F486089

General Info

Members Datasets Scaffolds Average Seq Length
933 296 1864 95

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10566789|Ga0111539_105667891
Length 115
Sequence LLNKLNLDVKKLIHLKKEVIMFAVVRHYHFKPEDGAKIDKIVQEGFVPLLKKAKGFIRYYWLDTGNGEGASLSVFKDKAGADESVRLAADFVKANLAQMLNQKPEVIEGPVKAHD

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
213 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
214 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 4.07
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 33.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10566789 3300009094 Bacteria 1323
2 JGI24032J14994_102648 3300001430 Unclassified 629
3 JGI24743J22301_10016904 3300001991 Unclassified 1365
4 JGI24035J26624_1000658 3300002126 Bacteria 3192
5 JGI24035J26624_1002800 3300002126 Unclassified 1627
6 Ga0065704_10819266 3300005289 Unclassified 519
7 Ga0065704_10858249 3300005289 Unclassified 507
8 Ga0065712_10004044 3300005290 Bacteria 5032
9 Ga0065712_10134478 3300005290 Bacteria 1507
10 Ga0065712_10135780 3300005290 Bacteria 1487
11 Ga0065712_10160456 3300005290 Bacteria 1306
12 Ga0065715_10005592 3300005293 Bacteria 6527
13 Ga0065715_10012414 3300005293 Bacteria 2543
14 Ga0065715_10025499 3300005293 Bacteria 1408
15 Ga0065715_10126105 3300005293 Archaea 2105
16 Ga0065715_10261916 3300005293 Bacteria 1135
17 Ga0065715_10401046 3300005293 Unclassified 875
18 Ga0065715_10436411 3300005293 Unclassified 841
19 Ga0065715_10489311 3300005293 Unclassified 789
20 Ga0065715_10508383 3300005293 Bacteria 773
21 Ga0065715_10579753 3300005293 Unclassified 676
22 Ga0065707_10223661 3300005295 Bacteria 1215
23 Ga0065707_10421418 3300005295 Unclassified 830
24 Ga0065707_10833487 3300005295 Bacteria 588
25 Ga0070658_10931653 3300005327 Bacteria 755
26 Ga0070676_10014778 3300005328 Bacteria 4295
27 Ga0070676_10081747 3300005328 Unclassified 1961
28 Ga0070676_10088411 3300005328 Bacteria 1893
29 Ga0070683_100011499 3300005329 Bacteria 7656
30 Ga0070683_100030484 3300005329 Unclassified 4898
31 Ga0070683_100102862 3300005329 Bacteria 2691
32 Ga0070683_101046186 3300005329 Unclassified 784
33 Ga0070683_101127421 3300005329 Unclassified 754
34 Ga0070683_101235137 3300005329 Unclassified 718
35 Ga0070683_102033275 3300005329 Bacteria 552
36 Ga0070683_102060023 3300005329 Bacteria 548
37 Ga0070690_100019296 3300005330 Bacteria 4135
38 Ga0070690_100107308 3300005330 Bacteria 1858
39 Ga0070690_100211894 3300005330 Unclassified 1353
40 Ga0070690_100232803 3300005330 Bacteria 1296
41 Ga0070690_100280222 3300005330 Bacteria 1189
42 Ga0070690_100419300 3300005330 Bacteria 986
43 Ga0070690_100504118 3300005330 Unclassified 906
44 Ga0070670_100038007 3300005331 Bacteria 4139
45 Ga0070670_100081973 3300005331 Unclassified 2772
46 Ga0070670_100394336 3300005331 Bacteria 1221
47 Ga0070670_100452960 3300005331 Unclassified 1137
48 Ga0070670_101461510 3300005331 Bacteria 627
49 Ga0070677_10033624 3300005333 Unclassified 1976
50 Ga0070677_10107986 3300005333 Bacteria 1238
51 Ga0070677_10626940 3300005333 Unclassified 598
52 Ga0068869_100231246 3300005334 Unclassified 1469
53 Ga0068869_100250849 3300005334 Bacteria 1413
54 Ga0068869_100402758 3300005334 Bacteria 1126
55 Ga0068869_100605785 3300005334 Unclassified 926
56 Ga0068869_101287444 3300005334 Unclassified 644
57 Ga0070666_10005870 3300005335 Bacteria 7544
58 Ga0070666_10122890 3300005335 Bacteria 1801
59 Ga0070666_10199184 3300005335 Bacteria 1409
60 Ga0070666_10495535 3300005335 Unclassified 885
61 Ga0070682_100114350 3300005337 Bacteria 1803
62 Ga0070682_100493615 3300005337 Unclassified 947
63 Ga0070682_101061604 3300005337 Unclassified 676
64 Ga0070682_101175427 3300005337 Bacteria 646
65 Ga0068868_100051035 3300005338 Bacteria 3251
66 Ga0068868_100087147 3300005338 Unclassified 2511
67 Ga0068868_100138969 3300005338 Bacteria 1993
68 Ga0068868_100182711 3300005338 Bacteria 1741
69 Ga0068868_100511545 3300005338 Bacteria 1053
70 Ga0068868_101228007 3300005338 Unclassified 694
71 Ga0070660_100133096 3300005339 Unclassified 1991
72 Ga0070660_100207272 3300005339 Unclassified 1591
73 Ga0070660_100282199 3300005339 Unclassified 1359
74 Ga0070689_100004490 3300005340 Bacteria 9439
75 Ga0070689_100007248 3300005340 Bacteria 7734
76 Ga0070689_100202486 3300005340 Bacteria 1622
77 Ga0070689_100556346 3300005340 Unclassified 989
78 Ga0070689_101578534 3300005340 Bacteria 595
79 Ga0070687_100054195 3300005343 Unclassified 2088
80 Ga0070687_100130896 3300005343 Unclassified 1448
81 Ga0070687_100626316 3300005343 Bacteria 742
82 Ga0070687_100794340 3300005343 Bacteria 670
83 Ga0070687_100882200 3300005343 Unclassified 640
84 Ga0070687_101273431 3300005343 Bacteria 545
85 Ga0070687_101376043 3300005343 Unclassified 527
86 Ga0070661_100300629 3300005344 Bacteria 1249
87 Ga0070661_100582524 3300005344 Unclassified 903
88 Ga0070692_11350696 3300005345 Unclassified 513
89 Ga0070668_100977910 3300005347 Bacteria 760
90 Ga0070668_101539835 3300005347 Unclassified 608
91 Ga0070668_101693665 3300005347 Bacteria 580
92 Ga0070669_100016907 3300005353 Bacteria 5207
93 Ga0070669_100143892 3300005353 Bacteria 1840
94 Ga0070669_100372419 3300005353 Unclassified 1163
95 Ga0070669_100423998 3300005353 Bacteria 1092
96 Ga0070669_100613550 3300005353 Unclassified 912
97 Ga0070669_100880120 3300005353 Bacteria 764
98 Ga0070669_100936037 3300005353 Bacteria 741
99 Ga0070675_100035982 3300005354 Bacteria 4026
100 Ga0070675_100063235 3300005354 Bacteria 3059
101 Ga0070675_100073569 3300005354 Bacteria 2837
102 Ga0070675_100096217 3300005354 Bacteria 2487
103 Ga0070675_100135537 3300005354 Bacteria 2101
104 Ga0070675_100185374 3300005354 Bacteria 1801
105 Ga0070675_100639262 3300005354 Bacteria 966
106 Ga0070675_101111763 3300005354 Bacteria 727
107 Ga0070675_101123899 3300005354 Bacteria 723
108 Ga0070675_102084608 3300005354 Bacteria 523
109 Ga0070675_102100260 3300005354 Unclassified 521
110 Ga0070671_100184621 3300005355 Bacteria 1767
111 Ga0070671_100224034 3300005355 Unclassified 1595
112 Ga0070671_100274237 3300005355 Unclassified 1434
113 Ga0070671_100523033 3300005355 Unclassified 1022
114 Ga0070671_100692878 3300005355 Bacteria 883
115 Ga0070671_100858391 3300005355 Bacteria 792
116 Ga0070671_101660801 3300005355 Bacteria 567
117 Ga0070671_102104101 3300005355 Unclassified 503
118 Ga0070674_100238628 3300005356 Bacteria 1422
119 Ga0070673_100013118 3300005364 Bacteria 5720
120 Ga0070673_100058068 3300005364 Bacteria 3058
121 Ga0070673_100769427 3300005364 Bacteria 887
122 Ga0070673_100852409 3300005364 Bacteria 843
123 Ga0070673_100931571 3300005364 Bacteria 807
124 Ga0070673_102346521 3300005364 Unclassified 507
125 Ga0070688_100001199 3300005365 Bacteria 12899
126 Ga0070688_100065104 3300005365 Bacteria 2315
127 Ga0070688_100075550 3300005365 Unclassified 2166
128 Ga0070688_100174116 3300005365 Unclassified 1488
129 Ga0070688_100684792 3300005365 Bacteria 793
130 Ga0070688_100966001 3300005365 Bacteria 675
131 Ga0070688_101467681 3300005365 Bacteria 554
132 Ga0070659_100002571 3300005366 Bacteria 12908
133 Ga0070659_100135247 3300005366 Unclassified 2004
134 Ga0070659_100658203 3300005366 Bacteria 903
135 Ga0070659_101133665 3300005366 Bacteria 690
136 Ga0070667_100018520 3300005367 Bacteria 5776
137 Ga0070667_100073067 3300005367 Bacteria 2924
138 Ga0070667_100085820 3300005367 Bacteria 2700
139 Ga0070667_100134228 3300005367 Bacteria 2163
140 Ga0070667_100477794 3300005367 Bacteria 1141
141 Ga0070667_100602263 3300005367 Bacteria 1012
142 Ga0070667_100978607 3300005367 Bacteria 789
143 Ga0070667_101197752 3300005367 Bacteria 711
144 Ga0070667_101247682 3300005367 Bacteria 696
145 Ga0070667_101497583 3300005367 Bacteria 634
146 Ga0070667_101499472 3300005367 Bacteria 633
147 Ga0070709_10983628 3300005434 Unclassified 670
148 Ga0070714_100093624 3300005435 Unclassified 2635
149 Ga0070713_100286211 3300005436 Bacteria 1513
150 Ga0070701_10293146 3300005438 Unclassified 998
151 Ga0070711_100125787 3300005439 Bacteria 1903
152 Ga0070711_100472312 3300005439 Bacteria 1029
153 Ga0070711_100757359 3300005439 Bacteria 821
154 Ga0070711_101256740 3300005439 Unclassified 642
155 Ga0070711_101713438 3300005439 Unclassified 551
156 Ga0070705_100179897 3300005440 Unclassified 1432
157 Ga0070705_100506255 3300005440 Unclassified 918
158 Ga0070705_101314929 3300005440 Unclassified 600
159 Ga0070700_100010242 3300005441 Bacteria 5172
160 Ga0070700_100635194 3300005441 Bacteria 841
161 Ga0070700_101580214 3300005441 Bacteria 560
162 Ga0070694_100140641 3300005444 Unclassified 1753
163 Ga0070694_100942734 3300005444 Unclassified 714
164 Ga0070694_101822670 3300005444 Unclassified 519
165 Ga0070708_100025891 3300005445 Bacteria 5017
166 Ga0070708_100313032 3300005445 Bacteria 1479
