F486222

General Info

Members Datasets Scaffolds Average Seq Length
937 714 444 261

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10274169|Ga0207639_102741692
Length 312
Sequence MIDVSNLVVRLGGKAVVKEVSFAAEPGTLTAICGPNGSGKTTTMKAISGELAYQGSVHMNGSEIGSLQAWQLAEMRGVLPQASSISFPFTVREIVRMGLTTGRNSRPEQADRIAADALACVDLIGFEGRFYQELSGGEQQRVQLARVLCQISEPVIDGKPCWLLLDEPVSSLDISHQLTIMTLARQFCRRGGGVIAVMHDLNLTALFADQMVLLKEGQLRAAGPVREVLQDRHLQDIFGCNLRVNRIPADGVPFVLAHSALPWAPVVPDPEPAEVRPRVYRTRAALSVRLARIADAVAPRGWVPQHHTASSR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
32 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
33 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
34 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
35 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
36 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
37 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
38 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
39 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
40 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
47 2519899620 Rhizobium sp. Pop5 Isolate Nodule
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
50 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
51 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
61 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
62 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
63 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
64 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
65 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
66 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
67 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
68 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
69 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
70 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
71 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
72 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
82 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
83 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
86 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
87 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
88 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
89 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
90 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
91 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
92 2643221557 Ensifer sp. Root558 Isolate Unclassified
93 2643221599 Rhizobium sp. Root708 Isolate Unclassified
94 2643221607 Rhizobium sp. Root73 Isolate Unclassified
95 2643221610 Ensifer sp. Root74 Isolate Unclassified
96 2643221618 Ensifer sp. Root231 Isolate Unclassified
97 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
98 2643221626 Ensifer sp. Root31 Isolate Unclassified
99 2643221629 Devosia sp. Root105 Isolate Unclassified
100 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
101 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
102 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
103 2643221655 Ensifer sp. Root1252 Isolate Unclassified
104 2643221659 Ensifer sp. Root127 Isolate Unclassified
105 2643221662 Devosia sp. Root413D1 Isolate Unclassified
106 2643221668 Ensifer sp. Root423 Isolate Unclassified
107 2643221675 Ensifer sp. Root1298 Isolate Unclassified
108 2643221680 Ensifer sp. Root1312 Isolate Unclassified
109 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
110 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
111 2643221698 Ensifer sp. Root142 Isolate Unclassified
112 2643221712 Ensifer sp. Root258 Isolate Unclassified
113 2643221718 Rhizobium sp. Root268 Isolate Unclassified
114 2643221723 Ensifer sp. Root278 Isolate Unclassified
115 2643221726 Ensifer sp. Root954 Isolate Unclassified
116 2643221736 Bosea sp. Root483D1 Isolate Unclassified
117 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
118 2718217927 Rhizobium sp. N324 Isolate Nodule
119 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
120 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
121 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
122 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
123 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
124 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
125 2718218423 Rhizobium sp. N941 Isolate Nodule
126 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
127 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
128 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
129 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
130 2721755809 Rhizobium sp. N541 Isolate Nodule
131 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
132 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
133 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
134 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
135 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
136 2738541293 Rhizobium sp. GV031 Isolate Unclassified
137 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
138 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
139 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
140 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
141 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
142 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
143 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
144 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
145 2791355256 Rhizobium sp. M10 Isolate Nodule
146 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
147 2791355260 Rhizobium sp. L9 Isolate Nodule
148 2791355261 Rhizobium sp. J15 Isolate Nodule
149 2791355263 Rhizobium chutanense C5 Isolate Nodule
150 2791355265 Rhizobium sp. H4 Isolate Nodule
151 2791355266 Rhizobium sp. L43 Isolate Nodule
152 2791355267 Rhizobium sp. L18 Isolate Nodule
153 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
154 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
155 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
156 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
157 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
158 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
159 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
160 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
161 2802429633 Rhizobium anhuiense J3 Isolate Nodule
162 2802429634 Rhizobium anhuiense S10 Isolate Nodule
163 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
164 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
165 2802429637 Rhizobium anhuiense C15 Isolate Nodule
166 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
167 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
168 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
169 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
170 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
171 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
172 2838048938 Rhizobium pisi 27/80 Isolate Nodule
173 2838061910 Rhizobium phaseoli L15 Isolate Nodule
174 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
175 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
176 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
177 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
178 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
179 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
180 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
181 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
182 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
183 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
184 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
185 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
186 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
187 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
188 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
189 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
190 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
191 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
192 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
193 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
194 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
195 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
196 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
197 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
198 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
199 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
200 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
201 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
202 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
203 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
204 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
205 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
206 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
207 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
208 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
209 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
210 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
211 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
212 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
213 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
214 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
215 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
216 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
217 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
218 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
219 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
220 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
221 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
222 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
223 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
224 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
225 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
226 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
227 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
228 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
229 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
230 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
231 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
232 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
233 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
234 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
235 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
236 2844163670 Ensifer sp. 1H6 Isolate Unclassified
237 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
238 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
239 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
240 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
241 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
242 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
243 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
244 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
245 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
246 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
247 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
248 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
249 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
250 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
251 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
252 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
253 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
254 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
255 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
256 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
257 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
258 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
259 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
260 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
261 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
262 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
263 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
264 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
265 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
266 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
267 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
268 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
269 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
270 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
271 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
272 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
273 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
274 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
275 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
276 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
277 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
278 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
279 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
280 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
281 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
282 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
283 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
284 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
285 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
286 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
287 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
288 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
289 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
