F486089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 933 | 296 | 1864 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10566789|Ga0111539_105667891 |
| Length | 115 |
| Sequence | LLNKLNLDVKKLIHLKKEVIMFAVVRHYHFKPEDGAKIDKIVQEGFVPLLKKAKGFIRYYWLDTGNGEGASLSVFKDKAGADESVRLAADFVKANLAQMLNQKPEVIEGPVKAHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 120 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 213 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 214 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 4.07 |
| Rhizosphere | 95.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10566789 | 3300009094 | Bacteria | 1323 |
| 2 | JGI24032J14994_102648 | 3300001430 | Unclassified | 629 |
| 3 | JGI24743J22301_10016904 | 3300001991 | Unclassified | 1365 |
| 4 | JGI24035J26624_1000658 | 3300002126 | Bacteria | 3192 |
| 5 | JGI24035J26624_1002800 | 3300002126 | Unclassified | 1627 |
| 6 | Ga0065704_10819266 | 3300005289 | Unclassified | 519 |
| 7 | Ga0065704_10858249 | 3300005289 | Unclassified | 507 |
| 8 | Ga0065712_10004044 | 3300005290 | Bacteria | 5032 |
| 9 | Ga0065712_10134478 | 3300005290 | Bacteria | 1507 |
| 10 | Ga0065712_10135780 | 3300005290 | Bacteria | 1487 |
| 11 | Ga0065712_10160456 | 3300005290 | Bacteria | 1306 |
| 12 | Ga0065715_10005592 | 3300005293 | Bacteria | 6527 |
| 13 | Ga0065715_10012414 | 3300005293 | Bacteria | 2543 |
| 14 | Ga0065715_10025499 | 3300005293 | Bacteria | 1408 |
| 15 | Ga0065715_10126105 | 3300005293 | Archaea | 2105 |
| 16 | Ga0065715_10261916 | 3300005293 | Bacteria | 1135 |
| 17 | Ga0065715_10401046 | 3300005293 | Unclassified | 875 |
| 18 | Ga0065715_10436411 | 3300005293 | Unclassified | 841 |
| 19 | Ga0065715_10489311 | 3300005293 | Unclassified | 789 |
| 20 | Ga0065715_10508383 | 3300005293 | Bacteria | 773 |
| 21 | Ga0065715_10579753 | 3300005293 | Unclassified | 676 |
| 22 | Ga0065707_10223661 | 3300005295 | Bacteria | 1215 |
| 23 | Ga0065707_10421418 | 3300005295 | Unclassified | 830 |
| 24 | Ga0065707_10833487 | 3300005295 | Bacteria | 588 |
| 25 | Ga0070658_10931653 | 3300005327 | Bacteria | 755 |
| 26 | Ga0070676_10014778 | 3300005328 | Bacteria | 4295 |
| 27 | Ga0070676_10081747 | 3300005328 | Unclassified | 1961 |
| 28 | Ga0070676_10088411 | 3300005328 | Bacteria | 1893 |
| 29 | Ga0070683_100011499 | 3300005329 | Bacteria | 7656 |
| 30 | Ga0070683_100030484 | 3300005329 | Unclassified | 4898 |
| 31 | Ga0070683_100102862 | 3300005329 | Bacteria | 2691 |
| 32 | Ga0070683_101046186 | 3300005329 | Unclassified | 784 |
| 33 | Ga0070683_101127421 | 3300005329 | Unclassified | 754 |
| 34 | Ga0070683_101235137 | 3300005329 | Unclassified | 718 |
| 35 | Ga0070683_102033275 | 3300005329 | Bacteria | 552 |
| 36 | Ga0070683_102060023 | 3300005329 | Bacteria | 548 |
| 37 | Ga0070690_100019296 | 3300005330 | Bacteria | 4135 |
| 38 | Ga0070690_100107308 | 3300005330 | Bacteria | 1858 |
| 39 | Ga0070690_100211894 | 3300005330 | Unclassified | 1353 |
| 40 | Ga0070690_100232803 | 3300005330 | Bacteria | 1296 |
| 41 | Ga0070690_100280222 | 3300005330 | Bacteria | 1189 |
| 42 | Ga0070690_100419300 | 3300005330 | Bacteria | 986 |
| 43 | Ga0070690_100504118 | 3300005330 | Unclassified | 906 |
| 44 | Ga0070670_100038007 | 3300005331 | Bacteria | 4139 |
| 45 | Ga0070670_100081973 | 3300005331 | Unclassified | 2772 |
| 46 | Ga0070670_100394336 | 3300005331 | Bacteria | 1221 |
| 47 | Ga0070670_100452960 | 3300005331 | Unclassified | 1137 |
| 48 | Ga0070670_101461510 | 3300005331 | Bacteria | 627 |
| 49 | Ga0070677_10033624 | 3300005333 | Unclassified | 1976 |
| 50 | Ga0070677_10107986 | 3300005333 | Bacteria | 1238 |
| 51 | Ga0070677_10626940 | 3300005333 | Unclassified | 598 |
| 52 | Ga0068869_100231246 | 3300005334 | Unclassified | 1469 |
| 53 | Ga0068869_100250849 | 3300005334 | Bacteria | 1413 |
| 54 | Ga0068869_100402758 | 3300005334 | Bacteria | 1126 |
| 55 | Ga0068869_100605785 | 3300005334 | Unclassified | 926 |
| 56 | Ga0068869_101287444 | 3300005334 | Unclassified | 644 |
| 57 | Ga0070666_10005870 | 3300005335 | Bacteria | 7544 |
| 58 | Ga0070666_10122890 | 3300005335 | Bacteria | 1801 |
| 59 | Ga0070666_10199184 | 3300005335 | Bacteria | 1409 |
| 60 | Ga0070666_10495535 | 3300005335 | Unclassified | 885 |
| 61 | Ga0070682_100114350 | 3300005337 | Bacteria | 1803 |
| 62 | Ga0070682_100493615 | 3300005337 | Unclassified | 947 |
| 63 | Ga0070682_101061604 | 3300005337 | Unclassified | 676 |
| 64 | Ga0070682_101175427 | 3300005337 | Bacteria | 646 |
| 65 | Ga0068868_100051035 | 3300005338 | Bacteria | 3251 |
| 66 | Ga0068868_100087147 | 3300005338 | Unclassified | 2511 |
| 67 | Ga0068868_100138969 | 3300005338 | Bacteria | 1993 |
| 68 | Ga0068868_100182711 | 3300005338 | Bacteria | 1741 |
| 69 | Ga0068868_100511545 | 3300005338 | Bacteria | 1053 |
| 70 | Ga0068868_101228007 | 3300005338 | Unclassified | 694 |
| 71 | Ga0070660_100133096 | 3300005339 | Unclassified | 1991 |
| 72 | Ga0070660_100207272 | 3300005339 | Unclassified | 1591 |
| 73 | Ga0070660_100282199 | 3300005339 | Unclassified | 1359 |
| 74 | Ga0070689_100004490 | 3300005340 | Bacteria | 9439 |
| 75 | Ga0070689_100007248 | 3300005340 | Bacteria | 7734 |
| 76 | Ga0070689_100202486 | 3300005340 | Bacteria | 1622 |
| 77 | Ga0070689_100556346 | 3300005340 | Unclassified | 989 |
| 78 | Ga0070689_101578534 | 3300005340 | Bacteria | 595 |
| 79 | Ga0070687_100054195 | 3300005343 | Unclassified | 2088 |
| 80 | Ga0070687_100130896 | 3300005343 | Unclassified | 1448 |
| 81 | Ga0070687_100626316 | 3300005343 | Bacteria | 742 |
| 82 | Ga0070687_100794340 | 3300005343 | Bacteria | 670 |
| 83 | Ga0070687_100882200 | 3300005343 | Unclassified | 640 |
| 84 | Ga0070687_101273431 | 3300005343 | Bacteria | 545 |
| 85 | Ga0070687_101376043 | 3300005343 | Unclassified | 527 |
| 86 | Ga0070661_100300629 | 3300005344 | Bacteria | 1249 |
| 87 | Ga0070661_100582524 | 3300005344 | Unclassified | 903 |
| 88 | Ga0070692_11350696 | 3300005345 | Unclassified | 513 |
| 89 | Ga0070668_100977910 | 3300005347 | Bacteria | 760 |
| 90 | Ga0070668_101539835 | 3300005347 | Unclassified | 608 |
| 91 | Ga0070668_101693665 | 3300005347 | Bacteria | 580 |
| 92 | Ga0070669_100016907 | 3300005353 | Bacteria | 5207 |
| 93 | Ga0070669_100143892 | 3300005353 | Bacteria | 1840 |
| 94 | Ga0070669_100372419 | 3300005353 | Unclassified | 1163 |
| 95 | Ga0070669_100423998 | 3300005353 | Bacteria | 1092 |
| 96 | Ga0070669_100613550 | 3300005353 | Unclassified | 912 |
| 97 | Ga0070669_100880120 | 3300005353 | Bacteria | 764 |
| 98 | Ga0070669_100936037 | 3300005353 | Bacteria | 741 |
| 99 | Ga0070675_100035982 | 3300005354 | Bacteria | 4026 |
| 100 | Ga0070675_100063235 | 3300005354 | Bacteria | 3059 |
| 101 | Ga0070675_100073569 | 3300005354 | Bacteria | 2837 |
| 102 | Ga0070675_100096217 | 3300005354 | Bacteria | 2487 |
| 103 | Ga0070675_100135537 | 3300005354 | Bacteria | 2101 |
| 104 | Ga0070675_100185374 | 3300005354 | Bacteria | 1801 |
| 105 | Ga0070675_100639262 | 3300005354 | Bacteria | 966 |
| 106 | Ga0070675_101111763 | 3300005354 | Bacteria | 727 |
| 107 | Ga0070675_101123899 | 3300005354 | Bacteria | 723 |
| 108 | Ga0070675_102084608 | 3300005354 | Bacteria | 523 |
| 109 | Ga0070675_102100260 | 3300005354 | Unclassified | 521 |
| 110 | Ga0070671_100184621 | 3300005355 | Bacteria | 1767 |
| 111 | Ga0070671_100224034 | 3300005355 | Unclassified | 1595 |
| 112 | Ga0070671_100274237 | 3300005355 | Unclassified | 1434 |
| 113 | Ga0070671_100523033 | 3300005355 | Unclassified | 1022 |
| 114 | Ga0070671_100692878 | 3300005355 | Bacteria | 883 |
| 115 | Ga0070671_100858391 | 3300005355 | Bacteria | 792 |
| 116 | Ga0070671_101660801 | 3300005355 | Bacteria | 567 |
| 117 | Ga0070671_102104101 | 3300005355 | Unclassified | 503 |
| 118 | Ga0070674_100238628 | 3300005356 | Bacteria | 1422 |
| 119 | Ga0070673_100013118 | 3300005364 | Bacteria | 5720 |
| 120 | Ga0070673_100058068 | 3300005364 | Bacteria | 3058 |
| 121 | Ga0070673_100769427 | 3300005364 | Bacteria | 887 |
| 122 | Ga0070673_100852409 | 3300005364 | Bacteria | 843 |
| 123 | Ga0070673_100931571 | 3300005364 | Bacteria | 807 |
| 124 | Ga0070673_102346521 | 3300005364 | Unclassified | 507 |
| 125 | Ga0070688_100001199 | 3300005365 | Bacteria | 12899 |
| 126 | Ga0070688_100065104 | 3300005365 | Bacteria | 2315 |
| 127 | Ga0070688_100075550 | 3300005365 | Unclassified | 2166 |
| 128 | Ga0070688_100174116 | 3300005365 | Unclassified | 1488 |
| 129 | Ga0070688_100684792 | 3300005365 | Bacteria | 793 |
| 130 | Ga0070688_100966001 | 3300005365 | Bacteria | 675 |
| 131 | Ga0070688_101467681 | 3300005365 | Bacteria | 554 |
| 132 | Ga0070659_100002571 | 3300005366 | Bacteria | 12908 |
| 133 | Ga0070659_100135247 | 3300005366 | Unclassified | 2004 |
| 134 | Ga0070659_100658203 | 3300005366 | Bacteria | 903 |
| 135 | Ga0070659_101133665 | 3300005366 | Bacteria | 690 |
| 136 | Ga0070667_100018520 | 3300005367 | Bacteria | 5776 |
| 137 | Ga0070667_100073067 | 3300005367 | Bacteria | 2924 |
| 138 | Ga0070667_100085820 | 3300005367 | Bacteria | 2700 |
| 139 | Ga0070667_100134228 | 3300005367 | Bacteria | 2163 |
| 140 | Ga0070667_100477794 | 3300005367 | Bacteria | 1141 |
| 141 | Ga0070667_100602263 | 3300005367 | Bacteria | 1012 |
| 142 | Ga0070667_100978607 | 3300005367 | Bacteria | 789 |
| 143 | Ga0070667_101197752 | 3300005367 | Bacteria | 711 |
| 144 | Ga0070667_101247682 | 3300005367 | Bacteria | 696 |
| 145 | Ga0070667_101497583 | 3300005367 | Bacteria | 634 |
| 146 | Ga0070667_101499472 | 3300005367 | Bacteria | 633 |
| 147 | Ga0070709_10983628 | 3300005434 | Unclassified | 670 |
| 148 | Ga0070714_100093624 | 3300005435 | Unclassified | 2635 |
| 149 | Ga0070713_100286211 | 3300005436 | Bacteria | 1513 |
| 150 | Ga0070701_10293146 | 3300005438 | Unclassified | 998 |
| 151 | Ga0070711_100125787 | 3300005439 | Bacteria | 1903 |
| 152 | Ga0070711_100472312 | 3300005439 | Bacteria | 1029 |
| 153 | Ga0070711_100757359 | 3300005439 | Bacteria | 821 |
| 154 | Ga0070711_101256740 | 3300005439 | Unclassified | 642 |
| 155 | Ga0070711_101713438 | 3300005439 | Unclassified | 551 |
| 156 | Ga0070705_100179897 | 3300005440 | Unclassified | 1432 |
| 157 | Ga0070705_100506255 | 3300005440 | Unclassified | 918 |
| 158 | Ga0070705_101314929 | 3300005440 | Unclassified | 600 |
| 159 | Ga0070700_100010242 | 3300005441 | Bacteria | 5172 |
| 160 | Ga0070700_100635194 | 3300005441 | Bacteria | 841 |
| 161 | Ga0070700_101580214 | 3300005441 | Bacteria | 560 |
| 162 | Ga0070694_100140641 | 3300005444 | Unclassified | 1753 |
| 163 | Ga0070694_100942734 | 3300005444 | Unclassified | 714 |
| 164 | Ga0070694_101822670 | 3300005444 | Unclassified | 519 |
| 165 | Ga0070708_100025891 | 3300005445 | Bacteria | 5017 |
| 166 | Ga0070708_100313032 | 3300005445 | Bacteria | 1479 |
| 167 | Ga0070708_101706955 | 3300005445 | Bacteria | 585 |
| 168 | Ga0070663_100009998 | 3300005455 | Bacteria | 5897 |
| 169 | Ga0070663_101287521 | 3300005455 | Bacteria | 645 |
| 170 | Ga0070678_100018086 | 3300005456 | Bacteria | 4560 |
| 171 | Ga0070678_100213280 | 3300005456 | Bacteria | 1601 |
| 172 | Ga0070678_100308272 | 3300005456 | Bacteria | 1348 |
| 173 | Ga0070662_100073930 | 3300005457 | Bacteria | 2520 |
| 174 | Ga0070662_100089622 | 3300005457 | Unclassified | 2307 |
| 175 | Ga0070662_100238277 | 3300005457 | Bacteria | 1458 |