167 Ga0070708_101706955 3300005445 Bacteria 585
168 Ga0070663_100009998 3300005455 Bacteria 5897
169 Ga0070663_101287521 3300005455 Bacteria 645
170 Ga0070678_100018086 3300005456 Bacteria 4560
171 Ga0070678_100213280 3300005456 Bacteria 1601
172 Ga0070678_100308272 3300005456 Bacteria 1348
173 Ga0070662_100073930 3300005457 Bacteria 2520
174 Ga0070662_100089622 3300005457 Unclassified 2307
175 Ga0070662_100238277 3300005457 Bacteria 1458
176 Ga0070662_100266203 3300005457 Bacteria 1382
177 Ga0070662_100370566 3300005457 Unclassified 1177
178 Ga0070662_100691071 3300005457 Viruses 863
179 Ga0070662_101004914 3300005457 Bacteria 714
180 Ga0070681_10224369 3300005458 Bacteria 1794
181 Ga0068867_100084519 3300005459 Bacteria 2398
182 Ga0068867_100214705 3300005459 Unclassified 1547
183 Ga0068867_100390588 3300005459 Unclassified 1171
184 Ga0068867_100398616 3300005459 Bacteria 1160
185 Ga0068867_100414753 3300005459 Unclassified 1139
186 Ga0068867_100605081 3300005459 Unclassified 956
187 Ga0068867_100900899 3300005459 Unclassified 796
188 Ga0068867_101132396 3300005459 Unclassified 716
189 Ga0068867_101245693 3300005459 Unclassified 685
190 Ga0068867_101744696 3300005459 Bacteria 584
191 Ga0070685_10006366 3300005466 Bacteria 6017
192 Ga0070685_10007687 3300005466 Bacteria 5517
193 Ga0070685_10017516 3300005466 Unclassified 3836
194 Ga0070685_10066526 3300005466 Bacteria 2124
195 Ga0070685_10887625 3300005466 Unclassified 663
196 Ga0070706_100023029 3300005467 Bacteria 5736
197 Ga0070706_100023191 3300005467 Bacteria 5716
198 Ga0070706_100726358 3300005467 Unclassified 921
199 Ga0070707_100147648 3300005468 Bacteria 2288
200 Ga0070707_101313212 3300005468 Unclassified 690
201 Ga0070707_101585781 3300005468 Unclassified 622
202 Ga0070698_100526981 3300005471 Bacteria 1120
203 Ga0070698_101452951 3300005471 Unclassified 637
204 Ga0070699_101294108 3300005518 Unclassified 669
205 Ga0070684_100006906 3300005535 Bacteria 8815
206 Ga0070684_100140455 3300005535 Unclassified 2184
207 Ga0070697_100001381 3300005536 Bacteria 18360
208 Ga0070697_100618380 3300005536 Bacteria 953
209 Ga0070697_101380454 3300005536 Unclassified 629
210 Ga0070697_101461731 3300005536 Unclassified 611
211 Ga0070697_101938381 3300005536 Unclassified 527
212 Ga0068853_100807417 3300005539 Bacteria 899
213 Ga0068853_101199714 3300005539 Unclassified 733
214 Ga0068853_101424043 3300005539 Unclassified 670
215 Ga0070672_100010949 3300005543 Bacteria 6310
216 Ga0070672_100040024 3300005543 Bacteria 3594
217 Ga0070672_100304207 3300005543 Unclassified 1352
218 Ga0070672_100750073 3300005543 Bacteria 857
219 Ga0070672_101087962 3300005543 Unclassified 710
220 Ga0070672_101344041 3300005543 Bacteria 638
221 Ga0070672_101733346 3300005543 Bacteria 561
222 Ga0070672_102106638 3300005543 Bacteria 508
223 Ga0070686_100024836 3300005544 Bacteria 3595
224 Ga0070686_100534364 3300005544 Bacteria 915
225 Ga0070686_100664187 3300005544 Unclassified 828
226 Ga0070686_100680700 3300005544 Bacteria 818
227 Ga0070686_101303351 3300005544 Bacteria 607
228 Ga0070686_101319934 3300005544 Bacteria 603
229 Ga0070695_100689768 3300005545 Unclassified 810
230 Ga0070693_100512421 3300005547 Bacteria 853
231 Ga0070693_101082875 3300005547 Unclassified 610
232 Ga0070665_100077406 3300005548 Bacteria 3332
233 Ga0070665_100131038 3300005548 Unclassified 2510
234 Ga0070665_100619989 3300005548 Bacteria 1095
235 Ga0070665_101022072 3300005548 Unclassified 839
236 Ga0070704_100022921 3300005549 Bacteria 4069
237 Ga0070704_100548442 3300005549 Bacteria 1010
238 Ga0070704_101521603 3300005549 Unclassified 616
239 Ga0068855_100624428 3300005563 Unclassified 1160
240 Ga0070664_101577321 3300005564 Unclassified 622
241 Ga0068857_100119514 3300005577 Bacteria 2372
242 Ga0068854_100072812 3300005578 Bacteria 2517
243 Ga0068854_100551022 3300005578 Unclassified 978
244 Ga0068854_101275231 3300005578 Bacteria 661
245 Ga0068856_102269539 3300005614 Bacteria 551
246 Ga0070702_100021227 3300005615 Bacteria 3414
247 Ga0070702_100409679 3300005615 Bacteria 972
248 Ga0070702_100465178 3300005615 Bacteria 920
249 Ga0070702_101250219 3300005615 Bacteria 601
250 Ga0070702_101527134 3300005615 Bacteria 550
251 Ga0070702_101578358 3300005615 Unclassified 542
252 Ga0068852_100064621 3300005616 Bacteria 3190
253 Ga0068852_100290946 3300005616 Unclassified 1578
254 Ga0068852_101264597 3300005616 Bacteria 759
255 Ga0068859_100035531 3300005617 Bacteria 5000
256 Ga0068859_100093098 3300005617 Bacteria 3065
257 Ga0068859_100304491 3300005617 Bacteria 1687
258 Ga0068859_100393877 3300005617 Bacteria 1481
259 Ga0068859_100430290 3300005617 Bacteria 1416
260 Ga0068859_100565722 3300005617 Bacteria 1231
261 Ga0068859_100847732 3300005617 Unclassified 1000
262 Ga0068859_102400754 3300005617 Unclassified 581
263 Ga0068859_102919102 3300005617 Unclassified 523
264 Ga0068864_100050010 3300005618 Bacteria 3597
265 Ga0068864_100069013 3300005618 Bacteria 3072
266 Ga0068864_100268308 3300005618 Unclassified 1589
267 Ga0068864_100583176 3300005618 Bacteria 1084
268 Ga0068864_100750689 3300005618 Unclassified 956
269 Ga0068864_100933884 3300005618 Bacteria 858
270 Ga0068864_101608758 3300005618 Bacteria 654
271 Ga0068864_102443818 3300005618 Unclassified 529
272 Ga0068864_102652362 3300005618 Unclassified 507
273 Ga0068866_10048868 3300005718 Unclassified 2141
274 Ga0068866_10300244 3300005718 Unclassified 1003
275 Ga0068866_10541540 3300005718 Unclassified 777
276 Ga0068866_11214608 3300005718 Unclassified 545
277 Ga0068861_100040137 3300005719 Bacteria 3498
278 Ga0068861_100079226 3300005719 Bacteria 2568
279 Ga0068861_100315563 3300005719 Bacteria 1360
280 Ga0068851_10222553 3300005834 Bacteria 1061
281 Ga0068870_11216641 3300005840 Bacteria 546
282 Ga0068863_100022457 3300005841 Bacteria 6026
283 Ga0068863_100047122 3300005841 Bacteria 4090
284 Ga0068863_100087581 3300005841 Bacteria 2951
285 Ga0068863_100161759 3300005841 Bacteria 2145
286 Ga0068863_101344747 3300005841 Bacteria 722
287 Ga0068863_102123465 3300005841 Bacteria 572
288 Ga0068858_100009874 3300005842 Bacteria 9069
289 Ga0068858_100075105 3300005842 Bacteria 3139
290 Ga0068858_100272656 3300005842 Bacteria 1610
291 Ga0068858_101473481 3300005842 Bacteria 671
292 Ga0068858_101477253 3300005842 Bacteria 670
293 Ga0068860_100027486 3300005843 Bacteria 5479
294 Ga0068860_100351835 3300005843 Bacteria 1450
295 Ga0068860_101046374 3300005843 Unclassified 835
296 Ga0068860_101641161 3300005843 Bacteria 665
297 Ga0068862_100159026 3300005844 Bacteria 2015
298 Ga0068862_100354776 3300005844 Unclassified 1361
299 Ga0068862_100557078 3300005844 Bacteria 1095
300 Ga0068862_100876778 3300005844 Bacteria 881
301 Ga0068862_100898080 3300005844 Unclassified 871
302 Ga0068862_100945230 3300005844 Bacteria 850
303 Ga0068862_101329737 3300005844 Bacteria 720
304 Ga0068862_102630749 3300005844 Bacteria 515
305 Ga0070717_10033417 3300006028 Bacteria 4150
306 Ga0075365_10630769 3300006038 Bacteria 758
307 Ga0070715_10181835 3300006163 Bacteria 1055
308 Ga0070715_10395233 3300006163 Bacteria 767
309 Ga0070716_101189635 3300006173 Unclassified 612
310 Ga0070712_100066847 3300006175 Unclassified 2556
311 Ga0070712_100134215 3300006175 Bacteria 1880
312 Ga0070712_100657590 3300006175 Unclassified 891
313 Ga0097621_100020065 3300006237 Bacteria 5146
314 Ga0097621_100070759 3300006237 Bacteria 2881
315 Ga0097621_100196884 3300006237 Unclassified 1747
316 Ga0097621_100217413 3300006237 Unclassified 1664
317 Ga0097621_100282090 3300006237 Bacteria 1462
318 Ga0097621_100362220 3300006237 Bacteria 1292
319 Ga0097621_100362483 3300006237 Bacteria 1291
320 Ga0097621_101038221 3300006237 Bacteria 768
321 Ga0097621_101084676 3300006237 Bacteria 751
322 Ga0068871_100033947 3300006358 Bacteria 4044
323 Ga0068871_100039948 3300006358 Unclassified 3756
324 Ga0068871_100059877 3300006358 Bacteria 3104
325 Ga0068871_100117289 3300006358 Bacteria 2245
326 Ga0068871_100154242 3300006358 Unclassified 1960
327 Ga0068871_100251516 3300006358 Bacteria 1539
328 Ga0068871_100285983 3300006358 Bacteria 1443
329 Ga0068871_100528054 3300006358 Unclassified 1066
330 Ga0068871_100757087 3300006358 Unclassified 893
331 Ga0068871_100899761 3300006358 Unclassified 820
332 Ga0068871_101265545 3300006358 Bacteria 693
333 Ga0068871_101669271 3300006358 Bacteria 604
334 Ga0075428_100454541 3300006844 Bacteria 1372
335 Ga0075430_100024562 3300006846 Bacteria 5126
336 Ga0075431_100052166 3300006847 Unclassified 4217
337 Ga0075431_100206210 3300006847 Bacteria 2010
338 Ga0075433_11081585 3300006852 Unclassified 697
339 Ga0075434_100298788 3300006871 Unclassified 1630
340 Ga0075429_100022430 3300006880 Bacteria 5475
341 Ga0075429_100313205 3300006880 Bacteria 1374