290 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
291 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
292 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
293 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
294 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
295 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
296 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
297 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
298 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
299 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
300 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
301 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
302 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
303 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
304 2933599457 Rhizobium phaseoli M3 Isolate Nodule
305 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
306 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
307 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
308 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
309 2936381700 Rhizobium chutanense C16 Isolate Unclassified
310 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
311 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
312 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
313 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
314 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
315 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
316 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
317 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
318 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
319 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
320 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
321 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
322 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
323 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
324 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
325 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
326 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
327 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
328 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
329 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
330 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
331 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
332 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
333 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
334 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
335 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
336 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
337 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
338 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
339 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
340 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
341 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
342 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
343 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
344 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
345 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
346 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
347 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
348 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
349 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
350 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
351 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
352 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
353 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
354 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
355 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
356 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
357 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
358 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
359 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
360 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
361 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
362 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
363 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
364 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
365 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
366 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
367 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
368 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
369 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
370 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
371 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
372 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
373 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
374 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
375 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
376 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
377 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
378 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
379 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
380 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
381 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
382 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
383 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
384 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
385 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
386 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
387 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
388 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
389 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
390 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
391 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
392 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
393 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
394 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
395 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
396 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
397 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
398 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
399 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
400 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
401 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
402 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
403 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
404 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
405 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
406 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
407 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
408 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
409 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
410 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
411 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
412 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
413 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
414 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
415 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
416 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
417 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
418 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
419 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
420 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
421 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
422 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
423 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
424 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
425 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
426 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
427 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
428 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
429 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
430 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
431 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
432 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
433 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
434 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
435 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
436 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
437 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
438 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
439 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
440 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
441 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
442 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
443 2996887358 Rhizobium sp. R711 Isolate Nodule
444 2996893221 Rhizobium sp. R635 Isolate Nodule
445 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
446 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
447 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
448 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
449 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
450 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
451 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
452 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
453 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
454 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
455 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
456 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
457 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
458 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
459 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
460 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
461 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
462 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
463 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
464 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
465 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
466 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
467 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
468 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
469 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
470 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
471 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
472 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
473 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
474 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
475 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
476 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
477 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
478 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
479 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
480 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
481 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
482 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
483 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
484 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
485 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
486 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
487 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
488 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
489 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
490 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
491 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
492 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
493 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
494 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
495 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
496 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
497 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
498 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
499 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
500 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
501 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
502 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
503 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
504 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
505 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
506 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
507 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
508 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
509 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
510 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
511 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
512 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
513 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
514 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
515 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
516 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
517 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
518 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
527 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
528 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
529 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
531 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
532 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
533 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
534 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
535 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
536 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
