_0253592
1594 Ga0495657_0011216
1595 Ga0495657_0025756
1596 Ga0495657_0249931
1597 Ga0495599_0007173
1598 Ga0495599_0076743
1599 Ga0495623_0002539
1600 Ga0495623_0156511
1601 Ga0495646_0002845
1602 Ga0495646_0006467
1603 Ga0495647_0004015
1604 Ga0495647_0052362
1605 Ga0495658_0000673
1606 Ga0495658_0008094
1607 Ga0495658_0476925
1608 Ga0495613_0014051
1609 Ga0495613_0081632
1610 Ga0495613_0172715
1611 Ga0495624_0004039
1612 Ga0495624_0016763
1613 Ga0495670_0000479
1614 Ga0495600_0000876
1615 Ga0495600_0023738
1616 Ga0495600_0117715
1617 Ga0495600_0176759
1618 Ga0495600_0608250
1619 Ga0495581_0006390
1620 Ga0495581_0246275
1621 Ga0495604_0001990
1622 Ga0495604_0011545
1623 Ga0495604_0034521
1624 Ga0495604_0042890
1625 Ga0495674_0058181
1626 Ga0495674_0086291
1627 Ga0495676_0096041
1628 Ga0495676_0589490
1629 Ga0495680_0002967
1630 Ga0495680_0012672
1631 Ga0495680_0067212
1632 Ga0495680_0388493
1633 Ga0495675_0004560
1634 Ga0495677_0147721
1635 Ga0495684_0003464
1636 Ga0495684_0062460
1637 Ga0495684_0104043
1638 Ga0495593_0003537
1639 Ga0495593_0013225
1640 Ga0495602_0003665
1641 Ga0495602_0004959
1642 Ga0495602_0467081
1643 Ga0495614_0017736
1644 Ga0496100_0004411
1645 Ga0496100_0006203
1646 Ga0496100_0686985
1647 Ga0496101_0000464
1648 Ga0496101_0009586
1649 Ga0496101_0011897
1650 Ga0496102_0001120
1651 Ga0496102_0070158
1652 Ga0496102_0103831
1653 Ga0496102_0190383
1654 Ga0496103_0000611
1655 Ga0496103_0354485
1656 Ga0496104_0000299
1657 Ga0496104_0062993
1658 Ga0496104_0172417
1659 Ga0496104_0292657
1660 Ga0496104_0381274
1661 Ga0496104_0510295
1662 Ga0496105_0001270
1663 Ga0496105_0127114
1664 Ga0496105_0631148
1665 Ga0496105_0682173
1666 Ga0496106_0000541
1667 Ga0496106_0020520
1668 Ga0496106_0028919
1669 Ga0496106_0176585
1670 Ga0496107_0001684
1671 Ga0496107_0013772
1672 Ga0496107_0092543
1673 Ga0496107_0174072
1674 Ga0496107_0180927
1675 Ga0496108_0000938
1676 Ga0496108_0111444
1677 Ga0496108_0187033
1678 Ga0496108_0189039
1679 Ga0496109_0000696
1680 Ga0496109_0000977
1681 Ga0496109_0187871
1682 Ga0496109_0194713
1683 Ga0496109_0480097
1684 Ga0496109_0527287
1685 Ga0496110_0046716
1686 Ga0496110_0120100
1687 Ga0496110_0219369
1688 Ga0496111_0011837
1689 Ga0496111_0462631
1690 Ga0496112_0000590
1691 Ga0496112_0015661
1692 Ga0496112_0165902
1693 Ga0496112_0429242
1694 Ga0496113_0029056
1695 Ga0496114_0014713
1696 Ga0496114_0020001
1697 Ga0496114_0249352
1698 Ga0496115_0012499
1699 Ga0496115_0041394
1700 Ga0496115_0088266
1701 Ga0496115_0192589
1702 Ga0496115_0214971
1703 Ga0496115_0500917
1704 Ga0496125_0340828
1705 Ga0501031_0132204
1706 Ga0501032_0013787
1707 Ga0501032_0016304
1708 Ga0501032_0042076
1709 Ga0501032_0082027
1710 Ga0501033_0064262
1711 Ga0501033_0066788
1712 Ga0501033_0371647
1713 Ga0501033_0591870
1714 Ga0501034_0000229
1715 Ga0501034_0013020
1716 Ga0501034_0032378
1717 Ga0501034_0059044
1718 Ga0501034_0070747
1719 Ga0501034_0121920
1720 Ga0501034_0222208
1721 Ga0501034_0243108
1722 Ga0501034_0399864
1723 Ga0501034_0419237
1724 Ga0501036_0001657
1725 Ga0501036_0015136
1726 Ga0501036_0097906
1727 Ga0501036_0435262
1728 Ga0501037_0005935
1729 Ga0501037_0018906
1730 Ga0501037_0122082
1731 Ga0501038_0013215
1732 Ga0501038_0151456
1733 Ga0501038_0352757
1734 Ga0501039_0009233
1735 Ga0501039_0041434
1736 Ga0501040_0666518
1737 Ga0501041_0062732
1738 Ga0501041_0645122
1739 Ga0501041_0690995
1740 Ga0501042_0093056
1741 Ga0501042_0336662
1742 Ga0501043_0002225
1743 Ga0501043_0007079
1744 Ga0501043_0011946
1745 Ga0501043_0339742
1746 Ga0501046_0015198
1747 Ga0501046_0015379
1748 Ga0501046_0083680
1749 Ga0501046_0116620
1750 Ga0501046_0284946
1751 Ga0501047_0000314
1752 Ga0501047_0020621
1753 Ga0501047_0078071
1754 Ga0501047_0078943