| 176 | Ga0070662_100266203 | 3300005457 | Bacteria | 1382 |
| 177 | Ga0070662_100370566 | 3300005457 | Unclassified | 1177 |
| 178 | Ga0070662_100691071 | 3300005457 | Viruses | 863 |
| 179 | Ga0070662_101004914 | 3300005457 | Bacteria | 714 |
| 180 | Ga0070681_10224369 | 3300005458 | Bacteria | 1794 |
| 181 | Ga0068867_100084519 | 3300005459 | Bacteria | 2398 |
| 182 | Ga0068867_100214705 | 3300005459 | Unclassified | 1547 |
| 183 | Ga0068867_100390588 | 3300005459 | Unclassified | 1171 |
| 184 | Ga0068867_100398616 | 3300005459 | Bacteria | 1160 |
| 185 | Ga0068867_100414753 | 3300005459 | Unclassified | 1139 |
| 186 | Ga0068867_100605081 | 3300005459 | Unclassified | 956 |
| 187 | Ga0068867_100900899 | 3300005459 | Unclassified | 796 |
| 188 | Ga0068867_101132396 | 3300005459 | Unclassified | 716 |
| 189 | Ga0068867_101245693 | 3300005459 | Unclassified | 685 |
| 190 | Ga0068867_101744696 | 3300005459 | Bacteria | 584 |
| 191 | Ga0070685_10006366 | 3300005466 | Bacteria | 6017 |
| 192 | Ga0070685_10007687 | 3300005466 | Bacteria | 5517 |
| 193 | Ga0070685_10017516 | 3300005466 | Unclassified | 3836 |
| 194 | Ga0070685_10066526 | 3300005466 | Bacteria | 2124 |
| 195 | Ga0070685_10887625 | 3300005466 | Unclassified | 663 |
| 196 | Ga0070706_100023029 | 3300005467 | Bacteria | 5736 |
| 197 | Ga0070706_100023191 | 3300005467 | Bacteria | 5716 |
| 198 | Ga0070706_100726358 | 3300005467 | Unclassified | 921 |
| 199 | Ga0070707_100147648 | 3300005468 | Bacteria | 2288 |
| 200 | Ga0070707_101313212 | 3300005468 | Unclassified | 690 |
| 201 | Ga0070707_101585781 | 3300005468 | Unclassified | 622 |
| 202 | Ga0070698_100526981 | 3300005471 | Bacteria | 1120 |
| 203 | Ga0070698_101452951 | 3300005471 | Unclassified | 637 |
| 204 | Ga0070699_101294108 | 3300005518 | Unclassified | 669 |
| 205 | Ga0070684_100006906 | 3300005535 | Bacteria | 8815 |
| 206 | Ga0070684_100140455 | 3300005535 | Unclassified | 2184 |
| 207 | Ga0070697_100001381 | 3300005536 | Bacteria | 18360 |
| 208 | Ga0070697_100618380 | 3300005536 | Bacteria | 953 |
| 209 | Ga0070697_101380454 | 3300005536 | Unclassified | 629 |
| 210 | Ga0070697_101461731 | 3300005536 | Unclassified | 611 |
| 211 | Ga0070697_101938381 | 3300005536 | Unclassified | 527 |
| 212 | Ga0068853_100807417 | 3300005539 | Bacteria | 899 |
| 213 | Ga0068853_101199714 | 3300005539 | Unclassified | 733 |
| 214 | Ga0068853_101424043 | 3300005539 | Unclassified | 670 |
| 215 | Ga0070672_100010949 | 3300005543 | Bacteria | 6310 |
| 216 | Ga0070672_100040024 | 3300005543 | Bacteria | 3594 |
| 217 | Ga0070672_100304207 | 3300005543 | Unclassified | 1352 |
| 218 | Ga0070672_100750073 | 3300005543 | Bacteria | 857 |
| 219 | Ga0070672_101087962 | 3300005543 | Unclassified | 710 |
| 220 | Ga0070672_101344041 | 3300005543 | Bacteria | 638 |
| 221 | Ga0070672_101733346 | 3300005543 | Bacteria | 561 |
| 222 | Ga0070672_102106638 | 3300005543 | Bacteria | 508 |
| 223 | Ga0070686_100024836 | 3300005544 | Bacteria | 3595 |
| 224 | Ga0070686_100534364 | 3300005544 | Bacteria | 915 |
| 225 | Ga0070686_100664187 | 3300005544 | Unclassified | 828 |
| 226 | Ga0070686_100680700 | 3300005544 | Bacteria | 818 |
| 227 | Ga0070686_101303351 | 3300005544 | Bacteria | 607 |
| 228 | Ga0070686_101319934 | 3300005544 | Bacteria | 603 |
| 229 | Ga0070695_100689768 | 3300005545 | Unclassified | 810 |
| 230 | Ga0070693_100512421 | 3300005547 | Bacteria | 853 |
| 231 | Ga0070693_101082875 | 3300005547 | Unclassified | 610 |
| 232 | Ga0070665_100077406 | 3300005548 | Bacteria | 3332 |
| 233 | Ga0070665_100131038 | 3300005548 | Unclassified | 2510 |
| 234 | Ga0070665_100619989 | 3300005548 | Bacteria | 1095 |
| 235 | Ga0070665_101022072 | 3300005548 | Unclassified | 839 |
| 236 | Ga0070704_100022921 | 3300005549 | Bacteria | 4069 |
| 237 | Ga0070704_100548442 | 3300005549 | Bacteria | 1010 |
| 238 | Ga0070704_101521603 | 3300005549 | Unclassified | 616 |
| 239 | Ga0068855_100624428 | 3300005563 | Unclassified | 1160 |
| 240 | Ga0070664_101577321 | 3300005564 | Unclassified | 622 |
| 241 | Ga0068857_100119514 | 3300005577 | Bacteria | 2372 |
| 242 | Ga0068854_100072812 | 3300005578 | Bacteria | 2517 |
| 243 | Ga0068854_100551022 | 3300005578 | Unclassified | 978 |
| 244 | Ga0068854_101275231 | 3300005578 | Bacteria | 661 |
| 245 | Ga0068856_102269539 | 3300005614 | Bacteria | 551 |
| 246 | Ga0070702_100021227 | 3300005615 | Bacteria | 3414 |
| 247 | Ga0070702_100409679 | 3300005615 | Bacteria | 972 |
| 248 | Ga0070702_100465178 | 3300005615 | Bacteria | 920 |
| 249 | Ga0070702_101250219 | 3300005615 | Bacteria | 601 |
| 250 | Ga0070702_101527134 | 3300005615 | Bacteria | 550 |
| 251 | Ga0070702_101578358 | 3300005615 | Unclassified | 542 |
| 252 | Ga0068852_100064621 | 3300005616 | Bacteria | 3190 |
| 253 | Ga0068852_100290946 | 3300005616 | Unclassified | 1578 |
| 254 | Ga0068852_101264597 | 3300005616 | Bacteria | 759 |
| 255 | Ga0068859_100035531 | 3300005617 | Bacteria | 5000 |
| 256 | Ga0068859_100093098 | 3300005617 | Bacteria | 3065 |
| 257 | Ga0068859_100304491 | 3300005617 | Bacteria | 1687 |
| 258 | Ga0068859_100393877 | 3300005617 | Bacteria | 1481 |
| 259 | Ga0068859_100430290 | 3300005617 | Bacteria | 1416 |
| 260 | Ga0068859_100565722 | 3300005617 | Bacteria | 1231 |
| 261 | Ga0068859_100847732 | 3300005617 | Unclassified | 1000 |
| 262 | Ga0068859_102400754 | 3300005617 | Unclassified | 581 |
| 263 | Ga0068859_102919102 | 3300005617 | Unclassified | 523 |
| 264 | Ga0068864_100050010 | 3300005618 | Bacteria | 3597 |
| 265 | Ga0068864_100069013 | 3300005618 | Bacteria | 3072 |
| 266 | Ga0068864_100268308 | 3300005618 | Unclassified | 1589 |
| 267 | Ga0068864_100583176 | 3300005618 | Bacteria | 1084 |
| 268 | Ga0068864_100750689 | 3300005618 | Unclassified | 956 |
| 269 | Ga0068864_100933884 | 3300005618 | Bacteria | 858 |
| 270 | Ga0068864_101608758 | 3300005618 | Bacteria | 654 |
| 271 | Ga0068864_102443818 | 3300005618 | Unclassified | 529 |
| 272 | Ga0068864_102652362 | 3300005618 | Unclassified | 507 |
| 273 | Ga0068866_10048868 | 3300005718 | Unclassified | 2141 |
| 274 | Ga0068866_10300244 | 3300005718 | Unclassified | 1003 |
| 275 | Ga0068866_10541540 | 3300005718 | Unclassified | 777 |
| 276 | Ga0068866_11214608 | 3300005718 | Unclassified | 545 |
| 277 | Ga0068861_100040137 | 3300005719 | Bacteria | 3498 |
| 278 | Ga0068861_100079226 | 3300005719 | Bacteria | 2568 |
| 279 | Ga0068861_100315563 | 3300005719 | Bacteria | 1360 |
| 280 | Ga0068851_10222553 | 3300005834 | Bacteria | 1061 |
| 281 | Ga0068870_11216641 | 3300005840 | Bacteria | 546 |
| 282 | Ga0068863_100022457 | 3300005841 | Bacteria | 6026 |
| 283 | Ga0068863_100047122 | 3300005841 | Bacteria | 4090 |
| 284 | Ga0068863_100087581 | 3300005841 | Bacteria | 2951 |
| 285 | Ga0068863_100161759 | 3300005841 | Bacteria | 2145 |
| 286 | Ga0068863_101344747 | 3300005841 | Bacteria | 722 |
| 287 | Ga0068863_102123465 | 3300005841 | Bacteria | 572 |
| 288 | Ga0068858_100009874 | 3300005842 | Bacteria | 9069 |
| 289 | Ga0068858_100075105 | 3300005842 | Bacteria | 3139 |
| 290 | Ga0068858_100272656 | 3300005842 | Bacteria | 1610 |
| 291 | Ga0068858_101473481 | 3300005842 | Bacteria | 671 |
| 292 | Ga0068858_101477253 | 3300005842 | Bacteria | 670 |
| 293 | Ga0068860_100027486 | 3300005843 | Bacteria | 5479 |
| 294 | Ga0068860_100351835 | 3300005843 | Bacteria | 1450 |
| 295 | Ga0068860_101046374 | 3300005843 | Unclassified | 835 |
| 296 | Ga0068860_101641161 | 3300005843 | Bacteria | 665 |
| 297 | Ga0068862_100159026 | 3300005844 | Bacteria | 2015 |
| 298 | Ga0068862_100354776 | 3300005844 | Unclassified | 1361 |
| 299 | Ga0068862_100557078 | 3300005844 | Bacteria | 1095 |
| 300 | Ga0068862_100876778 | 3300005844 | Bacteria | 881 |
| 301 | Ga0068862_100898080 | 3300005844 | Unclassified | 871 |
| 302 | Ga0068862_100945230 | 3300005844 | Bacteria | 850 |
| 303 | Ga0068862_101329737 | 3300005844 | Bacteria | 720 |
| 304 | Ga0068862_102630749 | 3300005844 | Bacteria | 515 |
| 305 | Ga0070717_10033417 | 3300006028 | Bacteria | 4150 |
| 306 | Ga0075365_10630769 | 3300006038 | Bacteria | 758 |
| 307 | Ga0070715_10181835 | 3300006163 | Bacteria | 1055 |
| 308 | Ga0070715_10395233 | 3300006163 | Bacteria | 767 |
| 309 | Ga0070716_101189635 | 3300006173 | Unclassified | 612 |
| 310 | Ga0070712_100066847 | 3300006175 | Unclassified | 2556 |
| 311 | Ga0070712_100134215 | 3300006175 | Bacteria | 1880 |
| 312 | Ga0070712_100657590 | 3300006175 | Unclassified | 891 |
| 313 | Ga0097621_100020065 | 3300006237 | Bacteria | 5146 |
| 314 | Ga0097621_100070759 | 3300006237 | Bacteria | 2881 |
| 315 | Ga0097621_100196884 | 3300006237 | Unclassified | 1747 |
| 316 | Ga0097621_100217413 | 3300006237 | Unclassified | 1664 |
| 317 | Ga0097621_100282090 | 3300006237 | Bacteria | 1462 |
| 318 | Ga0097621_100362220 | 3300006237 | Bacteria | 1292 |
| 319 | Ga0097621_100362483 | 3300006237 | Bacteria | 1291 |
| 320 | Ga0097621_101038221 | 3300006237 | Bacteria | 768 |
| 321 | Ga0097621_101084676 | 3300006237 | Bacteria | 751 |
| 322 | Ga0068871_100033947 | 3300006358 | Bacteria | 4044 |
| 323 | Ga0068871_100039948 | 3300006358 | Unclassified | 3756 |
| 324 | Ga0068871_100059877 | 3300006358 | Bacteria | 3104 |
| 325 | Ga0068871_100117289 | 3300006358 | Bacteria | 2245 |
| 326 | Ga0068871_100154242 | 3300006358 | Unclassified | 1960 |
| 327 | Ga0068871_100251516 | 3300006358 | Bacteria | 1539 |
| 328 | Ga0068871_100285983 | 3300006358 | Bacteria | 1443 |
| 329 | Ga0068871_100528054 | 3300006358 | Unclassified | 1066 |
| 330 | Ga0068871_100757087 | 3300006358 | Unclassified | 893 |
| 331 | Ga0068871_100899761 | 3300006358 | Unclassified | 820 |
| 332 | Ga0068871_101265545 | 3300006358 | Bacteria | 693 |
| 333 | Ga0068871_101669271 | 3300006358 | Bacteria | 604 |
| 334 | Ga0075428_100454541 | 3300006844 | Bacteria | 1372 |
| 335 | Ga0075430_100024562 | 3300006846 | Bacteria | 5126 |
| 336 | Ga0075431_100052166 | 3300006847 | Unclassified | 4217 |
| 337 | Ga0075431_100206210 | 3300006847 | Bacteria | 2010 |
| 338 | Ga0075433_11081585 | 3300006852 | Unclassified | 697 |
| 339 | Ga0075434_100298788 | 3300006871 | Unclassified | 1630 |
| 340 | Ga0075429_100022430 | 3300006880 | Bacteria | 5475 |
| 341 | Ga0075429_100313205 | 3300006880 | Bacteria | 1374 |
| 342 | Ga0068865_100081475 | 3300006881 | Unclassified | 2324 |
| 343 | Ga0068865_100415529 | 3300006881 | Unclassified | 1105 |
| 344 | Ga0068865_100937427 | 3300006881 | Unclassified | 755 |
| 345 | Ga0068865_101184821 | 3300006881 | Bacteria | 676 |
| 346 | Ga0068865_101200492 | 3300006881 | Bacteria | 671 |
| 347 | Ga0097620_100035530 | 3300006931 | Bacteria | 5000 |
| 348 | Ga0097620_100093092 | 3300006931 | Bacteria | 3065 |
| 349 | Ga0097620_100304511 | 3300006931 | Bacteria | 1687 |
| 350 | Ga0097620_100393906 | 3300006931 | Bacteria | 1481 |
| 351 | Ga0097620_100430329 | 3300006931 | Bacteria | 1416 |
| 352 | Ga0097620_100565716 | 3300006931 | Bacteria | 1231 |
| 353 | Ga0097620_100847806 | 3300006931 | Unclassified | 1000 |
| 354 | Ga0097620_102399726 | 3300006931 | Unclassified | 581 |
| 355 | Ga0097620_102918610 | 3300006931 | Unclassified | 523 |
| 356 | Ga0105251_10200959 | 3300009011 | Bacteria | 898 |
| 357 | Ga0105240_10260102 | 3300009093 | Bacteria | 2002 |
| 358 | Ga0111539_10048604 | 3300009094 | Bacteria | 5064 |
| 359 | Ga0111539_10482610 | 3300009094 | Bacteria | 1444 |