537 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
538 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
539 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
540 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
541 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
542 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
543 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
544 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
545 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
546 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
547 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
548 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
549 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
550 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
551 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
552 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
553 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
554 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
555 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
556 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
557 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
558 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
559 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
560 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
561 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
562 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
563 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
564 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
565 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
566 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
567 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
568 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
569 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
570 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
571 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
572 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
573 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
574 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
575 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
576 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
577 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
578 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
579 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
580 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
581 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
582 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
583 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
584 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
585 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
586 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
587 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
588 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
589 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
590 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
591 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
592 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
593 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
594 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
595 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
596 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
597 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
598 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
599 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
600 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
601 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
602 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
603 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
604 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
605 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
606 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
611 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
612 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
613 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
614 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
615 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
616 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
617 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
618 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
619 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
620 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
621 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
622 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
623 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
624 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
625 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
626 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
627 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
628 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
631 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
633 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
634 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
635 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
636 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
638 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
639 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
640 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
641 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
642 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
643 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
645 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
646 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
647 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
648 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
649 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
650 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
651 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
652 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
653 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
654 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
655 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
656 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
657 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
658 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
659 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
660 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
661 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
662 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
663 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
664 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
665 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
666 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
667 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
668 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
669 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
670 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
671 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
672 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
673 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
674 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
675 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
676 8005258706 Rhizobium sp. R693 Isolate Nodule
677 8005275841 Rhizobium sp. N4311 Isolate Nodule
678 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
679 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
680 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
681 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
682 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
683 8005321885 Rhizobium sp. R72 Isolate Nodule
684 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
685 8005382845 Rhizobium sp. R634 Isolate Nodule
686 8005395548 Rhizobium sp. R339 Isolate Nodule
687 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
688 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
689 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
690 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
691 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
692 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
693 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
694 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
695 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
696 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
697 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
698 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
699 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
700 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
701 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
702 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
703 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
704 8018176218 Rhizobium sp. N122 Isolate Nodule
705 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
706 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
707 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
708 8024501048 Rhizobium sp. H4 Isolate Nodule
709 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
710 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
711 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
712 8056382006 Rhizobium croatiense 13T Isolate Nodule
713 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
714 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.39
Metatranscriptomes 0
Isolates 52.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.61
Nodule 41.52
Rhizoplane 1.81
Rhizosphere 23.27
Stem 0
Stem Tuber 0
Unclassified 15.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004555 3300001979 Bacteria 5963
2 JGI25162J39368_1000149 3300002737 Bacteria 76227
3 JGI25162J39368_1000211 3300002737 Bacteria 61063
4 JGI25152J39213_1000899 3300002773 Bacteria 14563
5 JGI25152J39213_1003034 3300002773 Bacteria 5924
6 JGI25159J45721_1000008 3300002987 Bacteria 172667
7 JGI25159J45721_1006352 3300002987 Bacteria 3547
8 JGI25151J46595_10000027 3300003187 Bacteria 208739
9 JGI25151J46595_10001211 3300003187 Bacteria 18438
10 JGI25151J46595_10008331 3300003187 Bacteria 4995
11 JGI25151J46595_10014542 3300003187 Bacteria 3502
12 JGI25151J46595_10022311 3300003187 Bacteria 2631
13 JGI25165J46597_1000938 3300003214 Bacteria 19980
14 JGI25165J46597_1001280 3300003214 Bacteria 14630
15 JGI25165J46597_1004226 3300003214 Bacteria 3165
16 JGI25153J46596_10000608 3300003215 Bacteria 21909
17 JGI25153J46596_10003461 3300003215 Bacteria 8839
18 JGI25153J46596_10007133 3300003215 Bacteria 5544
19 rootL2_10007936 3300003322 Bacteria 8791
20 rootH1_10025853 3300003323 Bacteria 1804
21 rootH1_10025854 3300003323 Bacteria 2122
22 rootH1_10148901 3300003323 Bacteria 1207
23 JGI25160J50197_1000001 3300003354 Bacteria 782301
24 JGI25160J50197_1000033 3300003354 Bacteria 172667
25 JGI25160J50197_1001321 3300003354 Bacteria 12519
26 JGI25160J50197_1001492 3300003354 Bacteria 11623
27 JGI25161J50226_1000001 3300003374 Bacteria 655036
28 JGI25161J50226_1000163 3300003374 Bacteria 46470
29 JGI25161J50226_1002090 3300003374 Bacteria 5397
30 Ga0055526_1001871 3300003771 Bacteria 14577
31 Ga0055526_1002020 3300003771 Bacteria 13960
32 Ga0055526_1002721 3300003771 Bacteria 11747
33 Ga0055526_1025387 3300003771 Bacteria 1903
34 Ga0055524_1001345 3300003775 Bacteria 14335
35 Ga0055524_1012228 3300003775 Bacteria 3305
36 Ga0055524_1023782 3300003775 Bacteria 1964
37 Ga0055524_1043633 3300003775 Bacteria 1100
38 Ga0055528_1000247 3300003790 Bacteria 45698
39 Ga0055528_1003198 3300003790 Bacteria 8371
40 Ga0055528_1008999 3300003790 Bacteria 4215
41 Ga0055528_1026883 3300003790 Bacteria 1638
42 Ga0055540_1000607 3300003792 Bacteria 25671
43 Ga0055540_1001828 3300003792 Bacteria 12035
44 Ga0055531_10030140 3300003794 Bacteria 1830
45 Ga0055543_1000007 3300004625 Bacteria 204042
46 Ga0055543_1000026 3300004625 Bacteria 136177
47 Ga0055543_1000104 3300004625 Bacteria 73576
48 Ga0055543_1000108 3300004625 Bacteria 71519
49 Ga0065165_1000008 3300005262 Bacteria 334429
50 Ga0065165_1000178 3300005262 Bacteria 113319
51 Ga0065165_1010050 3300005262 Bacteria 4155
52 Ga0065165_1033708 3300005262 Bacteria 1591
53 Ga0070670_100001446 3300005331 Bacteria 19064
54 Ga0070668_100483315 3300005347 Bacteria 1070
55 Ga0070665_100146523 3300005548 Bacteria 2364
56 Ga0070665_100169482 3300005548 Bacteria 2185
57 Ga0070665_100326144 3300005548 Bacteria 1539
58 Ga0068855_100100926 3300005563 Bacteria 3322
59 Ga0068856_100039412 3300005614 Bacteria 4639
60 Ga0068856_100053210 3300005614 Bacteria 3992
61 Ga0068852_100312888 3300005616 Bacteria 1523
62 Ga0075365_10002133 3300006038 Bacteria 9493
63 Ga0075365_10083738 3300006038 Bacteria 2164
64 Ga0075365_10215109 3300006038 Bacteria 1348
65 Ga0075363_100127193 3300006048 Bacteria 1427
66 Ga0075362_10007089 3300006177 Bacteria 4218
67 Ga0075367_10002388 3300006178 Bacteria 8556
68 Ga0075369_10001117 3300006186 Bacteria 9017
69 Ga0075369_10097713 3300006186 Bacteria 1315
70 Ga0075370_10034712 3300006353 Bacteria 2828
71 Ga0079104_1005065 3300006946 Bacteria 5372
72 Ga0105244_10189625 3300009036 Bacteria 973
73 Ga0105240_10000014 3300009093 Bacteria 482033
74 Ga0105237_10001161 3300009545 Bacteria 35234
75 Ga0105238_10566216 3300009551 Bacteria 1141
76 Ga0123341_1000018 3300009765 Bacteria 81421
77 Ga0123341_1078856 3300009765 Bacteria 1318
78 Ga0123341_1090639 3300009765 Bacteria 1099