342 Ga0068865_100081475 3300006881 Unclassified 2324
343 Ga0068865_100415529 3300006881 Unclassified 1105
344 Ga0068865_100937427 3300006881 Unclassified 755
345 Ga0068865_101184821 3300006881 Bacteria 676
346 Ga0068865_101200492 3300006881 Bacteria 671
347 Ga0097620_100035530 3300006931 Bacteria 5000
348 Ga0097620_100093092 3300006931 Bacteria 3065
349 Ga0097620_100304511 3300006931 Bacteria 1687
350 Ga0097620_100393906 3300006931 Bacteria 1481
351 Ga0097620_100430329 3300006931 Bacteria 1416
352 Ga0097620_100565716 3300006931 Bacteria 1231
353 Ga0097620_100847806 3300006931 Unclassified 1000
354 Ga0097620_102399726 3300006931 Unclassified 581
355 Ga0097620_102918610 3300006931 Unclassified 523
356 Ga0105251_10200959 3300009011 Bacteria 898
357 Ga0105240_10260102 3300009093 Bacteria 2002
358 Ga0111539_10048604 3300009094 Bacteria 5064
359 Ga0111539_10482610 3300009094 Bacteria 1444
360 Ga0111539_10841575 3300009094 Bacteria 1067
361 Ga0111539_12294643 3300009094 Bacteria 626
362 Ga0111539_13239766 3300009094 Unclassified 524
363 Ga0111539_13459810 3300009094 Unclassified 507
364 Ga0105245_10179621 3300009098 Bacteria 2021
365 Ga0105245_10272511 3300009098 Bacteria 1651
366 Ga0105245_10328953 3300009098 Bacteria 1508
367 Ga0105245_10370392 3300009098 Bacteria 1424
368 Ga0105245_11084546 3300009098 Unclassified 847
369 Ga0105247_10069340 3300009101 Bacteria 2200
370 Ga0105247_10140515 3300009101 Unclassified 1582
371 Ga0105247_10161278 3300009101 Unclassified 1485
372 Ga0105247_10522979 3300009101 Bacteria 868
373 Ga0114129_10134955 3300009147 Bacteria 3386
374 Ga0105243_10081696 3300009148 Bacteria 2639
375 Ga0105243_10126597 3300009148 Bacteria 2162
376 Ga0105243_11078581 3300009148 Unclassified 810
377 Ga0105241_10093251 3300009174 Unclassified 2379
378 Ga0105241_10603844 3300009174 Bacteria 991
379 Ga0105241_11733662 3300009174 Unclassified 608
380 Ga0105242_10005987 3300009176 Bacteria 9376
381 Ga0105242_10185845 3300009176 Bacteria 1836
382 Ga0105242_10361110 3300009176 Unclassified 1344
383 Ga0105242_11291439 3300009176 Bacteria 753
384 Ga0105242_12031596 3300009176 Unclassified 618
385 Ga0105248_10075569 3300009177 Bacteria 3786
386 Ga0105248_10098900 3300009177 Bacteria 3287
387 Ga0105248_10398824 3300009177 Bacteria 1549
388 Ga0105248_10402636 3300009177 Unclassified 1541
389 Ga0105248_10488316 3300009177 Unclassified 1388
390 Ga0105248_10726649 3300009177 Bacteria 1120
391 Ga0105248_11053696 3300009177 Unclassified 919
392 Ga0105248_11845408 3300009177 Bacteria 686
393 Ga0105248_12498584 3300009177 Unclassified 589
394 Ga0105237_10150893 3300009545 Bacteria 2320
395 Ga0105237_11151633 3300009545 Bacteria 782
396 Ga0105249_10001311 3300009553 Bacteria 21783
397 Ga0105249_10010090 3300009553 Bacteria 8290
398 Ga0105249_10037978 3300009553 Bacteria 4370
399 Ga0105249_10041778 3300009553 Bacteria 4169
400 Ga0105249_10079433 3300009553 Bacteria 3045
401 Ga0105249_10293286 3300009553 Bacteria 1629
402 Ga0105249_10350192 3300009553 Unclassified 1496
403 Ga0105249_10414653 3300009553 Unclassified 1379
404 Ga0105249_10516984 3300009553 Bacteria 1241
405 Ga0105249_10599384 3300009553 Unclassified 1156
406 Ga0105249_11699170 3300009553 Bacteria 704
407 Ga0105249_13022754 3300009553 Bacteria 540
408 Ga0099796_10100323 3300010159 Bacteria 1088
409 Ga0105239_10052885 3300010375 Bacteria 4454
410 Ga0105239_10055606 3300010375 Bacteria 4340
411 Ga0105239_10215555 3300010375 Bacteria 2152
412 Ga0105239_10961147 3300010375 Bacteria 981
413 Ga0105246_10068122 3300011119 Bacteria 2495
414 Ga0157371_10268586 3300013102 Unclassified 1231
415 Ga0157371_10298495 3300013102 Bacteria 1166
416 Ga0157374_10013528 3300013296 Bacteria 7123
417 Ga0157374_10020158 3300013296 Bacteria 5911
418 Ga0157374_10053956 3300013296 Unclassified 3748
419 Ga0157374_10060608 3300013296 Bacteria 3542
420 Ga0157374_10263427 3300013296 Bacteria 1698
421 Ga0157374_10327872 3300013296 Bacteria 1518
422 Ga0157374_10491174 3300013296 Bacteria 1231
423 Ga0157374_10549174 3300013296 Unclassified 1163
424 Ga0157374_11074164 3300013296 Unclassified 825
425 Ga0157374_11076481 3300013296 Bacteria 824
426 Ga0157374_11521452 3300013296 Unclassified 693
427 Ga0157374_11625742 3300013296 Unclassified 670
428 Ga0157374_12845169 3300013296 Bacteria 511
429 Ga0157374_12883599 3300013296 Unclassified 508
430 Ga0157378_10025935 3300013297 Bacteria 5165
431 Ga0157378_10051722 3300013297 Bacteria 3655
432 Ga0157378_10055673 3300013297 Bacteria 3523
433 Ga0157378_10325271 3300013297 Unclassified 1495
434 Ga0157378_10363753 3300013297 Unclassified 1416
435 Ga0157378_10395389 3300013297 Bacteria 1361
436 Ga0157378_10439604 3300013297 Bacteria 1293
437 Ga0157378_10743519 3300013297 Bacteria 1003
438 Ga0157378_10755562 3300013297 Unclassified 995
439 Ga0157378_10810182 3300013297 Unclassified 963
440 Ga0157378_11912774 3300013297 Bacteria 642
441 Ga0157378_13030252 3300013297 Unclassified 521
442 Ga0163162_10010052 3300013306 Bacteria 9201
443 Ga0163162_10114454 3300013306 Bacteria 2796
444 Ga0163162_10124221 3300013306 Bacteria 2686
445 Ga0163162_10153141 3300013306 Unclassified 2424
446 Ga0163162_10204973 3300013306 Unclassified 2101
447 Ga0163162_11174474 3300013306 Bacteria 871
448 Ga0163162_11353665 3300013306 Bacteria 809
449 Ga0163162_11672673 3300013306 Bacteria 727
450 Ga0163162_12014398 3300013306 Bacteria 662
451 Ga0157372_10478705 3300013307 Unclassified 1451
452 Ga0157372_10716987 3300013307 Bacteria 1163
453 Ga0157372_11914408 3300013307 Unclassified 682
454 Ga0157372_12155459 3300013307 Bacteria 640
455 Ga0157375_10023557 3300013308 Bacteria 5683
456 Ga0157375_10086990 3300013308 Bacteria 3177
457 Ga0157375_10095316 3300013308 Bacteria 3046
458 Ga0157375_10137476 3300013308 Bacteria 2569
459 Ga0157375_10139419 3300013308 Unclassified 2551
460 Ga0157375_10378747 3300013308 Bacteria 1582
461 Ga0157375_10539301 3300013308 Bacteria 1329
462 Ga0157375_10586654 3300013308 Bacteria 1274
463 Ga0157375_11387335 3300013308 Unclassified 828
464 Ga0157375_11499745 3300013308 Unclassified 796
465 Ga0157375_13147499 3300013308 Unclassified 550
466 Ga0157375_13385849 3300013308 Unclassified 531
467 Ga0163163_10239924 3300014325 Bacteria 1862
468 Ga0163163_10601053 3300014325 Bacteria 1163
469 Ga0163163_10900261 3300014325 Bacteria 948
470 Ga0163163_11112829 3300014325 Bacteria 853
471 Ga0163163_11607120 3300014325 Unclassified 711
472 Ga0157380_10040869 3300014326 Bacteria 3616
473 Ga0157380_10365536 3300014326 Unclassified 1356
474 Ga0157380_10378537 3300014326 Bacteria 1335
475 Ga0157380_10625234 3300014326 Bacteria 1070
476 Ga0157380_11962378 3300014326 Unclassified 647
477 Ga0157380_12408596 3300014326 Unclassified 592
478 Ga0157377_10006420 3300014745 Bacteria 5610
479 Ga0157377_10011698 3300014745 Bacteria 4388
480 Ga0157377_10568789 3300014745 Bacteria 803
481 Ga0157377_10797289 3300014745 Bacteria 696
482 Ga0157377_11124317 3300014745 Bacteria 603
483 Ga0157377_11779637 3300014745 Unclassified 500
484 Ga0157379_10001919 3300014968 Bacteria 17194
485 Ga0157379_10056425 3300014968 Unclassified 3509
486 Ga0157379_10194117 3300014968 Bacteria 1835
487 Ga0157379_10207397 3300014968 Bacteria 1773
488 Ga0157379_10250274 3300014968 Bacteria 1608
489 Ga0157379_10376014 3300014968 Bacteria 1303
490 Ga0157379_10539993 3300014968 Bacteria 1084
491 Ga0157379_10693552 3300014968 Bacteria 955
492 Ga0157379_10871290 3300014968 Bacteria 853
493 Ga0157376_10030505 3300014969 Bacteria 4306
494 Ga0157376_10031260 3300014969 Bacteria 4260
495 Ga0157376_10032198 3300014969 Unclassified 4207
496 Ga0157376_10107502 3300014969 Bacteria 2449
497 Ga0157376_10310919 3300014969 Bacteria 1495
498 Ga0157376_10975493 3300014969 Bacteria 869
499 Ga0163161_10013980 3300017792 Bacteria 5589
500 Ga0163161_10024475 3300017792 Bacteria 4265
501 Ga0163161_10074190 3300017792 Bacteria 2494
502 Ga0163161_10075954 3300017792 Unclassified 2466
503 Ga0163161_10238404 3300017792 Bacteria 1414
504 Ga0163161_10241469 3300017792 Unclassified 1405
505 Ga0163161_10374205 3300017792 Bacteria 1137
506 Ga0163161_10416436 3300017792 Unclassified 1080
507 Ga0163161_11308036 3300017792 Unclassified 630
508 Ga0163161_11936812 3300017792 Bacteria 524
509 Ga0228598_1096405 3300024227 Unclassified 596
510 Ga0207666_1000715 3300025271 Bacteria 3977
511 Ga0207666_1025337 3300025271 Bacteria 889
512 Ga0207673_1000739 3300025290 Bacteria 3510
513 Ga0207673_1002367 3300025290 Bacteria 2147
514 Ga0207673_1023211 3300025290 Unclassified 844
515 Ga0207697_10002692 3300025315 Bacteria 9081
516 Ga0207697_10004121 3300025315 Bacteria 7017
517 Ga0207697_10178171 3300025315 Unclassified 931
518 Ga0207656_10088658 3300025321 Bacteria 1401
519 Ga0207653_10442742 3300025885 Unclassified 510