| 360 | Ga0111539_10841575 | 3300009094 | Bacteria | 1067 |
| 361 | Ga0111539_12294643 | 3300009094 | Bacteria | 626 |
| 362 | Ga0111539_13239766 | 3300009094 | Unclassified | 524 |
| 363 | Ga0111539_13459810 | 3300009094 | Unclassified | 507 |
| 364 | Ga0105245_10179621 | 3300009098 | Bacteria | 2021 |
| 365 | Ga0105245_10272511 | 3300009098 | Bacteria | 1651 |
| 366 | Ga0105245_10328953 | 3300009098 | Bacteria | 1508 |
| 367 | Ga0105245_10370392 | 3300009098 | Bacteria | 1424 |
| 368 | Ga0105245_11084546 | 3300009098 | Unclassified | 847 |
| 369 | Ga0105247_10069340 | 3300009101 | Bacteria | 2200 |
| 370 | Ga0105247_10140515 | 3300009101 | Unclassified | 1582 |
| 371 | Ga0105247_10161278 | 3300009101 | Unclassified | 1485 |
| 372 | Ga0105247_10522979 | 3300009101 | Bacteria | 868 |
| 373 | Ga0114129_10134955 | 3300009147 | Bacteria | 3386 |
| 374 | Ga0105243_10081696 | 3300009148 | Bacteria | 2639 |
| 375 | Ga0105243_10126597 | 3300009148 | Bacteria | 2162 |
| 376 | Ga0105243_11078581 | 3300009148 | Unclassified | 810 |
| 377 | Ga0105241_10093251 | 3300009174 | Unclassified | 2379 |
| 378 | Ga0105241_10603844 | 3300009174 | Bacteria | 991 |
| 379 | Ga0105241_11733662 | 3300009174 | Unclassified | 608 |
| 380 | Ga0105242_10005987 | 3300009176 | Bacteria | 9376 |
| 381 | Ga0105242_10185845 | 3300009176 | Bacteria | 1836 |
| 382 | Ga0105242_10361110 | 3300009176 | Unclassified | 1344 |
| 383 | Ga0105242_11291439 | 3300009176 | Bacteria | 753 |
| 384 | Ga0105242_12031596 | 3300009176 | Unclassified | 618 |
| 385 | Ga0105248_10075569 | 3300009177 | Bacteria | 3786 |
| 386 | Ga0105248_10098900 | 3300009177 | Bacteria | 3287 |
| 387 | Ga0105248_10398824 | 3300009177 | Bacteria | 1549 |
| 388 | Ga0105248_10402636 | 3300009177 | Unclassified | 1541 |
| 389 | Ga0105248_10488316 | 3300009177 | Unclassified | 1388 |
| 390 | Ga0105248_10726649 | 3300009177 | Bacteria | 1120 |
| 391 | Ga0105248_11053696 | 3300009177 | Unclassified | 919 |
| 392 | Ga0105248_11845408 | 3300009177 | Bacteria | 686 |
| 393 | Ga0105248_12498584 | 3300009177 | Unclassified | 589 |
| 394 | Ga0105237_10150893 | 3300009545 | Bacteria | 2320 |
| 395 | Ga0105237_11151633 | 3300009545 | Bacteria | 782 |
| 396 | Ga0105249_10001311 | 3300009553 | Bacteria | 21783 |
| 397 | Ga0105249_10010090 | 3300009553 | Bacteria | 8290 |
| 398 | Ga0105249_10037978 | 3300009553 | Bacteria | 4370 |
| 399 | Ga0105249_10041778 | 3300009553 | Bacteria | 4169 |
| 400 | Ga0105249_10079433 | 3300009553 | Bacteria | 3045 |
| 401 | Ga0105249_10293286 | 3300009553 | Bacteria | 1629 |
| 402 | Ga0105249_10350192 | 3300009553 | Unclassified | 1496 |
| 403 | Ga0105249_10414653 | 3300009553 | Unclassified | 1379 |
| 404 | Ga0105249_10516984 | 3300009553 | Bacteria | 1241 |
| 405 | Ga0105249_10599384 | 3300009553 | Unclassified | 1156 |
| 406 | Ga0105249_11699170 | 3300009553 | Bacteria | 704 |
| 407 | Ga0105249_13022754 | 3300009553 | Bacteria | 540 |
| 408 | Ga0099796_10100323 | 3300010159 | Bacteria | 1088 |
| 409 | Ga0105239_10052885 | 3300010375 | Bacteria | 4454 |
| 410 | Ga0105239_10055606 | 3300010375 | Bacteria | 4340 |
| 411 | Ga0105239_10215555 | 3300010375 | Bacteria | 2152 |
| 412 | Ga0105239_10961147 | 3300010375 | Bacteria | 981 |
| 413 | Ga0105246_10068122 | 3300011119 | Bacteria | 2495 |
| 414 | Ga0157371_10268586 | 3300013102 | Unclassified | 1231 |
| 415 | Ga0157371_10298495 | 3300013102 | Bacteria | 1166 |
| 416 | Ga0157374_10013528 | 3300013296 | Bacteria | 7123 |
| 417 | Ga0157374_10020158 | 3300013296 | Bacteria | 5911 |
| 418 | Ga0157374_10053956 | 3300013296 | Unclassified | 3748 |
| 419 | Ga0157374_10060608 | 3300013296 | Bacteria | 3542 |
| 420 | Ga0157374_10263427 | 3300013296 | Bacteria | 1698 |
| 421 | Ga0157374_10327872 | 3300013296 | Bacteria | 1518 |
| 422 | Ga0157374_10491174 | 3300013296 | Bacteria | 1231 |
| 423 | Ga0157374_10549174 | 3300013296 | Unclassified | 1163 |
| 424 | Ga0157374_11074164 | 3300013296 | Unclassified | 825 |
| 425 | Ga0157374_11076481 | 3300013296 | Bacteria | 824 |
| 426 | Ga0157374_11521452 | 3300013296 | Unclassified | 693 |
| 427 | Ga0157374_11625742 | 3300013296 | Unclassified | 670 |
| 428 | Ga0157374_12845169 | 3300013296 | Bacteria | 511 |
| 429 | Ga0157374_12883599 | 3300013296 | Unclassified | 508 |
| 430 | Ga0157378_10025935 | 3300013297 | Bacteria | 5165 |
| 431 | Ga0157378_10051722 | 3300013297 | Bacteria | 3655 |
| 432 | Ga0157378_10055673 | 3300013297 | Bacteria | 3523 |
| 433 | Ga0157378_10325271 | 3300013297 | Unclassified | 1495 |
| 434 | Ga0157378_10363753 | 3300013297 | Unclassified | 1416 |
| 435 | Ga0157378_10395389 | 3300013297 | Bacteria | 1361 |
| 436 | Ga0157378_10439604 | 3300013297 | Bacteria | 1293 |
| 437 | Ga0157378_10743519 | 3300013297 | Bacteria | 1003 |
| 438 | Ga0157378_10755562 | 3300013297 | Unclassified | 995 |
| 439 | Ga0157378_10810182 | 3300013297 | Unclassified | 963 |
| 440 | Ga0157378_11912774 | 3300013297 | Bacteria | 642 |
| 441 | Ga0157378_13030252 | 3300013297 | Unclassified | 521 |
| 442 | Ga0163162_10010052 | 3300013306 | Bacteria | 9201 |
| 443 | Ga0163162_10114454 | 3300013306 | Bacteria | 2796 |
| 444 | Ga0163162_10124221 | 3300013306 | Bacteria | 2686 |
| 445 | Ga0163162_10153141 | 3300013306 | Unclassified | 2424 |
| 446 | Ga0163162_10204973 | 3300013306 | Unclassified | 2101 |
| 447 | Ga0163162_11174474 | 3300013306 | Bacteria | 871 |
| 448 | Ga0163162_11353665 | 3300013306 | Bacteria | 809 |
| 449 | Ga0163162_11672673 | 3300013306 | Bacteria | 727 |
| 450 | Ga0163162_12014398 | 3300013306 | Bacteria | 662 |
| 451 | Ga0157372_10478705 | 3300013307 | Unclassified | 1451 |
| 452 | Ga0157372_10716987 | 3300013307 | Bacteria | 1163 |
| 453 | Ga0157372_11914408 | 3300013307 | Unclassified | 682 |
| 454 | Ga0157372_12155459 | 3300013307 | Bacteria | 640 |
| 455 | Ga0157375_10023557 | 3300013308 | Bacteria | 5683 |
| 456 | Ga0157375_10086990 | 3300013308 | Bacteria | 3177 |
| 457 | Ga0157375_10095316 | 3300013308 | Bacteria | 3046 |
| 458 | Ga0157375_10137476 | 3300013308 | Bacteria | 2569 |
| 459 | Ga0157375_10139419 | 3300013308 | Unclassified | 2551 |
| 460 | Ga0157375_10378747 | 3300013308 | Bacteria | 1582 |
| 461 | Ga0157375_10539301 | 3300013308 | Bacteria | 1329 |
| 462 | Ga0157375_10586654 | 3300013308 | Bacteria | 1274 |
| 463 | Ga0157375_11387335 | 3300013308 | Unclassified | 828 |
| 464 | Ga0157375_11499745 | 3300013308 | Unclassified | 796 |
| 465 | Ga0157375_13147499 | 3300013308 | Unclassified | 550 |
| 466 | Ga0157375_13385849 | 3300013308 | Unclassified | 531 |
| 467 | Ga0163163_10239924 | 3300014325 | Bacteria | 1862 |
| 468 | Ga0163163_10601053 | 3300014325 | Bacteria | 1163 |
| 469 | Ga0163163_10900261 | 3300014325 | Bacteria | 948 |
| 470 | Ga0163163_11112829 | 3300014325 | Bacteria | 853 |
| 471 | Ga0163163_11607120 | 3300014325 | Unclassified | 711 |
| 472 | Ga0157380_10040869 | 3300014326 | Bacteria | 3616 |
| 473 | Ga0157380_10365536 | 3300014326 | Unclassified | 1356 |
| 474 | Ga0157380_10378537 | 3300014326 | Bacteria | 1335 |
| 475 | Ga0157380_10625234 | 3300014326 | Bacteria | 1070 |
| 476 | Ga0157380_11962378 | 3300014326 | Unclassified | 647 |
| 477 | Ga0157380_12408596 | 3300014326 | Unclassified | 592 |
| 478 | Ga0157377_10006420 | 3300014745 | Bacteria | 5610 |
| 479 | Ga0157377_10011698 | 3300014745 | Bacteria | 4388 |
| 480 | Ga0157377_10568789 | 3300014745 | Bacteria | 803 |
| 481 | Ga0157377_10797289 | 3300014745 | Bacteria | 696 |
| 482 | Ga0157377_11124317 | 3300014745 | Bacteria | 603 |
| 483 | Ga0157377_11779637 | 3300014745 | Unclassified | 500 |
| 484 | Ga0157379_10001919 | 3300014968 | Bacteria | 17194 |
| 485 | Ga0157379_10056425 | 3300014968 | Unclassified | 3509 |
| 486 | Ga0157379_10194117 | 3300014968 | Bacteria | 1835 |
| 487 | Ga0157379_10207397 | 3300014968 | Bacteria | 1773 |
| 488 | Ga0157379_10250274 | 3300014968 | Bacteria | 1608 |
| 489 | Ga0157379_10376014 | 3300014968 | Bacteria | 1303 |
| 490 | Ga0157379_10539993 | 3300014968 | Bacteria | 1084 |
| 491 | Ga0157379_10693552 | 3300014968 | Bacteria | 955 |
| 492 | Ga0157379_10871290 | 3300014968 | Bacteria | 853 |
| 493 | Ga0157376_10030505 | 3300014969 | Bacteria | 4306 |
| 494 | Ga0157376_10031260 | 3300014969 | Bacteria | 4260 |
| 495 | Ga0157376_10032198 | 3300014969 | Unclassified | 4207 |
| 496 | Ga0157376_10107502 | 3300014969 | Bacteria | 2449 |
| 497 | Ga0157376_10310919 | 3300014969 | Bacteria | 1495 |
| 498 | Ga0157376_10975493 | 3300014969 | Bacteria | 869 |
| 499 | Ga0163161_10013980 | 3300017792 | Bacteria | 5589 |
| 500 | Ga0163161_10024475 | 3300017792 | Bacteria | 4265 |
| 501 | Ga0163161_10074190 | 3300017792 | Bacteria | 2494 |
| 502 | Ga0163161_10075954 | 3300017792 | Unclassified | 2466 |
| 503 | Ga0163161_10238404 | 3300017792 | Bacteria | 1414 |
| 504 | Ga0163161_10241469 | 3300017792 | Unclassified | 1405 |
| 505 | Ga0163161_10374205 | 3300017792 | Bacteria | 1137 |
| 506 | Ga0163161_10416436 | 3300017792 | Unclassified | 1080 |
| 507 | Ga0163161_11308036 | 3300017792 | Unclassified | 630 |
| 508 | Ga0163161_11936812 | 3300017792 | Bacteria | 524 |
| 509 | Ga0228598_1096405 | 3300024227 | Unclassified | 596 |
| 510 | Ga0207666_1000715 | 3300025271 | Bacteria | 3977 |
| 511 | Ga0207666_1025337 | 3300025271 | Bacteria | 889 |
| 512 | Ga0207673_1000739 | 3300025290 | Bacteria | 3510 |
| 513 | Ga0207673_1002367 | 3300025290 | Bacteria | 2147 |
| 514 | Ga0207673_1023211 | 3300025290 | Unclassified | 844 |
| 515 | Ga0207697_10002692 | 3300025315 | Bacteria | 9081 |
| 516 | Ga0207697_10004121 | 3300025315 | Bacteria | 7017 |
| 517 | Ga0207697_10178171 | 3300025315 | Unclassified | 931 |
| 518 | Ga0207656_10088658 | 3300025321 | Bacteria | 1401 |
| 519 | Ga0207653_10442742 | 3300025885 | Unclassified | 510 |
| 520 | Ga0207682_10036406 | 3300025893 | Unclassified | 1991 |
| 521 | Ga0207682_10568424 | 3300025893 | Bacteria | 535 |
| 522 | Ga0207692_10609112 | 3300025898 | Unclassified | 703 |
| 523 | Ga0207642_10036727 | 3300025899 | Unclassified | 2105 |
| 524 | Ga0207642_10347440 | 3300025899 | Bacteria | 874 |
| 525 | Ga0207642_10619789 | 3300025899 | Unclassified | 675 |
| 526 | Ga0207710_10004123 | 3300025900 | Bacteria | 6381 |
| 527 | Ga0207710_10482424 | 3300025900 | Bacteria | 642 |
| 528 | Ga0207688_10088285 | 3300025901 | Bacteria | 1778 |
| 529 | Ga0207688_10116765 | 3300025901 | Unclassified | 1554 |
| 530 | Ga0207680_10008325 | 3300025903 | Bacteria | 5082 |
| 531 | Ga0207680_10030765 | 3300025903 | Bacteria | 3033 |
| 532 | Ga0207680_10448836 | 3300025903 | Unclassified | 915 |
| 533 | Ga0207647_10010327 | 3300025904 | Bacteria | 6594 |
| 534 | Ga0207685_10085696 | 3300025905 | Bacteria | 1315 |
| 535 | Ga0207685_10146251 | 3300025905 | Bacteria | 1065 |
| 536 | Ga0207699_10527715 | 3300025906 | Unclassified | 854 |
| 537 | Ga0207699_10650600 | 3300025906 | Bacteria | 770 |
| 538 | Ga0207645_10025077 | 3300025907 | Bacteria | 3861 |
| 539 | Ga0207645_10115682 | 3300025907 | Unclassified | 1739 |
| 540 | Ga0207645_10433101 | 3300025907 | Bacteria | 887 |
| 541 | Ga0207645_10901081 | 3300025907 | Unclassified | 601 |
| 542 | Ga0207643_10011654 | 3300025908 | Bacteria | 4748 |
| 543 | Ga0207643_10143758 | 3300025908 | Bacteria | 1426 |
| 544 | Ga0207643_10219908 | 3300025908 | Bacteria | 1162 |
| 545 | Ga0207643_10342824 | 3300025908 | Bacteria | 937 |