79 Ga0123342_1009978 3300009766 Bacteria 11071
80 Ga0123342_1038664 3300009766 Bacteria 1848
81 Ga0105239_10005301 3300010375 Bacteria 15145
82 Ga0157373_10123453 3300013100 Bacteria 1820
83 Ga0157370_10000015 3300013104 Bacteria 185771
84 Ga0171463_1007 3300013249 Bacteria 301198
85 Ga0182008_10060340 3300014497 Bacteria 1870
86 Ga0182007_10000385 3300015262 Bacteria 27600
87 Ga0183363_1078 3300015690 Bacteria 29406
88 Ga0214542_1015589 3300021321 Bacteria 7832
89 Ga0214543_1000022 3300021327 Bacteria 241930
90 Ga0228711_1000017 3300022739 Bacteria 121084
91 Ga0228710_1000005 3300022740 Bacteria 233531
92 Ga0209436_100058 3300025208 Bacteria 60755
93 Ga0209436_101354 3300025208 Bacteria 8660
94 Ga0209437_100058 3300025233 Bacteria 357279
95 Ga0209437_100060 3300025233 Bacteria 355034
96 Ga0207425_1000043 3300025245 Bacteria 208791
97 Ga0207425_1000436 3300025245 Bacteria 27617
98 Ga0207425_1002033 3300025245 Bacteria 7534
99 Ga0209677_100289 3300025253 Bacteria 33302
100 Ga0209148_1003810 3300025254 Bacteria 3949
101 Ga0209129_1000072 3300025258 Bacteria 208805
102 Ga0209129_1000128 3300025258 Bacteria 130420
103 Ga0209129_1000765 3300025258 Bacteria 20447
104 Ga0209129_1001667 3300025258 Bacteria 12027
105 Ga0209129_1004976 3300025258 Bacteria 4912
106 Ga0209129_1006922 3300025258 Bacteria 3510
107 Ga0209129_1006924 3300025258 Bacteria 3509
108 Ga0209233_1000137 3300025261 Bacteria 200314
109 Ga0209233_1000149 3300025261 Bacteria 181183
110 Ga0209233_1000160 3300025261 Bacteria 159035
111 Ga0209233_1013152 3300025261 Bacteria 2370
112 Ga0209565_1030534 3300025263 Bacteria 1052
113 Ga0209673_1000025 3300025273 Bacteria 404572
114 Ga0209673_1000125 3300025273 Bacteria 168465
115 Ga0209673_1000256 3300025273 Bacteria 100514
116 Ga0209673_1001756 3300025273 Bacteria 18064
117 Ga0209673_1003121 3300025273 Bacteria 10126
118 Ga0209673_1004623 3300025273 Bacteria 7285
119 Ga0209673_1037816 3300025273 Bacteria 1413
120 Ga0209673_1053543 3300025273 Bacteria 1052
121 Ga0209130_1000003 3300025284 Bacteria 677988
122 Ga0209130_1000017 3300025284 Bacteria 388431
123 Ga0209130_1000023 3300025284 Bacteria 359355
124 Ga0209675_1028676 3300025291 Bacteria 1350
125 Ga0209676_1012015 3300025292 Bacteria 3442
126 Ga0209676_1034027 3300025292 Bacteria 1510
127 Ga0209025_1000120 3300025294 Bacteria 208791
128 Ga0209025_1000153 3300025294 Bacteria 170548
129 Ga0209025_1000451 3300025294 Bacteria 80470
130 Ga0209025_1000537 3300025294 Bacteria 71838
131 Ga0209025_1000545 3300025294 Bacteria 70608
132 Ga0209025_1008140 3300025294 Bacteria 7612
133 Ga0209025_1009023 3300025294 Bacteria 7037
134 Ga0209025_1076920 3300025294 Bacteria 1153
135 Ga0209564_1000013 3300025295 Bacteria 775755
136 Ga0209564_1000259 3300025295 Bacteria 112570
137 Ga0209564_1000841 3300025295 Bacteria 41363
138 Ga0209564_1002367 3300025295 Bacteria 15158
139 Ga0209564_1002386 3300025295 Bacteria 15044
140 Ga0209564_1010644 3300025295 Bacteria 4209
141 Ga0209564_1020991 3300025295 Bacteria 2370
142 Ga0209758_1000111 3300025297 Bacteria 208790
143 Ga0209758_1000254 3300025297 Bacteria 107330
144 Ga0209758_1000592 3300025297 Bacteria 56476
145 Ga0209758_1000678 3300025297 Bacteria 50806
146 Ga0209758_1003028 3300025297 Bacteria 16025
147 Ga0209758_1004877 3300025297 Bacteria 10795
148 Ga0209758_1032268 3300025297 Bacteria 2130
149 Ga0209758_1038456 3300025297 Bacteria 1835
150 Ga0209050_1009447 3300025298 Bacteria 4989
151 Ga0209050_1015458 3300025298 Bacteria 3203
152 Ga0209256_1000211 3300025299 Bacteria 110131
153 Ga0209256_1000283 3300025299 Bacteria 89387
154 Ga0209256_1000669 3300025299 Bacteria 46351
155 Ga0209256_1000885 3300025299 Bacteria 36961
156 Ga0209256_1002050 3300025299 Bacteria 17868
157 Ga0209256_1009263 3300025299 Bacteria 4349
158 Ga0209256_1024647 3300025299 Bacteria 1767
159 Ga0209256_1038223 3300025299 Bacteria 1245
160 Ga0207426_1000006 3300025302 Bacteria 1025969
161 Ga0207426_1000011 3300025302 Bacteria 791203
162 Ga0207426_1000087 3300025302 Bacteria 288870
163 Ga0207426_1000208 3300025302 Bacteria 140385
164 Ga0207426_1000936 3300025302 Bacteria 29086
165 Ga0209051_1000176 3300025303 Bacteria 115875
166 Ga0209051_1003032 3300025303 Bacteria 11372
167 Ga0209051_1003066 3300025303 Bacteria 11293
168 Ga0209051_1021245 3300025303 Bacteria 2770
169 Ga0209051_1056082 3300025303 Bacteria 1274
170 Ga0209257_1004862 3300025304 Bacteria 9928
171 Ga0209257_1013370 3300025304 Bacteria 3660
172 Ga0207695_10000037 3300025913 Bacteria 476303
173 Ga0207671_10000080 3300025914 Bacteria 148567
174 Ga0207650_10000624 3300025925 Bacteria 28219
175 Ga0207644_10015740 3300025931 Bacteria 5082
176 Ga0207640_10319644 3300025981 Bacteria 1235
177 Ga0207639_10274169 3300026041 Bacteria 1481
178 Ga0207702_10043016 3300026078 Bacteria 3791
179 Ga0207702_10045362 3300026078 Bacteria 3698
180 Ga0207698_10343433 3300026142 Bacteria 1407
181 Ga0209281_1000082 3300027111 Bacteria 257684
182 Ga0209281_1001180 3300027111 Bacteria 18042
183 Ga0209371_1002582 3300027312 Bacteria 9967
184 Ga0209282_1000006 3300027666 Bacteria 276998
185 Ga0268266_10097108 3300028379 Bacteria 2591
186 Ga0268266_10154083 3300028379 Bacteria 2074
187 Ga0268266_10265403 3300028379 Bacteria 1592
188 Ga0307515_10000017 3300028794 Bacteria 550465
189 Ga0307515_10005257 3300028794 Bacteria 26313
190 Ga0307515_10006504 3300028794 Bacteria 23375
191 Ga0268256_1003727 3300030500 Bacteria 6704
192 Ga0307513_10002736 3300031456 Bacteria 24255
193 Ga0307513_10004524 3300031456 Bacteria 18536
194 Ga0307408_100191993 3300031548 Bacteria 1646
195 Ga0307405_10001465 3300031731 Bacteria 9949
196 Ga0307410_10148222 3300031852 Bacteria 1744
197 Ga0307412_10001457 3300031911 Bacteria 13166
198 Ga0315914_1000003 3300031967 Bacteria 314370
199 Ga0315913_1000001 3300033430 Bacteria 284459
200 Ga0315915_1000008 3300033464 Bacteria 258517
201 Ga0395898_0076038 3300037466 Bacteria 3243
202 Ga0395901_0165628 3300038443 Bacteria 2321
203 Ga0439436_0002190 3300041404 Bacteria 5843
204 Ga0439466_0063380 3300041411 Bacteria 1186
205 Ga0439465_0005328 3300041413 Bacteria 4109
206 Ga0439465_0005625 3300041413 Bacteria 3992
207 Ga0439465_0006019 3300041413 Bacteria 3856
208 Ga0439465_0063530 3300041413 Bacteria 1227
209 Ga0439465_0066573 3300041413 Bacteria 1201
210 Ga0451807_0935891 3300041486 Bacteria 983
211 Ga0451839_0542176 3300041496 Bacteria 3127
212 Ga0451841_0577157 3300041498 Bacteria 3073
213 Ga0451845_0517278 3300041501 Bacteria 1796
214 Ga0451845_0608757 3300041501 Bacteria 1321
215 Ga0451851_0417130 3300041507 Bacteria 3124
216 Ga0451855_0274722 3300041511 Bacteria 803
217 Ga0451853_3019187 3300041512 Bacteria 1536
218 Ga0439431_0004203 3300041997 Bacteria 3158
219 Ga0439449_0009721 3300042007 Bacteria 3639
220 Ga0439449_0011947 3300042007 Bacteria 3264
221 Ga0439462_0002411 3300042015 Bacteria 4341
222 Ga0450910_003987 3300042147 Bacteria 1982
223 Ga0439434_0004579 3300042435 Bacteria 4047
224 Ga0450918_007282 3300042531 Bacteria 1961
225 Ga0466966_0108748 3300044684 Bacteria 1710
226 Ga0466963_0051153 3300044694 Bacteria 2737
227 Ga0466971_0067186 3300044719 Bacteria 1625
228 Ga0466970_0008960 3300044765 Bacteria 5046
229 Ga0466957_0121407 3300044842 Bacteria 1666
230 Ga0466958_0039723 3300045836 Bacteria 2827
231 Ga0495617_040351 3300046452 Bacteria 1561
232 Ga0495592_0231349 3300046454 Bacteria 1230
233 Ga0495629_0183097 3300046459 Bacteria 1451
234 Ga0495638_0000746 3300046460 Bacteria 34841
235 Ga0495650_0056795 3300046471 Bacteria 1587
236 Ga0495605_0001667 3300046474 Bacteria 14285
237 Ga0495585_0059643 3300046492 Bacteria 2102
238 Ga0495607_0029078 3300046501 Bacteria 3404
239 Ga0495607_0030837 3300046501 Bacteria 3287
240 Ga0495583_0014903 3300046506 Bacteria 4256
241 Ga0495606_0001297 3300046507 Bacteria 34485
242 Ga0495606_0037171 3300046507 Bacteria 3308
243 Ga0495610_0002186 3300046512 Bacteria 16597
244 Ga0495616_0009440 3300046513 Bacteria 5706
245 Ga0495618_0069806 3300046514 Bacteria 2234
246 Ga0495620_0022072 3300046515 Bacteria 3075
247 Ga0495620_0027186 3300046515 Bacteria 2680
248 Ga0495631_0000518 3300046518 Bacteria 25896
249 Ga0495632_0001449 3300046519 Bacteria 19723
250 Ga0495632_0006976 3300046519 Bacteria 7171
251 Ga0495632_0016788 3300046519 Bacteria 4060
252 Ga0495643_0005454 3300046522 Bacteria 8602
253 Ga0495643_0009985 3300046522 Bacteria 5862
254 Ga0495643_0058031 3300046522 Bacteria 2061
255 Ga0495648_0031474 3300046524 Bacteria 3492
256 Ga0495648_0153543 3300046524 Bacteria 1198
257 Ga0495652_0152990 3300046529 Bacteria 1800
258 Ga0495654_0086295 3300046530 Bacteria 1463
259 Ga0495587_0179067 3300046536 Bacteria 1203
260 Ga0495609_0009963 3300046538 Bacteria 4577
261 Ga0495609_0040304 3300046538 Bacteria 2102
262 Ga0495597_0056838 3300046542 Bacteria 1713
263 Ga0495622_0034388 3300046557 Bacteria 2364
264 Ga0495633_0023315 3300046558 Bacteria 3067
265 Ga0495633_0052680 3300046558 Bacteria 1916
266 Ga0495656_0014559 3300046615 Bacteria 2951
267 Ga0495656_0043844 3300046615 Bacteria 1880
268 Ga0495668_0004830 3300046616 Bacteria 9377
269 Ga0495611_0005153 3300046648 Bacteria 5603
270 Ga0495611_0019043 3300046648 Bacteria 2948
271 Ga0495625_0004688 3300046660 Bacteria 12835
272 Ga0495625_0036128 3300046660 Bacteria 3634
273 Ga0495625_0046542 3300046660 Bacteria 3130
274 Ga0495625_0051062 3300046660 Bacteria 2966
275 Ga0495625_0140658 3300046660 Bacteria 1628
276 Ga0495661_0076663 3300046665 Bacteria 1939
277 Ga0495588_0070613 3300046674 Bacteria 1815
278 Ga0495624_0079396 3300046690 Bacteria 2035
279 Ga0495670_0010277 3300046691 Bacteria 4599
280 Ga0495670_0127276 3300046691 Bacteria 1326
281 Ga0495671_0027098 3300046692 Bacteria 2962
282 Ga0495660_0048243 3300046810 Bacteria 2329
283 Ga0495660_0049810 3300046810 Bacteria 2284
284 Ga0495604_0037338 3300047317 Bacteria 3826
285 Ga0495636_0031727 3300047318 Bacteria 2167
286 Ga0495687_029489 3300047443 Bacteria 2538
287 Ga0495687_074926 3300047443 Bacteria 1344
288 Ga0495677_0152053 3300047445 Bacteria 891
289 Ga0495673_0146266 3300047469 Bacteria 917
290 Ga0495681_0035511 3300047470 Bacteria 2474
291 Ga0495681_0065139 3300047470 Bacteria 1667
292 Ga0495681_0094327 3300047470 Bacteria 1317
293 Ga0495686_0000418 3300047472 Bacteria 67274
294 Ga0495686_0002364 3300047472 Bacteria 17981
295 Ga0495686_0010867 3300047472 Bacteria 6447
296 Ga0495686_0057962 3300047472 Bacteria 2416
297 Ga0495686_0103574 3300047472 Bacteria 1714
298 Ga0496100_0003974 3300048903 Bacteria 7772
299 Ga0496101_0044657 3300048904 Bacteria 3171
300 Ga0496101_0257032 3300048904 Bacteria 1362
301 Ga0496102_0008867 3300048905 Bacteria 8630
302 Ga0496103_0010981 3300048906 Bacteria 5360
303 Ga0496103_0072928 3300048906 Bacteria 2151
304 Ga0496104_0340241 3300048907 Bacteria 1413
305 Ga0496105_0122365 3300048908 Bacteria 2145
306 Ga0496106_0052791 3300048909 Bacteria 3068
307 Ga0496106_0055929 3300048909 Bacteria 2983
308 Ga0496113_0454510 3300048916 Bacteria 1029
309 Ga0496114_0086478 3300048917 Bacteria 2657
310 Ga0496116_0012735 3300048919 Bacteria 6841
311 Ga0496116_0012821 3300048919 Bacteria 6811
312 Ga0496116_0032068 3300048919 Bacteria 3750
313 Ga0496116_0180844 3300048919 Bacteria 1129
314 Ga0496116_0216259 3300048919 Bacteria 987
315 Ga0496117_0003887 3300048920 Bacteria 16943
316 Ga0496117_0005580 3300048920 Bacteria 13167
317 Ga0496117_0010882 3300048920 Bacteria 8206
318 Ga0496117_0073253 3300048920 Bacteria 2286
319 Ga0496117_0095863 3300048920 Bacteria 1894
320 Ga0496117_0109230 3300048920 Bacteria 1727
321 Ga0496118_0003614 3300048921 Bacteria 19207
322 Ga0496118_0004868 3300048921 Bacteria 15633
323 Ga0496118_0013710 3300048921 Bacteria 7647
324 Ga0496118_0036618 3300048921 Bacteria 3963
325 Ga0496118_0046256 3300048921 Bacteria 3388
326 Ga0496119_0046552 3300048922 Bacteria 2708
327 Ga0496119_0053932 3300048922 Bacteria 2451
328 Ga0496119_0104505 3300048922 Bacteria 1584
329 Ga0496120_0061450 3300048923 Bacteria 2096
330 Ga0496121_0005802 3300048924 Bacteria 15658
331 Ga0496121_0019161 3300048924 Bacteria 6857
332 Ga0496121_0057768 3300048924 Bacteria 3213
333 Ga0496121_0086372 3300048924 Bacteria 2465
334 Ga0496121_0293245 3300048924 Bacteria 1107
335 Ga0496121_0386265 3300048924 Bacteria 921
336 Ga0496122_0002474 3300048925 Bacteria 26122
337 Ga0496122_0004381 3300048925 Bacteria 17581
338 Ga0496122_0028667 3300048925 Bacteria 4716
339 Ga0496122_0034028 3300048925 Bacteria 4178
340 Ga0496122_0036119 3300048925 Bacteria 4004
341 Ga0496122_0088694 3300048925 Bacteria 2118
342 Ga0496122_0101019 3300048925 Bacteria 1928
343 Ga0496122_0113907 3300048925 Bacteria 1765
344 Ga0496123_0000839 3300048926 Bacteria 49128
345 Ga0496123_0007514 3300048926 Bacteria 10229
346 Ga0496123_0034193 3300048926 Bacteria 3645
347 Ga0496123_0040913 3300048926 Bacteria 3220
348 Ga0496123_0117119 3300048926 Bacteria 1507
349 Ga0496123_0124912 3300048926 Bacteria 1438
350 Ga0496123_0215421 3300048926 Bacteria 972
351 Ga0496124_0001743 3300048927 Bacteria 30475
352 Ga0496124_0005611 3300048927 Bacteria 14038
353 Ga0496124_0005719 3300048927 Bacteria 13853
354 Ga0496124_0010468 3300048927 Bacteria 9389
355 Ga0496124_0037267 3300048927 Bacteria 4231
356 Ga0496124_0082710 3300048927 Bacteria 2635
357 Ga0496124_0101101 3300048927 Bacteria 2336
358 Ga0496124_0135947 3300048927 Bacteria 1946
359 Ga0496124_0150465 3300048927 Bacteria 1826
360 Ga0496124_0411325 3300048927 Bacteria 935
361 Ga0496125_0002475 3300048928 Bacteria 23966
362 Ga0496125_0004711 3300048928 Bacteria 15545
363 Ga0496125_0011734 3300048928 Bacteria 8733
364 Ga0496125_0080363 3300048928 Bacteria 2495
365 Ga0496125_0131158 3300048928 Bacteria 1764
366 Ga0496126_0000188 3300048929 Bacteria 139625
367 Ga0496126_0008731 3300048929 Bacteria 10883
368 Ga0496126_0066328 3300048929 Bacteria 3227