1755 Ga0501047_0639787
1756 Ga0501048_0002000
1757 Ga0501048_0066703
1758 Ga0501048_0685812
1759 Ga0501067_0016018
1760 Ga0501067_0163639
1761 Ga0501067_0204963
1762 Ga0501068_0021225
1763 Ga0501068_0223643
1764 Ga0501069_0020383
1765 Ga0501069_0124614
1766 Ga0501069_0164709
1767 Ga0501069_0265866
1768 Ga0501070_0007677
1769 Ga0501070_0021163
1770 Ga0501070_0036638
1771 Ga0501070_0068451
1772 Ga0501070_0078829
1773 Ga0501070_0121095
1774 Ga0501070_0175488
1775 Ga0501070_0556253
1776 Ga0501071_0137072
1777 Ga0501071_0385393
1778 Ga0501071_0583521
1779 Ga0501072_0045302
1780 Ga0501072_0222722
1781 Ga0501072_0260323
1782 Ga0501072_0509623
1783 Ga0501073_0007118
1784 Ga0501073_0032059
1785 Ga0501073_0033635
1786 Ga0501073_0356355
1787 Ga0501074_0012343
1788 Ga0501074_0015285
1789 Ga0501074_0036703
1790 Ga0501074_0051749
1791 Ga0501074_0097631
1792 Ga0501075_0168132
1793 Ga0501076_0117848
1794 Ga0501076_0249678
1795 Ga0501076_0337725
1796 Ga0501077_0156958
1797 Ga0501077_0161794
1798 Ga0501079_0023277
1799 Ga0501079_0184882
1800 Ga0501079_0320540
1801 Ga0501079_0361069
1802 Ga0501080_0005419
1803 Ga0501080_0048972
1804 Ga0501080_0214905
1805 Ga0501080_0276721
1806 Ga0501080_0282549
1807 Ga0501081_0098757
1808 Ga0501083_0001743
1809 Ga0501083_0090411
1810 Ga0501083_0240287
1811 Ga0501083_0260794
1812 Ga0501035_0012411
1813 Ga0501035_0221399
1814 Ga0501035_0319539
1815 Ga0501035_0343266
1816 Ga0501035_0373755
1817 Ga0501044_0026016
1818 Ga0501044_0029583
1819 Ga0501044_0030329
1820 Ga0501044_0042476
1821 Ga0501044_0075111
1822 Ga0501044_0168287
1823 Ga0501044_0243311
1824 Ga0501044_0291385
1825 Ga0501044_0517374
1826 Ga0501044_0948085
1827 Ga0501045_0123442
1828 nmdc:mga03n38_453050_c1
1829 nmdc:mga03n38_8356_c1
1830 nmdc:mga03n38_92874_c1
1831 nmdc:mga00v17_2703_c1
1832 nmdc:mga00v17_481408_c1
1833 nmdc:mga0yw44_147276_c1
1834 nmdc:mga0yw44_2990_c1
1835 nmdc:mga0yw44_39217_c1
1836 nmdc:mga06z11_11933_c1
1837 nmdc:mga06z11_124640_c1
1838 nmdc:mga06z11_13594_c1
1839 nmdc:mga06z11_542205_c1
1840 nmdc:mga06z11_813_c1
1841 nmdc:mga06z11_8820_c1
1842 nmdc:mga04h51_1434_c1
1843 nmdc:mga04h51_1837_c1
1844 nmdc:mga04h51_210397_c1
1845 nmdc:mga04h51_35394_c1
1846 nmdc:mga05p37_177673_c1
1847 nmdc:mga05p37_2697_c1
1848 nmdc:mga05p37_490392_c1
1849 nmdc:mga05p37_82000_c1
1850 nmdc:mga09592_14093_c1
1851 nmdc:mga09592_369726_c1
1852 nmdc:mga0qj67_693_c1
1853 nmdc:mga0qj67_9904_c1
1854 nmdc:mga06r32_1056_c1
1855 nmdc:mga06r32_11208_c1
1856 nmdc:mga06r32_3021_c1
1857 nmdc:mga08y16_3846_c1
1858 nmdc:mga08y16_86942_c1
1859 nmdc:mga0n895_1654_c1
1860 nmdc:mga0n895_291_c1
1861 nmdc:mga0n895_787849_c1
1862 nmdc:mga0rr50_1013_c1
1863 nmdc:mga0rr50_479234_c1
1864 nmdc:mga08x19_106529_c1
1865 nmdc:mga08x19_136597_c1
1866 nmdc:mga08x19_53923_c1
1867 nmdc:mga0a205_151212_c1
1868 nmdc:mga0a205_467_c1
1869 nmdc:mga0a205_581998_c1
1870 nmdc:mga0a205_6139_c1
1871 nmdc:mga0sz30_117808_c1
1872 Ga0495601_0000701
1873 Ga0495601_0003725
1874 Ga0495601_0034176
1875 Ga0495601_0042664
1876 Ga0495612_0000569
1877 Ga0495612_0001410
1878 Ga0495612_0008471
1879 Ga0495612_0057632
1880 Ga0495595_0001815
1881 Ga0495595_0002638
1882 Ga0495595_0010175
1883 Ga0495595_0011206
1884 Ga0495595_0080904
1885 Ga0495595_0216773
1886 Ga0495595_0284191
1887 Ga0495619_0000159
1888 Ga0495619_0000300
1889 Ga0495619_0004640
1890 Ga0495619_0008242
1891 Ga0495619_0009949
1892 Ga0500566_0331176
1893 Ga0500593_031273
1894 Ga0500586_000409
1895 Ga0500636_0001477
1896 Ga0501084_0088980
1897 Ga0501084_0372953
1898 Ga0501084_0529620
1899 Ga0501082_0040790
1900 Ga0501082_0125083
1901 Ga0501082_0234824
1902 Ga0501082_0247403
1903 Ga0501082_0275176
1904 Ga0501082_0404388
1905 Ga0530510_0250296
1906 Ga0530510_0404625