| 546 | Ga0207684_10024515 | 3300025910 | Bacteria | 5142 |
| 547 | Ga0207684_10060512 | 3300025910 | Bacteria | 3216 |
| 548 | Ga0207684_10951340 | 3300025910 | Unclassified | 720 |
| 549 | Ga0207654_10203907 | 3300025911 | Unclassified | 1304 |
| 550 | Ga0207707_10375910 | 3300025912 | Unclassified | 1222 |
| 551 | Ga0207695_10915386 | 3300025913 | Unclassified | 756 |
| 552 | Ga0207693_10085755 | 3300025915 | Bacteria | 2467 |
| 553 | Ga0207693_10117940 | 3300025915 | Bacteria | 2084 |
| 554 | Ga0207693_10252928 | 3300025915 | Bacteria | 1382 |
| 555 | Ga0207693_10438766 | 3300025915 | Unclassified | 1021 |
| 556 | Ga0207663_10137944 | 3300025916 | Bacteria | 1695 |
| 557 | Ga0207660_10313238 | 3300025917 | Bacteria | 1252 |
| 558 | Ga0207662_10085817 | 3300025918 | Unclassified | 1928 |
| 559 | Ga0207662_10329974 | 3300025918 | Bacteria | 1020 |
| 560 | Ga0207662_10922014 | 3300025918 | Bacteria | 619 |
| 561 | Ga0207657_10250225 | 3300025919 | Unclassified | 1413 |
| 562 | Ga0207657_10252053 | 3300025919 | Bacteria | 1407 |
| 563 | Ga0207649_10256805 | 3300025920 | Bacteria | 1261 |
| 564 | Ga0207649_10579797 | 3300025920 | Unclassified | 861 |
| 565 | Ga0207646_10516857 | 3300025922 | Unclassified | 1075 |
| 566 | Ga0207646_10518318 | 3300025922 | Unclassified | 1073 |
| 567 | Ga0207646_11307124 | 3300025922 | Unclassified | 633 |
| 568 | Ga0207681_10193786 | 3300025923 | Bacteria | 1556 |
| 569 | Ga0207681_10215360 | 3300025923 | Bacteria | 1483 |
| 570 | Ga0207681_10308411 | 3300025923 | Bacteria | 1255 |
| 571 | Ga0207681_10657051 | 3300025923 | Unclassified | 869 |
| 572 | Ga0207681_11197981 | 3300025923 | Bacteria | 638 |
| 573 | Ga0207681_11551219 | 3300025923 | Bacteria | 555 |
| 574 | Ga0207694_11402338 | 3300025924 | Unclassified | 590 |
| 575 | Ga0207650_10184144 | 3300025925 | Bacteria | 1666 |
| 576 | Ga0207650_10345283 | 3300025925 | Bacteria | 1223 |
| 577 | Ga0207650_10913570 | 3300025925 | Unclassified | 746 |
| 578 | Ga0207650_11775011 | 3300025925 | Unclassified | 522 |
| 579 | Ga0207659_10011372 | 3300025926 | Bacteria | 5620 |
| 580 | Ga0207659_10012514 | 3300025926 | Bacteria | 5401 |
| 581 | Ga0207659_10057444 | 3300025926 | Bacteria | 2790 |
| 582 | Ga0207659_10070737 | 3300025926 | Bacteria | 2545 |
| 583 | Ga0207659_10540667 | 3300025926 | Bacteria | 989 |
| 584 | Ga0207659_10614810 | 3300025926 | Bacteria | 927 |
| 585 | Ga0207659_10627284 | 3300025926 | Bacteria | 918 |
| 586 | Ga0207659_10980936 | 3300025926 | Bacteria | 727 |
| 587 | Ga0207659_11747836 | 3300025926 | Bacteria | 529 |
| 588 | Ga0207659_11831376 | 3300025926 | Unclassified | 515 |
| 589 | Ga0207687_10180202 | 3300025927 | Bacteria | 1636 |
| 590 | Ga0207687_10192239 | 3300025927 | Bacteria | 1589 |
| 591 | Ga0207687_10466611 | 3300025927 | Unclassified | 1049 |
| 592 | Ga0207700_10006919 | 3300025928 | Bacteria | 6898 |
| 593 | Ga0207700_10613716 | 3300025928 | Unclassified | 968 |
| 594 | Ga0207664_10287792 | 3300025929 | Unclassified | 1443 |
| 595 | Ga0207644_10110847 | 3300025931 | Unclassified | 2075 |
| 596 | Ga0207644_10242530 | 3300025931 | Bacteria | 1435 |
| 597 | Ga0207644_10580867 | 3300025931 | Unclassified | 929 |
| 598 | Ga0207644_10700569 | 3300025931 | Bacteria | 844 |
| 599 | Ga0207644_11533481 | 3300025931 | Unclassified | 559 |
| 600 | Ga0207644_11548735 | 3300025931 | Unclassified | 556 |
| 601 | Ga0207690_10008297 | 3300025932 | Bacteria | 6161 |
| 602 | Ga0207690_10068423 | 3300025932 | Unclassified | 2439 |
| 603 | Ga0207690_10499537 | 3300025932 | Bacteria | 984 |
| 604 | Ga0207706_10028458 | 3300025933 | Bacteria | 4991 |
| 605 | Ga0207706_10083063 | 3300025933 | Bacteria | 2815 |
| 606 | Ga0207706_10184713 | 3300025933 | Bacteria | 1831 |
| 607 | Ga0207706_10249722 | 3300025933 | Bacteria | 1550 |
| 608 | Ga0207686_10001103 | 3300025934 | Bacteria | 15716 |
| 609 | Ga0207686_10162306 | 3300025934 | Bacteria | 1567 |
| 610 | Ga0207686_10185653 | 3300025934 | Bacteria | 1478 |
| 611 | Ga0207686_10190282 | 3300025934 | Bacteria | 1462 |
| 612 | Ga0207686_10190905 | 3300025934 | Bacteria | 1460 |
| 613 | Ga0207709_11055995 | 3300025935 | Bacteria | 666 |
| 614 | Ga0207670_10022966 | 3300025936 | Unclassified | 3874 |
| 615 | Ga0207670_10063849 | 3300025936 | Bacteria | 2521 |
| 616 | Ga0207670_10067034 | 3300025936 | Bacteria | 2468 |
| 617 | Ga0207670_10247476 | 3300025936 | Bacteria | 1376 |
| 618 | Ga0207670_10422753 | 3300025936 | Unclassified | 1069 |
| 619 | Ga0207669_10074008 | 3300025937 | Bacteria | 2152 |
| 620 | Ga0207669_10208319 | 3300025937 | Bacteria | 1425 |
| 621 | Ga0207669_10319932 | 3300025937 | Bacteria | 1187 |
| 622 | Ga0207704_10042162 | 3300025938 | Bacteria | 2684 |
| 623 | Ga0207704_10195161 | 3300025938 | Unclassified | 1476 |
| 624 | Ga0207704_10705934 | 3300025938 | Unclassified | 835 |
| 625 | Ga0207704_11512574 | 3300025938 | Bacteria | 576 |
| 626 | Ga0207665_10071351 | 3300025939 | Bacteria | 2371 |
| 627 | Ga0207665_11084646 | 3300025939 | Unclassified | 638 |
| 628 | Ga0207691_10074762 | 3300025940 | Bacteria | 3056 |
| 629 | Ga0207691_10310870 | 3300025940 | Unclassified | 1352 |
| 630 | Ga0207691_10496346 | 3300025940 | Bacteria | 1037 |
| 631 | Ga0207691_10833958 | 3300025940 | Bacteria | 774 |
| 632 | Ga0207691_10836455 | 3300025940 | Unclassified | 772 |
| 633 | Ga0207711_10076271 | 3300025941 | Unclassified | 2919 |
| 634 | Ga0207711_10150947 | 3300025941 | Unclassified | 2096 |
| 635 | Ga0207711_10163161 | 3300025941 | Bacteria | 2018 |
| 636 | Ga0207711_10805190 | 3300025941 | Bacteria | 875 |
| 637 | Ga0207711_11589868 | 3300025941 | Bacteria | 597 |
| 638 | Ga0207689_10027393 | 3300025942 | Bacteria | 4771 |
| 639 | Ga0207689_10042683 | 3300025942 | Unclassified | 3750 |
| 640 | Ga0207689_10098593 | 3300025942 | Bacteria | 2401 |
| 641 | Ga0207689_10134284 | 3300025942 | Unclassified | 2037 |
| 642 | Ga0207689_10161280 | 3300025942 | Bacteria | 1847 |
| 643 | Ga0207689_10165628 | 3300025942 | Bacteria | 1821 |
| 644 | Ga0207689_10373079 | 3300025942 | Bacteria | 1187 |
| 645 | Ga0207689_10899130 | 3300025942 | Bacteria | 747 |
| 646 | Ga0207661_10156511 | 3300025944 | Unclassified | 1974 |
| 647 | Ga0207661_10190271 | 3300025944 | Bacteria | 1799 |
| 648 | Ga0207661_10535142 | 3300025944 | Bacteria | 1072 |
| 649 | Ga0207661_10675087 | 3300025944 | Unclassified | 950 |
| 650 | Ga0207661_11012931 | 3300025944 | Unclassified | 765 |
| 651 | Ga0207661_11530003 | 3300025944 | Bacteria | 611 |
| 652 | Ga0207679_10047842 | 3300025945 | Bacteria | 3110 |
| 653 | Ga0207679_10202869 | 3300025945 | Unclassified | 1658 |
| 654 | Ga0207679_11328131 | 3300025945 | Bacteria | 660 |
| 655 | Ga0207651_10009480 | 3300025960 | Bacteria | 5335 |
| 656 | Ga0207651_10466047 | 3300025960 | Bacteria | 1086 |
| 657 | Ga0207651_10493880 | 3300025960 | Bacteria | 1057 |
| 658 | Ga0207651_10518190 | 3300025960 | Bacteria | 1033 |
| 659 | Ga0207651_10872768 | 3300025960 | Bacteria | 800 |
| 660 | Ga0207651_11393742 | 3300025960 | Bacteria | 631 |
| 661 | Ga0207651_11954042 | 3300025960 | Unclassified | 527 |
| 662 | Ga0207712_10001769 | 3300025961 | Bacteria | 14411 |
| 663 | Ga0207712_10005517 | 3300025961 | Bacteria | 7980 |
| 664 | Ga0207712_10177843 | 3300025961 | Bacteria | 1669 |
| 665 | Ga0207712_10271583 | 3300025961 | Bacteria | 1380 |
| 666 | Ga0207712_10461791 | 3300025961 | Bacteria | 1079 |
| 667 | Ga0207712_10510537 | 3300025961 | Unclassified | 1029 |
| 668 | Ga0207712_10572285 | 3300025961 | Unclassified | 974 |
| 669 | Ga0207712_10697075 | 3300025961 | Unclassified | 886 |
| 670 | Ga0207712_11017040 | 3300025961 | Unclassified | 736 |
| 671 | Ga0207668_10028390 | 3300025972 | Bacteria | 3658 |
| 672 | Ga0207668_10432582 | 3300025972 | Bacteria | 1119 |
| 673 | Ga0207640_10274772 | 3300025981 | Bacteria | 1320 |
| 674 | Ga0207640_10732836 | 3300025981 | Unclassified | 851 |
| 675 | Ga0207658_10366369 | 3300025986 | Bacteria | 1259 |
| 676 | Ga0207658_10398943 | 3300025986 | Unclassified | 1208 |
| 677 | Ga0207658_10549066 | 3300025986 | Bacteria | 1034 |
| 678 | Ga0207658_10587619 | 3300025986 | Unclassified | 999 |
| 679 | Ga0207658_10761679 | 3300025986 | Unclassified | 877 |
| 680 | Ga0207658_10822787 | 3300025986 | Bacteria | 844 |
| 681 | Ga0207658_10892811 | 3300025986 | Bacteria | 809 |
| 682 | Ga0207658_11028263 | 3300025986 | Bacteria | 752 |
| 683 | Ga0207658_11051946 | 3300025986 | Bacteria | 743 |
| 684 | Ga0207658_11253312 | 3300025986 | Bacteria | 678 |
| 685 | Ga0207658_11926487 | 3300025986 | Unclassified | 538 |
| 686 | Ga0207677_10032530 | 3300026023 | Bacteria | 3354 |
| 687 | Ga0207677_10098632 | 3300026023 | Bacteria | 2144 |
| 688 | Ga0207677_10109412 | 3300026023 | Bacteria | 2054 |
| 689 | Ga0207677_10573906 | 3300026023 | Unclassified | 986 |
| 690 | Ga0207677_10792031 | 3300026023 | Unclassified | 848 |
| 691 | Ga0207677_10826328 | 3300026023 | Bacteria | 831 |
| 692 | Ga0207677_11008155 | 3300026023 | Bacteria | 755 |
| 693 | Ga0207677_11019510 | 3300026023 | Bacteria | 751 |
| 694 | Ga0207677_12199154 | 3300026023 | Bacteria | 513 |
| 695 | Ga0207703_10021697 | 3300026035 | Bacteria | 5027 |
| 696 | Ga0207703_10033048 | 3300026035 | Unclassified | 4099 |
| 697 | Ga0207703_10149126 | 3300026035 | Unclassified | 2037 |
| 698 | Ga0207703_10169522 | 3300026035 | Bacteria | 1919 |
| 699 | Ga0207703_10488668 | 3300026035 | Bacteria | 1154 |
| 700 | Ga0207703_11262210 | 3300026035 | Bacteria | 710 |
| 701 | Ga0207703_12425253 | 3300026035 | Bacteria | 500 |
| 702 | Ga0207639_10716935 | 3300026041 | Bacteria | 929 |
| 703 | Ga0207639_11459794 | 3300026041 | Unclassified | 642 |
| 704 | Ga0207639_12096833 | 3300026041 | Bacteria | 527 |
| 705 | Ga0207678_10697596 | 3300026067 | Bacteria | 893 |
| 706 | Ga0207708_10007764 | 3300026075 | Bacteria | 7944 |
| 707 | Ga0207708_10016661 | 3300026075 | Bacteria | 5530 |
| 708 | Ga0207708_11063741 | 3300026075 | Bacteria | 704 |
| 709 | Ga0207708_11325395 | 3300026075 | Bacteria | 631 |
| 710 | Ga0207702_10943007 | 3300026078 | Bacteria | 856 |
| 711 | Ga0207641_10001178 | 3300026088 | Bacteria | 26272 |
| 712 | Ga0207641_10042379 | 3300026088 | Bacteria | 3818 |
| 713 | Ga0207641_10064617 | 3300026088 | Bacteria | 3128 |
| 714 | Ga0207641_10118993 | 3300026088 | Bacteria | 2354 |
| 715 | Ga0207641_10180361 | 3300026088 | Bacteria | 1934 |
| 716 | Ga0207641_10557529 | 3300026088 | Bacteria | 1118 |
| 717 | Ga0207641_10705323 | 3300026088 | Bacteria | 994 |
| 718 | Ga0207641_12368216 | 3300026088 | Bacteria | 530 |
| 719 | Ga0207648_10084345 | 3300026089 | Bacteria | 2771 |
| 720 | Ga0207648_10581107 | 3300026089 | Bacteria | 1031 |
| 721 | Ga0207648_10673812 | 3300026089 | Bacteria | 957 |
| 722 | Ga0207648_11143562 | 3300026089 | Unclassified | 730 |
| 723 | Ga0207648_11791712 | 3300026089 | Bacteria | 576 |
| 724 | Ga0207648_11867968 | 3300026089 | Unclassified | 562 |
| 725 | Ga0207648_12207695 | 3300026089 | Unclassified | 511 |
| 726 | Ga0207676_10085000 | 3300026095 | Unclassified | 2581 |
| 727 | Ga0207676_10288585 | 3300026095 | Bacteria | 1493 |
| 728 | Ga0207676_10964595 | 3300026095 | Bacteria | 839 |
| 729 | Ga0207676_11007469 | 3300026095 | Bacteria | 821 |
| 730 | Ga0207676_11250766 | 3300026095 | Bacteria | 736 |
| 731 | Ga0207676_11287490 | 3300026095 | Bacteria | 726 |