520 Ga0207682_10036406 3300025893 Unclassified 1991
521 Ga0207682_10568424 3300025893 Bacteria 535
522 Ga0207692_10609112 3300025898 Unclassified 703
523 Ga0207642_10036727 3300025899 Unclassified 2105
524 Ga0207642_10347440 3300025899 Bacteria 874
525 Ga0207642_10619789 3300025899 Unclassified 675
526 Ga0207710_10004123 3300025900 Bacteria 6381
527 Ga0207710_10482424 3300025900 Bacteria 642
528 Ga0207688_10088285 3300025901 Bacteria 1778
529 Ga0207688_10116765 3300025901 Unclassified 1554
530 Ga0207680_10008325 3300025903 Bacteria 5082
531 Ga0207680_10030765 3300025903 Bacteria 3033
532 Ga0207680_10448836 3300025903 Unclassified 915
533 Ga0207647_10010327 3300025904 Bacteria 6594
534 Ga0207685_10085696 3300025905 Bacteria 1315
535 Ga0207685_10146251 3300025905 Bacteria 1065
536 Ga0207699_10527715 3300025906 Unclassified 854
537 Ga0207699_10650600 3300025906 Bacteria 770
538 Ga0207645_10025077 3300025907 Bacteria 3861
539 Ga0207645_10115682 3300025907 Unclassified 1739
540 Ga0207645_10433101 3300025907 Bacteria 887
541 Ga0207645_10901081 3300025907 Unclassified 601
542 Ga0207643_10011654 3300025908 Bacteria 4748
543 Ga0207643_10143758 3300025908 Bacteria 1426
544 Ga0207643_10219908 3300025908 Bacteria 1162
545 Ga0207643_10342824 3300025908 Bacteria 937
546 Ga0207684_10024515 3300025910 Bacteria 5142
547 Ga0207684_10060512 3300025910 Bacteria 3216
548 Ga0207684_10951340 3300025910 Unclassified 720
549 Ga0207654_10203907 3300025911 Unclassified 1304
550 Ga0207707_10375910 3300025912 Unclassified 1222
551 Ga0207695_10915386 3300025913 Unclassified 756
552 Ga0207693_10085755 3300025915 Bacteria 2467
553 Ga0207693_10117940 3300025915 Bacteria 2084
554 Ga0207693_10252928 3300025915 Bacteria 1382
555 Ga0207693_10438766 3300025915 Unclassified 1021
556 Ga0207663_10137944 3300025916 Bacteria 1695
557 Ga0207660_10313238 3300025917 Bacteria 1252
558 Ga0207662_10085817 3300025918 Unclassified 1928
559 Ga0207662_10329974 3300025918 Bacteria 1020
560 Ga0207662_10922014 3300025918 Bacteria 619
561 Ga0207657_10250225 3300025919 Unclassified 1413
562 Ga0207657_10252053 3300025919 Bacteria 1407
563 Ga0207649_10256805 3300025920 Bacteria 1261
564 Ga0207649_10579797 3300025920 Unclassified 861
565 Ga0207646_10516857 3300025922 Unclassified 1075
566 Ga0207646_10518318 3300025922 Unclassified 1073
567 Ga0207646_11307124 3300025922 Unclassified 633
568 Ga0207681_10193786 3300025923 Bacteria 1556
569 Ga0207681_10215360 3300025923 Bacteria 1483
570 Ga0207681_10308411 3300025923 Bacteria 1255
571 Ga0207681_10657051 3300025923 Unclassified 869
572 Ga0207681_11197981 3300025923 Bacteria 638
573 Ga0207681_11551219 3300025923 Bacteria 555
574 Ga0207694_11402338 3300025924 Unclassified 590
575 Ga0207650_10184144 3300025925 Bacteria 1666
576 Ga0207650_10345283 3300025925 Bacteria 1223
577 Ga0207650_10913570 3300025925 Unclassified 746
578 Ga0207650_11775011 3300025925 Unclassified 522
579 Ga0207659_10011372 3300025926 Bacteria 5620
580 Ga0207659_10012514 3300025926 Bacteria 5401
581 Ga0207659_10057444 3300025926 Bacteria 2790
582 Ga0207659_10070737 3300025926 Bacteria 2545
583 Ga0207659_10540667 3300025926 Bacteria 989
584 Ga0207659_10614810 3300025926 Bacteria 927
585 Ga0207659_10627284 3300025926 Bacteria 918
586 Ga0207659_10980936 3300025926 Bacteria 727
587 Ga0207659_11747836 3300025926 Bacteria 529
588 Ga0207659_11831376 3300025926 Unclassified 515
589 Ga0207687_10180202 3300025927 Bacteria 1636
590 Ga0207687_10192239 3300025927 Bacteria 1589
591 Ga0207687_10466611 3300025927 Unclassified 1049
592 Ga0207700_10006919 3300025928 Bacteria 6898
593 Ga0207700_10613716 3300025928 Unclassified 968
594 Ga0207664_10287792 3300025929 Unclassified 1443
595 Ga0207644_10110847 3300025931 Unclassified 2075
596 Ga0207644_10242530 3300025931 Bacteria 1435
597 Ga0207644_10580867 3300025931 Unclassified 929
598 Ga0207644_10700569 3300025931 Bacteria 844
599 Ga0207644_11533481 3300025931 Unclassified 559
600 Ga0207644_11548735 3300025931 Unclassified 556
601 Ga0207690_10008297 3300025932 Bacteria 6161
602 Ga0207690_10068423 3300025932 Unclassified 2439
603 Ga0207690_10499537 3300025932 Bacteria 984
604 Ga0207706_10028458 3300025933 Bacteria 4991
605 Ga0207706_10083063 3300025933 Bacteria 2815
606 Ga0207706_10184713 3300025933 Bacteria 1831
607 Ga0207706_10249722 3300025933 Bacteria 1550
608 Ga0207686_10001103 3300025934 Bacteria 15716
609 Ga0207686_10162306 3300025934 Bacteria 1567
610 Ga0207686_10185653 3300025934 Bacteria 1478
611 Ga0207686_10190282 3300025934 Bacteria 1462
612 Ga0207686_10190905 3300025934 Bacteria 1460
613 Ga0207709_11055995 3300025935 Bacteria 666
614 Ga0207670_10022966 3300025936 Unclassified 3874
615 Ga0207670_10063849 3300025936 Bacteria 2521
616 Ga0207670_10067034 3300025936 Bacteria 2468
617 Ga0207670_10247476 3300025936 Bacteria 1376
618 Ga0207670_10422753 3300025936 Unclassified 1069
619 Ga0207669_10074008 3300025937 Bacteria 2152
620 Ga0207669_10208319 3300025937 Bacteria 1425
621 Ga0207669_10319932 3300025937 Bacteria 1187
622 Ga0207704_10042162 3300025938 Bacteria 2684
623 Ga0207704_10195161 3300025938 Unclassified 1476
624 Ga0207704_10705934 3300025938 Unclassified 835
625 Ga0207704_11512574 3300025938 Bacteria 576
626 Ga0207665_10071351 3300025939 Bacteria 2371
627 Ga0207665_11084646 3300025939 Unclassified 638
628 Ga0207691_10074762 3300025940 Bacteria 3056
629 Ga0207691_10310870 3300025940 Unclassified 1352
630 Ga0207691_10496346 3300025940 Bacteria 1037
631 Ga0207691_10833958 3300025940 Bacteria 774
632 Ga0207691_10836455 3300025940 Unclassified 772
633 Ga0207711_10076271 3300025941 Unclassified 2919
634 Ga0207711_10150947 3300025941 Unclassified 2096
635 Ga0207711_10163161 3300025941 Bacteria 2018
636 Ga0207711_10805190 3300025941 Bacteria 875
637 Ga0207711_11589868 3300025941 Bacteria 597
638 Ga0207689_10027393 3300025942 Bacteria 4771
639 Ga0207689_10042683 3300025942 Unclassified 3750
640 Ga0207689_10098593 3300025942 Bacteria 2401
641 Ga0207689_10134284 3300025942 Unclassified 2037
642 Ga0207689_10161280 3300025942 Bacteria 1847
643 Ga0207689_10165628 3300025942 Bacteria 1821
644 Ga0207689_10373079 3300025942 Bacteria 1187
645 Ga0207689_10899130 3300025942 Bacteria 747
646 Ga0207661_10156511 3300025944 Unclassified 1974
647 Ga0207661_10190271 3300025944 Bacteria 1799
648 Ga0207661_10535142 3300025944 Bacteria 1072
649 Ga0207661_10675087 3300025944 Unclassified 950
650 Ga0207661_11012931 3300025944 Unclassified 765
651 Ga0207661_11530003 3300025944 Bacteria 611
652 Ga0207679_10047842 3300025945 Bacteria 3110
653 Ga0207679_10202869 3300025945 Unclassified 1658
654 Ga0207679_11328131 3300025945 Bacteria 660
655 Ga0207651_10009480 3300025960 Bacteria 5335
656 Ga0207651_10466047 3300025960 Bacteria 1086
657 Ga0207651_10493880 3300025960 Bacteria 1057
658 Ga0207651_10518190 3300025960 Bacteria 1033
659 Ga0207651_10872768 3300025960 Bacteria 800
660 Ga0207651_11393742 3300025960 Bacteria 631
661 Ga0207651_11954042 3300025960 Unclassified 527
662 Ga0207712_10001769 3300025961 Bacteria 14411
663 Ga0207712_10005517 3300025961 Bacteria 7980
664 Ga0207712_10177843 3300025961 Bacteria 1669
665 Ga0207712_10271583 3300025961 Bacteria 1380
666 Ga0207712_10461791 3300025961 Bacteria 1079
667 Ga0207712_10510537 3300025961 Unclassified 1029
668 Ga0207712_10572285 3300025961 Unclassified 974
669 Ga0207712_10697075 3300025961 Unclassified 886
670 Ga0207712_11017040 3300025961 Unclassified 736
671 Ga0207668_10028390 3300025972 Bacteria 3658
672 Ga0207668_10432582 3300025972 Bacteria 1119
673 Ga0207640_10274772 3300025981 Bacteria 1320
674 Ga0207640_10732836 3300025981 Unclassified 851
675 Ga0207658_10366369 3300025986 Bacteria 1259
676 Ga0207658_10398943 3300025986 Unclassified 1208
677 Ga0207658_10549066 3300025986 Bacteria 1034
678 Ga0207658_10587619 3300025986 Unclassified 999
679 Ga0207658_10761679 3300025986 Unclassified 877
680 Ga0207658_10822787 3300025986 Bacteria 844
681 Ga0207658_10892811 3300025986 Bacteria 809
682 Ga0207658_11028263 3300025986 Bacteria 752
683 Ga0207658_11051946 3300025986 Bacteria 743
684 Ga0207658_11253312 3300025986 Bacteria 678
685 Ga0207658_11926487 3300025986 Unclassified 538
686 Ga0207677_10032530 3300026023 Bacteria 3354
687 Ga0207677_10098632 3300026023 Bacteria 2144
688 Ga0207677_10109412 3300026023 Bacteria 2054
689 Ga0207677_10573906 3300026023 Unclassified 986
690 Ga0207677_10792031 3300026023 Unclassified 848
691 Ga0207677_10826328 3300026023 Bacteria 831
692 Ga0207677_11008155 3300026023 Bacteria 755
693 Ga0207677_11019510 3300026023 Bacteria 751
694 Ga0207677_12199154 3300026023 Bacteria 513
695 Ga0207703_10021697 3300026035 Bacteria 5027
696 Ga0207703_10033048 3300026035 Unclassified 4099
697 Ga0207703_10149126 3300026035 Unclassified 2037
698 Ga0207703_10169522 3300026035 Bacteria 1919