369 Ga0496126_0260269 3300048929 Bacteria 1443
370 Ga0501031_0000202 3300049568 Bacteria 33947
371 Ga0501032_0000443 3300049569 Bacteria 33947
372 Ga0501032_0105637 3300049569 Bacteria 1865
373 Ga0501032_0275438 3300049569 Bacteria 1090
374 Ga0501033_0000097 3300049570 Bacteria 83228
375 Ga0501033_0010825 3300049570 Bacteria 6995
376 Ga0501034_0000186 3300049571 Bacteria 116500
377 Ga0501034_0011544 3300049571 Bacteria 9150
378 Ga0501034_0041553 3300049571 Bacteria 4653
379 Ga0501034_0135186 3300049571 Bacteria 2446
380 Ga0501036_0000002 3300049572 Bacteria 293106
381 Ga0501036_0146379 3300049572 Bacteria 1993
382 Ga0501036_0249412 3300049572 Bacteria 1488
383 Ga0501036_0345260 3300049572 Bacteria 1243
384 Ga0501037_0000443 3300049573 Bacteria 33927
385 Ga0501038_0000867 3300049574 Bacteria 26767
386 Ga0501038_0036305 3300049574 Bacteria 4326
387 Ga0501039_0000002 3300049575 Bacteria 375152
388 Ga0501039_0069810 3300049575 Bacteria 2729
389 Ga0501040_0001925 3300049576 Bacteria 13348
390 Ga0501040_0014483 3300049576 Bacteria 5197
391 Ga0501043_0000543 3300049579 Bacteria 33914
392 Ga0501043_0037844 3300049579 Bacteria 3795
393 Ga0501043_0078405 3300049579 Bacteria 2595
394 Ga0501043_0143718 3300049579 Bacteria 1868
395 Ga0501047_0002364 3300049581 Bacteria 18037
396 Ga0501047_0157248 3300049581 Bacteria 2146
397 Ga0501047_0168987 3300049581 Bacteria 2056
398 Ga0501047_0172428 3300049581 Bacteria 2032
399 Ga0501067_0146215 3300049583 Bacteria 1317
400 Ga0501068_0169680 3300049584 Bacteria 1377
401 Ga0501070_0009430 3300049586 Bacteria 8251
402 Ga0501070_0169394 3300049586 Bacteria 1799
403 Ga0501070_0269910 3300049586 Bacteria 1389
404 Ga0501073_0271248 3300049589 Bacteria 1171
405 Ga0501080_0069209 3300049742 Bacteria 3282
406 Ga0501083_0099443 3300049744 Bacteria 1918
407 Ga0501083_0199315 3300049744 Bacteria 1306
408 Ga0501035_0000100 3300049822 Bacteria 107321
409 Ga0501035_0038128 3300049822 Bacteria 4352
410 Ga0501044_0000002 3300049823 Bacteria 375152
411 Ga0501044_0036127 3300049823 Bacteria 5169
412 Ga0501044_0101205 3300049823 Bacteria 2899
413 Ga0501044_0150409 3300049823 Bacteria 2311
414 Ga0501045_0334474 3300049824 Bacteria 1127
415 nmdc:mga0yw44_19685_c1 3300050492 Bacteria 3727
416 Ga0500578_0093222 3300053086 Bacteria 1910
417 Ga0500643_026321 3300053087 Bacteria 1823
418 Ga0500646_0007652 3300053090 Bacteria 2761
419 Ga0500651_0243042 3300053093 Bacteria 1049
420 Ga0500650_0028901 3300053098 Bacteria 2507
421 Ga0500556_0023251 3300053104 Bacteria 2023
422 Ga0500557_000282 3300053105 Bacteria 6913
423 Ga0500560_070174 3300053107 Bacteria 1154
424 Ga0500562_002778 3300053108 Bacteria 4356
425 Ga0500569_016074 3300053109 Bacteria 1888
426 Ga0500594_0000635 3300053118 Bacteria 7500
427 Ga0500618_006727 3300053125 Bacteria 3347
428 Ga0500618_006924 3300053125 Bacteria 3280
429 Ga0500658_0000880 3300053134 Bacteria 12318
430 Ga0500658_0005307 3300053134 Bacteria 4790
431 Ga0500568_0000629 3300053139 Bacteria 25351
432 Ga0500568_0002233 3300053139 Bacteria 11604
433 Ga0500590_000127 3300053148 Bacteria 21175
434 Ga0500604_0017296 3300053151 Bacteria 1994
435 Ga0500616_0005719 3300053153 Bacteria 8370
436 Ga0500616_0110610 3300053153 Bacteria 1327
437 Ga0500620_000852 3300053155 Bacteria 5300
438 Ga0500622_0001672 3300053156 Bacteria 17312
439 Ga0500627_0032004 3300053158 Bacteria 2214
440 Ga0500633_0016986 3300053160 Bacteria 2125
441 Ga0500633_0051404 3300053160 Bacteria 1423
442 Ga0500636_0097124 3300053177 Bacteria 1680
443 Ga0500645_015656 3300053730 Bacteria 2400
444 Ga0501082_0056138 3300060353 Bacteria 3392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0935891 Ga0451807_0935891_299_967 212
2 iso_pu_bacteria 2916068649 2916075751 214
3 iso_pu_bacteria 2977828996 2977832025 219
4 3300041511 Ga0451855_0274722 Ga0451855_0274722_121_789 221
5 3300042007 Ga0439449_0009721 Ga0439449_0009721_2914_3621 234
6 iso_pu_bacteria 2643221736 2644743308 249
7 iso_pu_bacteria 2501025502 2501078086 250
8 iso_pu_bacteria 2510917013 2511091957 250
9 3300049568 Ga0501031_0000202 Ga0501031_0000202_7530_8321 251
10 3300049569 Ga0501032_0000443 Ga0501032_0000443_25627_26418 251
11 3300049570 Ga0501033_0000097 Ga0501033_0000097_7530_8321 251
12 3300049571 Ga0501034_0000186 Ga0501034_0000186_108178_108969 251
13 3300049572 Ga0501036_0000002 Ga0501036_0000002_284788_285579 251
14 3300049573 Ga0501037_0000443 Ga0501037_0000443_7523_8314 251
15 3300049574 Ga0501038_0000867 Ga0501038_0000867_18447_19238 251
16 3300049575 Ga0501039_0000002 Ga0501039_0000002_366832_367623 251
17 3300049576 Ga0501040_0001925 Ga0501040_0001925_2213_3004 251
18 3300049579 Ga0501043_0000543 Ga0501043_0000543_25606_26397 251
19 3300049581 Ga0501047_0002364 Ga0501047_0002364_7461_8252 251
20 3300049586 Ga0501070_0009430 Ga0501070_0009430_7279_8070 251
21 3300049822 Ga0501035_0000100 Ga0501035_0000100_99001_99792 251
22 3300049823 Ga0501044_0000002 Ga0501044_0000002_7530_8321 251
23 3300048924 Ga0496121_0293245 Ga0496121_0293245_12_773 253
24 3300049576 Ga0501040_0014483 Ga0501040_0014483_1095_1886 255
25 3300049586 Ga0501070_0269910 Ga0501070_0269910_85_876 255
26 3300049742 Ga0501080_0069209 Ga0501080_0069209_79_870 255
27 3300049589 Ga0501073_0271248 Ga0501073_0271248_59_877 256
28 iso_pu_bacteria 2919679072 2919679727 256
29 3300049581 Ga0501047_0168987 Ga0501047_0168987_649_1425 257
30 iso_pu_bacteria 2510065057 2510308320 257
31 iso_pu_bacteria 2511231052 2511502503 257
32 iso_pu_bacteria 2512047086 2512533878 257
33 iso_pu_bacteria 2512875026 2512970367 257
34 iso_pu_bacteria 2513237086 2513587465 257
35 iso_pu_bacteria 2513237089 2513601431 257
36 iso_pu_bacteria 2513237091 2513619558 257
37 iso_pu_bacteria 2513237140 2513881809 257
38 iso_pu_bacteria 2513237143 2513904953 257
39 iso_pu_bacteria 2513237156 2513983629 257
40 iso_pu_bacteria 2513237160 2514003122 257
41 iso_pu_bacteria 2513237305 2514420214 257
42 iso_pu_bacteria 2516653046 2516893878 257
43 iso_pu_bacteria 2517487022 2517570595 257
44 iso_pu_bacteria 2524023207 2524448298 257
45 iso_pu_bacteria 2551306084 2551679615 257
46 iso_pu_bacteria 2551306085 2551689446 257
47 iso_pu_bacteria 2551306087 2551704732 257
48 iso_pu_bacteria 2551306089 2551710591 257
49 iso_pu_bacteria 2551306090 2551723158 257
50 iso_pu_bacteria 2551306092 2551735560 257
51 iso_pu_bacteria 2551306093 2551740098 257
52 iso_pu_bacteria 2582581283 2585167553 257
53 iso_pu_bacteria 2597489875 2597814374 257
54 iso_pu_bacteria 2643221607 2644050103 257
55 iso_pu_bacteria 2643221636 2644204837 257
56 iso_pu_bacteria 2643221686 2644483024 257
57 iso_pu_bacteria 2643221689 2644497692 257
58 iso_pu_bacteria 2721755686 2723575730 257
59 iso_pu_bacteria 2791355094 2792638784 257
60 iso_pu_bacteria 2802428858 2802716724 257
61 iso_pu_bacteria 2802428859 2802725535 257
62 iso_pu_bacteria 2802428860 2802730373 257
63 iso_pu_bacteria 2802428861 2802737656 257
64 iso_pu_bacteria 2802428862 2802742955 257
65 iso_pu_bacteria 2802428863 2802750379 257
66 iso_pu_bacteria 2847417321 2847419761 257
67 iso_pu_bacteria 2848992105 2848994778 257
68 iso_pu_bacteria 2855825444 2855826604 257
69 iso_pu_bacteria 2855839649 2855841994 257
70 iso_pu_bacteria 2855872281 2855877277 257
71 iso_pu_bacteria 2858800743 2858802668 257
72 iso_pu_bacteria 2871451962 2871454819 257
73 iso_pu_bacteria 2882632389 2882635620 257
74 iso_pu_bacteria 2915980308 2915981135 257
75 iso_pu_bacteria 2915986958 2915993233 257
76 iso_pu_bacteria 2915993759 2915999039 257
77 iso_pu_bacteria 2916000859 2916005045 257
78 iso_pu_bacteria 2916007675 2916012711 257
79 iso_pu_bacteria 2916014648 2916018961 257
80 iso_pu_bacteria 2916021584 2916023016 257
81 iso_pu_bacteria 2916028427 2916033855 257
82 iso_pu_bacteria 2916035215 2916039364 257
83 iso_pu_bacteria 2916041962 2916044373 257
84 iso_pu_bacteria 2916048683 2916050421 257
85 iso_pu_bacteria 2916055098 2916060333 257
86 iso_pu_bacteria 2916061851 2916063323 257
87 iso_pu_bacteria 2916076590 2916080471 257
88 iso_pu_bacteria 2921201388 2921205763 257
89 iso_pu_bacteria 2921208531 2921212556 257
90 iso_pu_bacteria 2921237296 2921243988 257
91 iso_pu_bacteria 2921244191 2921244487 257
92 iso_pu_bacteria 2921250672 2921251644 257
93 iso_pu_bacteria 2921257292 2921262655 257
94 iso_pu_bacteria 2921263974 2921269413 257
95 iso_pu_bacteria 2921282425 2921287130 257
96 iso_pu_bacteria 2921289301 2921294122 257
97 iso_pu_bacteria 2921296804 2921299564 257
98 iso_pu_bacteria 2924144063 2924150320 257
99 iso_pu_bacteria 2924150972 2924156528 257
100 iso_pu_bacteria 2924158325 2924159883 257
101 iso_pu_bacteria 2924165586 2924172253 257
102 iso_pu_bacteria 2924172951 2924178431 257
103 iso_pu_bacteria 2924179722 2924183502 257
104 iso_pu_bacteria 2924186466 2924193087 257
105 iso_pu_bacteria 2924193448 2924196437 257
106 iso_pu_bacteria 2924200457 2924203887 257
107 iso_pu_bacteria 2924207177 2924210798 257
108 iso_pu_bacteria 2924214083 2924218396 257
109 iso_pu_bacteria 2924221636 2924225632 257
110 iso_pu_bacteria 2924228884 2924233274 257
111 iso_pu_bacteria 2924762789 2924766773 257
112 iso_pu_bacteria 2937002841 2937005319 257
113 iso_pu_bacteria 2937009748 2937012854 257
114 iso_pu_bacteria 2937016420 2937021880 257
115 iso_pu_bacteria 2937023124 2937027330 257
116 iso_pu_bacteria 2937029754 2937035626 257
117 iso_pu_bacteria 2937036028 2937039659 257
118 iso_pu_bacteria 2937042894 2937048470 257
119 iso_pu_bacteria 2937049772 2937055575 257
120 iso_pu_bacteria 2937056579 2937063786 257
121 iso_pu_bacteria 2937063883 2937068700 257
122 iso_pu_bacteria 2937071275 2937075923 257
123 iso_pu_bacteria 2937078374 2937080688 257
124 iso_pu_bacteria 2937084907 2937088885 257
125 iso_pu_bacteria 2937091812 2937097441 257
126 iso_pu_bacteria 2937098957 2937101156 257
127 iso_pu_bacteria 2937106411 2937110207 257
128 iso_pu_bacteria 2937113482 2937117687 257
129 iso_pu_bacteria 2937119839 2937124520 257
130 iso_pu_bacteria 2937126314 2937132284 257
131 iso_pu_bacteria 2957375807 2957380699 257
132 iso_pu_bacteria 2957382221 2957387273 257
133 iso_pu_bacteria 2957388812 2957389513 257
134 iso_pu_bacteria 2957395598 2957397247 257
135 iso_pu_bacteria 2957402308 2957408310 257
136 iso_pu_bacteria 2957408893 2957412934 257
137 iso_pu_bacteria 2957415311 2957418932 257
138 iso_pu_bacteria 2957422303 2957426302 257
139 iso_pu_bacteria 2957430029 2957435828 257
140 iso_pu_bacteria 2957437181 2957441148 257
141 iso_pu_bacteria 2957443900 2957450232 257
142 iso_pu_bacteria 2957450854 2957455769 257
143 iso_pu_bacteria 2957457609 2957460461 257
144 iso_pu_bacteria 2957464669 2957468809 257
145 iso_pu_bacteria 2957471148 2957476639 257
146 iso_pu_bacteria 2957478035 2957483159 257
147 iso_pu_bacteria 2957484790 2957489189 257
148 iso_pu_bacteria 2957491536 2957495143 257
149 iso_pu_bacteria 2957498199 2957501681 257
150 iso_pu_bacteria 2957505466 2957512313 257
151 iso_pu_bacteria 2960584000 2960584875 257
152 iso_pu_bacteria 2960591022 2960591801 257
153 iso_pu_bacteria 2960597568 2960602116 257
154 iso_pu_bacteria 2960603979 2960610261 257
155 iso_pu_bacteria 2960610863 2960613109 257
156 iso_pu_bacteria 2960617483 2960617986 257
157 iso_pu_bacteria 2960624210 2960629770 257
158 iso_pu_bacteria 2960631154 2960634002 257
159 iso_pu_bacteria 2960637947 2960638332 257
160 iso_pu_bacteria 2960645483 2960651103 257
161 iso_pu_bacteria 2960652885 2960655048 257
162 iso_pu_bacteria 2960660292 2960667080 257
163 iso_pu_bacteria 2960667422 2960670716 257
164 iso_pu_bacteria 2960674078 2960680535 257
165 iso_pu_bacteria 2960680706 2960680815 257
166 iso_pu_bacteria 2960687367 2960688193 257
167 iso_pu_bacteria 2960693952 2960699591 257
168 iso_pu_bacteria 2964615318 2964618167 257
169 iso_pu_bacteria 2964621998 2964628044 257
170 iso_pu_bacteria 2964628898 2964634216 257
171 iso_pu_bacteria 2964636051 2964639153 257
172 iso_pu_bacteria 2964643177 2964646239 257
173 iso_pu_bacteria 2964649959 2964651258 257
174 iso_pu_bacteria 2964656573 2964656951 257
175 iso_pu_bacteria 2964663802 2964667675 257
176 iso_pu_bacteria 2964670856 2964676580 257
177 iso_pu_bacteria 2964678106 2964682675 257
178 iso_pu_bacteria 2964685014 2964689230 257
179 iso_pu_bacteria 2964691889 2964694794 257
180 iso_pu_bacteria 2964698721 2964704512 257
181 iso_pu_bacteria 2964705432 2964706509 257
182 iso_pu_bacteria 2964712639 2964714774 257
183 iso_pu_bacteria 2964719344 2964725795 257
184 iso_pu_bacteria 2967664464 2967666776 257
185 iso_pu_bacteria 2967671571 2967677774 257
186 iso_pu_bacteria 2967678726 2967685813 257
187 iso_pu_bacteria 2967686174 2967690051 257
188 iso_pu_bacteria 2967693043 2967698648 257
189 iso_pu_bacteria 2967706974 2967711430 257
190 iso_pu_bacteria 2967721400 2967727231 257
191 iso_pu_bacteria 2967728569 2967734117 257
192 iso_pu_bacteria 2967735183 2967739853 257
193 iso_pu_bacteria 2967742019 2967745101 257
194 iso_pu_bacteria 2967748971 2967754213 257
195 iso_pu_bacteria 2967755722 2967759661 257
196 iso_pu_bacteria 2967762386 2967768454 257
197 iso_pu_bacteria 2967769361 2967772692 257
198 iso_pu_bacteria 2967775926 2967779401 257
199 iso_pu_bacteria 2970019648 2970024328 257
200 iso_pu_bacteria 2970026789 2970027593 257
201 iso_pu_bacteria 2970033650 2970035971 257
202 iso_pu_bacteria 2970040964 2970045211 257
203 iso_pu_bacteria 2970047711 2970051475 257
204 iso_pu_bacteria 2970054988 2970056215 257
205 iso_pu_bacteria 2970061556 2970065490 257
206 iso_pu_bacteria 2970068827 2970070980 257
207 iso_pu_bacteria 2970076120 2970079410 257
208 iso_pu_bacteria 2970082768 2970084621 257
209 iso_pu_bacteria 2970088815 2970094322 257
210 iso_pu_bacteria 2970095765 2970099960 257
211 iso_pu_bacteria 2970102677 2970103978 257
212 iso_pu_bacteria 2970109326 2970111906 257
213 iso_pu_bacteria 2970116247 2970120548 257