| 732 | Ga0207676_12052773 | 3300026095 | Bacteria | 570 |
| 733 | Ga0207676_12551333 | 3300026095 | Unclassified | 507 |
| 734 | Ga0207674_10110994 | 3300026116 | Bacteria | 2717 |
| 735 | Ga0207674_10557199 | 3300026116 | Bacteria | 1107 |
| 736 | Ga0207674_10624036 | 3300026116 | Bacteria | 1041 |
| 737 | Ga0207674_10780763 | 3300026116 | Bacteria | 922 |
| 738 | Ga0207675_100005780 | 3300026118 | Bacteria | 11828 |
| 739 | Ga0207675_100035164 | 3300026118 | Bacteria | 4673 |
| 740 | Ga0207675_100089964 | 3300026118 | Bacteria | 2885 |
| 741 | Ga0207675_100674671 | 3300026118 | Bacteria | 1041 |
| 742 | Ga0207675_100848968 | 3300026118 | Bacteria | 928 |
| 743 | Ga0207683_10028142 | 3300026121 | Bacteria | 4859 |
| 744 | Ga0207683_10104577 | 3300026121 | Bacteria | 2530 |
| 745 | Ga0207683_11165564 | 3300026121 | Bacteria | 714 |
| 746 | Ga0207698_10063362 | 3300026142 | Bacteria | 2893 |
| 747 | Ga0207698_10887576 | 3300026142 | Bacteria | 898 |
| 748 | Ga0207698_11304935 | 3300026142 | Bacteria | 740 |
| 749 | Ga0207698_12136041 | 3300026142 | Bacteria | 573 |
| 750 | Ga0209984_1007833 | 3300027424 | Unclassified | 1333 |
| 751 | Ga0209995_1090494 | 3300027471 | Unclassified | 526 |
| 752 | Ga0209999_1124097 | 3300027543 | Unclassified | 506 |
| 753 | Ga0209970_1113803 | 3300027614 | Unclassified | 521 |
| 754 | Ga0209983_1027992 | 3300027665 | Unclassified | 1194 |
| 755 | Ga0207428_10029239 | 3300027907 | Bacteria | 4570 |
| 756 | Ga0207428_10371430 | 3300027907 | Bacteria | 1050 |
| 757 | Ga0265357_1014890 | 3300028023 | Bacteria | 819 |
| 758 | Ga0268266_10159199 | 3300028379 | Bacteria | 2041 |
| 759 | Ga0268266_10325802 | 3300028379 | Unclassified | 1439 |
| 760 | Ga0268266_10915381 | 3300028379 | Bacteria | 848 |
| 761 | Ga0268265_10460408 | 3300028380 | Bacteria | 1190 |
| 762 | Ga0268265_10554601 | 3300028380 | Unclassified | 1091 |
| 763 | Ga0268265_10569599 | 3300028380 | Bacteria | 1078 |
| 764 | Ga0268265_10639664 | 3300028380 | Bacteria | 1021 |
| 765 | Ga0268265_11421533 | 3300028380 | Bacteria | 696 |
| 766 | Ga0268265_11438502 | 3300028380 | Bacteria | 692 |
| 767 | Ga0268265_11742443 | 3300028380 | Bacteria | 629 |
| 768 | Ga0268264_10008851 | 3300028381 | Bacteria | 8344 |
| 769 | Ga0268264_10029385 | 3300028381 | Bacteria | 4501 |
| 770 | Ga0268264_10171372 | 3300028381 | Unclassified | 1963 |
| 771 | Ga0307407_11062060 | 3300031903 | Bacteria | 628 |
| 772 | Ga0307414_10201934 | 3300032004 | Bacteria | 1618 |
| 773 | Ga0307414_11781737 | 3300032004 | Bacteria | 574 |
| 774 | Ga0373934_0069289 | 3300035086 | Bacteria | 1410 |
| 775 | Ga0373936_0615141 | 3300035113 | Unclassified | 511 |
| 776 | Ga0373954_0234421 | 3300035118 | Unclassified | 903 |
| 777 | Ga0373943_0063641 | 3300035170 | Bacteria | 1850 |
| 778 | Ga0373943_0072378 | 3300035170 | Bacteria | 1748 |
| 779 | Ga0373943_0092836 | 3300035170 | Bacteria | 1566 |
| 780 | Ga0373943_0959196 | 3300035170 | Bacteria | 512 |
| 781 | Ga0373955_0074924 | 3300035172 | Bacteria | 1901 |
| 782 | Ga0373955_0350002 | 3300035172 | Bacteria | 895 |
| 783 | Ga0373955_0365183 | 3300035172 | Unclassified | 875 |
| 784 | Ga0373955_0944158 | 3300035172 | Unclassified | 531 |
| 785 | Ga0373935_0057912 | 3300035692 | Bacteria | 2473 |
| 786 | Ga0373935_0156384 | 3300035692 | Bacteria | 1551 |
| 787 | Ga0373927_1018292 | 3300035695 | Bacteria | 546 |
| 788 | Ga0373947_0132604 | 3300035725 | Unclassified | 1592 |
| 789 | Ga0373947_1177026 | 3300035725 | Unclassified | 522 |
| 790 | Ga0373947_1252385 | 3300035725 | Unclassified | 505 |
| 791 | Ga0373937_0041534 | 3300036401 | Bacteria | 4195 |
| 792 | Ga0373937_0836942 | 3300036401 | Bacteria | 868 |
| 793 | Ga0373937_1040406 | 3300036401 | Unclassified | 767 |
| 794 | Ga0373937_1047167 | 3300036401 | Bacteria | 765 |
| 795 | Ga0373925_0212557 | 3300037068 | Unclassified | 1541 |
| 796 | Ga0373925_0319459 | 3300037068 | Bacteria | 1256 |
| 797 | Ga0373925_1388132 | 3300037068 | Bacteria | 576 |
| 798 | Ga0451804_0689320 | 3300041463 | Unclassified | 620 |
| 799 | Ga0451839_1424319 | 3300041496 | Unclassified | 641 |
| 800 | Ga0451841_0197885 | 3300041498 | Unclassified | 594 |
| 801 | Ga0451853_1763246 | 3300041512 | Bacteria | 925 |
| 802 | Ga0450914_057887 | 3300042118 | Unclassified | 521 |
| 803 | Ga0450923_029410 | 3300042125 | Bacteria | 1113 |
| 804 | Ga0450918_128684 | 3300042531 | Unclassified | 510 |
| 805 | Ga0495592_0140469 | 3300046454 | Bacteria | 1681 |
| 806 | Ga0495592_0392186 | 3300046454 | Unclassified | 881 |
| 807 | Ga0495603_0350726 | 3300046455 | Bacteria | 847 |
| 808 | Ga0495641_0197787 | 3300046461 | Unclassified | 901 |
| 809 | Ga0495651_0404465 | 3300046462 | Unclassified | 891 |
| 810 | Ga0495653_0183664 | 3300046463 | Bacteria | 1433 |
| 811 | Ga0495582_0411887 | 3300046473 | Unclassified | 780 |
| 812 | Ga0495582_0855955 | 3300046473 | Bacteria | 526 |
| 813 | Ga0495639_0344344 | 3300046475 | Unclassified | 748 |
| 814 | Ga0495584_0203350 | 3300046491 | Bacteria | 1007 |
| 815 | Ga0495594_0141137 | 3300046499 | Bacteria | 1367 |
| 816 | Ga0495594_0325255 | 3300046499 | Bacteria | 876 |
| 817 | Ga0495608_0242270 | 3300046511 | Bacteria | 1126 |
| 818 | Ga0495618_0238461 | 3300046514 | Bacteria | 1144 |
| 819 | Ga0495628_0154686 | 3300046516 | Bacteria | 1745 |
| 820 | Ga0495630_0169240 | 3300046517 | Bacteria | 1664 |
| 821 | Ga0495630_1086488 | 3300046517 | Unclassified | 607 |
| 822 | Ga0495644_0353461 | 3300046523 | Unclassified | 579 |
| 823 | Ga0495665_0168769 | 3300046531 | Bacteria | 1140 |
| 824 | Ga0495640_0432262 | 3300046533 | Unclassified | 806 |
| 825 | Ga0495586_0280821 | 3300046535 | Unclassified | 953 |
| 826 | Ga0495587_0123859 | 3300046536 | Bacteria | 1480 |
| 827 | Ga0495587_0230747 | 3300046536 | Bacteria | 1043 |
| 828 | Ga0495598_0213582 | 3300046537 | Bacteria | 702 |
| 829 | Ga0495621_0129545 | 3300046539 | Bacteria | 981 |
| 830 | Ga0495621_0374676 | 3300046539 | Bacteria | 600 |
| 831 | Ga0495645_0267171 | 3300046543 | Bacteria | 1130 |
| 832 | Ga0495645_0346084 | 3300046543 | Unclassified | 959 |
| 833 | Ga0495622_0204192 | 3300046557 | Bacteria | 880 |
| 834 | Ga0495634_0082340 | 3300046642 | Unclassified | 2103 |
| 835 | Ga0495635_0444691 | 3300046663 | Unclassified | 857 |
| 836 | Ga0495657_0308437 | 3300046675 | Unclassified | 943 |
| 837 | Ga0495657_0323618 | 3300046675 | Bacteria | 916 |
| 838 | Ga0495599_0677247 | 3300046678 | Bacteria | 596 |
| 839 | Ga0495647_0388295 | 3300046681 | Bacteria | 640 |
| 840 | Ga0495658_0186683 | 3300046683 | Unclassified | 1288 |
| 841 | Ga0495658_0533827 | 3300046683 | Unclassified | 751 |
| 842 | Ga0495658_0551868 | 3300046683 | Unclassified | 738 |
| 843 | Ga0495613_0642505 | 3300046689 | Bacteria | 703 |
| 844 | Ga0495613_0886732 | 3300046689 | Unclassified | 578 |
| 845 | Ga0495600_0304941 | 3300046809 | Bacteria | 1004 |
| 846 | Ga0495581_0201909 | 3300047315 | Bacteria | 1163 |
| 847 | Ga0495581_0222866 | 3300047315 | Unclassified | 1103 |
| 848 | Ga0495676_0128486 | 3300047321 | Bacteria | 1833 |
| 849 | Ga0495676_0501969 | 3300047321 | Unclassified | 796 |
| 850 | Ga0495680_0140445 | 3300047322 | Bacteria | 1768 |
| 851 | Ga0495680_0303795 | 3300047322 | Bacteria | 1120 |
| 852 | Ga0495680_0304210 | 3300047322 | Bacteria | 1119 |
| 853 | Ga0495675_0848891 | 3300047444 | Bacteria | 503 |
| 854 | Ga0495684_0013026 | 3300047471 | Bacteria | 6419 |
| 855 | Ga0495684_0058302 | 3300047471 | Bacteria | 2942 |
| 856 | Ga0496100_0201216 | 3300048903 | Bacteria | 1452 |
| 857 | Ga0496100_0306889 | 3300048903 | Bacteria | 1189 |
| 858 | Ga0496101_0412884 | 3300048904 | Bacteria | 1064 |
| 859 | Ga0496101_0454095 | 3300048904 | Bacteria | 1011 |
| 860 | Ga0496101_0558749 | 3300048904 | Bacteria | 905 |
| 861 | Ga0496101_0977387 | 3300048904 | Unclassified | 666 |
| 862 | Ga0496102_0127369 | 3300048905 | Unclassified | 2381 |
| 863 | Ga0496104_0106525 | 3300048907 | Unclassified | 2687 |
| 864 | Ga0496104_0371428 | 3300048907 | Unclassified | 1343 |
| 865 | Ga0496105_0345942 | 3300048908 | Unclassified | 1188 |
| 866 | Ga0496105_0369681 | 3300048908 | Bacteria | 1143 |
| 867 | Ga0496105_0705658 | 3300048908 | Bacteria | 774 |
| 868 | Ga0496105_0907349 | 3300048908 | Unclassified | 664 |
| 869 | Ga0496106_0328550 | 3300048909 | Bacteria | 1228 |
| 870 | Ga0496106_0334136 | 3300048909 | Bacteria | 1217 |
| 871 | Ga0496107_0487759 | 3300048910 | Unclassified | 914 |
| 872 | Ga0496107_0820721 | 3300048910 | Bacteria | 680 |
| 873 | Ga0496108_0116381 | 3300048911 | Bacteria | 2290 |
| 874 | Ga0496108_0221688 | 3300048911 | Bacteria | 1643 |
| 875 | Ga0496108_0884654 | 3300048911 | Bacteria | 767 |
| 876 | Ga0496108_0939949 | 3300048911 | Bacteria | 741 |
| 877 | Ga0496108_0962592 | 3300048911 | Unclassified | 730 |
| 878 | Ga0496109_0047500 | 3300048912 | Bacteria | 3904 |
| 879 | Ga0496109_0136217 | 3300048912 | Bacteria | 2295 |
| 880 | Ga0496109_0397979 | 3300048912 | Bacteria | 1301 |
| 881 | Ga0496110_0118806 | 3300048913 | Bacteria | 2381 |
| 882 | Ga0496110_0234915 | 3300048913 | Bacteria | 1668 |
| 883 | Ga0496111_0034461 | 3300048914 | Bacteria | 3615 |
| 884 | Ga0496111_0587104 | 3300048914 | Unclassified | 816 |
| 885 | Ga0496111_0701600 | 3300048914 | Unclassified | 736 |
| 886 | Ga0496112_0074701 | 3300048915 | Bacteria | 3352 |
| 887 | Ga0496113_0424646 | 3300048916 | Bacteria | 1068 |
| 888 | Ga0496113_1456873 | 3300048916 | Unclassified | 529 |
| 889 | Ga0496114_0120850 | 3300048917 | Bacteria | 2253 |
| 890 | Ga0496114_0179867 | 3300048917 | Bacteria | 1846 |
| 891 | Ga0496115_0053864 | 3300048918 | Bacteria | 3230 |
| 892 | Ga0496115_0526153 | 3300048918 | Unclassified | 948 |
| 893 | Ga0501037_0345535 | 3300049573 | Bacteria | 1027 |
| 894 | Ga0501038_0045517 | 3300049574 | Bacteria | 3810 |
| 895 | Ga0501040_0162592 | 3300049576 | Bacteria | 1578 |
| 896 | Ga0501042_0065024 | 3300049578 | Bacteria | 2607 |
| 897 | Ga0501046_0810795 | 3300049580 | Bacteria | 656 |
| 898 | Ga0501048_0986191 | 3300049582 | Unclassified | 606 |
| 899 | Ga0501067_0848411 | 3300049583 | Unclassified | 515 |
| 900 | Ga0501071_0044864 | 3300049587 | Bacteria | 3172 |
| 901 | Ga0501071_0480237 | 3300049587 | Bacteria | 952 |
| 902 | Ga0501073_1143745 | 3300049589 | Unclassified | 535 |
| 903 | Ga0501075_0014831 | 3300049591 | Bacteria | 5589 |
| 904 | Ga0501077_0086589 | 3300049593 | Bacteria | 1986 |
| 905 | Ga0501217_108043 | 3300049661 | Bacteria | 797 |
| 906 | Ga0501079_0106610 | 3300049741 | Bacteria | 2174 |
| 907 | Ga0501081_0097460 | 3300049743 | Bacteria | 2075 |
| 908 | Ga0501035_0140157 | 3300049822 | Bacteria | 2103 |
| 909 | Ga0501044_1243431 | 3300049823 | Bacteria | 612 |
| 910 | Ga0501045_0051656 | 3300049824 | Bacteria | 3000 |
| 911 | Ga0501045_1262318 | 3300049824 | Unclassified | 538 |
| 912 | nmdc:mga0yw44_561388_c1 | 3300050492 | Bacteria | 775 |
| 913 | nmdc:mga05p37_100162_c1 | 3300050507 | Unclassified | 3568 |
| 914 | nmdc:mga09592_12308_c1 | 3300050508 | Bacteria | 6966 |
| 915 | nmdc:mga09592_507909_c1 | 3300050508 | Unclassified | 1037 |
| 916 | nmdc:mga0qj67_1715_c1 | 3300050509 | Bacteria | 15457 |
| 917 | nmdc:mga06r32_678213_c1 | 3300050510 | Unclassified | 997 |
| 918 | nmdc:mga08y16_122808_c1 | 3300050511 | Bacteria | 2702 |
| 919 | nmdc:mga08y16_158726_c1 | 3300050511 | Bacteria | 2350 |