699 Ga0207703_10488668 3300026035 Bacteria 1154
700 Ga0207703_11262210 3300026035 Bacteria 710
701 Ga0207703_12425253 3300026035 Bacteria 500
702 Ga0207639_10716935 3300026041 Bacteria 929
703 Ga0207639_11459794 3300026041 Unclassified 642
704 Ga0207639_12096833 3300026041 Bacteria 527
705 Ga0207678_10697596 3300026067 Bacteria 893
706 Ga0207708_10007764 3300026075 Bacteria 7944
707 Ga0207708_10016661 3300026075 Bacteria 5530
708 Ga0207708_11063741 3300026075 Bacteria 704
709 Ga0207708_11325395 3300026075 Bacteria 631
710 Ga0207702_10943007 3300026078 Bacteria 856
711 Ga0207641_10001178 3300026088 Bacteria 26272
712 Ga0207641_10042379 3300026088 Bacteria 3818
713 Ga0207641_10064617 3300026088 Bacteria 3128
714 Ga0207641_10118993 3300026088 Bacteria 2354
715 Ga0207641_10180361 3300026088 Bacteria 1934
716 Ga0207641_10557529 3300026088 Bacteria 1118
717 Ga0207641_10705323 3300026088 Bacteria 994
718 Ga0207641_12368216 3300026088 Bacteria 530
719 Ga0207648_10084345 3300026089 Bacteria 2771
720 Ga0207648_10581107 3300026089 Bacteria 1031
721 Ga0207648_10673812 3300026089 Bacteria 957
722 Ga0207648_11143562 3300026089 Unclassified 730
723 Ga0207648_11791712 3300026089 Bacteria 576
724 Ga0207648_11867968 3300026089 Unclassified 562
725 Ga0207648_12207695 3300026089 Unclassified 511
726 Ga0207676_10085000 3300026095 Unclassified 2581
727 Ga0207676_10288585 3300026095 Bacteria 1493
728 Ga0207676_10964595 3300026095 Bacteria 839
729 Ga0207676_11007469 3300026095 Bacteria 821
730 Ga0207676_11250766 3300026095 Bacteria 736
731 Ga0207676_11287490 3300026095 Bacteria 726
732 Ga0207676_12052773 3300026095 Bacteria 570
733 Ga0207676_12551333 3300026095 Unclassified 507
734 Ga0207674_10110994 3300026116 Bacteria 2717
735 Ga0207674_10557199 3300026116 Bacteria 1107
736 Ga0207674_10624036 3300026116 Bacteria 1041
737 Ga0207674_10780763 3300026116 Bacteria 922
738 Ga0207675_100005780 3300026118 Bacteria 11828
739 Ga0207675_100035164 3300026118 Bacteria 4673
740 Ga0207675_100089964 3300026118 Bacteria 2885
741 Ga0207675_100674671 3300026118 Bacteria 1041
742 Ga0207675_100848968 3300026118 Bacteria 928
743 Ga0207683_10028142 3300026121 Bacteria 4859
744 Ga0207683_10104577 3300026121 Bacteria 2530
745 Ga0207683_11165564 3300026121 Bacteria 714
746 Ga0207698_10063362 3300026142 Bacteria 2893
747 Ga0207698_10887576 3300026142 Bacteria 898
748 Ga0207698_11304935 3300026142 Bacteria 740
749 Ga0207698_12136041 3300026142 Bacteria 573
750 Ga0209984_1007833 3300027424 Unclassified 1333
751 Ga0209995_1090494 3300027471 Unclassified 526
752 Ga0209999_1124097 3300027543 Unclassified 506
753 Ga0209970_1113803 3300027614 Unclassified 521
754 Ga0209983_1027992 3300027665 Unclassified 1194
755 Ga0207428_10029239 3300027907 Bacteria 4570
756 Ga0207428_10371430 3300027907 Bacteria 1050
757 Ga0265357_1014890 3300028023 Bacteria 819
758 Ga0268266_10159199 3300028379 Bacteria 2041
759 Ga0268266_10325802 3300028379 Unclassified 1439
760 Ga0268266_10915381 3300028379 Bacteria 848
761 Ga0268265_10460408 3300028380 Bacteria 1190
762 Ga0268265_10554601 3300028380 Unclassified 1091
763 Ga0268265_10569599 3300028380 Bacteria 1078
764 Ga0268265_10639664 3300028380 Bacteria 1021
765 Ga0268265_11421533 3300028380 Bacteria 696
766 Ga0268265_11438502 3300028380 Bacteria 692
767 Ga0268265_11742443 3300028380 Bacteria 629
768 Ga0268264_10008851 3300028381 Bacteria 8344
769 Ga0268264_10029385 3300028381 Bacteria 4501
770 Ga0268264_10171372 3300028381 Unclassified 1963
771 Ga0307407_11062060 3300031903 Bacteria 628
772 Ga0307414_10201934 3300032004 Bacteria 1618
773 Ga0307414_11781737 3300032004 Bacteria 574
774 Ga0373934_0069289 3300035086 Bacteria 1410
775 Ga0373936_0615141 3300035113 Unclassified 511
776 Ga0373954_0234421 3300035118 Unclassified 903
777 Ga0373943_0063641 3300035170 Bacteria 1850
778 Ga0373943_0072378 3300035170 Bacteria 1748
779 Ga0373943_0092836 3300035170 Bacteria 1566
780 Ga0373943_0959196 3300035170 Bacteria 512
781 Ga0373955_0074924 3300035172 Bacteria 1901
782 Ga0373955_0350002 3300035172 Bacteria 895
783 Ga0373955_0365183 3300035172 Unclassified 875
784 Ga0373955_0944158 3300035172 Unclassified 531
785 Ga0373935_0057912 3300035692 Bacteria 2473
786 Ga0373935_0156384 3300035692 Bacteria 1551
787 Ga0373927_1018292 3300035695 Bacteria 546
788 Ga0373947_0132604 3300035725 Unclassified 1592
789 Ga0373947_1177026 3300035725 Unclassified 522
790 Ga0373947_1252385 3300035725 Unclassified 505
791 Ga0373937_0041534 3300036401 Bacteria 4195
792 Ga0373937_0836942 3300036401 Bacteria 868
793 Ga0373937_1040406 3300036401 Unclassified 767
794 Ga0373937_1047167 3300036401 Bacteria 765
795 Ga0373925_0212557 3300037068 Unclassified 1541
796 Ga0373925_0319459 3300037068 Bacteria 1256
797 Ga0373925_1388132 3300037068 Bacteria 576
798 Ga0451804_0689320 3300041463 Unclassified 620
799 Ga0451839_1424319 3300041496 Unclassified 641
800 Ga0451841_0197885 3300041498 Unclassified 594
801 Ga0451853_1763246 3300041512 Bacteria 925
802 Ga0450914_057887 3300042118 Unclassified 521
803 Ga0450923_029410 3300042125 Bacteria 1113
804 Ga0450918_128684 3300042531 Unclassified 510
805 Ga0495592_0140469 3300046454 Bacteria 1681
806 Ga0495592_0392186 3300046454 Unclassified 881
807 Ga0495603_0350726 3300046455 Bacteria 847
808 Ga0495641_0197787 3300046461 Unclassified 901
809 Ga0495651_0404465 3300046462 Unclassified 891
810 Ga0495653_0183664 3300046463 Bacteria 1433
811 Ga0495582_0411887 3300046473 Unclassified 780
812 Ga0495582_0855955 3300046473 Bacteria 526
813 Ga0495639_0344344 3300046475 Unclassified 748
814 Ga0495584_0203350 3300046491 Bacteria 1007
815 Ga0495594_0141137 3300046499 Bacteria 1367
816 Ga0495594_0325255 3300046499 Bacteria 876
817 Ga0495608_0242270 3300046511 Bacteria 1126
818 Ga0495618_0238461 3300046514 Bacteria 1144
819 Ga0495628_0154686 3300046516 Bacteria 1745
820 Ga0495630_0169240 3300046517 Bacteria 1664
821 Ga0495630_1086488 3300046517 Unclassified 607
822 Ga0495644_0353461 3300046523 Unclassified 579
823 Ga0495665_0168769 3300046531 Bacteria 1140
824 Ga0495640_0432262 3300046533 Unclassified 806
825 Ga0495586_0280821 3300046535 Unclassified 953
826 Ga0495587_0123859 3300046536 Bacteria 1480
827 Ga0495587_0230747 3300046536 Bacteria 1043
828 Ga0495598_0213582 3300046537 Bacteria 702
829 Ga0495621_0129545 3300046539 Bacteria 981
830 Ga0495621_0374676 3300046539 Bacteria 600
831 Ga0495645_0267171 3300046543 Bacteria 1130
832 Ga0495645_0346084 3300046543 Unclassified 959
833 Ga0495622_0204192 3300046557 Bacteria 880
834 Ga0495634_0082340 3300046642 Unclassified 2103
835 Ga0495635_0444691 3300046663 Unclassified 857
836 Ga0495657_0308437 3300046675 Unclassified 943
837 Ga0495657_0323618 3300046675 Bacteria 916
838 Ga0495599_0677247 3300046678 Bacteria 596
839 Ga0495647_0388295 3300046681 Bacteria 640
840 Ga0495658_0186683 3300046683 Unclassified 1288
841 Ga0495658_0533827 3300046683 Unclassified 751
842 Ga0495658_0551868 3300046683 Unclassified 738
843 Ga0495613_0642505 3300046689 Bacteria 703
844 Ga0495613_0886732 3300046689 Unclassified 578
845 Ga0495600_0304941 3300046809 Bacteria 1004
846 Ga0495581_0201909 3300047315 Bacteria 1163
847 Ga0495581_0222866 3300047315 Unclassified 1103
848 Ga0495676_0128486 3300047321 Bacteria 1833
849 Ga0495676_0501969 3300047321 Unclassified 796
850 Ga0495680_0140445 3300047322 Bacteria 1768
851 Ga0495680_0303795 3300047322 Bacteria 1120
852 Ga0495680_0304210 3300047322 Bacteria 1119
853 Ga0495675_0848891 3300047444 Bacteria 503
854 Ga0495684_0013026 3300047471 Bacteria 6419
855 Ga0495684_0058302 3300047471 Bacteria 2942
856 Ga0496100_0201216 3300048903 Bacteria 1452
857 Ga0496100_0306889 3300048903 Bacteria 1189
858 Ga0496101_0412884 3300048904 Bacteria 1064
859 Ga0496101_0454095 3300048904 Bacteria 1011
860 Ga0496101_0558749 3300048904 Bacteria 905
861 Ga0496101_0977387 3300048904 Unclassified 666
862 Ga0496102_0127369 3300048905 Unclassified 2381
863 Ga0496104_0106525 3300048907 Unclassified 2687
864 Ga0496104_0371428 3300048907 Unclassified 1343
865 Ga0496105_0345942 3300048908 Unclassified 1188
866 Ga0496105_0369681 3300048908 Bacteria 1143
867 Ga0496105_0705658 3300048908 Bacteria 774
868 Ga0496105_0907349 3300048908 Unclassified 664
869 Ga0496106_0328550 3300048909 Bacteria 1228
870 Ga0496106_0334136 3300048909 Bacteria 1217
871 Ga0496107_0487759 3300048910 Unclassified 914
872 Ga0496107_0820721 3300048910 Bacteria 680
873 Ga0496108_0116381 3300048911 Bacteria 2290
874 Ga0496108_0221688 3300048911 Bacteria 1643
875 Ga0496108_0884654 3300048911 Bacteria 767
876 Ga0496108_0939949 3300048911 Bacteria 741
877 Ga0496108_0962592 3300048911 Unclassified 730
878 Ga0496109_0047500 3300048912 Bacteria 3904
879 Ga0496109_0136217 3300048912 Bacteria 2295
880 Ga0496109_0397979 3300048912 Bacteria 1301