214 iso_pu_bacteria 2970122695 2970126320 257
215 iso_pu_bacteria 2970129317 2970134686 257
216 iso_pu_bacteria 2970136068 2970141774 257
217 iso_pu_bacteria 2970143518 2970147122 257
218 iso_pu_bacteria 2970149975 2970152445 257
219 iso_pu_bacteria 2970156795 2970162254 257
220 iso_pu_bacteria 2970164137 2970168264 257
221 iso_pu_bacteria 2970170962 2970175941 257
222 iso_pu_bacteria 2970177841 2970181116 257
223 iso_pu_bacteria 2970184632 2970186233 257
224 iso_pu_bacteria 2970191845 2970196160 257
225 iso_pu_bacteria 2970524798 2970530670 257
226 iso_pu_bacteria 2977516862 2977523297 257
227 iso_pu_bacteria 2977523885 2977528092 257
228 iso_pu_bacteria 2977530762 2977536404 257
229 iso_pu_bacteria 2977537788 2977543348 257
230 iso_pu_bacteria 2977544691 2977551745 257
231 iso_pu_bacteria 2977551784 2977553014 257
232 iso_pu_bacteria 2977558990 2977564147 257
233 iso_pu_bacteria 2977565890 2977568810 257
234 iso_pu_bacteria 2977572785 2977574098 257
235 iso_pu_bacteria 2977579622 2977585956 257
236 iso_pu_bacteria 2987666974 2987668885 257
237 iso_pu_bacteria 643692032 643826655 257
238 iso_pu_bacteria 648276728 648739492 257
239 iso_pu_bacteria 8003992118 8003994430 257
240 iso_pu_bacteria 8003999396 8004002132 257
241 iso_pu_bacteria 2508501122 2509108047 258
242 iso_pu_bacteria 2509276019 2509376774 258
243 iso_pu_bacteria 2511231027 2511391278 258
244 iso_pu_bacteria 2513237159 2513997574 258
245 iso_pu_bacteria 2513237351 2514588972 258
246 iso_pu_bacteria 2515154107 2515609292 258
247 iso_pu_bacteria 2558860100 2558865869 258
248 iso_pu_bacteria 2582581306 2585265780 258
249 iso_pu_bacteria 2582581865 2585389027 258
250 iso_pu_bacteria 2582581866 2585395173 258
251 iso_pu_bacteria 2599185352 2600196076 258
252 iso_pu_bacteria 2643221557 2643804384 258
253 iso_pu_bacteria 2643221610 2644065155 258
254 iso_pu_bacteria 2643221618 2644105446 258
255 iso_pu_bacteria 2643221623 2644129083 258
256 iso_pu_bacteria 2643221626 2644146449 258
257 iso_pu_bacteria 2643221637 2644208696 258
258 iso_pu_bacteria 2643221655 2644308197 258
259 iso_pu_bacteria 2643221659 2644334021 258
260 iso_pu_bacteria 2643221668 2644377564 258
261 iso_pu_bacteria 2643221675 2644416827 258
262 iso_pu_bacteria 2643221680 2644449867 258
263 iso_pu_bacteria 2643221698 2644541618 258
264 iso_pu_bacteria 2643221712 2644615479 258
265 iso_pu_bacteria 2643221718 2644652226 258
266 iso_pu_bacteria 2643221723 2644672780 258
267 iso_pu_bacteria 2643221726 2644690001 258
268 iso_pu_bacteria 2765235802 2765467210 258
269 iso_pu_bacteria 2767802442 2770198806 258
270 iso_pu_bacteria 2775506902 2776273014 258
271 iso_pu_bacteria 2775506904 2776282143 258
272 iso_pu_bacteria 2791355260 2793323790 258
273 iso_pu_bacteria 2838074704 2838079678 258
274 iso_pu_bacteria 2839993093 2839996428 258
275 iso_pu_bacteria 2840764183 2840770364 258
276 iso_pu_bacteria 2842521101 2842522183 258
277 iso_pu_bacteria 2842871566 2842875729 258
278 iso_pu_bacteria 2844163670 2844166360 258
279 iso_pu_bacteria 2850079185 2850081776 258
280 iso_pu_bacteria 2889914905 2889916997 258
281 iso_pu_bacteria 2891373044 2891373701 258
282 iso_pu_bacteria 2896384573 2896391211 258
283 iso_pu_bacteria 2904578770 2904582563 258
284 iso_pu_bacteria 2919119836 2919124043 258
285 iso_pu_bacteria 2920760137 2920761186 258
286 iso_pu_bacteria 2920822456 2920825622 258
287 iso_pu_bacteria 2928521798 2928524837 258
288 iso_pu_bacteria 2936996657 2937002755 258
289 iso_pu_bacteria 2941499720 2941504612 258
290 iso_pu_bacteria 2954011201 2954011203 258
291 iso_pu_bacteria 2989349275 2989350178 258
292 iso_pu_bacteria 2989771324 2989773304 258
293 iso_pu_bacteria 2996310559 2996310623 258
294 iso_pu_bacteria 2996336353 2996341078 258
295 iso_pu_bacteria 3002141150 3002145395 258
296 iso_pu_bacteria 3003930520 3003934644 258
297 iso_pu_bacteria 2509276021 2509390175 259
298 iso_pu_bacteria 2510065019 2510134359 259
299 iso_pu_bacteria 2510461076 2510895792 259
300 iso_pu_bacteria 2510917022 2511131929 259
301 iso_pu_bacteria 2510917028 2511182654 259
302 iso_pu_bacteria 2510917030 2511194915 259
303 iso_pu_bacteria 2513237084 2513567521 259
304 iso_pu_bacteria 2513237085 2513577857 259
305 iso_pu_bacteria 2513237088 2513598404 259
306 iso_pu_bacteria 2513237093 2513631996 259
307 iso_pu_bacteria 2513237103 2513712530 259
308 iso_pu_bacteria 2513237138 2513867916 259
309 iso_pu_bacteria 2513237144 2513910648 259
310 iso_pu_bacteria 2513237146 2513928093 259
311 iso_pu_bacteria 2515154113 2515635243 259
312 iso_pu_bacteria 2515154114 2515643850 259
313 iso_pu_bacteria 2515154116 2515654938 259
314 iso_pu_bacteria 2515154134 2515739884 259
315 iso_pu_bacteria 2516653085 2517077483 259
316 iso_pu_bacteria 2517093000 2517096249 259
317 iso_pu_bacteria 2517287029 2517408107 259
318 iso_pu_bacteria 2519899620 2520381948 259
319 iso_pu_bacteria 2524023209 2524459012 259
320 iso_pu_bacteria 2529292951 2530646387 259
321 iso_pu_bacteria 2534681796 2535517230 259
322 iso_pu_bacteria 2582581294 2585205102 259
323 iso_pu_bacteria 2582581298 2585225255 259
324 iso_pu_bacteria 2582581299 2585230680 259
325 iso_pu_bacteria 2582581304 2585259115 259
326 iso_pu_bacteria 2582581307 2585273969 259
327 iso_pu_bacteria 2582581308 2585279430 259
328 iso_pu_bacteria 2582581315 2585322910 259
329 iso_pu_bacteria 2582581316 2585331078 259
330 iso_pu_bacteria 2582581867 2585404602 259
331 iso_pu_bacteria 2585427526 2585524910 259
332 iso_pu_bacteria 2585427527 2585531086 259
333 iso_pu_bacteria 2585427528 2585542783 259
334 iso_pu_bacteria 2585427529 2585547811 259
335 iso_pu_bacteria 2585427530 2585552993 259
336 iso_pu_bacteria 2585427531 2585560420 259
337 iso_pu_bacteria 2585427590 2585824861 259
338 iso_pu_bacteria 2585427593 2585841425 259
339 iso_pu_bacteria 2585427594 2585847703 259
340 iso_pu_bacteria 2585427608 2585898614 259
341 iso_pu_bacteria 2585427609 2585903798 259
342 iso_pu_bacteria 2585428125 2587981083 259
343 iso_pu_bacteria 2599185170 2599421102 259
344 iso_pu_bacteria 2615840624 2616296660 259
345 iso_pu_bacteria 2615840626 2616307003 259
346 iso_pu_bacteria 2615840698 2616554616 259
347 iso_pu_bacteria 2617270742 2617384883 259
348 iso_pu_bacteria 2643221599 2644002914 259
349 iso_pu_bacteria 2643221643 2644237894 259
350 iso_pu_bacteria 2667528174 2671111861 259
351 iso_pu_bacteria 2718217927 2719386834 259
352 iso_pu_bacteria 2718217997 2719666574 259
353 iso_pu_bacteria 2718218199 2720492994 259
354 iso_pu_bacteria 2718218232 2720614470 259
355 iso_pu_bacteria 2718218233 2720621246 259
356 iso_pu_bacteria 2718218235 2720632572 259
357 iso_pu_bacteria 2718218269 2720776294 259
358 iso_pu_bacteria 2718218423 2721400557 259
359 iso_pu_bacteria 2721755556 2723027886 259
360 iso_pu_bacteria 2721755684 2723561514 259
361 iso_pu_bacteria 2721755685 2723568144 259
362 iso_pu_bacteria 2721755809 2724039370 259
363 iso_pu_bacteria 2721755819 2724090901 259
364 iso_pu_bacteria 2721755822 2724105409 259
365 iso_pu_bacteria 2721755823 2724111232 259
366 iso_pu_bacteria 2724679232 2725950239 259
367 iso_pu_bacteria 2728369352 2730108822 259
368 iso_pu_bacteria 2738541293 2738805420 259
369 iso_pu_bacteria 2738541333 2739033235 259
370 iso_pu_bacteria 2765235942 2766066279 259
371 iso_pu_bacteria 2775507266 2778173383 259
372 iso_pu_bacteria 2791355256 2793294020 259
373 iso_pu_bacteria 2791355259 2793314305 259
374 iso_pu_bacteria 2791355261 2793329696 259
375 iso_pu_bacteria 2791355263 2793342297 259
376 iso_pu_bacteria 2791355265 2793355317 259
377 iso_pu_bacteria 2791355266 2793362967 259
378 iso_pu_bacteria 2791355267 2793369879 259
379 iso_pu_bacteria 2802429605 2805929534 259
380 iso_pu_bacteria 2802429606 2805936838 259
381 iso_pu_bacteria 2802429633 2806047523 259
382 iso_pu_bacteria 2802429634 2806055127 259
383 iso_pu_bacteria 2802429635 2806063063 259
384 iso_pu_bacteria 2802429636 2806069798 259
385 iso_pu_bacteria 2802429637 2806075727 259
386 iso_pu_bacteria 2818991448 2819609927 259
387 iso_pu_bacteria 2818991453 2819640037 259
388 iso_pu_bacteria 2838029111 2838033238 259
389 iso_pu_bacteria 2838035591 2838041465 259
390 iso_pu_bacteria 2838661181 2838665857 259
391 iso_pu_bacteria 2838686498 2838686639 259
392 iso_pu_bacteria 2838694306 2838698026 259
393 iso_pu_bacteria 2838707686 2838711141 259
394 iso_pu_bacteria 2838729681 2838734881 259
395 iso_pu_bacteria 2838742623 2838747496 259
396 iso_pu_bacteria 2841851746 2841854468 259
397 iso_pu_bacteria 2842077413 2842079316 259
398 iso_pu_bacteria 2842110456 2842115578 259
399 iso_pu_bacteria 2842118031 2842118173 259
400 iso_pu_bacteria 2842156927 2842158513 259
401 iso_pu_bacteria 2842163707 2842169043 259
402 iso_pu_bacteria 2842180545 2842182127 259
403 iso_pu_bacteria 2842217011 2842218360 259
404 iso_pu_bacteria 2842229732 2842229873 259
405 iso_pu_bacteria 2842237096 2842240087 259
406 iso_pu_bacteria 2842243621 2842243762 259
407 iso_pu_bacteria 2842257432 2842258153 259
408 iso_pu_bacteria 2842271015 2842271823 259
409 iso_pu_bacteria 2842291075 2842292978 259
410 iso_pu_bacteria 2842298080 2842298364 259
411 iso_pu_bacteria 2842304105 2842305434 259
412 iso_pu_bacteria 2842357229 2842360376 259
413 iso_pu_bacteria 2842370503 2842373660 259
414 iso_pu_bacteria 2842377471 2842379375 259
415 iso_pu_bacteria 2842384541 2842384684 259
416 iso_pu_bacteria 2842475841 2842480097 259
417 iso_pu_bacteria 2842482326 2842483709 259
418 iso_pu_bacteria 2842502639 2842505118 259
419 iso_pu_bacteria 2842509118 2842510380 259
420 iso_pu_bacteria 2844454524 2844457937 259
421 iso_pu_bacteria 2852387548 2852390795 259
422 iso_pu_bacteria 2857516855 2857517014 259
423 iso_pu_bacteria 2889790730 2889792368 259
424 iso_pu_bacteria 2919100787 2919105589 259
425 iso_pu_bacteria 2919408235 2919410361 259
426 iso_pu_bacteria 2923556063 2923562262 259
427 iso_pu_bacteria 2933570622 2933571241 259
428 iso_pu_bacteria 2933586486 2933591993 259
429 iso_pu_bacteria 2935894831 2935896590 259
430 iso_pu_bacteria 2935901341 2935901485 259
431 iso_pu_bacteria 2936381700 2936383409 259
432 iso_pu_bacteria 2996887358 2996892532 259
433 iso_pu_bacteria 2996893221 2996898046 259
434 iso_pu_bacteria 3005416602 3005418817 259
435 iso_pu_bacteria 3005445848 3005448824 259
436 iso_pu_bacteria 3005452660 3005455049 259
437 iso_pu_bacteria 8005258706 8005264841 259
438 iso_pu_bacteria 8005307578 8005314069 259
439 iso_pu_bacteria 8005314921 8005318291 259
440 iso_pu_bacteria 8005321885 8005327059 259
441 iso_pu_bacteria 8005484373 8005488826 259
442 iso_pu_bacteria 8005542996 8005546050 259
443 iso_pu_bacteria 8005570704 8005573055 259
444 iso_pu_bacteria 8005645114 8005645797 259
445 iso_pu_bacteria 8005682033 8005682520 259
446 iso_pu_bacteria 8023680758 8023682760 259
447 iso_pu_bacteria 8024486573 8024488426 259
448 iso_pu_bacteria 8046767195 8046772641 259
449 iso_pu_bacteria 8056382006 8056387333 259
450 iso_pu_bacteria 8057575449 8057576898 259
451 iso_pu_bacteria 2894652903 2894657084 260
452 3300002773 JGI25152J39213_1003034 JGI25152J39213_10030344 261
453 3300003187 JGI25151J46595_10014542 JGI25151J46595_100145425 261
454 3300003775 Ga0055524_1012228 Ga0055524_10122284 261
455 3300003790 Ga0055528_1008999 Ga0055528_10089991 261
456 3300005548 Ga0070665_100326144 Ga0070665_1003261442 261
457 3300006946 Ga0079104_1005065 Ga0079104_10050652 261
458 3300022739 Ga0228711_1000017 Ga0228711_1000017102 261
459 3300022740 Ga0228710_1000005 Ga0228710_1000005151 261
460 3300025258 Ga0209129_1000128 Ga0209129_100012855 261
461 3300025261 Ga0209233_1013152 Ga0209233_10131522 261
462 3300025273 Ga0209673_1000125 Ga0209673_100012580 261
463 3300025294 Ga0209025_1000451 Ga0209025_100045154 261
464 3300025294 Ga0209025_1008140 Ga0209025_10081409 261
465 3300025295 Ga0209564_1002386 Ga0209564_10023867 261
466 3300025297 Ga0209758_1032268 Ga0209758_10322682 261
467 3300025299 Ga0209256_1000885 Ga0209256_100088530 261
468 3300025303 Ga0209051_1021245 Ga0209051_10212452 261
469 3300027111 Ga0209281_1000082 Ga0209281_100008299 261
470 3300027111 Ga0209281_1001180 Ga0209281_10011803 261
471 3300027666 Ga0209282_1000006 Ga0209282_1000006121 261
472 3300028379 Ga0268266_10154083 Ga0268266_101540832 261
473 3300031967 Ga0315914_1000003 Ga0315914_1000003176 261
474 3300033430 Ga0315913_1000001 Ga0315913_1000001127 261
475 3300033464 Ga0315915_1000008 Ga0315915_1000008160 261
476 3300046660 Ga0495625_0046542 Ga0495625_0046542_582_1370 261
477 3300048909 Ga0496106_0055929 Ga0496106_0055929_1828_2613 261
478 3300048926 Ga0496123_0124912 Ga0496123_0124912_635_1420 261
479 3300049569 Ga0501032_0275438 Ga0501032_0275438_15_803 261
480 3300049572 Ga0501036_0345260 Ga0501036_0345260_321_1109 261
481 3300049823 Ga0501044_0150409 Ga0501044_0150409_924_1712 261
482 3300050492 nmdc:mga0yw44_19685_c1 nmdc:mga0yw44_19685_c1_696_1484 261
483 3300053107 Ga0500560_070174 Ga0500560_070174_195_980 261
484 3300053155 Ga0500620_000852 Ga0500620_000852_1794_2582 261
485 iso_pu_bacteria 8054558443 8054561875 261
486 3300002987 JGI25159J45721_1000008 JGI25159J45721_1000008113 262
487 3300003187 JGI25151J46595_10008331 JGI25151J46595_100083313 262
488 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003362 262
489 3300003374 JGI25161J50226_1002090 JGI25161J50226_10020905 262
490 3300003771 Ga0055526_1002020 Ga0055526_10020207 262
491 3300003794 Ga0055531_10030140 Ga0055531_100301402 262
492 3300004625 Ga0055543_1000026 Ga0055543_100002678 262
493 3300005262 Ga0065165_1000178 Ga0065165_100017862 262
494 3300013249 Ga0171463_1007 Ga0171463_1007185 262
495 3300015690 Ga0183363_1078 Ga0183363_107823 262
496 3300021321 Ga0214542_1015589 Ga0214542_10155897 262
497 3300021327 Ga0214543_1000022 Ga0214543_1000022197 262
498 3300025208 Ga0209436_101354 Ga0209436_10135410 262
499 3300025284 Ga0209130_1000017 Ga0209130_1000017115 262