| 920 | nmdc:mga08y16_746604_c1 | 3300050511 | Bacteria | 975 |
| 921 | nmdc:mga0n895_1257704_c1 | 3300050512 | Bacteria | 712 |
| 922 | nmdc:mga0n895_816094_c1 | 3300050512 | Unclassified | 922 |
| 923 | nmdc:mga0a205_1572920_c1 | 3300050515 | Unclassified | 506 |
| 924 | nmdc:mga0a205_324472_c1 | 3300050515 | Unclassified | 1410 |
| 925 | Ga0495612_0396650 | 3300053078 | Unclassified | 627 |
| 926 | Ga0495595_0435417 | 3300053084 | Unclassified | 666 |
| 927 | Ga0495619_0203377 | 3300053085 | Bacteria | 1371 |
| 928 | Ga0495619_0294475 | 3300053085 | Bacteria | 1124 |
| 929 | Ga0500642_0187130 | 3300053130 | Bacteria | 967 |
| 930 | Ga0501084_0069969 | 3300054114 | Bacteria | 2938 |
| 931 | Ga0501082_0191871 | 3300060353 | Bacteria | 1777 |
| 932 | Ga0530510_0033729 | 3300061734 | Bacteria | 3685 |
| 933 | Ga0111539_10566789 | |||
| 934 | JGI24032J14994_102648 | |||
| 935 | JGI24743J22301_10016904 | |||
| 936 | JGI24035J26624_1000658 | |||
| 937 | JGI24035J26624_1002800 | |||
| 938 | Ga0065704_10819266 | |||
| 939 | Ga0065704_10858249 | |||
| 940 | Ga0065712_10004044 | |||
| 941 | Ga0065712_10134478 | |||
| 942 | Ga0065712_10135780 | |||
| 943 | Ga0065712_10160456 | |||
| 944 | Ga0065715_10005592 | |||
| 945 | Ga0065715_10012414 | |||
| 946 | Ga0065715_10025499 | |||
| 947 | Ga0065715_10126105 | |||
| 948 | Ga0065715_10261916 | |||
| 949 | Ga0065715_10401046 | |||
| 950 | Ga0065715_10436411 | |||
| 951 | Ga0065715_10489311 | |||
| 952 | Ga0065715_10508383 | |||
| 953 | Ga0065715_10579753 | |||
| 954 | Ga0065707_10223661 | |||
| 955 | Ga0065707_10421418 | |||
| 956 | Ga0065707_10833487 | |||
| 957 | Ga0070658_10931653 | |||
| 958 | Ga0070676_10014778 | |||
| 959 | Ga0070676_10081747 | |||
| 960 | Ga0070676_10088411 | |||
| 961 | Ga0070683_100011499 | |||
| 962 | Ga0070683_100030484 | |||
| 963 | Ga0070683_100102862 | |||
| 964 | Ga0070683_101046186 | |||
| 965 | Ga0070683_101127421 | |||
| 966 | Ga0070683_101235137 | |||
| 967 | Ga0070683_102033275 | |||
| 968 | Ga0070683_102060023 | |||
| 969 | Ga0070690_100019296 | |||
| 970 | Ga0070690_100107308 | |||
| 971 | Ga0070690_100211894 | |||
| 972 | Ga0070690_100232803 | |||
| 973 | Ga0070690_100280222 | |||
| 974 | Ga0070690_100419300 | |||
| 975 | Ga0070690_100504118 | |||
| 976 | Ga0070670_100038007 | |||
| 977 | Ga0070670_100081973 | |||
| 978 | Ga0070670_100394336 | |||
| 979 | Ga0070670_100452960 | |||
| 980 | Ga0070670_101461510 | |||
| 981 | Ga0070677_10033624 | |||
| 982 | Ga0070677_10107986 | |||
| 983 | Ga0070677_10626940 | |||
| 984 | Ga0068869_100231246 | |||
| 985 | Ga0068869_100250849 | |||
| 986 | Ga0068869_100402758 | |||
| 987 | Ga0068869_100605785 | |||
| 988 | Ga0068869_101287444 | |||
| 989 | Ga0070666_10005870 | |||
| 990 | Ga0070666_10122890 | |||
| 991 | Ga0070666_10199184 | |||
| 992 | Ga0070666_10495535 | |||
| 993 | Ga0070682_100114350 | |||
| 994 | Ga0070682_100493615 | |||
| 995 | Ga0070682_101061604 | |||
| 996 | Ga0070682_101175427 | |||
| 997 | Ga0068868_100051035 | |||
| 998 | Ga0068868_100087147 | |||
| 999 | Ga0068868_100138969 | |||
| 1000 | Ga0068868_100182711 | |||
| 1001 | Ga0068868_100511545 | |||
| 1002 | Ga0068868_101228007 | |||
| 1003 | Ga0070660_100133096 | |||
| 1004 | Ga0070660_100207272 | |||
| 1005 | Ga0070660_100282199 | |||
| 1006 | Ga0070689_100004490 | |||
| 1007 | Ga0070689_100007248 | |||
| 1008 | Ga0070689_100202486 | |||
| 1009 | Ga0070689_100556346 | |||
| 1010 | Ga0070689_101578534 | |||
| 1011 | Ga0070687_100054195 | |||
| 1012 | Ga0070687_100130896 | |||
| 1013 | Ga0070687_100626316 | |||
| 1014 | Ga0070687_100794340 | |||
| 1015 | Ga0070687_100882200 | |||
| 1016 | Ga0070687_101273431 | |||
| 1017 | Ga0070687_101376043 | |||
| 1018 | Ga0070661_100300629 | |||
| 1019 | Ga0070661_100582524 | |||
| 1020 | Ga0070692_11350696 | |||
| 1021 | Ga0070668_100977910 | |||
| 1022 | Ga0070668_101539835 | |||
| 1023 | Ga0070668_101693665 | |||
| 1024 | Ga0070669_100016907 | |||
| 1025 | Ga0070669_100143892 | |||
| 1026 | Ga0070669_100372419 | |||
| 1027 | Ga0070669_100423998 | |||
| 1028 | Ga0070669_100613550 | |||
| 1029 | Ga0070669_100880120 | |||
| 1030 | Ga0070669_100936037 | |||
| 1031 | Ga0070675_100035982 | |||
| 1032 | Ga0070675_100063235 | |||
| 1033 | Ga0070675_100073569 | |||
| 1034 | Ga0070675_100096217 | |||
| 1035 | Ga0070675_100135537 | |||
| 1036 | Ga0070675_100185374 | |||
| 1037 | Ga0070675_100639262 | |||
| 1038 | Ga0070675_101111763 | |||
| 1039 | Ga0070675_101123899 | |||
| 1040 | Ga0070675_102084608 | |||
| 1041 | Ga0070675_102100260 | |||
| 1042 | Ga0070671_100184621 | |||
| 1043 | Ga0070671_100224034 | |||
| 1044 | Ga0070671_100274237 | |||
| 1045 | Ga0070671_100523033 | |||
| 1046 | Ga0070671_100692878 | |||
| 1047 | Ga0070671_100858391 | |||
| 1048 | Ga0070671_101660801 | |||
| 1049 | Ga0070671_102104101 | |||
| 1050 | Ga0070674_100238628 | |||
| 1051 | Ga0070673_100013118 | |||
| 1052 | Ga0070673_100058068 | |||
| 1053 | Ga0070673_100769427 | |||
| 1054 | Ga0070673_100852409 | |||
| 1055 | Ga0070673_100931571 | |||
| 1056 | Ga0070673_102346521 | |||
| 1057 | Ga0070688_100001199 | |||
| 1058 | Ga0070688_100065104 | |||
| 1059 | Ga0070688_100075550 | |||
| 1060 | Ga0070688_100174116 | |||
| 1061 | Ga0070688_100684792 | |||
| 1062 | Ga0070688_100966001 | |||
| 1063 | Ga0070688_101467681 | |||
| 1064 | Ga0070659_100002571 | |||
| 1065 | Ga0070659_100135247 | |||
| 1066 | Ga0070659_100658203 | |||
| 1067 | Ga0070659_101133665 | |||
| 1068 | Ga0070667_100018520 | |||
| 1069 | Ga0070667_100073067 | |||
| 1070 | Ga0070667_100085820 | |||
| 1071 | Ga0070667_100134228 | |||
| 1072 | Ga0070667_100477794 | |||
| 1073 | Ga0070667_100602263 | |||
| 1074 | Ga0070667_100978607 | |||
| 1075 | Ga0070667_101197752 | |||
| 1076 | Ga0070667_101247682 | |||
| 1077 | Ga0070667_101497583 | |||
| 1078 | Ga0070667_101499472 | |||
| 1079 | Ga0070709_10983628 | |||
| 1080 | Ga0070714_100093624 | |||
| 1081 | Ga0070713_100286211 | |||
| 1082 | Ga0070701_10293146 | |||
| 1083 | Ga0070711_100125787 | |||
| 1084 | Ga0070711_100472312 | |||
| 1085 | Ga0070711_100757359 | |||
| 1086 | Ga0070711_101256740 | |||
| 1087 | Ga0070711_101713438 | |||
| 1088 | Ga0070705_100179897 | |||
| 1089 | Ga0070705_100506255 | |||
| 1090 | Ga0070705_101314929 | |||
| 1091 | Ga0070700_100010242 | |||
| 1092 | Ga0070700_100635194 | |||
| 1093 | Ga0070700_101580214 | |||
| 1094 | Ga0070694_100140641 | |||
| 1095 | Ga0070694_100942734 | |||
| 1096 | Ga0070694_101822670 | |||
| 1097 | Ga0070708_100025891 | |||
| 1098 | Ga0070708_100313032 | |||
| 1099 | Ga0070708_101706955 | |||
| 1100 | Ga0070663_100009998 | |||
| 1101 | Ga0070663_101287521 | |||
| 1102 | Ga0070678_100018086 | |||
| 1103 | Ga0070678_100213280 | |||
| 1104 | Ga0070678_100308272 | |||
| 1105 | Ga0070662_100073930 | |||
| 1106 | Ga0070662_100089622 | |||
| 1107 | Ga0070662_100238277 | |||
| 1108 | Ga0070662_100266203 | |||
| 1109 | Ga0070662_100370566 | |||
| 1110 | Ga0070662_100691071 | |||
| 1111 | Ga0070662_101004914 | |||
| 1112 | Ga0070681_10224369 | |||
| 1113 | Ga0068867_100084519 | |||
| 1114 | Ga0068867_100214705 | |||
| 1115 | Ga0068867_100390588 | |||
| 1116 | Ga0068867_100398616 | |||
| 1117 | Ga0068867_100414753 | |||
| 1118 | Ga0068867_100605081 | |||
| 1119 | Ga0068867_100900899 | |||
| 1120 | Ga0068867_101132396 | |||
| 1121 | Ga0068867_101245693 | |||
| 1122 | Ga0068867_101744696 | |||
| 1123 | Ga0070685_10006366 | |||
| 1124 | Ga0070685_10007687 | |||
| 1125 | Ga0070685_10017516 | |||
| 1126 | Ga0070685_10066526 | |||
| 1127 | Ga0070685_10887625 | |||
| 1128 | Ga0070706_100023029 | |||
| 1129 | Ga0070706_100023191 | |||
| 1130 | Ga0070706_100726358 | |||
| 1131 | Ga0070707_100147648 | |||
| 1132 | Ga0070707_101313212 | |||
| 1133 | Ga0070707_101585781 | |||
| 1134 | Ga0070698_100526981 | |||
| 1135 | Ga0070698_101452951 | |||
| 1136 | Ga0070699_101294108 | |||
| 1137 | Ga0070684_100006906 | |||
| 1138 | Ga0070684_100140455 | |||
| 1139 | Ga0070697_100001381 | |||
| 1140 | Ga0070697_100618380 | |||
| 1141 | Ga0070697_101380454 | |||
| 1142 | Ga0070697_101461731 | |||
| 1143 | Ga0070697_101938381 | |||
| 1144 | Ga0068853_100807417 | |||
| 1145 | Ga0068853_101199714 | |||
| 1146 | Ga0068853_101424043 | |||
| 1147 | Ga0070672_100010949 | |||
| 1148 | Ga0070672_100040024 | |||
| 1149 | Ga0070672_100304207 | |||
| 1150 | Ga0070672_100750073 | |||
| 1151 | Ga0070672_101087962 | |||
| 1152 | Ga0070672_101344041 | |||
| 1153 | Ga0070672_101733346 | |||
| 1154 | Ga0070672_102106638 | |||
| 1155 | Ga0070686_100024836 | |||
| 1156 | Ga0070686_100534364 | |||
| 1157 | Ga0070686_100664187 | |||
| 1158 | Ga0070686_100680700 | |||
| 1159 | Ga0070686_101303351 | |||
| 1160 | Ga0070686_101319934 | |||
| 1161 | Ga0070695_100689768 | |||
| 1162 | Ga0070693_100512421 | |||
| 1163 | Ga0070693_101082875 | |||
| 1164 | Ga0070665_100077406 | |||
| 1165 | Ga0070665_100131038 | |||
| 1166 | Ga0070665_100619989 | |||
| 1167 | Ga0070665_101022072 | |||
| 1168 | Ga0070704_100022921 | |||
| 1169 | Ga0070704_100548442 | |||
| 1170 | Ga0070704_101521603 | |||
| 1171 | Ga0068855_100624428 | |||
| 1172 | Ga0070664_101577321 | |||
| 1173 | Ga0068857_100119514 | |||
| 1174 | Ga0068854_100072812 | |||
| 1175 | Ga0068854_100551022 | |||
| 1176 | Ga0068854_101275231 | |||
| 1177 | Ga0068856_102269539 | |||
| 1178 | Ga0070702_100021227 | |||
| 1179 | Ga0070702_100409679 | |||
| 1180 | Ga0070702_100465178 | |||
| 1181 | Ga0070702_101250219 | |||
| 1182 | Ga0070702_101527134 | |||
| 1183 | Ga0070702_101578358 | |||
| 1184 | Ga0068852_100064621 | |||
| 1185 | Ga0068852_100290946 | |||
| 1186 | Ga0068852_101264597 | |||
| 1187 | Ga0068859_100035531 | |||
| 1188 | Ga0068859_100093098 | |||
| 1189 | Ga0068859_100304491 | |||
| 1190 | Ga0068859_100393877 | |||
| 1191 | Ga0068859_100430290 | |||
| 1192 | Ga0068859_100565722 | |||
| 1193 | Ga0068859_100847732 | |||
| 1194 | Ga0068859_102400754 | |||
| 1195 | Ga0068859_102919102 | |||
| 1196 | Ga0068864_100050010 | |||
| 1197 | Ga0068864_100069013 | |||
| 1198 | Ga0068864_100268308 | |||
| 1199 | Ga0068864_100583176 | |||
| 1200 | Ga0068864_100750689 | |||
| 1201 | Ga0068864_100933884 | |||
| 1202 | Ga0068864_101608758 | |||
| 1203 | Ga0068864_102443818 | |||
| 1204 | Ga0068864_102652362 | |||
| 1205 | Ga0068866_10048868 | |||
| 1206 | Ga0068866_10300244 | |||
| 1207 | Ga0068866_10541540 | |||
| 1208 | Ga0068866_11214608 | |||
| 1209 | Ga0068861_100040137 | |||
| 1210 | Ga0068861_100079226 | |||
| 1211 | Ga0068861_100315563 | |||
| 1212 | Ga0068851_10222553 | |||
| 1213 | Ga0068870_11216641 | |||
| 1214 | Ga0068863_100022457 | |||
| 1215 | Ga0068863_100047122 | |||
| 1216 | Ga0068863_100087581 | |||
| 1217 | Ga0068863_100161759 | |||
| 1218 | Ga0068863_101344747 | |||
| 1219 | Ga0068863_102123465 | |||
| 1220 | Ga0068858_100009874 | |||
| 1221 | Ga0068858_100075105 | |||
| 1222 | Ga0068858_100272656 | |||
| 1223 | Ga0068858_101473481 | |||
| 1224 | Ga0068858_101477253 | |||
| 1225 | Ga0068860_100027486 | |||
| 1226 | Ga0068860_100351835 | |||
| 1227 | Ga0068860_101046374 | |||
| 1228 | Ga0068860_101641161 | |||
| 1229 | Ga0068862_100159026 | |||
| 1230 | Ga0068862_100354776 | |||
| 1231 | Ga0068862_100557078 | |||
| 1232 | Ga0068862_100876778 | |||
| 1233 | Ga0068862_100898080 | |||
| 1234 | Ga0068862_100945230 | |||
| 1235 | Ga0068862_101329737 | |||
| 1236 | Ga0068862_102630749 | |||
