F486032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 931 | 365 | 1862 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100012357|Ga0070714_1000123577 |
| Length | 281 |
| Sequence | MALWVDQFLSGAGSGEAEFPSCMRFAMIDLFGIQGLHALVTGGSSGLGRFFATSLAARGALVTVGARRAEALAKTVDDIAAAKGQAQSVVMDVTVGASIETALDSAEARFGPIQIVVNNAGVTATRPALQQDETDWDKVVDTNLKGVWLVAQAAGRKMVANKVKGSIVNVASILGLRVASSVAPYAISKAGVVQMTKALALEWARYGIRVNALAPGYFETELNDDFFQEAAGQALIKRIPQRRLGELRELEGPLLLLASEAGSYMTGSVIVADGGHVVSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 341 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 342 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 346 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 350 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 351 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 352 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 353 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 354 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 355 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 356 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 357 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 358 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 359 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 360 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 361 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 362 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 363 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 364 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 365 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.58 |
| Nodule | 0.43 |
| Rhizoplane | 5.8 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100012357 | 3300005435 | Bacteria | 6816 |
| 2 | JGI24034J26672_10023738 | 3300002239 | Bacteria | 974 |
| 3 | JGI24751J29686_10048055 | 3300002459 | Bacteria | 880 |
| 4 | JGI25406J46586_10001111 | 3300003203 | Bacteria | 12608 |
| 5 | rootL2_10282064 | 3300003322 | Bacteria | 1594 |
| 6 | JGI25404J52841_10000240 | 3300003659 | Bacteria | 6868 |
| 7 | JGI25405J52794_10030357 | 3300003911 | Bacteria | 1120 |
| 8 | Ga0065715_10303549 | 3300005293 | Bacteria | 1024 |
| 9 | Ga0070658_10149119 | 3300005327 | Bacteria | 1957 |
| 10 | Ga0070676_10027703 | 3300005328 | Bacteria | 3215 |
| 11 | Ga0070676_10212221 | 3300005328 | Bacteria | 1274 |
| 12 | Ga0070676_10281374 | 3300005328 | Bacteria | 1121 |
| 13 | Ga0070683_100034649 | 3300005329 | Bacteria | 4613 |
| 14 | Ga0070683_100072024 | 3300005329 | Bacteria | 3225 |
| 15 | Ga0070683_100482203 | 3300005329 | Bacteria | 1184 |
| 16 | Ga0070690_100080742 | 3300005330 | Bacteria | 2127 |
| 17 | Ga0070690_100220596 | 3300005330 | Unclassified | 1328 |
| 18 | Ga0070690_100310698 | 3300005330 | Bacteria | 1133 |
| 19 | Ga0070670_100329057 | 3300005331 | Unclassified | 1340 |
| 20 | Ga0070677_10077039 | 3300005333 | Unclassified | 1417 |
| 21 | Ga0068869_100020691 | 3300005334 | Bacteria | 4517 |
| 22 | Ga0068869_100061149 | 3300005334 | Bacteria | 2762 |