500 3300025292 Ga0209676_1012015 Ga0209676_10120153 262
501 3300025294 Ga0209025_1000153 Ga0209025_100015360 262
502 3300025294 Ga0209025_1000545 Ga0209025_100054559 262
503 3300025295 Ga0209564_1000013 Ga0209564_1000013564 262
504 3300025297 Ga0209758_1038456 Ga0209758_10384562 262
505 3300025298 Ga0209050_1009447 Ga0209050_10094473 262
506 3300025299 Ga0209256_1000211 Ga0209256_100021155 262
507 3300025299 Ga0209256_1002050 Ga0209256_100205012 262
508 3300025302 Ga0207426_1000006 Ga0207426_1000006114 262
509 3300025304 Ga0209257_1013370 Ga0209257_10133703 262
510 3300028794 Ga0307515_10005257 Ga0307515_1000525722 262
511 3300031548 Ga0307408_100191993 Ga0307408_1001919932 262
512 3300031852 Ga0307410_10148222 Ga0307410_101482222 262
513 3300037466 Ga0395898_0076038 Ga0395898_0076038_1566_2357 262
514 3300038443 Ga0395901_0165628 Ga0395901_0165628_114_905 262
515 3300041404 Ga0439436_0002190 Ga0439436_0002190_4247_5035 262
516 3300041411 Ga0439466_0063380 Ga0439466_0063380_279_1067 262
517 3300041413 Ga0439465_0005625 Ga0439465_0005625_1711_2499 262
518 3300041413 Ga0439465_0006019 Ga0439465_0006019_2994_3803 262
519 3300041413 Ga0439465_0063530 Ga0439465_0063530_371_1162 262
520 3300041413 Ga0439465_0066573 Ga0439465_0066573_213_1004 262
521 3300041997 Ga0439431_0004203 Ga0439431_0004203_2011_2799 262
522 3300042007 Ga0439449_0011947 Ga0439449_0011947_857_1645 262
523 3300042015 Ga0439462_0002411 Ga0439462_0002411_742_1530 262
524 3300042147 Ga0450910_003987 Ga0450910_003987_535_1323 262
525 3300042435 Ga0439434_0004579 Ga0439434_0004579_488_1276 262
526 3300042531 Ga0450918_007282 Ga0450918_007282_1120_1908 262
527 3300046660 Ga0495625_0140658 Ga0495625_0140658_213_1001 262
528 3300048920 Ga0496117_0003887 Ga0496117_0003887_7351_8139 262
529 3300048925 Ga0496122_0002474 Ga0496122_0002474_9836_10624 262
530 3300048926 Ga0496123_0000839 Ga0496123_0000839_38505_39293 262
531 3300048927 Ga0496124_0001743 Ga0496124_0001743_15885_16673 262
532 3300048928 Ga0496125_0002475 Ga0496125_0002475_9834_10622 262
533 3300048928 Ga0496125_0131158 Ga0496125_0131158_69_857 262
534 3300048929 Ga0496126_0000188 Ga0496126_0000188_16082_16870 262
535 3300048929 Ga0496126_0008731 Ga0496126_0008731_4488_5276 262
536 3300049570 Ga0501033_0010825 Ga0501033_0010825_867_1655 262
537 3300049571 Ga0501034_0011544 Ga0501034_0011544_4095_4886 262
538 3300049572 Ga0501036_0249412 Ga0501036_0249412_596_1384 262
539 3300049579 Ga0501043_0078405 Ga0501043_0078405_978_1766 262
540 3300049586 Ga0501070_0169394 Ga0501070_0169394_46_837 262
541 3300049823 Ga0501044_0036127 Ga0501044_0036127_3929_4717 262
542 3300049824 Ga0501045_0334474 Ga0501045_0334474_88_876 262
543 3300053087 Ga0500643_026321 Ga0500643_026321_579_1370 262
544 iso_pu_bacteria 2643221629 2644168758 262
545 iso_pu_bacteria 2643221662 2644347307 262
546 iso_pu_bacteria 8018127388 8018127560 262
547 3300001979 JGI24740J21852_10004555 JGI24740J21852_100045553 263
548 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014940 263
549 3300002737 JGI25162J39368_1000211 JGI25162J39368_100021120 263
550 3300002773 JGI25152J39213_1000899 JGI25152J39213_100089910 263
551 3300002987 JGI25159J45721_1006352 JGI25159J45721_10063524 263
552 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002720 263
553 3300003187 JGI25151J46595_10001211 JGI25151J46595_1000121115 263
554 3300003187 JGI25151J46595_10022311 JGI25151J46595_100223114 263
555 3300003214 JGI25165J46597_1000938 JGI25165J46597_100093813 263
556 3300003214 JGI25165J46597_1001280 JGI25165J46597_100128014 263
557 3300003214 JGI25165J46597_1004226 JGI25165J46597_10042263 263
558 3300003215 JGI25153J46596_10000608 JGI25153J46596_1000060817 263
559 3300003215 JGI25153J46596_10003461 JGI25153J46596_100034616 263
560 3300003215 JGI25153J46596_10007133 JGI25153J46596_100071336 263
561 3300003322 rootL2_10007936 rootL2_100079367 263
562 3300003323 rootH1_10025853 rootH1_100258533 263
563 3300003323 rootH1_10025854 rootH1_100258543 263
564 3300003323 rootH1_10148901 rootH1_101489012 263
565 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001184 263
566 3300003354 JGI25160J50197_1001321 JGI25160J50197_10013213 263
567 3300003354 JGI25160J50197_1001492 JGI25160J50197_10014928 263
568 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001584 263
569 3300003374 JGI25161J50226_1000163 JGI25161J50226_100016316 263
570 3300003771 Ga0055526_1001871 Ga0055526_100187112 263
571 3300003771 Ga0055526_1002721 Ga0055526_10027215 263
572 3300003771 Ga0055526_1025387 Ga0055526_10253871 263
573 3300003775 Ga0055524_1001345 Ga0055524_100134515 263
574 3300003775 Ga0055524_1023782 Ga0055524_10237822 263
575 3300003775 Ga0055524_1043633 Ga0055524_10436332 263
576 3300003790 Ga0055528_1000247 Ga0055528_100024716 263
577 3300003790 Ga0055528_1003198 Ga0055528_10031988 263
578 3300003790 Ga0055528_1026883 Ga0055528_10268832 263
579 3300003792 Ga0055540_1000607 Ga0055540_100060719 263
580 3300003792 Ga0055540_1001828 Ga0055540_100182810 263
581 3300004625 Ga0055543_1000007 Ga0055543_100000711 263
582 3300004625 Ga0055543_1000104 Ga0055543_100010455 263
583 3300004625 Ga0055543_1000108 Ga0055543_100010861 263
584 3300005262 Ga0065165_1000008 Ga0065165_1000008279 263
585 3300005262 Ga0065165_1010050 Ga0065165_10100506 263
586 3300005262 Ga0065165_1033708 Ga0065165_10337082 263
587 3300005331 Ga0070670_100001446 Ga0070670_1000014467 263
588 3300005347 Ga0070668_100483315 Ga0070668_1004833151 263
589 3300005548 Ga0070665_100146523 Ga0070665_1001465232 263
590 3300005548 Ga0070665_100169482 Ga0070665_1001694823 263
591 3300005563 Ga0068855_100100926 Ga0068855_1001009263 263
592 3300005614 Ga0068856_100039412 Ga0068856_1000394122 263
593 3300005614 Ga0068856_100053210 Ga0068856_1000532102 263
594 3300005616 Ga0068852_100312888 Ga0068852_1003128881 263
595 3300006038 Ga0075365_10002133 Ga0075365_100021337 263
596 3300006038 Ga0075365_10083738 Ga0075365_100837382 263
597 3300006038 Ga0075365_10215109 Ga0075365_102151092 263
598 3300006048 Ga0075363_100127193 Ga0075363_1001271932 263
599 3300006177 Ga0075362_10007089 Ga0075362_100070894 263
600 3300006178 Ga0075367_10002388 Ga0075367_100023887 263
601 3300006186 Ga0075369_10001117 Ga0075369_100011178 263
602 3300006186 Ga0075369_10097713 Ga0075369_100977132 263
603 3300006353 Ga0075370_10034712 Ga0075370_100347124 263
604 3300009036 Ga0105244_10189625 Ga0105244_101896251 263
605 3300009093 Ga0105240_10000014 Ga0105240_10000014132 263
606 3300009545 Ga0105237_10001161 Ga0105237_100011617 263
607 3300009551 Ga0105238_10566216 Ga0105238_105662162 263
608 3300009765 Ga0123341_1000018 Ga0123341_100001873 263
609 3300009765 Ga0123341_1078856 Ga0123341_10788562 263
610 3300009765 Ga0123341_1090639 Ga0123341_10906392 263
611 3300009766 Ga0123342_1009978 Ga0123342_10099787 263
612 3300009766 Ga0123342_1038664 Ga0123342_10386642 263
613 3300010375 Ga0105239_10005301 Ga0105239_100053017 263
614 3300013100 Ga0157373_10123453 Ga0157373_101234532 263
615 3300013104 Ga0157370_10000015 Ga0157370_10000015132 263
616 3300014497 Ga0182008_10060340 Ga0182008_100603401 263
617 3300015262 Ga0182007_10000385 Ga0182007_1000038513 263
618 3300025208 Ga0209436_100058 Ga0209436_10005852 263
619 3300025233 Ga0209437_100058 Ga0209437_100058103 263
620 3300025233 Ga0209437_100060 Ga0209437_100060156 263
621 3300025245 Ga0207425_1000043 Ga0207425_100004319 263
622 3300025245 Ga0207425_1000436 Ga0207425_100043613 263
623 3300025245 Ga0207425_1002033 Ga0207425_100203310 263
624 3300025253 Ga0209677_100289 Ga0209677_10028912 263
625 3300025254 Ga0209148_1003810 Ga0209148_10038104 263
626 3300025258 Ga0209129_1000072 Ga0209129_1000072175 263
627 3300025258 Ga0209129_1000765 Ga0209129_100076522 263
628 3300025258 Ga0209129_1001667 Ga0209129_10016673 263
629 3300025258 Ga0209129_1004976 Ga0209129_10049765 263
630 3300025258 Ga0209129_1006922 Ga0209129_10069223 263
631 3300025258 Ga0209129_1006924 Ga0209129_10069243 263
632 3300025261 Ga0209233_1000137 Ga0209233_1000137133 263
633 3300025261 Ga0209233_1000149 Ga0209233_100014981 263
634 3300025261 Ga0209233_1000160 Ga0209233_100016075 263
635 3300025263 Ga0209565_1030534 Ga0209565_10305341 263
636 3300025273 Ga0209673_1000025 Ga0209673_100002516 263
637 3300025273 Ga0209673_1000256 Ga0209673_100025676 263
638 3300025273 Ga0209673_1001756 Ga0209673_100175617 263
639 3300025273 Ga0209673_1003121 Ga0209673_10031217 263
640 3300025273 Ga0209673_1004623 Ga0209673_10046232 263
641 3300025273 Ga0209673_1037816 Ga0209673_10378162 263
642 3300025273 Ga0209673_1053543 Ga0209673_10535431 263
643 3300025284 Ga0209130_1000003 Ga0209130_1000003590 263
644 3300025284 Ga0209130_1000023 Ga0209130_1000023128 263
645 3300025291 Ga0209675_1028676 Ga0209675_10286762 263
646 3300025292 Ga0209676_1034027 Ga0209676_10340272 263
647 3300025294 Ga0209025_1000120 Ga0209025_1000120175 263
648 3300025294 Ga0209025_1000537 Ga0209025_100053765 263
649 3300025294 Ga0209025_1009023 Ga0209025_10090237 263
650 3300025294 Ga0209025_1076920 Ga0209025_10769202 263
651 3300025295 Ga0209564_1000259 Ga0209564_100025984 263
652 3300025295 Ga0209564_1000841 Ga0209564_100084130 263
653 3300025295 Ga0209564_1002367 Ga0209564_10023679 263
654 3300025295 Ga0209564_1010644 Ga0209564_10106442 263
655 3300025295 Ga0209564_1020991 Ga0209564_10209914 263
656 3300025297 Ga0209758_1000111 Ga0209758_1000111176 263
657 3300025297 Ga0209758_1000254 Ga0209758_100025491 263
658 3300025297 Ga0209758_1000592 Ga0209758_100059248 263
659 3300025297 Ga0209758_1000678 Ga0209758_100067826 263
660 3300025297 Ga0209758_1003028 Ga0209758_10030283 263
661 3300025297 Ga0209758_1004877 Ga0209758_100487717 263
662 3300025298 Ga0209050_1015458 Ga0209050_10154582 263
663 3300025299 Ga0209256_1000283 Ga0209256_100028315 263
664 3300025299 Ga0209256_1000669 Ga0209256_10006693 263
665 3300025299 Ga0209256_1009263 Ga0209256_10092633 263
666 3300025299 Ga0209256_1024647 Ga0209256_10246473 263
667 3300025299 Ga0209256_1038223 Ga0209256_10382231 263
668 3300025302 Ga0207426_1000011 Ga0207426_1000011185 263
669 3300025302 Ga0207426_1000087 Ga0207426_1000087235 263
670 3300025302 Ga0207426_1000208 Ga0207426_1000208111 263
671 3300025302 Ga0207426_1000936 Ga0207426_100093623 263
672 3300025303 Ga0209051_1000176 Ga0209051_1000176121 263
673 3300025303 Ga0209051_1003032 Ga0209051_10030329 263
674 3300025303 Ga0209051_1003066 Ga0209051_10030664 263
675 3300025303 Ga0209051_1056082 Ga0209051_10560822 263
676 3300025304 Ga0209257_1004862 Ga0209257_10048623 263
677 3300025913 Ga0207695_10000037 Ga0207695_10000037132 263
678 3300025914 Ga0207671_10000080 Ga0207671_10000080133 263
679 3300025925 Ga0207650_10000624 Ga0207650_1000062413 263
680 3300025931 Ga0207644_10015740 Ga0207644_100157406 263
681 3300025981 Ga0207640_10319644 Ga0207640_103196441 263
682 3300026041 Ga0207639_10274169 Ga0207639_102741692 263
683 3300026078 Ga0207702_10043016 Ga0207702_100430166 263
684 3300026078 Ga0207702_10045362 Ga0207702_100453622 263
685 3300026142 Ga0207698_10343433 Ga0207698_103434332 263
686 3300027312 Ga0209371_1002582 Ga0209371_10025823 263
687 3300028379 Ga0268266_10097108 Ga0268266_100971082 263
688 3300028379 Ga0268266_10265403 Ga0268266_102654031 263
689 3300028794 Ga0307515_10000017 Ga0307515_10000017205 263
690 3300028794 Ga0307515_10006504 Ga0307515_1000650426 263
691 3300030500 Ga0268256_1003727 Ga0268256_10037273 263
692 3300031456 Ga0307513_10002736 Ga0307513_1000273628 263
693 3300031456 Ga0307513_10004524 Ga0307513_1000452419 263
694 3300031731 Ga0307405_10001465 Ga0307405_100014654 263
695 3300031911 Ga0307412_10001457 Ga0307412_100014575 263
696 3300041413 Ga0439465_0005328 Ga0439465_0005328_1951_2760 263
697 3300041496 Ga0451839_0542176 Ga0451839_0542176_1621_2415 263
698 3300041498 Ga0451841_0577157 Ga0451841_0577157_432_1226 263
699 3300041501 Ga0451845_0517278 Ga0451845_0517278_18_812 263
700 3300041501 Ga0451845_0608757 Ga0451845_0608757_38_832 263
701 3300041507 Ga0451851_0417130 Ga0451851_0417130_866_1660 263
702 3300041512 Ga0451853_3019187 Ga0451853_3019187_669_1463 263
703 3300044684 Ga0466966_0108748 Ga0466966_0108748_213_1004 263
704 3300044694 Ga0466963_0051153 Ga0466963_0051153_1406_2197 263
705 3300044719 Ga0466971_0067186 Ga0466971_0067186_651_1442 263
706 3300044765 Ga0466970_0008960 Ga0466970_0008960_2721_3512 263
707 3300044842 Ga0466957_0121407 Ga0466957_0121407_744_1535 263
708 3300045836 Ga0466958_0039723 Ga0466958_0039723_55_846 263
709 3300046452 Ga0495617_040351 Ga0495617_040351_417_1211 263
710 3300046454 Ga0495592_0231349 Ga0495592_0231349_83_874 263
711 3300046459 Ga0495629_0183097 Ga0495629_0183097_435_1226 263
712 3300046460 Ga0495638_0000746 Ga0495638_0000746_18618_19412 263
713 3300046471 Ga0495650_0056795 Ga0495650_0056795_224_1015 263
714 3300046474 Ga0495605_0001667 Ga0495605_0001667_7065_7859 263
715 3300046492 Ga0495585_0059643 Ga0495585_0059643_391_1185 263
716 3300046501 Ga0495607_0029078 Ga0495607_0029078_1973_2767 263
717 3300046501 Ga0495607_0030837 Ga0495607_0030837_164_958 263
718 3300046506 Ga0495583_0014903 Ga0495583_0014903_2980_3774 263
719 3300046507 Ga0495606_0001297 Ga0495606_0001297_4925_5716 263
720 3300046507 Ga0495606_0037171 Ga0495606_0037171_1562_2356 263
721 3300046512 Ga0495610_0002186 Ga0495610_0002186_11634_12425 263
722 3300046513 Ga0495616_0009440 Ga0495616_0009440_988_1782 263
723 3300046514 Ga0495618_0069806 Ga0495618_0069806_47_838 263
724 3300046515 Ga0495620_0022072 Ga0495620_0022072_1194_1985 263
725 3300046515 Ga0495620_0027186 Ga0495620_0027186_649_1443 263
726 3300046518 Ga0495631_0000518 Ga0495631_0000518_6672_7466 263
727 3300046519 Ga0495632_0001449 Ga0495632_0001449_6325_7116 263
728 3300046519 Ga0495632_0006976 Ga0495632_0006976_430_1224 263