| 1237 | Ga0070717_10033417 | |||
| 1238 | Ga0075365_10630769 | |||
| 1239 | Ga0070715_10181835 | |||
| 1240 | Ga0070715_10395233 | |||
| 1241 | Ga0070716_101189635 | |||
| 1242 | Ga0070712_100066847 | |||
| 1243 | Ga0070712_100134215 | |||
| 1244 | Ga0070712_100657590 | |||
| 1245 | Ga0097621_100020065 | |||
| 1246 | Ga0097621_100070759 | |||
| 1247 | Ga0097621_100196884 | |||
| 1248 | Ga0097621_100217413 | |||
| 1249 | Ga0097621_100282090 | |||
| 1250 | Ga0097621_100362220 | |||
| 1251 | Ga0097621_100362483 | |||
| 1252 | Ga0097621_101038221 | |||
| 1253 | Ga0097621_101084676 | |||
| 1254 | Ga0068871_100033947 | |||
| 1255 | Ga0068871_100039948 | |||
| 1256 | Ga0068871_100059877 | |||
| 1257 | Ga0068871_100117289 | |||
| 1258 | Ga0068871_100154242 | |||
| 1259 | Ga0068871_100251516 | |||
| 1260 | Ga0068871_100285983 | |||
| 1261 | Ga0068871_100528054 | |||
| 1262 | Ga0068871_100757087 | |||
| 1263 | Ga0068871_100899761 | |||
| 1264 | Ga0068871_101265545 | |||
| 1265 | Ga0068871_101669271 | |||
| 1266 | Ga0075428_100454541 | |||
| 1267 | Ga0075430_100024562 | |||
| 1268 | Ga0075431_100052166 | |||
| 1269 | Ga0075431_100206210 | |||
| 1270 | Ga0075433_11081585 | |||
| 1271 | Ga0075434_100298788 | |||
| 1272 | Ga0075429_100022430 | |||
| 1273 | Ga0075429_100313205 | |||
| 1274 | Ga0068865_100081475 | |||
| 1275 | Ga0068865_100415529 | |||
| 1276 | Ga0068865_100937427 | |||
| 1277 | Ga0068865_101184821 | |||
| 1278 | Ga0068865_101200492 | |||
| 1279 | Ga0097620_100035530 | |||
| 1280 | Ga0097620_100093092 | |||
| 1281 | Ga0097620_100304511 | |||
| 1282 | Ga0097620_100393906 | |||
| 1283 | Ga0097620_100430329 | |||
| 1284 | Ga0097620_100565716 | |||
| 1285 | Ga0097620_100847806 | |||
| 1286 | Ga0097620_102399726 | |||
| 1287 | Ga0097620_102918610 | |||
| 1288 | Ga0105251_10200959 | |||
| 1289 | Ga0105240_10260102 | |||
| 1290 | Ga0111539_10048604 | |||
| 1291 | Ga0111539_10482610 | |||
| 1292 | Ga0111539_10841575 | |||
| 1293 | Ga0111539_12294643 | |||
| 1294 | Ga0111539_13239766 | |||
| 1295 | Ga0111539_13459810 | |||
| 1296 | Ga0105245_10179621 | |||
| 1297 | Ga0105245_10272511 | |||
| 1298 | Ga0105245_10328953 | |||
| 1299 | Ga0105245_10370392 | |||
| 1300 | Ga0105245_11084546 | |||
| 1301 | Ga0105247_10069340 | |||
| 1302 | Ga0105247_10140515 | |||
| 1303 | Ga0105247_10161278 | |||
| 1304 | Ga0105247_10522979 | |||
| 1305 | Ga0114129_10134955 | |||
| 1306 | Ga0105243_10081696 | |||
| 1307 | Ga0105243_10126597 | |||
| 1308 | Ga0105243_11078581 | |||
| 1309 | Ga0105241_10093251 | |||
| 1310 | Ga0105241_10603844 | |||
| 1311 | Ga0105241_11733662 | |||
| 1312 | Ga0105242_10005987 | |||
| 1313 | Ga0105242_10185845 | |||
| 1314 | Ga0105242_10361110 | |||
| 1315 | Ga0105242_11291439 | |||
| 1316 | Ga0105242_12031596 | |||
| 1317 | Ga0105248_10075569 | |||
| 1318 | Ga0105248_10098900 | |||
| 1319 | Ga0105248_10398824 | |||
| 1320 | Ga0105248_10402636 | |||
| 1321 | Ga0105248_10488316 | |||
| 1322 | Ga0105248_10726649 | |||
| 1323 | Ga0105248_11053696 | |||
| 1324 | Ga0105248_11845408 | |||
| 1325 | Ga0105248_12498584 | |||
| 1326 | Ga0105237_10150893 | |||
| 1327 | Ga0105237_11151633 | |||
| 1328 | Ga0105249_10001311 | |||
| 1329 | Ga0105249_10010090 | |||
| 1330 | Ga0105249_10037978 | |||
| 1331 | Ga0105249_10041778 | |||
| 1332 | Ga0105249_10079433 | |||
| 1333 | Ga0105249_10293286 | |||
| 1334 | Ga0105249_10350192 | |||
| 1335 | Ga0105249_10414653 | |||
| 1336 | Ga0105249_10516984 | |||
| 1337 | Ga0105249_10599384 | |||
| 1338 | Ga0105249_11699170 | |||
| 1339 | Ga0105249_13022754 | |||
| 1340 | Ga0099796_10100323 | |||
| 1341 | Ga0105239_10052885 | |||
| 1342 | Ga0105239_10055606 | |||
| 1343 | Ga0105239_10215555 | |||
| 1344 | Ga0105239_10961147 | |||
| 1345 | Ga0105246_10068122 | |||
| 1346 | Ga0157371_10268586 | |||
| 1347 | Ga0157371_10298495 | |||
| 1348 | Ga0157374_10013528 | |||
| 1349 | Ga0157374_10020158 | |||
| 1350 | Ga0157374_10053956 | |||
| 1351 | Ga0157374_10060608 | |||
| 1352 | Ga0157374_10263427 | |||
| 1353 | Ga0157374_10327872 | |||
| 1354 | Ga0157374_10491174 | |||
| 1355 | Ga0157374_10549174 | |||
| 1356 | Ga0157374_11074164 | |||
| 1357 | Ga0157374_11076481 | |||
| 1358 | Ga0157374_11521452 | |||
| 1359 | Ga0157374_11625742 | |||
| 1360 | Ga0157374_12845169 | |||
| 1361 | Ga0157374_12883599 | |||
| 1362 | Ga0157378_10025935 | |||
| 1363 | Ga0157378_10051722 | |||
| 1364 | Ga0157378_10055673 | |||
| 1365 | Ga0157378_10325271 | |||
| 1366 | Ga0157378_10363753 | |||
| 1367 | Ga0157378_10395389 | |||
| 1368 | Ga0157378_10439604 | |||
| 1369 | Ga0157378_10743519 | |||
| 1370 | Ga0157378_10755562 | |||
| 1371 | Ga0157378_10810182 | |||
| 1372 | Ga0157378_11912774 | |||
| 1373 | Ga0157378_13030252 | |||
| 1374 | Ga0163162_10010052 | |||
| 1375 | Ga0163162_10114454 | |||
| 1376 | Ga0163162_10124221 | |||
| 1377 | Ga0163162_10153141 | |||
| 1378 | Ga0163162_10204973 | |||
| 1379 | Ga0163162_11174474 | |||
| 1380 | Ga0163162_11353665 | |||
| 1381 | Ga0163162_11672673 | |||
| 1382 | Ga0163162_12014398 | |||
| 1383 | Ga0157372_10478705 | |||
| 1384 | Ga0157372_10716987 | |||
| 1385 | Ga0157372_11914408 | |||
| 1386 | Ga0157372_12155459 | |||
| 1387 | Ga0157375_10023557 | |||
| 1388 | Ga0157375_10086990 | |||
| 1389 | Ga0157375_10095316 | |||
| 1390 | Ga0157375_10137476 | |||
| 1391 | Ga0157375_10139419 | |||
| 1392 | Ga0157375_10378747 | |||
| 1393 | Ga0157375_10539301 | |||
| 1394 | Ga0157375_10586654 | |||
| 1395 | Ga0157375_11387335 | |||
| 1396 | Ga0157375_11499745 | |||
| 1397 | Ga0157375_13147499 | |||
| 1398 | Ga0157375_13385849 | |||
| 1399 | Ga0163163_10239924 | |||
| 1400 | Ga0163163_10601053 | |||
| 1401 | Ga0163163_10900261 | |||
| 1402 | Ga0163163_11112829 | |||
| 1403 | Ga0163163_11607120 | |||
| 1404 | Ga0157380_10040869 | |||
| 1405 | Ga0157380_10365536 | |||
| 1406 | Ga0157380_10378537 | |||
| 1407 | Ga0157380_10625234 | |||
| 1408 | Ga0157380_11962378 | |||
| 1409 | Ga0157380_12408596 | |||
| 1410 | Ga0157377_10006420 | |||
| 1411 | Ga0157377_10011698 | |||
| 1412 | Ga0157377_10568789 | |||
| 1413 | Ga0157377_10797289 | |||
| 1414 | Ga0157377_11124317 | |||
| 1415 | Ga0157377_11779637 | |||
| 1416 | Ga0157379_10001919 | |||
| 1417 | Ga0157379_10056425 | |||
| 1418 | Ga0157379_10194117 | |||
| 1419 | Ga0157379_10207397 | |||
| 1420 | Ga0157379_10250274 | |||
| 1421 | Ga0157379_10376014 | |||
| 1422 | Ga0157379_10539993 | |||
| 1423 | Ga0157379_10693552 | |||
| 1424 | Ga0157379_10871290 | |||
| 1425 | Ga0157376_10030505 | |||
| 1426 | Ga0157376_10031260 | |||
| 1427 | Ga0157376_10032198 | |||
| 1428 | Ga0157376_10107502 | |||
| 1429 | Ga0157376_10310919 | |||
| 1430 | Ga0157376_10975493 | |||
| 1431 | Ga0163161_10013980 | |||
| 1432 | Ga0163161_10024475 | |||
| 1433 | Ga0163161_10074190 | |||
| 1434 | Ga0163161_10075954 | |||
| 1435 | Ga0163161_10238404 | |||
| 1436 | Ga0163161_10241469 | |||
| 1437 | Ga0163161_10374205 | |||
| 1438 | Ga0163161_10416436 | |||
| 1439 | Ga0163161_11308036 | |||
| 1440 | Ga0163161_11936812 | |||
| 1441 | Ga0228598_1096405 | |||
| 1442 | Ga0207666_1000715 | |||
| 1443 | Ga0207666_1025337 | |||
| 1444 | Ga0207673_1000739 | |||
| 1445 | Ga0207673_1002367 | |||
| 1446 | Ga0207673_1023211 | |||
| 1447 | Ga0207697_10002692 | |||
| 1448 | Ga0207697_10004121 | |||
| 1449 | Ga0207697_10178171 | |||
| 1450 | Ga0207656_10088658 | |||
| 1451 | Ga0207653_10442742 | |||
| 1452 | Ga0207682_10036406 | |||
| 1453 | Ga0207682_10568424 | |||
| 1454 | Ga0207692_10609112 | |||
| 1455 | Ga0207642_10036727 | |||
| 1456 | Ga0207642_10347440 | |||
| 1457 | Ga0207642_10619789 | |||
| 1458 | Ga0207710_10004123 | |||
| 1459 | Ga0207710_10482424 | |||
| 1460 | Ga0207688_10088285 | |||
| 1461 | Ga0207688_10116765 | |||
| 1462 | Ga0207680_10008325 | |||
| 1463 | Ga0207680_10030765 | |||
| 1464 | Ga0207680_10448836 | |||
| 1465 | Ga0207647_10010327 | |||
| 1466 | Ga0207685_10085696 | |||
| 1467 | Ga0207685_10146251 | |||
| 1468 | Ga0207699_10527715 | |||
| 1469 | Ga0207699_10650600 | |||
| 1470 | Ga0207645_10025077 | |||
| 1471 | Ga0207645_10115682 | |||
| 1472 | Ga0207645_10433101 | |||
| 1473 | Ga0207645_10901081 | |||
| 1474 | Ga0207643_10011654 | |||
| 1475 | Ga0207643_10143758 | |||
| 1476 | Ga0207643_10219908 | |||
| 1477 | Ga0207643_10342824 | |||
| 1478 | Ga0207684_10024515 | |||
| 1479 | Ga0207684_10060512 | |||
| 1480 | Ga0207684_10951340 | |||
| 1481 | Ga0207654_10203907 | |||
| 1482 | Ga0207707_10375910 | |||
| 1483 | Ga0207695_10915386 | |||
| 1484 | Ga0207693_10085755 | |||
| 1485 | Ga0207693_10117940 | |||
| 1486 | Ga0207693_10252928 | |||
| 1487 | Ga0207693_10438766 | |||
| 1488 | Ga0207663_10137944 | |||
| 1489 | Ga0207660_10313238 | |||
| 1490 | Ga0207662_10085817 | |||
| 1491 | Ga0207662_10329974 | |||
| 1492 | Ga0207662_10922014 | |||
| 1493 | Ga0207657_10250225 | |||
| 1494 | Ga0207657_10252053 | |||
| 1495 | Ga0207649_10256805 | |||
| 1496 | Ga0207649_10579797 | |||
| 1497 | Ga0207646_10516857 | |||
| 1498 | Ga0207646_10518318 | |||
| 1499 | Ga0207646_11307124 | |||
| 1500 | Ga0207681_10193786 | |||
| 1501 | Ga0207681_10215360 | |||
| 1502 | Ga0207681_10308411 | |||
| 1503 | Ga0207681_10657051 | |||
| 1504 | Ga0207681_11197981 | |||
| 1505 | Ga0207681_11551219 | |||
| 1506 | Ga0207694_11402338 | |||
| 1507 | Ga0207650_10184144 | |||
| 1508 | Ga0207650_10345283 | |||
| 1509 | Ga0207650_10913570 | |||
| 1510 | Ga0207650_11775011 | |||
| 1511 | Ga0207659_10011372 | |||
| 1512 | Ga0207659_10012514 | |||
| 1513 | Ga0207659_10057444 | |||
| 1514 | Ga0207659_10070737 | |||
| 1515 | Ga0207659_10540667 | |||
| 1516 | Ga0207659_10614810 | |||
| 1517 | Ga0207659_10627284 | |||
| 1518 | Ga0207659_10980936 | |||
| 1519 | Ga0207659_11747836 | |||
| 1520 | Ga0207659_11831376 | |||
| 1521 | Ga0207687_10180202 | |||
| 1522 | Ga0207687_10192239 | |||
| 1523 | Ga0207687_10466611 | |||
| 1524 | Ga0207700_10006919 | |||
| 1525 | Ga0207700_10613716 | |||
| 1526 | Ga0207664_10287792 | |||
| 1527 | Ga0207644_10110847 | |||
| 1528 | Ga0207644_10242530 | |||
| 1529 | Ga0207644_10580867 | |||
| 1530 | Ga0207644_10700569 | |||
| 1531 | Ga0207644_11533481 | |||
| 1532 | Ga0207644_11548735 | |||
| 1533 | Ga0207690_10008297 | |||
| 1534 | Ga0207690_10068423 | |||
| 1535 | Ga0207690_10499537 | |||
| 1536 | Ga0207706_10028458 | |||
| 1537 | Ga0207706_10083063 | |||
| 1538 | Ga0207706_10184713 | |||
| 1539 | Ga0207706_10249722 | |||
| 1540 | Ga0207686_10001103 | |||
| 1541 | Ga0207686_10162306 | |||
| 1542 | Ga0207686_10185653 | |||
| 1543 | Ga0207686_10190282 | |||
| 1544 | Ga0207686_10190905 | |||
| 1545 | Ga0207709_11055995 | |||
| 1546 | Ga0207670_10022966 | |||
| 1547 | Ga0207670_10063849 | |||
| 1548 | Ga0207670_10067034 | |||
| 1549 | Ga0207670_10247476 | |||
| 1550 | Ga0207670_10422753 | |||
| 1551 | Ga0207669_10074008 | |||
| 1552 | Ga0207669_10208319 | |||
| 1553 | Ga0207669_10319932 | |||
| 1554 | Ga0207704_10042162 | |||
| 1555 | Ga0207704_10195161 | |||
| 1556 | Ga0207704_10705934 | |||
| 1557 | Ga0207704_11512574 | |||
| 1558 | Ga0207665_10071351 | |||
| 1559 | Ga0207665_11084646 | |||
| 1560 | Ga0207691_10074762 | |||
| 1561 | Ga0207691_10310870 | |||
| 1562 | Ga0207691_10496346 | |||
| 1563 | Ga0207691_10833958 | |||
| 1564 | Ga0207691_10836455 | |||
| 1565 | Ga0207711_10076271 | |||
| 1566 | Ga0207711_10150947 | |||
| 1567 | Ga0207711_10163161 | |||
| 1568 | Ga0207711_10805190 | |||
| 1569 | Ga0207711_11589868 | |||