| 23 | Ga0070666_10004139 | 3300005335 | Bacteria | 8802 |
| 24 | Ga0070666_10026855 | 3300005335 | Bacteria | 3766 |
| 25 | Ga0070666_10060256 | 3300005335 | Bacteria | 2568 |
| 26 | Ga0070666_10141782 | 3300005335 | Bacteria | 1674 |
| 27 | Ga0070666_10247316 | 3300005335 | Bacteria | 1262 |
| 28 | Ga0070680_100119833 | 3300005336 | Bacteria | 2196 |
| 29 | Ga0070680_100639446 | 3300005336 | Bacteria | 914 |
| 30 | Ga0070682_100175888 | 3300005337 | Bacteria | 1491 |
| 31 | Ga0068868_100098577 | 3300005338 | Bacteria | 2363 |
| 32 | Ga0068868_100179794 | 3300005338 | Bacteria | 1754 |
| 33 | Ga0068868_100437731 | 3300005338 | Bacteria | 1135 |
| 34 | Ga0068868_100472405 | 3300005338 | Bacteria | 1094 |
| 35 | Ga0070660_100009904 | 3300005339 | Bacteria | 6722 |
| 36 | Ga0070660_100019782 | 3300005339 | Bacteria | 4938 |
| 37 | Ga0070660_100037023 | 3300005339 | Bacteria | 3698 |
| 38 | Ga0070660_100048417 | 3300005339 | Bacteria | 3265 |
| 39 | Ga0070660_100243265 | 3300005339 | Bacteria | 1466 |
| 40 | Ga0070689_100003058 | 3300005340 | Bacteria | 11018 |
| 41 | Ga0070689_100345765 | 3300005340 | Unclassified | 1246 |
| 42 | Ga0070661_100019023 | 3300005344 | Bacteria | 4889 |
| 43 | Ga0070661_100022594 | 3300005344 | Bacteria | 4504 |
| 44 | Ga0070661_100031004 | 3300005344 | Bacteria | 3865 |
| 45 | Ga0070692_10018833 | 3300005345 | Bacteria | 3327 |
| 46 | Ga0070692_10033813 | 3300005345 | Bacteria | 2578 |
| 47 | Ga0070668_100013378 | 3300005347 | Bacteria | 6123 |
| 48 | Ga0070668_100116421 | 3300005347 | Bacteria | 2131 |
| 49 | Ga0070668_100620644 | 3300005347 | Bacteria | 947 |
| 50 | Ga0070669_100029099 | 3300005353 | Bacteria | 3981 |
| 51 | Ga0070669_100100908 | 3300005353 | Bacteria | 2177 |
| 52 | Ga0070669_100150514 | 3300005353 | Bacteria | 1801 |
| 53 | Ga0070675_100038048 | 3300005354 | Bacteria | 3920 |
| 54 | Ga0070675_100093182 | 3300005354 | Bacteria | 2526 |
| 55 | Ga0070675_100299567 | 3300005354 | Bacteria | 1416 |
| 56 | Ga0070671_100054368 | 3300005355 | Bacteria | 3329 |
| 57 | Ga0070671_100058106 | 3300005355 | Bacteria | 3220 |
| 58 | Ga0070671_100182612 | 3300005355 | Bacteria | 1776 |
| 59 | Ga0070671_100322725 | 3300005355 | Bacteria | 1316 |
| 60 | Ga0070671_100414339 | 3300005355 | Bacteria | 1153 |
| 61 | Ga0070674_100005862 | 3300005356 | Bacteria | 7145 |
| 62 | Ga0070674_100005913 | 3300005356 | Bacteria | 7115 |
| 63 | Ga0070673_100091758 | 3300005364 | Bacteria | 2483 |
| 64 | Ga0070673_100102820 | 3300005364 | Bacteria | 2356 |
| 65 | Ga0070673_100229419 | 3300005364 | Bacteria | 1610 |
| 66 | Ga0070673_100489738 | 3300005364 | Bacteria | 1111 |
| 67 | Ga0070673_100550393 | 3300005364 | Bacteria | 1048 |
| 68 | Ga0070688_100015320 | 3300005365 | Bacteria | 4360 |
| 69 | Ga0070688_100093508 | 3300005365 | Bacteria | 1969 |
| 70 | Ga0070659_100000182 | 3300005366 | Bacteria | 48054 |
| 71 | Ga0070659_100002279 | 3300005366 | Bacteria | 13661 |
| 72 | Ga0070659_100023880 | 3300005366 | Bacteria | 4683 |
| 73 | Ga0070659_100041424 | 3300005366 | Bacteria | 3600 |