881 Ga0496110_0118806 3300048913 Bacteria 2381
882 Ga0496110_0234915 3300048913 Bacteria 1668
883 Ga0496111_0034461 3300048914 Bacteria 3615
884 Ga0496111_0587104 3300048914 Unclassified 816
885 Ga0496111_0701600 3300048914 Unclassified 736
886 Ga0496112_0074701 3300048915 Bacteria 3352
887 Ga0496113_0424646 3300048916 Bacteria 1068
888 Ga0496113_1456873 3300048916 Unclassified 529
889 Ga0496114_0120850 3300048917 Bacteria 2253
890 Ga0496114_0179867 3300048917 Bacteria 1846
891 Ga0496115_0053864 3300048918 Bacteria 3230
892 Ga0496115_0526153 3300048918 Unclassified 948
893 Ga0501037_0345535 3300049573 Bacteria 1027
894 Ga0501038_0045517 3300049574 Bacteria 3810
895 Ga0501040_0162592 3300049576 Bacteria 1578
896 Ga0501042_0065024 3300049578 Bacteria 2607
897 Ga0501046_0810795 3300049580 Bacteria 656
898 Ga0501048_0986191 3300049582 Unclassified 606
899 Ga0501067_0848411 3300049583 Unclassified 515
900 Ga0501071_0044864 3300049587 Bacteria 3172
901 Ga0501071_0480237 3300049587 Bacteria 952
902 Ga0501073_1143745 3300049589 Unclassified 535
903 Ga0501075_0014831 3300049591 Bacteria 5589
904 Ga0501077_0086589 3300049593 Bacteria 1986
905 Ga0501217_108043 3300049661 Bacteria 797
906 Ga0501079_0106610 3300049741 Bacteria 2174
907 Ga0501081_0097460 3300049743 Bacteria 2075
908 Ga0501035_0140157 3300049822 Bacteria 2103
909 Ga0501044_1243431 3300049823 Bacteria 612
910 Ga0501045_0051656 3300049824 Bacteria 3000
911 Ga0501045_1262318 3300049824 Unclassified 538
912 nmdc:mga0yw44_561388_c1 3300050492 Bacteria 775
913 nmdc:mga05p37_100162_c1 3300050507 Unclassified 3568
914 nmdc:mga09592_12308_c1 3300050508 Bacteria 6966
915 nmdc:mga09592_507909_c1 3300050508 Unclassified 1037
916 nmdc:mga0qj67_1715_c1 3300050509 Bacteria 15457
917 nmdc:mga06r32_678213_c1 3300050510 Unclassified 997
918 nmdc:mga08y16_122808_c1 3300050511 Bacteria 2702
919 nmdc:mga08y16_158726_c1 3300050511 Bacteria 2350
920 nmdc:mga08y16_746604_c1 3300050511 Bacteria 975
921 nmdc:mga0n895_1257704_c1 3300050512 Bacteria 712
922 nmdc:mga0n895_816094_c1 3300050512 Unclassified 922
923 nmdc:mga0a205_1572920_c1 3300050515 Unclassified 506
924 nmdc:mga0a205_324472_c1 3300050515 Unclassified 1410
925 Ga0495612_0396650 3300053078 Unclassified 627
926 Ga0495595_0435417 3300053084 Unclassified 666
927 Ga0495619_0203377 3300053085 Bacteria 1371
928 Ga0495619_0294475 3300053085 Bacteria 1124
929 Ga0500642_0187130 3300053130 Bacteria 967
930 Ga0501084_0069969 3300054114 Bacteria 2938
931 Ga0501082_0191871 3300060353 Bacteria 1777
932 Ga0530510_0033729 3300061734 Bacteria 3685
933 Ga0111539_10566789
934 JGI24032J14994_102648
935 JGI24743J22301_10016904
936 JGI24035J26624_1000658
937 JGI24035J26624_1002800
938 Ga0065704_10819266
939 Ga0065704_10858249
940 Ga0065712_10004044
941 Ga0065712_10134478
942 Ga0065712_10135780
943 Ga0065712_10160456
944 Ga0065715_10005592
945 Ga0065715_10012414
946 Ga0065715_10025499
947 Ga0065715_10126105
948 Ga0065715_10261916
949 Ga0065715_10401046
950 Ga0065715_10436411
951 Ga0065715_10489311
952 Ga0065715_10508383
953 Ga0065715_10579753
954 Ga0065707_10223661
955 Ga0065707_10421418
956 Ga0065707_10833487
957 Ga0070658_10931653
958 Ga0070676_10014778
959 Ga0070676_10081747
960 Ga0070676_10088411
961 Ga0070683_100011499
962 Ga0070683_100030484
963 Ga0070683_100102862
964 Ga0070683_101046186
965 Ga0070683_101127421
966 Ga0070683_101235137
967 Ga0070683_102033275
968 Ga0070683_102060023
969 Ga0070690_100019296
970 Ga0070690_100107308
971 Ga0070690_100211894
972 Ga0070690_100232803
973 Ga0070690_100280222
974 Ga0070690_100419300
975 Ga0070690_100504118
976 Ga0070670_100038007
977 Ga0070670_100081973
978 Ga0070670_100394336
979 Ga0070670_100452960
980 Ga0070670_101461510
981 Ga0070677_10033624
982 Ga0070677_10107986
983 Ga0070677_10626940
984 Ga0068869_100231246
985 Ga0068869_100250849
986 Ga0068869_100402758
987 Ga0068869_100605785
988 Ga0068869_101287444
989 Ga0070666_10005870
990 Ga0070666_10122890
991 Ga0070666_10199184
992 Ga0070666_10495535
993 Ga0070682_100114350
994 Ga0070682_100493615
995 Ga0070682_101061604
996 Ga0070682_101175427
997 Ga0068868_100051035
998 Ga0068868_100087147
999 Ga0068868_100138969
1000 Ga0068868_100182711
1001 Ga0068868_100511545
1002 Ga0068868_101228007
1003 Ga0070660_100133096
1004 Ga0070660_100207272
1005 Ga0070660_100282199
1006 Ga0070689_100004490
1007 Ga0070689_100007248
1008 Ga0070689_100202486
1009 Ga0070689_100556346
1010 Ga0070689_101578534
1011 Ga0070687_100054195
1012 Ga0070687_100130896
1013 Ga0070687_100626316
1014 Ga0070687_100794340
1015 Ga0070687_100882200
1016 Ga0070687_101273431
1017 Ga0070687_101376043
1018 Ga0070661_100300629
1019 Ga0070661_100582524
1020 Ga0070692_11350696
1021 Ga0070668_100977910
1022 Ga0070668_101539835
1023 Ga0070668_101693665
1024 Ga0070669_100016907
1025 Ga0070669_100143892
1026 Ga0070669_100372419
1027 Ga0070669_100423998
1028 Ga0070669_100613550
1029 Ga0070669_100880120
1030 Ga0070669_100936037
1031 Ga0070675_100035982
1032 Ga0070675_100063235
1033 Ga0070675_100073569
1034 Ga0070675_100096217
1035 Ga0070675_100135537
1036 Ga0070675_100185374
1037 Ga0070675_100639262
1038 Ga0070675_101111763
1039 Ga0070675_101123899
1040 Ga0070675_102084608
1041 Ga0070675_102100260
1042 Ga0070671_100184621
1043 Ga0070671_100224034
1044 Ga0070671_100274237
1045 Ga0070671_100523033
1046 Ga0070671_100692878
1047 Ga0070671_100858391
1048 Ga0070671_101660801
1049 Ga0070671_102104101
1050 Ga0070674_100238628
1051 Ga0070673_100013118
1052 Ga0070673_100058068
1053 Ga0070673_100769427
1054 Ga0070673_100852409
1055 Ga0070673_100931571
1056 Ga0070673_102346521
1057 Ga0070688_100001199
1058 Ga0070688_100065104
1059 Ga0070688_100075550
1060 Ga0070688_100174116
1061 Ga0070688_100684792
1062 Ga0070688_100966001
1063 Ga0070688_101467681
1064 Ga0070659_100002571
1065 Ga0070659_100135247
1066 Ga0070659_100658203
1067 Ga0070659_101133665
1068 Ga0070667_100018520
1069 Ga0070667_100073067
1070 Ga0070667_100085820
1071 Ga0070667_100134228
1072 Ga0070667_100477794
1073 Ga0070667_100602263
1074 Ga0070667_100978607
1075 Ga0070667_101197752
1076 Ga0070667_101247682
1077 Ga0070667_101497583
1078 Ga0070667_101499472
1079 Ga0070709_10983628
1080 Ga0070714_100093624
1081 Ga0070713_100286211
1082 Ga0070701_10293146
1083 Ga0070711_100125787
1084 Ga0070711_100472312
1085 Ga0070711_100757359
1086 Ga0070711_101256740
1087 Ga0070711_101713438
1088 Ga0070705_100179897
1089 Ga0070705_100506255
1090 Ga0070705_101314929
1091 Ga0070700_100010242
1092 Ga0070700_100635194
1093 Ga0070700_101580214
1094 Ga0070694_100140641
1095 Ga0070694_100942734
1096 Ga0070694_101822670
1097 Ga0070708_100025891
1098 Ga0070708_100313032
1099 Ga0070708_101706955
1100 Ga0070663_100009998
1101 Ga0070663_101287521
1102 Ga0070678_100018086
1103 Ga0070678_100213280
1104 Ga0070678_100308272
1105 Ga0070662_100073930
1106 Ga0070662_100089622
1107 Ga0070662_100238277
1108 Ga0070662_100266203
1109 Ga0070662_100370566
1110 Ga0070662_100691071
1111 Ga0070662_101004914
1112 Ga0070681_10224369
1113 Ga0068867_100084519
1114 Ga0068867_100214705
1115 Ga0068867_100390588
1116 Ga0068867_100398616
1117 Ga0068867_100414753
1118 Ga0068867_100605081
1119 Ga0068867_100900899
1120 Ga0068867_101132396
1121 Ga0068867_101245693
1122 Ga0068867_101744696
1123 Ga0070685_10006366
1124 Ga0070685_10007687
1125 Ga0070685_10017516
1126 Ga0070685_10066526
1127 Ga0070685_10887625
1128 Ga0070706_100023029
1129 Ga0070706_100023191
1130 Ga0070706_100726358
1131 Ga0070707_100147648
1132 Ga0070707_101313212
1133 Ga0070707_101585781
1134 Ga0070698_100526981
1135 Ga0070698_101452951
1136 Ga0070699_101294108
1137 Ga0070684_100006906
1138 Ga0070684_100140455
1139 Ga0070697_100001381
1140 Ga0070697_100618380
1141 Ga0070697_101380454
1142 Ga0070697_101461731
1143 Ga0070697_101938381
1144 Ga0068853_100807417
1145 Ga0068853_101199714
1146 Ga0068853_101424043
1147 Ga0070672_100010949
1148 Ga0070672_100040024
1149 Ga0070672_100304207
1150 Ga0070672_100750073
1151 Ga0070672_101087962
1152 Ga0070672_101344041
1153 Ga0070672_101733346
1154 Ga0070672_102106638
1155 Ga0070686_100024836
1156 Ga0070686_100534364
1157 Ga0070686_100664187
1158 Ga0070686_100680700
1159 Ga0070686_101303351
1160 Ga0070686_101319934
1161 Ga0070695_100689768
1162 Ga0070693_100512421
1163 Ga0070693_101082875
1164 Ga0070665_100077406
1165 Ga0070665_100131038
1166 Ga0070665_100619989
1167 Ga0070665_101022072
1168 Ga0070704_100022921
1169 Ga0070704_100548442
1170 Ga0070704_101521603
1171 Ga0068855_100624428
1172 Ga0070664_101577321
1173 Ga0068857_100119514
1174 Ga0068854_100072812
1175 Ga0068854_100551022
1176 Ga0068854_101275231
1177 Ga0068856_102269539
1178 Ga0070702_100021227
1179 Ga0070702_100409679
1180 Ga0070702_100465178
1181 Ga0070702_101250219
1182 Ga0070702_101527134
1183 Ga0070702_101578358