| 1570 | Ga0207689_10027393 | |||
| 1571 | Ga0207689_10042683 | |||
| 1572 | Ga0207689_10098593 | |||
| 1573 | Ga0207689_10134284 | |||
| 1574 | Ga0207689_10161280 | |||
| 1575 | Ga0207689_10165628 | |||
| 1576 | Ga0207689_10373079 | |||
| 1577 | Ga0207689_10899130 | |||
| 1578 | Ga0207661_10156511 | |||
| 1579 | Ga0207661_10190271 | |||
| 1580 | Ga0207661_10535142 | |||
| 1581 | Ga0207661_10675087 | |||
| 1582 | Ga0207661_11012931 | |||
| 1583 | Ga0207661_11530003 | |||
| 1584 | Ga0207679_10047842 | |||
| 1585 | Ga0207679_10202869 | |||
| 1586 | Ga0207679_11328131 | |||
| 1587 | Ga0207651_10009480 | |||
| 1588 | Ga0207651_10466047 | |||
| 1589 | Ga0207651_10493880 | |||
| 1590 | Ga0207651_10518190 | |||
| 1591 | Ga0207651_10872768 | |||
| 1592 | Ga0207651_11393742 | |||
| 1593 | Ga0207651_11954042 | |||
| 1594 | Ga0207712_10001769 | |||
| 1595 | Ga0207712_10005517 | |||
| 1596 | Ga0207712_10177843 | |||
| 1597 | Ga0207712_10271583 | |||
| 1598 | Ga0207712_10461791 | |||
| 1599 | Ga0207712_10510537 | |||
| 1600 | Ga0207712_10572285 | |||
| 1601 | Ga0207712_10697075 | |||
| 1602 | Ga0207712_11017040 | |||
| 1603 | Ga0207668_10028390 | |||
| 1604 | Ga0207668_10432582 | |||
| 1605 | Ga0207640_10274772 | |||
| 1606 | Ga0207640_10732836 | |||
| 1607 | Ga0207658_10366369 | |||
| 1608 | Ga0207658_10398943 | |||
| 1609 | Ga0207658_10549066 | |||
| 1610 | Ga0207658_10587619 | |||
| 1611 | Ga0207658_10761679 | |||
| 1612 | Ga0207658_10822787 | |||
| 1613 | Ga0207658_10892811 | |||
| 1614 | Ga0207658_11028263 | |||
| 1615 | Ga0207658_11051946 | |||
| 1616 | Ga0207658_11253312 | |||
| 1617 | Ga0207658_11926487 | |||
| 1618 | Ga0207677_10032530 | |||
| 1619 | Ga0207677_10098632 | |||
| 1620 | Ga0207677_10109412 | |||
| 1621 | Ga0207677_10573906 | |||
| 1622 | Ga0207677_10792031 | |||
| 1623 | Ga0207677_10826328 | |||
| 1624 | Ga0207677_11008155 | |||
| 1625 | Ga0207677_11019510 | |||
| 1626 | Ga0207677_12199154 | |||
| 1627 | Ga0207703_10021697 | |||
| 1628 | Ga0207703_10033048 | |||
| 1629 | Ga0207703_10149126 | |||
| 1630 | Ga0207703_10169522 | |||
| 1631 | Ga0207703_10488668 | |||
| 1632 | Ga0207703_11262210 | |||
| 1633 | Ga0207703_12425253 | |||
| 1634 | Ga0207639_10716935 | |||
| 1635 | Ga0207639_11459794 | |||
| 1636 | Ga0207639_12096833 | |||
| 1637 | Ga0207678_10697596 | |||
| 1638 | Ga0207708_10007764 | |||
| 1639 | Ga0207708_10016661 | |||
| 1640 | Ga0207708_11063741 | |||
| 1641 | Ga0207708_11325395 | |||
| 1642 | Ga0207702_10943007 | |||
| 1643 | Ga0207641_10001178 | |||
| 1644 | Ga0207641_10042379 | |||
| 1645 | Ga0207641_10064617 | |||
| 1646 | Ga0207641_10118993 | |||
| 1647 | Ga0207641_10180361 | |||
| 1648 | Ga0207641_10557529 | |||
| 1649 | Ga0207641_10705323 | |||
| 1650 | Ga0207641_12368216 | |||
| 1651 | Ga0207648_10084345 | |||
| 1652 | Ga0207648_10581107 | |||
| 1653 | Ga0207648_10673812 | |||
| 1654 | Ga0207648_11143562 | |||
| 1655 | Ga0207648_11791712 | |||
| 1656 | Ga0207648_11867968 | |||
| 1657 | Ga0207648_12207695 | |||
| 1658 | Ga0207676_10085000 | |||
| 1659 | Ga0207676_10288585 | |||
| 1660 | Ga0207676_10964595 | |||
| 1661 | Ga0207676_11007469 | |||
| 1662 | Ga0207676_11250766 | |||
| 1663 | Ga0207676_11287490 | |||
| 1664 | Ga0207676_12052773 | |||
| 1665 | Ga0207676_12551333 | |||
| 1666 | Ga0207674_10110994 | |||
| 1667 | Ga0207674_10557199 | |||
| 1668 | Ga0207674_10624036 | |||
| 1669 | Ga0207674_10780763 | |||
| 1670 | Ga0207675_100005780 | |||
| 1671 | Ga0207675_100035164 | |||
| 1672 | Ga0207675_100089964 | |||
| 1673 | Ga0207675_100674671 | |||
| 1674 | Ga0207675_100848968 | |||
| 1675 | Ga0207683_10028142 | |||
| 1676 | Ga0207683_10104577 | |||
| 1677 | Ga0207683_11165564 | |||
| 1678 | Ga0207698_10063362 | |||
| 1679 | Ga0207698_10887576 | |||
| 1680 | Ga0207698_11304935 | |||
| 1681 | Ga0207698_12136041 | |||
| 1682 | Ga0209984_1007833 | |||
| 1683 | Ga0209995_1090494 | |||
| 1684 | Ga0209999_1124097 | |||
| 1685 | Ga0209970_1113803 | |||
| 1686 | Ga0209983_1027992 | |||
| 1687 | Ga0207428_10029239 | |||
| 1688 | Ga0207428_10371430 | |||
| 1689 | Ga0265357_1014890 | |||
| 1690 | Ga0268266_10159199 | |||
| 1691 | Ga0268266_10325802 | |||
| 1692 | Ga0268266_10915381 | |||
| 1693 | Ga0268265_10460408 | |||
| 1694 | Ga0268265_10554601 | |||
| 1695 | Ga0268265_10569599 | |||
| 1696 | Ga0268265_10639664 | |||
| 1697 | Ga0268265_11421533 | |||
| 1698 | Ga0268265_11438502 | |||
| 1699 | Ga0268265_11742443 | |||
| 1700 | Ga0268264_10008851 | |||
| 1701 | Ga0268264_10029385 | |||
| 1702 | Ga0268264_10171372 | |||
| 1703 | Ga0307407_11062060 | |||
| 1704 | Ga0307414_10201934 | |||
| 1705 | Ga0307414_11781737 | |||
| 1706 | Ga0373934_0069289 | |||
| 1707 | Ga0373936_0615141 | |||
| 1708 | Ga0373954_0234421 | |||
| 1709 | Ga0373943_0063641 | |||
| 1710 | Ga0373943_0072378 | |||
| 1711 | Ga0373943_0092836 | |||
| 1712 | Ga0373943_0959196 | |||
| 1713 | Ga0373955_0074924 | |||
| 1714 | Ga0373955_0350002 | |||
| 1715 | Ga0373955_0365183 | |||
| 1716 | Ga0373955_0944158 | |||
| 1717 | Ga0373935_0057912 | |||
| 1718 | Ga0373935_0156384 | |||
| 1719 | Ga0373927_1018292 | |||
| 1720 | Ga0373947_0132604 | |||
| 1721 | Ga0373947_1177026 | |||
| 1722 | Ga0373947_1252385 | |||
| 1723 | Ga0373937_0041534 | |||
| 1724 | Ga0373937_0836942 | |||
| 1725 | Ga0373937_1040406 | |||
| 1726 | Ga0373937_1047167 | |||
| 1727 | Ga0373925_0212557 | |||
| 1728 | Ga0373925_0319459 | |||
| 1729 | Ga0373925_1388132 | |||
| 1730 | Ga0451804_0689320 | |||
| 1731 | Ga0451839_1424319 | |||
| 1732 | Ga0451841_0197885 | |||
| 1733 | Ga0451853_1763246 | |||
| 1734 | Ga0450914_057887 | |||
| 1735 | Ga0450923_029410 | |||
| 1736 | Ga0450918_128684 | |||
| 1737 | Ga0495592_0140469 | |||
| 1738 | Ga0495592_0392186 | |||
| 1739 | Ga0495603_0350726 | |||
| 1740 | Ga0495641_0197787 | |||
| 1741 | Ga0495651_0404465 | |||
| 1742 | Ga0495653_0183664 | |||
| 1743 | Ga0495582_0411887 | |||
| 1744 | Ga0495582_0855955 | |||
| 1745 | Ga0495639_0344344 | |||
| 1746 | Ga0495584_0203350 | |||
| 1747 | Ga0495594_0141137 | |||
| 1748 | Ga0495594_0325255 | |||
| 1749 | Ga0495608_0242270 | |||
| 1750 | Ga0495618_0238461 | |||
| 1751 | Ga0495628_0154686 | |||
| 1752 | Ga0495630_0169240 | |||
| 1753 | Ga0495630_1086488 | |||
| 1754 | Ga0495644_0353461 | |||
| 1755 | Ga0495665_0168769 | |||
| 1756 | Ga0495640_0432262 | |||
| 1757 | Ga0495586_0280821 | |||
| 1758 | Ga0495587_0123859 | |||
| 1759 | Ga0495587_0230747 | |||
| 1760 | Ga0495598_0213582 | |||
| 1761 | Ga0495621_0129545 | |||
| 1762 | Ga0495621_0374676 | |||
| 1763 | Ga0495645_0267171 | |||
| 1764 | Ga0495645_0346084 | |||
| 1765 | Ga0495622_0204192 | |||
| 1766 | Ga0495634_0082340 | |||
| 1767 | Ga0495635_0444691 | |||
| 1768 | Ga0495657_0308437 | |||
| 1769 | Ga0495657_0323618 | |||
| 1770 | Ga0495599_0677247 | |||
| 1771 | Ga0495647_0388295 | |||
| 1772 | Ga0495658_0186683 | |||
| 1773 | Ga0495658_0533827 | |||
| 1774 | Ga0495658_0551868 | |||
| 1775 | Ga0495613_0642505 | |||
| 1776 | Ga0495613_0886732 | |||
| 1777 | Ga0495600_0304941 | |||
| 1778 | Ga0495581_0201909 | |||
| 1779 | Ga0495581_0222866 | |||
| 1780 | Ga0495676_0128486 | |||
| 1781 | Ga0495676_0501969 | |||
| 1782 | Ga0495680_0140445 | |||
| 1783 | Ga0495680_0303795 | |||
| 1784 | Ga0495680_0304210 | |||
| 1785 | Ga0495675_0848891 | |||
| 1786 | Ga0495684_0013026 | |||
| 1787 | Ga0495684_0058302 | |||
| 1788 | Ga0496100_0201216 | |||
| 1789 | Ga0496100_0306889 | |||
| 1790 | Ga0496101_0412884 | |||
| 1791 | Ga0496101_0454095 | |||
| 1792 | Ga0496101_0558749 | |||
| 1793 | Ga0496101_0977387 | |||
| 1794 | Ga0496102_0127369 | |||
| 1795 | Ga0496104_0106525 | |||
| 1796 | Ga0496104_0371428 | |||
| 1797 | Ga0496105_0345942 | |||
| 1798 | Ga0496105_0369681 | |||
| 1799 | Ga0496105_0705658 | |||
| 1800 | Ga0496105_0907349 | |||
| 1801 | Ga0496106_0328550 | |||
| 1802 | Ga0496106_0334136 | |||
| 1803 | Ga0496107_0487759 | |||
| 1804 | Ga0496107_0820721 | |||
| 1805 | Ga0496108_0116381 | |||
| 1806 | Ga0496108_0221688 | |||
| 1807 | Ga0496108_0884654 | |||
| 1808 | Ga0496108_0939949 | |||
| 1809 | Ga0496108_0962592 | |||
| 1810 | Ga0496109_0047500 | |||
| 1811 | Ga0496109_0136217 | |||
| 1812 | Ga0496109_0397979 | |||
| 1813 | Ga0496110_0118806 | |||
| 1814 | Ga0496110_0234915 | |||
| 1815 | Ga0496111_0034461 | |||
| 1816 | Ga0496111_0587104 | |||
| 1817 | Ga0496111_0701600 | |||
| 1818 | Ga0496112_0074701 | |||
| 1819 | Ga0496113_0424646 | |||
| 1820 | Ga0496113_1456873 | |||
| 1821 | Ga0496114_0120850 | |||
| 1822 | Ga0496114_0179867 | |||
| 1823 | Ga0496115_0053864 | |||
| 1824 | Ga0496115_0526153 | |||
| 1825 | Ga0501037_0345535 | |||
| 1826 | Ga0501038_0045517 | |||
| 1827 | Ga0501040_0162592 | |||
| 1828 | Ga0501042_0065024 | |||
| 1829 | Ga0501046_0810795 | |||
| 1830 | Ga0501048_0986191 | |||
| 1831 | Ga0501067_0848411 | |||
| 1832 | Ga0501071_0044864 | |||
| 1833 | Ga0501071_0480237 | |||
| 1834 | Ga0501073_1143745 | |||
| 1835 | Ga0501075_0014831 | |||
| 1836 | Ga0501077_0086589 | |||
| 1837 | Ga0501217_108043 | |||
| 1838 | Ga0501079_0106610 | |||
| 1839 | Ga0501081_0097460 | |||
| 1840 | Ga0501035_0140157 | |||
| 1841 | Ga0501044_1243431 | |||
| 1842 | Ga0501045_0051656 | |||
| 1843 | Ga0501045_1262318 | |||
| 1844 | nmdc:mga0yw44_561388_c1 | |||
| 1845 | nmdc:mga05p37_100162_c1 | |||
| 1846 | nmdc:mga09592_12308_c1 | |||
| 1847 | nmdc:mga09592_507909_c1 | |||
| 1848 | nmdc:mga0qj67_1715_c1 | |||
| 1849 | nmdc:mga06r32_678213_c1 | |||
| 1850 | nmdc:mga08y16_122808_c1 | |||
| 1851 | nmdc:mga08y16_158726_c1 | |||
| 1852 | nmdc:mga08y16_746604_c1 | |||
| 1853 | nmdc:mga0n895_1257704_c1 | |||
| 1854 | nmdc:mga0n895_816094_c1 | |||
| 1855 | nmdc:mga0a205_1572920_c1 | |||
| 1856 | nmdc:mga0a205_324472_c1 | |||
| 1857 | Ga0495612_0396650 | |||
| 1858 | Ga0495595_0435417 | |||
| 1859 | Ga0495619_0203377 | |||
| 1860 | Ga0495619_0294475 | |||
| 1861 | Ga0500642_0187130 | |||
| 1862 | Ga0501084_0069969 | |||
| 1863 | Ga0501082_0191871 | |||
| 1864 | Ga0530510_0033729 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.8536 | 2 | 95 |
| 3fgv-assembly1.cif.gz_B | crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution | 0.8408 | 2 | 92 |
| 6fxd-assembly1.cif.gz_A-2 | crystal structure of mupz from pseudomonas fluorescens | 0.8401 | 2 | 86 |
| 4zos-assembly2.cif.gz_B | 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] | 0.8382 | 2 | 93 |
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.8376 | 2 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLA3_32_98_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9015 | 5 | 66 | 3.10.450.240 |
| 4zosB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8382 | 2 | 93 | 3.30.70.100 |
| 3fgvB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8348 | 1 | 92 | 3.30.70.100 |
| af_P9WLA3_32_98_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8285 | 5 | 66 | 3.10.450.240 |
| 3fgvB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8268 | 1 | 92 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5SFK5-F1-model_v4 | Uncharacterized protein | 0.9957 | 1 | 57 |
|
| AF-A0A537JX09-F1-model_v4 | ABM domain-containing protein | 0.9836 | 1 | 95 |
|
| AF-A0A2V6K1P2-F1-model_v4 | ABM domain-containing protein | 0.9784 | 1 | 62 |
|
| AF-A0A2V6HD35-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9723 | 1 | 60 |
|
| AF-A0A2V6C7R8-F1-model_v4 | ABM domain-containing protein | 0.9683 | 1 | 74 |
|