| 74 | Ga0070659_100179291 | 3300005366 | Bacteria | 1738 |
| 75 | Ga0070667_100001759 | 3300005367 | Bacteria | 19302 |
| 76 | Ga0070667_100070917 | 3300005367 | Bacteria | 2967 |
| 77 | Ga0070667_100093912 | 3300005367 | Bacteria | 2584 |
| 78 | Ga0070667_100126209 | 3300005367 | Bacteria | 2230 |
| 79 | Ga0070667_100290235 | 3300005367 | Bacteria | 1471 |
| 80 | Ga0070667_100698337 | 3300005367 | Bacteria | 939 |
| 81 | Ga0070709_10001020 | 3300005434 | Bacteria | 15489 |
| 82 | Ga0070709_10001626 | 3300005434 | Bacteria | 12157 |
| 83 | Ga0070709_10004665 | 3300005434 | Bacteria | 7402 |
| 84 | Ga0070709_10008636 | 3300005434 | Bacteria | 5603 |
| 85 | Ga0070709_10067302 | 3300005434 | Bacteria | 2300 |
| 86 | Ga0070714_100002584 | 3300005435 | Bacteria | 13346 |
| 87 | Ga0070714_100036631 | 3300005435 | Bacteria | 4115 |
| 88 | Ga0070714_100039615 | 3300005435 | Bacteria | 3968 |
| 89 | Ga0070714_100888778 | 3300005435 | Bacteria | 865 |
| 90 | Ga0070713_100000018 | 3300005436 | Bacteria | 118409 |
| 91 | Ga0070713_100001762 | 3300005436 | Bacteria | 13965 |
| 92 | Ga0070713_100016897 | 3300005436 | Bacteria | 5498 |
| 93 | Ga0070713_100031472 | 3300005436 | Bacteria | 4226 |
| 94 | Ga0070713_100053328 | 3300005436 | Bacteria | 3351 |
| 95 | Ga0070713_100073756 | 3300005436 | Bacteria | 2890 |
| 96 | Ga0070713_100457964 | 3300005436 | Bacteria | 1199 |
| 97 | Ga0070710_10000501 | 3300005437 | Bacteria | 18393 |
| 98 | Ga0070710_10002329 | 3300005437 | Bacteria | 8993 |
| 99 | Ga0070710_10008451 | 3300005437 | Bacteria | 5011 |
| 100 | Ga0070710_10021411 | 3300005437 | Bacteria | 3369 |
| 101 | Ga0070710_10044901 | 3300005437 | Bacteria | 2454 |
| 102 | Ga0070710_10139780 | 3300005437 | Bacteria | 1484 |
| 103 | Ga0070701_10016072 | 3300005438 | Bacteria | 3471 |
| 104 | Ga0070711_100003966 | 3300005439 | Bacteria | 8698 |
| 105 | Ga0070711_100009080 | 3300005439 | Bacteria | 6108 |
| 106 | Ga0070711_100014864 | 3300005439 | Bacteria | 4916 |
| 107 | Ga0070711_100031186 | 3300005439 | Bacteria | 3536 |
| 108 | Ga0070711_100050933 | 3300005439 | Bacteria | 2841 |
| 109 | Ga0070711_100127915 | 3300005439 | Bacteria | 1888 |
| 110 | Ga0070711_100279395 | 3300005439 | Bacteria | 1320 |
| 111 | Ga0070711_100477939 | 3300005439 | Bacteria | 1024 |
| 112 | Ga0070700_100042872 | 3300005441 | Bacteria | 2781 |
| 113 | Ga0070694_100263888 | 3300005444 | Unclassified | 1307 |
| 114 | Ga0070663_100024357 | 3300005455 | Bacteria | 4072 |
| 115 | Ga0070663_100148883 | 3300005455 | Bacteria | 1793 |
| 116 | Ga0070663_100257400 | 3300005455 | Bacteria | 1383 |
| 117 | Ga0070678_100000194 | 3300005456 | Bacteria | 26767 |
| 118 | Ga0070678_100000941 | 3300005456 | Bacteria | 14965 |
| 119 | Ga0070678_100028009 | 3300005456 | Bacteria | 3835 |
| 120 | Ga0070678_100033427 | 3300005456 | Bacteria | 3571 |
| 121 | Ga0070678_100069589 | 3300005456 | Bacteria | 2628 |
| 122 | Ga0070678_100268470 | 3300005456 | Bacteria | 1438 |
| 123 | Ga0070678_100532246 | 3300005456 | Bacteria | 1041 |
| 124 | Ga0070678_100737353 | 3300005456 | Bacteria | 890 |