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

6

181

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iby-assembly1.cif.gz_A human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 0.8946 9 203
5ajv-assembly1.cif.gz_B human pfkfb3 in complex with an indole inhibitor 1 0.8892 9 202
1tip-assembly1.cif.gz_B the bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 0.8886 9 203
5ajz-assembly1.cif.gz_A-2 human pfkfb3 in complex with an indole inhibitor 5 0.8844 9 203
5ajy-assembly1.cif.gz_A human pfkfb3 in complex with an indole inhibitor 4 0.8838 9 203
ID Description Score Start End Superfamily
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8792 9 194 3.40.50.1240
af_Q54SI2_327_480_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.863 63 188 3.40.50.1240
af_A0A1D6QHM8_37_228_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8622 9 195 3.40.50.1240
af_Q9N590_245_450_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8619 9 203 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8596 9 194 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A345ZVN2-F1-model_v4 Histidine phosphatase family protein 0.9998 7 204 GO:0005737
GO:0016791
AF-A0A345ZVN2-F1-model_v4 Histidine phosphatase family protein 0.9898 7 204 GO:0005737
GO:0016791
AF-A0A1H9LY98-F1-model_v4 deleted 0.9857 5 202
AF-Q6NAI5-F1-model_v4 Histidine phosphatase family protein (Possible phosphoglycerate mutase) 0.9841 9 204 GO:0005737
GO:0016791
AF-A0A1G8DQ38-F1-model_v4 Probable phosphoglycerate mutase 0.9814 8 202 GO:0005737
GO:0016791

Map