1184 Ga0068852_100064621
1185 Ga0068852_100290946
1186 Ga0068852_101264597
1187 Ga0068859_100035531
1188 Ga0068859_100093098
1189 Ga0068859_100304491
1190 Ga0068859_100393877
1191 Ga0068859_100430290
1192 Ga0068859_100565722
1193 Ga0068859_100847732
1194 Ga0068859_102400754
1195 Ga0068859_102919102
1196 Ga0068864_100050010
1197 Ga0068864_100069013
1198 Ga0068864_100268308
1199 Ga0068864_100583176
1200 Ga0068864_100750689
1201 Ga0068864_100933884
1202 Ga0068864_101608758
1203 Ga0068864_102443818
1204 Ga0068864_102652362
1205 Ga0068866_10048868
1206 Ga0068866_10300244
1207 Ga0068866_10541540
1208 Ga0068866_11214608
1209 Ga0068861_100040137
1210 Ga0068861_100079226
1211 Ga0068861_100315563
1212 Ga0068851_10222553
1213 Ga0068870_11216641
1214 Ga0068863_100022457
1215 Ga0068863_100047122
1216 Ga0068863_100087581
1217 Ga0068863_100161759
1218 Ga0068863_101344747
1219 Ga0068863_102123465
1220 Ga0068858_100009874
1221 Ga0068858_100075105
1222 Ga0068858_100272656
1223 Ga0068858_101473481
1224 Ga0068858_101477253
1225 Ga0068860_100027486
1226 Ga0068860_100351835
1227 Ga0068860_101046374
1228 Ga0068860_101641161
1229 Ga0068862_100159026
1230 Ga0068862_100354776
1231 Ga0068862_100557078
1232 Ga0068862_100876778
1233 Ga0068862_100898080
1234 Ga0068862_100945230
1235 Ga0068862_101329737
1236 Ga0068862_102630749
1237 Ga0070717_10033417
1238 Ga0075365_10630769
1239 Ga0070715_10181835
1240 Ga0070715_10395233
1241 Ga0070716_101189635
1242 Ga0070712_100066847
1243 Ga0070712_100134215
1244 Ga0070712_100657590
1245 Ga0097621_100020065
1246 Ga0097621_100070759
1247 Ga0097621_100196884
1248 Ga0097621_100217413
1249 Ga0097621_100282090
1250 Ga0097621_100362220
1251 Ga0097621_100362483
1252 Ga0097621_101038221
1253 Ga0097621_101084676
1254 Ga0068871_100033947
1255 Ga0068871_100039948
1256 Ga0068871_100059877
1257 Ga0068871_100117289
1258 Ga0068871_100154242
1259 Ga0068871_100251516
1260 Ga0068871_100285983
1261 Ga0068871_100528054
1262 Ga0068871_100757087
1263 Ga0068871_100899761
1264 Ga0068871_101265545
1265 Ga0068871_101669271
1266 Ga0075428_100454541
1267 Ga0075430_100024562
1268 Ga0075431_100052166
1269 Ga0075431_100206210
1270 Ga0075433_11081585
1271 Ga0075434_100298788
1272 Ga0075429_100022430
1273 Ga0075429_100313205
1274 Ga0068865_100081475
1275 Ga0068865_100415529
1276 Ga0068865_100937427
1277 Ga0068865_101184821
1278 Ga0068865_101200492
1279 Ga0097620_100035530
1280 Ga0097620_100093092
1281 Ga0097620_100304511
1282 Ga0097620_100393906
1283 Ga0097620_100430329
1284 Ga0097620_100565716
1285 Ga0097620_100847806
1286 Ga0097620_102399726
1287 Ga0097620_102918610
1288 Ga0105251_10200959
1289 Ga0105240_10260102
1290 Ga0111539_10048604
1291 Ga0111539_10482610
1292 Ga0111539_10841575
1293 Ga0111539_12294643
1294 Ga0111539_13239766
1295 Ga0111539_13459810
1296 Ga0105245_10179621
1297 Ga0105245_10272511
1298 Ga0105245_10328953
1299 Ga0105245_10370392
1300 Ga0105245_11084546
1301 Ga0105247_10069340
1302 Ga0105247_10140515
1303 Ga0105247_10161278
1304 Ga0105247_10522979
1305 Ga0114129_10134955
1306 Ga0105243_10081696
1307 Ga0105243_10126597
1308 Ga0105243_11078581
1309 Ga0105241_10093251
1310 Ga0105241_10603844
1311 Ga0105241_11733662
1312 Ga0105242_10005987
1313 Ga0105242_10185845
1314 Ga0105242_10361110
1315 Ga0105242_11291439
1316 Ga0105242_12031596
1317 Ga0105248_10075569
1318 Ga0105248_10098900
1319 Ga0105248_10398824
1320 Ga0105248_10402636
1321 Ga0105248_10488316
1322 Ga0105248_10726649
1323 Ga0105248_11053696
1324 Ga0105248_11845408
1325 Ga0105248_12498584
1326 Ga0105237_10150893
1327 Ga0105237_11151633
1328 Ga0105249_10001311
1329 Ga0105249_10010090
1330 Ga0105249_10037978
1331 Ga0105249_10041778
1332 Ga0105249_10079433
1333 Ga0105249_10293286
1334 Ga0105249_10350192
1335 Ga0105249_10414653
1336 Ga0105249_10516984
1337 Ga0105249_10599384
1338 Ga0105249_11699170
1339 Ga0105249_13022754
1340 Ga0099796_10100323
1341 Ga0105239_10052885
1342 Ga0105239_10055606
1343 Ga0105239_10215555
1344 Ga0105239_10961147
1345 Ga0105246_10068122
1346 Ga0157371_10268586
1347 Ga0157371_10298495
1348 Ga0157374_10013528
1349 Ga0157374_10020158
1350 Ga0157374_10053956
1351 Ga0157374_10060608
1352 Ga0157374_10263427
1353 Ga0157374_10327872
1354 Ga0157374_10491174
1355 Ga0157374_10549174
1356 Ga0157374_11074164
1357 Ga0157374_11076481
1358 Ga0157374_11521452
1359 Ga0157374_11625742
1360 Ga0157374_12845169
1361 Ga0157374_12883599
1362 Ga0157378_10025935
1363 Ga0157378_10051722
1364 Ga0157378_10055673
1365 Ga0157378_10325271
1366 Ga0157378_10363753
1367 Ga0157378_10395389
1368 Ga0157378_10439604
1369 Ga0157378_10743519
1370 Ga0157378_10755562
1371 Ga0157378_10810182
1372 Ga0157378_11912774
1373 Ga0157378_13030252
1374 Ga0163162_10010052
1375 Ga0163162_10114454
1376 Ga0163162_10124221
1377 Ga0163162_10153141
1378 Ga0163162_10204973
1379 Ga0163162_11174474
1380 Ga0163162_11353665
1381 Ga0163162_11672673
1382 Ga0163162_12014398
1383 Ga0157372_10478705
1384 Ga0157372_10716987
1385 Ga0157372_11914408
1386 Ga0157372_12155459
1387 Ga0157375_10023557
1388 Ga0157375_10086990
1389 Ga0157375_10095316
1390 Ga0157375_10137476
1391 Ga0157375_10139419
1392 Ga0157375_10378747
1393 Ga0157375_10539301
1394 Ga0157375_10586654
1395 Ga0157375_11387335
1396 Ga0157375_11499745
1397 Ga0157375_13147499
1398 Ga0157375_13385849
1399 Ga0163163_10239924
1400 Ga0163163_10601053
1401 Ga0163163_10900261
1402 Ga0163163_11112829
1403 Ga0163163_11607120
1404 Ga0157380_10040869
1405 Ga0157380_10365536
1406 Ga0157380_10378537
1407 Ga0157380_10625234
1408 Ga0157380_11962378
1409 Ga0157380_12408596
1410 Ga0157377_10006420
1411 Ga0157377_10011698
1412 Ga0157377_10568789
1413 Ga0157377_10797289
1414 Ga0157377_11124317
1415 Ga0157377_11779637
1416 Ga0157379_10001919
1417 Ga0157379_10056425
1418 Ga0157379_10194117
1419 Ga0157379_10207397
1420 Ga0157379_10250274
1421 Ga0157379_10376014
1422 Ga0157379_10539993
1423 Ga0157379_10693552
1424 Ga0157379_10871290
1425 Ga0157376_10030505
1426 Ga0157376_10031260
1427 Ga0157376_10032198
1428 Ga0157376_10107502
1429 Ga0157376_10310919
1430 Ga0157376_10975493
1431 Ga0163161_10013980
1432 Ga0163161_10024475
1433 Ga0163161_10074190
1434 Ga0163161_10075954
1435 Ga0163161_10238404
1436 Ga0163161_10241469
1437 Ga0163161_10374205
1438 Ga0163161_10416436
1439 Ga0163161_11308036
1440 Ga0163161_11936812
1441 Ga0228598_1096405
1442 Ga0207666_1000715
1443 Ga0207666_1025337
1444 Ga0207673_1000739
1445 Ga0207673_1002367
1446 Ga0207673_1023211
1447 Ga0207697_10002692
1448 Ga0207697_10004121
1449 Ga0207697_10178171
1450 Ga0207656_10088658
1451 Ga0207653_10442742
1452 Ga0207682_10036406
1453 Ga0207682_10568424
1454 Ga0207692_10609112
1455 Ga0207642_10036727
1456 Ga0207642_10347440
1457 Ga0207642_10619789
1458 Ga0207710_10004123
1459 Ga0207710_10482424
1460 Ga0207688_10088285
1461 Ga0207688_10116765
1462 Ga0207680_10008325
1463 Ga0207680_10030765
1464 Ga0207680_10448836
1465 Ga0207647_10010327
1466 Ga0207685_10085696
1467 Ga0207685_10146251
1468 Ga0207699_10527715
1469 Ga0207699_10650600
1470 Ga0207645_10025077
1471 Ga0207645_10115682
1472 Ga0207645_10433101
1473 Ga0207645_10901081
1474 Ga0207643_10011654
1475 Ga0207643_10143758
1476 Ga0207643_10219908
1477 Ga0207643_10342824
1478 Ga0207684_10024515
1479 Ga0207684_10060512
1480 Ga0207684_10951340
1481 Ga0207654_10203907
1482 Ga0207707_10375910
1483 Ga0207695_10915386
1484 Ga0207693_10085755
1485 Ga0207693_10117940
1486 Ga0207693_10252928
1487 Ga0207693_10438766
1488 Ga0207663_10137944
1489 Ga0207660_10313238
1490 Ga0207662_10085817
1491 Ga0207662_10329974
1492 Ga0207662_10922014
1493 Ga0207657_10250225
1494 Ga0207657_10252053
1495 Ga0207649_10256805
1496 Ga0207649_10579797
1497 Ga0207646_10516857
1498 Ga0207646_10518318
1499 Ga0207646_11307124
1500 Ga0207681_10193786
1501 Ga0207681_10215360
1502 Ga0207681_10308411
1503 Ga0207681_10657051
1504 Ga0207681_11197981
1505 Ga0207681_11551219
1506 Ga0207694_11402338
1507 Ga0207650_10184144
1508 Ga0207650_10345283
1509 Ga0207650_10913570
1510 Ga0207650_11775011
1511 Ga0207659_10011372
1512 Ga0207659_10012514
1513 Ga0207659_10057444
1514 Ga0207659_10070737
1515 Ga0207659_10540667
1516 Ga0207659_10614810
1517 Ga0207659_10627284
1518 Ga0207659_10980936
1519 Ga0207659_11747836
1520 Ga0207659_11831376
1521 Ga0207687_10180202
1522 Ga0207687_10192239
1523 Ga0207687_10466611
1524 Ga0207700_10006919
1525 Ga0207700_10613716
1526 Ga0207664_10287792
1527 Ga0207644_10110847
1528 Ga0207644_10242530
1529 Ga0207644_10580867
1530 Ga0207644_10700569
1531 Ga0207644_11533481
1532 Ga0207644_11548735
1533 Ga0207690_10008297
1534 Ga0207690_10068423
1535 Ga0207690_10499537
1536 Ga0207706_10028458
1537 Ga0207706_10083063
1538 Ga0207706_10184713
1539 Ga0207706_10249722
1540 Ga0207686_10001103
1541 Ga0207686_10162306
1542 Ga0207686_10185653
1543 Ga0207686_10190282