| 125 | Ga0070662_100000120 | 3300005457 | Bacteria | 43782 |
| 126 | Ga0070662_100014078 | 3300005457 | Bacteria | 5334 |
| 127 | Ga0070662_100017566 | 3300005457 | Bacteria | 4825 |
| 128 | Ga0070662_100078996 | 3300005457 | Bacteria | 2445 |
| 129 | Ga0070662_100128597 | 3300005457 | Bacteria | 1950 |
| 130 | Ga0070681_10050801 | 3300005458 | Bacteria | 4137 |
| 131 | Ga0070681_10097627 | 3300005458 | Bacteria | 2885 |
| 132 | Ga0068867_100062565 | 3300005459 | Bacteria | 2765 |
| 133 | Ga0068867_100117031 | 3300005459 | Bacteria | 2055 |
| 134 | Ga0068867_100547437 | 3300005459 | Bacteria | 1002 |
| 135 | Ga0070685_10016352 | 3300005466 | Bacteria | 3952 |
| 136 | Ga0070698_100160616 | 3300005471 | Bacteria | 2191 |
| 137 | Ga0070679_100083118 | 3300005530 | Bacteria | 3191 |
| 138 | Ga0070679_100350568 | 3300005530 | Bacteria | 1424 |
| 139 | Ga0070684_100344952 | 3300005535 | Bacteria | 1369 |
| 140 | Ga0070697_100199098 | 3300005536 | Bacteria | 1702 |
| 141 | Ga0068853_100001080 | 3300005539 | Bacteria | 19275 |
| 142 | Ga0068853_100031659 | 3300005539 | Bacteria | 4475 |
| 143 | Ga0068853_100052626 | 3300005539 | Bacteria | 3507 |
| 144 | Ga0068853_100117706 | 3300005539 | Bacteria | 2367 |
| 145 | Ga0070672_100001583 | 3300005543 | Bacteria | 14108 |
| 146 | Ga0070672_100052573 | 3300005543 | Bacteria | 3181 |
| 147 | Ga0070686_100106246 | 3300005544 | Bacteria | 1905 |
| 148 | Ga0070686_100106775 | 3300005544 | Bacteria | 1901 |
| 149 | Ga0070695_100160857 | 3300005545 | Unclassified | 1576 |
| 150 | Ga0070665_100010384 | 3300005548 | Bacteria | 9422 |
| 151 | Ga0070665_100099334 | 3300005548 | Bacteria | 2914 |
| 152 | Ga0070665_100109385 | 3300005548 | Bacteria | 2766 |
| 153 | Ga0070665_100186781 | 3300005548 | Bacteria | 2073 |
| 154 | Ga0070665_100395511 | 3300005548 | Bacteria | 1390 |
| 155 | Ga0070665_100696448 | 3300005548 | Bacteria | 1029 |
| 156 | Ga0068855_100001125 | 3300005563 | Bacteria | 33195 |
| 157 | Ga0068855_100002492 | 3300005563 | Bacteria | 22681 |
| 158 | Ga0068855_100003366 | 3300005563 | Bacteria | 19577 |
| 159 | Ga0068855_100110719 | 3300005563 | Bacteria | 3152 |
| 160 | Ga0068855_100132740 | 3300005563 | Bacteria | 2842 |
| 161 | Ga0068855_100361975 | 3300005563 | Bacteria | 1596 |
| 162 | Ga0070664_100000226 | 3300005564 | Bacteria | 40249 |
| 163 | Ga0070664_100005943 | 3300005564 | Bacteria | 9859 |
| 164 | Ga0070664_100017178 | 3300005564 | Bacteria | 5939 |
| 165 | Ga0070664_100040115 | 3300005564 | Bacteria | 3946 |
| 166 | Ga0070664_100193235 | 3300005564 | Bacteria | 1814 |
| 167 | Ga0070664_100727509 | 3300005564 | Bacteria | 925 |
| 168 | Ga0068857_100243412 | 3300005577 | Bacteria | 1647 |
| 169 | Ga0068857_100403931 | 3300005577 | Bacteria | 1271 |
| 170 | Ga0068857_100742663 | 3300005577 | Bacteria | 934 |
| 171 | Ga0068854_100016658 | 3300005578 | Bacteria | 4904 |
| 172 | Ga0068854_100104455 | 3300005578 | Bacteria | 2128 |
| 173 | Ga0068854_100131156 | 3300005578 | Bacteria | 1914 |
| 174 | Ga0068854_100652432 | 3300005578 | Bacteria | 904 |