729 3300046519 Ga0495632_0016788 Ga0495632_0016788_1156_1947 263
730 3300046522 Ga0495643_0005454 Ga0495643_0005454_7754_8548 263
731 3300046522 Ga0495643_0009985 Ga0495643_0009985_3993_4787 263
732 3300046522 Ga0495643_0058031 Ga0495643_0058031_858_1652 263
733 3300046524 Ga0495648_0031474 Ga0495648_0031474_2090_2881 263
734 3300046524 Ga0495648_0153543 Ga0495648_0153543_166_960 263
735 3300046529 Ga0495652_0152990 Ga0495652_0152990_982_1773 263
736 3300046530 Ga0495654_0086295 Ga0495654_0086295_201_995 263
737 3300046536 Ga0495587_0179067 Ga0495587_0179067_137_928 263
738 3300046538 Ga0495609_0009963 Ga0495609_0009963_1426_2220 263
739 3300046538 Ga0495609_0040304 Ga0495609_0040304_415_1209 263
740 3300046542 Ga0495597_0056838 Ga0495597_0056838_91_885 263
741 3300046557 Ga0495622_0034388 Ga0495622_0034388_1406_2197 263
742 3300046558 Ga0495633_0023315 Ga0495633_0023315_858_1652 263
743 3300046558 Ga0495633_0052680 Ga0495633_0052680_654_1445 263
744 3300046615 Ga0495656_0014559 Ga0495656_0014559_1100_1894 263
745 3300046615 Ga0495656_0043844 Ga0495656_0043844_853_1644 263
746 3300046616 Ga0495668_0004830 Ga0495668_0004830_2697_3491 263
747 3300046648 Ga0495611_0005153 Ga0495611_0005153_1676_2470 263
748 3300046648 Ga0495611_0019043 Ga0495611_0019043_2025_2819 263
749 3300046660 Ga0495625_0004688 Ga0495625_0004688_5707_6501 263
750 3300046660 Ga0495625_0036128 Ga0495625_0036128_1315_2109 263
751 3300046660 Ga0495625_0051062 Ga0495625_0051062_98_889 263
752 3300046665 Ga0495661_0076663 Ga0495661_0076663_402_1193 263
753 3300046674 Ga0495588_0070613 Ga0495588_0070613_563_1354 263
754 3300046690 Ga0495624_0079396 Ga0495624_0079396_135_926 263
755 3300046691 Ga0495670_0010277 Ga0495670_0010277_3164_3958 263
756 3300046691 Ga0495670_0127276 Ga0495670_0127276_265_1059 263
757 3300046692 Ga0495671_0027098 Ga0495671_0027098_1368_2162 263
758 3300046810 Ga0495660_0048243 Ga0495660_0048243_1137_1931 263
759 3300046810 Ga0495660_0049810 Ga0495660_0049810_853_1647 263
760 3300047317 Ga0495604_0037338 Ga0495604_0037338_1236_2027 263
761 3300047318 Ga0495636_0031727 Ga0495636_0031727_22_816 263
762 3300047443 Ga0495687_029489 Ga0495687_029489_1443_2234 263
763 3300047443 Ga0495687_074926 Ga0495687_074926_520_1326 263
764 3300047445 Ga0495677_0152053 Ga0495677_0152053_63_857 263
765 3300047469 Ga0495673_0146266 Ga0495673_0146266_60_851 263
766 3300047470 Ga0495681_0035511 Ga0495681_0035511_1488_2279 263
767 3300047470 Ga0495681_0065139 Ga0495681_0065139_22_813 263
768 3300047470 Ga0495681_0094327 Ga0495681_0094327_300_1094 263
769 3300047472 Ga0495686_0000418 Ga0495686_0000418_61391_62182 263
770 3300047472 Ga0495686_0002364 Ga0495686_0002364_12624_13415 263
771 3300047472 Ga0495686_0010867 Ga0495686_0010867_3725_4516 263
772 3300047472 Ga0495686_0057962 Ga0495686_0057962_405_1196 263
773 3300047472 Ga0495686_0103574 Ga0495686_0103574_574_1368 263
774 3300048903 Ga0496100_0003974 Ga0496100_0003974_4717_5508 263
775 3300048904 Ga0496101_0044657 Ga0496101_0044657_1779_2570 263
776 3300048904 Ga0496101_0257032 Ga0496101_0257032_371_1177 263
777 3300048905 Ga0496102_0008867 Ga0496102_0008867_2459_3250 263
778 3300048906 Ga0496103_0010981 Ga0496103_0010981_2457_3248 263
779 3300048906 Ga0496103_0072928 Ga0496103_0072928_1193_1999 263
780 3300048907 Ga0496104_0340241 Ga0496104_0340241_564_1370 263
781 3300048908 Ga0496105_0122365 Ga0496105_0122365_190_996 263
782 3300048909 Ga0496106_0052791 Ga0496106_0052791_851_1642 263
783 3300048916 Ga0496113_0454510 Ga0496113_0454510_136_927 263
784 3300048917 Ga0496114_0086478 Ga0496114_0086478_969_1760 263
785 3300048919 Ga0496116_0012735 Ga0496116_0012735_4136_4927 263
786 3300048919 Ga0496116_0012821 Ga0496116_0012821_3273_4064 263
787 3300048919 Ga0496116_0032068 Ga0496116_0032068_102_893 263
788 3300048919 Ga0496116_0180844 Ga0496116_0180844_201_995 263
789 3300048919 Ga0496116_0216259 Ga0496116_0216259_95_886 263
790 3300048920 Ga0496117_0005580 Ga0496117_0005580_8183_8974 263
791 3300048920 Ga0496117_0010882 Ga0496117_0010882_6900_7691 263
792 3300048920 Ga0496117_0073253 Ga0496117_0073253_499_1293 263
793 3300048920 Ga0496117_0095863 Ga0496117_0095863_221_1012 263
794 3300048920 Ga0496117_0109230 Ga0496117_0109230_473_1264 263
795 3300048921 Ga0496118_0003614 Ga0496118_0003614_10211_11002 263
796 3300048921 Ga0496118_0004868 Ga0496118_0004868_6498_7289 263
797 3300048921 Ga0496118_0013710 Ga0496118_0013710_743_1537 263
798 3300048921 Ga0496118_0036618 Ga0496118_0036618_2651_3442 263
799 3300048921 Ga0496118_0046256 Ga0496118_0046256_1355_2149 263
800 3300048922 Ga0496119_0046552 Ga0496119_0046552_1720_2511 263
801 3300048922 Ga0496119_0053932 Ga0496119_0053932_335_1126 263
802 3300048922 Ga0496119_0104505 Ga0496119_0104505_555_1346 263
803 3300048923 Ga0496120_0061450 Ga0496120_0061450_1168_1959 263
804 3300048924 Ga0496121_0005802 Ga0496121_0005802_6173_6964 263
805 3300048924 Ga0496121_0019161 Ga0496121_0019161_1326_2117 263
806 3300048924 Ga0496121_0057768 Ga0496121_0057768_719_1513 263
807 3300048924 Ga0496121_0086372 Ga0496121_0086372_1478_2269 263
808 3300048924 Ga0496121_0386265 Ga0496121_0386265_93_884 263
809 3300048925 Ga0496122_0004381 Ga0496122_0004381_8832_9623 263
810 3300048925 Ga0496122_0028667 Ga0496122_0028667_1560_2354 263
811 3300048925 Ga0496122_0034028 Ga0496122_0034028_3293_4084 263
812 3300048925 Ga0496122_0036119 Ga0496122_0036119_2468_3259 263
813 3300048925 Ga0496122_0088694 Ga0496122_0088694_371_1162 263
814 3300048925 Ga0496122_0101019 Ga0496122_0101019_95_886 263
815 3300048925 Ga0496122_0113907 Ga0496122_0113907_52_843 263
816 3300048926 Ga0496123_0007514 Ga0496123_0007514_6310_7104 263
817 3300048926 Ga0496123_0034193 Ga0496123_0034193_2225_3016 263
818 3300048926 Ga0496123_0040913 Ga0496123_0040913_468_1259 263
819 3300048926 Ga0496123_0117119 Ga0496123_0117119_127_918 263
820 3300048926 Ga0496123_0215421 Ga0496123_0215421_78_869 263
821 3300048927 Ga0496124_0005611 Ga0496124_0005611_12753_13544 263
822 3300048927 Ga0496124_0005719 Ga0496124_0005719_12968_13759 263
823 3300048927 Ga0496124_0010468 Ga0496124_0010468_7431_8222 263
824 3300048927 Ga0496124_0037267 Ga0496124_0037267_1540_2334 263
825 3300048927 Ga0496124_0082710 Ga0496124_0082710_685_1476 263
826 3300048927 Ga0496124_0101101 Ga0496124_0101101_76_867 263
827 3300048927 Ga0496124_0135947 Ga0496124_0135947_530_1321 263
828 3300048927 Ga0496124_0150465 Ga0496124_0150465_935_1741 263
829 3300048927 Ga0496124_0411325 Ga0496124_0411325_50_841 263
830 3300048928 Ga0496125_0004711 Ga0496125_0004711_550_1341 263
831 3300048928 Ga0496125_0011734 Ga0496125_0011734_5342_6133 263
832 3300048928 Ga0496125_0080363 Ga0496125_0080363_423_1214 263
833 3300048929 Ga0496126_0066328 Ga0496126_0066328_1607_2398 263
834 3300048929 Ga0496126_0260269 Ga0496126_0260269_97_903 263
835 3300049569 Ga0501032_0105637 Ga0501032_0105637_458_1252 263
836 3300049571 Ga0501034_0041553 Ga0501034_0041553_2896_3705 263
837 3300049571 Ga0501034_0135186 Ga0501034_0135186_857_1651 263
838 3300049572 Ga0501036_0146379 Ga0501036_0146379_934_1728 263
839 3300049574 Ga0501038_0036305 Ga0501038_0036305_3208_4014 263
840 3300049575 Ga0501039_0069810 Ga0501039_0069810_1003_1809 263
841 3300049579 Ga0501043_0037844 Ga0501043_0037844_1796_2590 263
842 3300049579 Ga0501043_0143718 Ga0501043_0143718_261_1067 263
843 3300049581 Ga0501047_0157248 Ga0501047_0157248_181_975 263
844 3300049581 Ga0501047_0172428 Ga0501047_0172428_949_1755 263
845 3300049583 Ga0501067_0146215 Ga0501067_0146215_128_922 263
846 3300049584 Ga0501068_0169680 Ga0501068_0169680_350_1144 263
847 3300049744 Ga0501083_0099443 Ga0501083_0099443_889_1683 263
848 3300049744 Ga0501083_0199315 Ga0501083_0199315_457_1248 263
849 3300049822 Ga0501035_0038128 Ga0501035_0038128_1061_1867 263
850 3300049823 Ga0501044_0101205 Ga0501044_0101205_1033_1839 263
851 3300053086 Ga0500578_0093222 Ga0500578_0093222_1031_1825 263
852 3300053090 Ga0500646_0007652 Ga0500646_0007652_1308_2102 263
853 3300053093 Ga0500651_0243042 Ga0500651_0243042_212_1006 263
854 3300053098 Ga0500650_0028901 Ga0500650_0028901_1164_1958 263
855 3300053104 Ga0500556_0023251 Ga0500556_0023251_596_1390 263
856 3300053105 Ga0500557_000282 Ga0500557_000282_4543_5337 263
857 3300053108 Ga0500562_002778 Ga0500562_002778_1363_2157 263
858 3300053109 Ga0500569_016074 Ga0500569_016074_133_927 263
859 3300053118 Ga0500594_0000635 Ga0500594_0000635_3953_4747 263
860 3300053125 Ga0500618_006727 Ga0500618_006727_1577_2368 263
861 3300053125 Ga0500618_006924 Ga0500618_006924_1612_2403 263
862 3300053134 Ga0500658_0000880 Ga0500658_0000880_7957_8751 263
863 3300053134 Ga0500658_0005307 Ga0500658_0005307_2005_2805 263
864 3300053139 Ga0500568_0000629 Ga0500568_0000629_6272_7066 263
865 3300053139 Ga0500568_0002233 Ga0500568_0002233_4384_5184 263
866 3300053148 Ga0500590_000127 Ga0500590_000127_15616_16407 263
867 3300053151 Ga0500604_0017296 Ga0500604_0017296_1072_1872 263
868 3300053153 Ga0500616_0005719 Ga0500616_0005719_6781_7575 263
869 3300053153 Ga0500616_0110610 Ga0500616_0110610_187_981 263
870 3300053156 Ga0500622_0001672 Ga0500622_0001672_7077_7871 263
871 3300053158 Ga0500627_0032004 Ga0500627_0032004_720_1514 263
872 3300053160 Ga0500633_0016986 Ga0500633_0016986_1093_1887 263
873 3300053160 Ga0500633_0051404 Ga0500633_0051404_356_1150 263
874 3300053177 Ga0500636_0097124 Ga0500636_0097124_215_1006 263
875 3300053730 Ga0500645_015656 Ga0500645_015656_653_1447 263
876 3300060353 Ga0501082_0056138 Ga0501082_0056138_1530_2324 263
877 iso_pu_bacteria 2509276033 2509447535 263
878 iso_pu_bacteria 2515075009 2515113530 263
879 iso_pu_bacteria 2516653077 2517037142 263
880 iso_pu_bacteria 2838016132 2838019937 263
881 iso_pu_bacteria 2838042994 2838045609 263
882 iso_pu_bacteria 2838048938 2838052747 263
883 iso_pu_bacteria 2838061910 2838065004 263
884 iso_pu_bacteria 2838068647 2838069729 263
885 iso_pu_bacteria 2838668709 2838671765 263
886 iso_pu_bacteria 2838701080 2838704444 263
887 iso_pu_bacteria 2841864319 2841867387 263
888 iso_pu_bacteria 2842146304 2842149662 263
889 iso_pu_bacteria 2842192696 2842195635 263
890 iso_pu_bacteria 2842250916 2842254171 263
891 iso_pu_bacteria 2842264693 2842267656 263
892 iso_pu_bacteria 2842278818 2842284406 263
893 iso_pu_bacteria 2842285085 2842285192 263
894 iso_pu_bacteria 2842311132 2842314158 263
895 iso_pu_bacteria 2842317721 2842319961 263
896 iso_pu_bacteria 2842341865 2842347643 263
897 iso_pu_bacteria 2842363717 2842368705 263
898 iso_pu_bacteria 2842395702 2842400587 263
899 iso_pu_bacteria 2842402390 2842402550 263
900 iso_pu_bacteria 2842409023 2842410079 263
901 iso_pu_bacteria 2842415677 2842416727 263
902 iso_pu_bacteria 2842422224 2842423343 263
903 iso_pu_bacteria 2842428310 2842430300 263
904 iso_pu_bacteria 2842434925 2842436888 263
905 iso_pu_bacteria 2842441272 2842443270 263
906 iso_pu_bacteria 2842447887 2842449135 263
907 iso_pu_bacteria 2842462802 2842467172 263
908 iso_pu_bacteria 2842469257 2842471242 263
909 iso_pu_bacteria 2842489311 2842493499 263
910 iso_pu_bacteria 2842495871 2842497649 263
911 iso_pu_bacteria 2933599457 2933600536 263
912 iso_pu_bacteria 2936367885 2936371628 263
913 iso_pu_bacteria 2936375103 2936377001 263
914 iso_pu_bacteria 639633055 639649574 263
915 iso_pu_bacteria 8005275841 8005281645 263
916 iso_pu_bacteria 8005282627 8005284393 263
917 iso_pu_bacteria 8005289223 8005289650 263
918 iso_pu_bacteria 8005301065 8005303553 263
919 iso_pu_bacteria 8005376324 8005382689 263
920 iso_pu_bacteria 8005382845 8005384651 263
921 iso_pu_bacteria 8005395548 8005395679 263
922 iso_pu_bacteria 8005430974 8005433915 263
923 iso_pu_bacteria 8005460587 8005464215 263
924 iso_pu_bacteria 8005497431 8005501319 263
925 iso_pu_bacteria 8005556819 8005561628 263
926 iso_pu_bacteria 8005563573 8005568403 263
927 iso_pu_bacteria 8005619151 8005622681 263
928 iso_pu_bacteria 8005626139 8005630198 263
929 iso_pu_bacteria 8005668836 8005672738 263
930 iso_pu_bacteria 8005688590 8005691669 263
931 iso_pu_bacteria 8005695170 8005696799 263
932 iso_pu_bacteria 8018163183 8018164157 263
933 iso_pu_bacteria 8018176218 8018178951 263
934 iso_pu_bacteria 8024479707 8024486116 263
935 iso_pu_bacteria 8024501048 8024501194 263
936 iso_pu_bacteria 8056375014 8056377012 263
937 iso_pu_bacteria 8057874678 8057881930 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

170

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qi9-assembly1.cif.gz_D abc-transporter btucd in complex with its periplasmic binding protein btuf 0.9387 2 243
4dbl-assembly1.cif.gz_C crystal structure of e159q mutant of btucdf 0.9376 2 243
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9285 2 237
1l7v-assembly1.cif.gz_D bacterial abc transporter involved in b12 uptake 0.9284 2 240
4r9u-assembly1.cif.gz_D structure of vitamin b12 transporter btucd in a nucleotide-bound outward facing state 0.9197 2 245
ID Description Score Start End Superfamily
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 1 247 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 2 220 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 2 227 3.40.50.300
2qi9C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9215 1 239 3.40.50.300
af_Q2FVG0_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9209 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q8NL85-F1-model_v4 Iron ABC transporter 0.986 1 263 GO:0005524
GO:0016887
AF-A0A7W3ZHU8-F1-model_v4 deleted 0.9607 1 253
AF-A0A7W6EYH3-F1-model_v4 Iron complex transport system ATP-binding protein 0.9607 2 239 GO:0005524
GO:0016887
AF-A0A4V3JXG7-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9587 2 248 GO:0005524
GO:0016887
AF-A0A2M9LCL9-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9549 1 237 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map