1544 Ga0207686_10190905
1545 Ga0207709_11055995
1546 Ga0207670_10022966
1547 Ga0207670_10063849
1548 Ga0207670_10067034
1549 Ga0207670_10247476
1550 Ga0207670_10422753
1551 Ga0207669_10074008
1552 Ga0207669_10208319
1553 Ga0207669_10319932
1554 Ga0207704_10042162
1555 Ga0207704_10195161
1556 Ga0207704_10705934
1557 Ga0207704_11512574
1558 Ga0207665_10071351
1559 Ga0207665_11084646
1560 Ga0207691_10074762
1561 Ga0207691_10310870
1562 Ga0207691_10496346
1563 Ga0207691_10833958
1564 Ga0207691_10836455
1565 Ga0207711_10076271
1566 Ga0207711_10150947
1567 Ga0207711_10163161
1568 Ga0207711_10805190
1569 Ga0207711_11589868
1570 Ga0207689_10027393
1571 Ga0207689_10042683
1572 Ga0207689_10098593
1573 Ga0207689_10134284
1574 Ga0207689_10161280
1575 Ga0207689_10165628
1576 Ga0207689_10373079
1577 Ga0207689_10899130
1578 Ga0207661_10156511
1579 Ga0207661_10190271
1580 Ga0207661_10535142
1581 Ga0207661_10675087
1582 Ga0207661_11012931
1583 Ga0207661_11530003
1584 Ga0207679_10047842
1585 Ga0207679_10202869
1586 Ga0207679_11328131
1587 Ga0207651_10009480
1588 Ga0207651_10466047
1589 Ga0207651_10493880
1590 Ga0207651_10518190
1591 Ga0207651_10872768
1592 Ga0207651_11393742
1593 Ga0207651_11954042
1594 Ga0207712_10001769
1595 Ga0207712_10005517
1596 Ga0207712_10177843
1597 Ga0207712_10271583
1598 Ga0207712_10461791
1599 Ga0207712_10510537
1600 Ga0207712_10572285
1601 Ga0207712_10697075
1602 Ga0207712_11017040
1603 Ga0207668_10028390
1604 Ga0207668_10432582
1605 Ga0207640_10274772
1606 Ga0207640_10732836
1607 Ga0207658_10366369
1608 Ga0207658_10398943
1609 Ga0207658_10549066
1610 Ga0207658_10587619
1611 Ga0207658_10761679
1612 Ga0207658_10822787
1613 Ga0207658_10892811
1614 Ga0207658_11028263
1615 Ga0207658_11051946
1616 Ga0207658_11253312
1617 Ga0207658_11926487
1618 Ga0207677_10032530
1619 Ga0207677_10098632
1620 Ga0207677_10109412
1621 Ga0207677_10573906
1622 Ga0207677_10792031
1623 Ga0207677_10826328
1624 Ga0207677_11008155
1625 Ga0207677_11019510
1626 Ga0207677_12199154
1627 Ga0207703_10021697
1628 Ga0207703_10033048
1629 Ga0207703_10149126
1630 Ga0207703_10169522
1631 Ga0207703_10488668
1632 Ga0207703_11262210
1633 Ga0207703_12425253
1634 Ga0207639_10716935
1635 Ga0207639_11459794
1636 Ga0207639_12096833
1637 Ga0207678_10697596
1638 Ga0207708_10007764
1639 Ga0207708_10016661
1640 Ga0207708_11063741
1641 Ga0207708_11325395
1642 Ga0207702_10943007
1643 Ga0207641_10001178
1644 Ga0207641_10042379
1645 Ga0207641_10064617
1646 Ga0207641_10118993
1647 Ga0207641_10180361
1648 Ga0207641_10557529
1649 Ga0207641_10705323
1650 Ga0207641_12368216
1651 Ga0207648_10084345
1652 Ga0207648_10581107
1653 Ga0207648_10673812
1654 Ga0207648_11143562
1655 Ga0207648_11791712
1656 Ga0207648_11867968
1657 Ga0207648_12207695
1658 Ga0207676_10085000
1659 Ga0207676_10288585
1660 Ga0207676_10964595
1661 Ga0207676_11007469
1662 Ga0207676_11250766
1663 Ga0207676_11287490
1664 Ga0207676_12052773
1665 Ga0207676_12551333
1666 Ga0207674_10110994
1667 Ga0207674_10557199
1668 Ga0207674_10624036
1669 Ga0207674_10780763
1670 Ga0207675_100005780
1671 Ga0207675_100035164
1672 Ga0207675_100089964
1673 Ga0207675_100674671
1674 Ga0207675_100848968
1675 Ga0207683_10028142
1676 Ga0207683_10104577
1677 Ga0207683_11165564
1678 Ga0207698_10063362
1679 Ga0207698_10887576
1680 Ga0207698_11304935
1681 Ga0207698_12136041
1682 Ga0209984_1007833
1683 Ga0209995_1090494
1684 Ga0209999_1124097
1685 Ga0209970_1113803
1686 Ga0209983_1027992
1687 Ga0207428_10029239
1688 Ga0207428_10371430
1689 Ga0265357_1014890
1690 Ga0268266_10159199
1691 Ga0268266_10325802
1692 Ga0268266_10915381
1693 Ga0268265_10460408
1694 Ga0268265_10554601
1695 Ga0268265_10569599
1696 Ga0268265_10639664
1697 Ga0268265_11421533
1698 Ga0268265_11438502
1699 Ga0268265_11742443
1700 Ga0268264_10008851
1701 Ga0268264_10029385
1702 Ga0268264_10171372
1703 Ga0307407_11062060
1704 Ga0307414_10201934
1705 Ga0307414_11781737
1706 Ga0373934_0069289
1707 Ga0373936_0615141
1708 Ga0373954_0234421
1709 Ga0373943_0063641
1710 Ga0373943_0072378
1711 Ga0373943_0092836
1712 Ga0373943_0959196
1713 Ga0373955_0074924
1714 Ga0373955_0350002
1715 Ga0373955_0365183
1716 Ga0373955_0944158
1717 Ga0373935_0057912
1718 Ga0373935_0156384
1719 Ga0373927_1018292
1720 Ga0373947_0132604
1721 Ga0373947_1177026
1722 Ga0373947_1252385
1723 Ga0373937_0041534
1724 Ga0373937_0836942
1725 Ga0373937_1040406
1726 Ga0373937_1047167
1727 Ga0373925_0212557
1728 Ga0373925_0319459
1729 Ga0373925_1388132
1730 Ga0451804_0689320
1731 Ga0451839_1424319
1732 Ga0451841_0197885
1733 Ga0451853_1763246
1734 Ga0450914_057887
1735 Ga0450923_029410
1736 Ga0450918_128684
1737 Ga0495592_0140469
1738 Ga0495592_0392186
1739 Ga0495603_0350726
1740 Ga0495641_0197787
1741 Ga0495651_0404465
1742 Ga0495653_0183664
1743 Ga0495582_0411887
1744 Ga0495582_0855955
1745 Ga0495639_0344344
1746 Ga0495584_0203350
1747 Ga0495594_0141137
1748 Ga0495594_0325255
1749 Ga0495608_0242270
1750 Ga0495618_0238461
1751 Ga0495628_0154686
1752 Ga0495630_0169240
1753 Ga0495630_1086488
1754 Ga0495644_0353461
1755 Ga0495665_0168769
1756 Ga0495640_0432262
1757 Ga0495586_0280821
1758 Ga0495587_0123859
1759 Ga0495587_0230747
1760 Ga0495598_0213582
1761 Ga0495621_0129545
1762 Ga0495621_0374676
1763 Ga0495645_0267171
1764 Ga0495645_0346084
1765 Ga0495622_0204192
1766 Ga0495634_0082340
1767 Ga0495635_0444691
1768 Ga0495657_0308437
1769 Ga0495657_0323618
1770 Ga0495599_0677247
1771 Ga0495647_0388295
1772 Ga0495658_0186683
1773 Ga0495658_0533827
1774 Ga0495658_0551868
1775 Ga0495613_0642505
1776 Ga0495613_0886732
1777 Ga0495600_0304941
1778 Ga0495581_0201909
1779 Ga0495581_0222866
1780 Ga0495676_0128486
1781 Ga0495676_0501969
1782 Ga0495680_0140445
1783 Ga0495680_0303795
1784 Ga0495680_0304210
1785 Ga0495675_0848891
1786 Ga0495684_0013026
1787 Ga0495684_0058302
1788 Ga0496100_0201216
1789 Ga0496100_0306889
1790 Ga0496101_0412884
1791 Ga0496101_0454095
1792 Ga0496101_0558749
1793 Ga0496101_0977387
1794 Ga0496102_0127369
1795 Ga0496104_0106525
1796 Ga0496104_0371428
1797 Ga0496105_0345942
1798 Ga0496105_0369681
1799 Ga0496105_0705658
1800 Ga0496105_0907349
1801 Ga0496106_0328550
1802 Ga0496106_0334136
1803 Ga0496107_0487759
1804 Ga0496107_0820721
1805 Ga0496108_0116381
1806 Ga0496108_0221688
1807 Ga0496108_0884654
1808 Ga0496108_0939949
1809 Ga0496108_0962592
1810 Ga0496109_0047500
1811 Ga0496109_0136217
1812 Ga0496109_0397979
1813 Ga0496110_0118806
1814 Ga0496110_0234915
1815 Ga0496111_0034461
1816 Ga0496111_0587104
1817 Ga0496111_0701600
1818 Ga0496112_0074701
1819 Ga0496113_0424646
1820 Ga0496113_1456873
1821 Ga0496114_0120850
1822 Ga0496114_0179867
1823 Ga0496115_0053864
1824 Ga0496115_0526153
1825 Ga0501037_0345535
1826 Ga0501038_0045517
1827 Ga0501040_0162592
1828 Ga0501042_0065024
1829 Ga0501046_0810795
1830 Ga0501048_0986191
1831 Ga0501067_0848411
1832 Ga0501071_0044864
1833 Ga0501071_0480237
1834 Ga0501073_1143745
1835 Ga0501075_0014831
1836 Ga0501077_0086589
1837 Ga0501217_108043
1838 Ga0501079_0106610
1839 Ga0501081_0097460
1840 Ga0501035_0140157
1841 Ga0501044_1243431
1842 Ga0501045_0051656
1843 Ga0501045_1262318
1844 nmdc:mga0yw44_561388_c1
1845 nmdc:mga05p37_100162_c1
1846 nmdc:mga09592_12308_c1
1847 nmdc:mga09592_507909_c1
1848 nmdc:mga0qj67_1715_c1
1849 nmdc:mga06r32_678213_c1
1850 nmdc:mga08y16_122808_c1
1851 nmdc:mga08y16_158726_c1
1852 nmdc:mga08y16_746604_c1
1853 nmdc:mga0n895_1257704_c1
1854 nmdc:mga0n895_816094_c1
1855 nmdc:mga0a205_1572920_c1
1856 nmdc:mga0a205_324472_c1
1857 Ga0495612_0396650
1858 Ga0495595_0435417
1859 Ga0495619_0203377
1860 Ga0495619_0294475
1861 Ga0500642_0187130
1862 Ga0501084_0069969
1863 Ga0501082_0191871
1864 Ga0530510_0033729

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.8536 2 95
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.8408 2 92
6fxd-assembly1.cif.gz_A-2 crystal structure of mupz from pseudomonas fluorescens 0.8401 2 86
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8382 2 93
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.8376 2 95
ID Description Score Start End Superfamily
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9015 5 66 3.10.450.240
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8382 2 93 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8348 1 92 3.30.70.100
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8285 5 66 3.10.450.240
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8268 1 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V5SFK5-F1-model_v4 Uncharacterized protein 0.9957 1 57
AF-A0A537JX09-F1-model_v4 ABM domain-containing protein 0.9836 1 95
AF-A0A2V6K1P2-F1-model_v4 ABM domain-containing protein 0.9784 1 62
AF-A0A2V6HD35-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9723 1 60
AF-A0A2V6C7R8-F1-model_v4 ABM domain-containing protein 0.9683 1 74

Map