| 175 | Ga0068856_100001739 | 3300005614 | Bacteria | 22768 |
| 176 | Ga0068856_100005592 | 3300005614 | Bacteria | 12370 |
| 177 | Ga0068856_100006697 | 3300005614 | Bacteria | 11296 |
| 178 | Ga0068856_100051747 | 3300005614 | Bacteria | 4049 |
| 179 | Ga0068856_100490960 | 3300005614 | Bacteria | 1249 |
| 180 | Ga0070702_100029406 | 3300005615 | Bacteria | 2987 |
| 181 | Ga0068852_100041070 | 3300005616 | Bacteria | 3907 |
| 182 | Ga0068852_100064062 | 3300005616 | Bacteria | 3203 |
| 183 | Ga0068852_100072519 | 3300005616 | Bacteria | 3026 |
| 184 | Ga0068852_100143948 | 3300005616 | Bacteria | 2209 |
| 185 | Ga0068852_100523805 | 3300005616 | Bacteria | 1183 |
| 186 | Ga0068859_100044877 | 3300005617 | Bacteria | 4441 |
| 187 | Ga0068859_100084994 | 3300005617 | Bacteria | 3209 |
| 188 | Ga0068859_100440374 | 3300005617 | Bacteria | 1399 |
| 189 | Ga0068859_100798935 | 3300005617 | Bacteria | 1031 |
| 190 | Ga0068864_100003834 | 3300005618 | Bacteria | 12396 |
| 191 | Ga0068864_100044645 | 3300005618 | Bacteria | 3800 |
| 192 | Ga0068864_100083910 | 3300005618 | Bacteria | 2798 |
| 193 | Ga0068866_10027616 | 3300005718 | Bacteria | 2695 |
| 194 | Ga0068866_10046747 | 3300005718 | Bacteria | 2178 |
| 195 | Ga0068866_10064994 | 3300005718 | Bacteria | 1907 |
| 196 | Ga0068861_100021195 | 3300005719 | Bacteria | 4670 |
| 197 | Ga0068861_100040221 | 3300005719 | Bacteria | 3495 |
| 198 | Ga0068861_100050631 | 3300005719 | Bacteria | 3150 |
| 199 | Ga0068851_10004520 | 3300005834 | Bacteria | 6275 |
| 200 | Ga0068851_10008957 | 3300005834 | Bacteria | 4642 |
| 201 | Ga0068851_10050440 | 3300005834 | Bacteria | 2113 |
| 202 | Ga0068870_10115568 | 3300005840 | Unclassified | 1538 |
| 203 | Ga0068870_10218095 | 3300005840 | Bacteria | 1166 |
| 204 | Ga0068863_100007860 | 3300005841 | Bacteria | 10426 |
| 205 | Ga0068863_100049982 | 3300005841 | Bacteria | 3965 |
| 206 | Ga0068863_100092096 | 3300005841 | Bacteria | 2875 |
| 207 | Ga0068858_100022334 | 3300005842 | Bacteria | 5907 |
| 208 | Ga0068858_100065327 | 3300005842 | Bacteria | 3366 |
| 209 | Ga0068858_100358046 | 3300005842 | Bacteria | 1398 |
| 210 | Ga0068858_100485784 | 3300005842 | Bacteria | 1192 |
| 211 | Ga0068860_100083385 | 3300005843 | Bacteria | 3040 |
| 212 | Ga0068860_100115849 | 3300005843 | Bacteria | 2563 |
| 213 | Ga0068860_100160391 | 3300005843 | Bacteria | 2168 |
| 214 | Ga0068860_100225608 | 3300005843 | Bacteria | 1820 |
| 215 | Ga0068860_100335898 | 3300005843 | Bacteria | 1485 |
| 216 | Ga0068862_100177399 | 3300005844 | Bacteria | 1910 |
| 217 | Ga0081455_10002176 | 3300005937 | Bacteria | 23372 |
| 218 | Ga0081455_10006640 | 3300005937 | Bacteria | 12369 |
| 219 | Ga0081455_10155536 | 3300005937 | Bacteria | 1758 |
| 220 | Ga0081540_1000096 | 3300005983 | Bacteria | 92520 |
| 221 | Ga0081540_1001408 | 3300005983 | Bacteria | 20808 |
| 222 | Ga0081540_1005726 | 3300005983 | Bacteria | 9218 |
| 223 | Ga0081540_1022947 | 3300005983 | Bacteria | 3668 |
| 224 | Ga0081540_1022965 | 3300005983 | Bacteria | 3666 |
| 225 | Ga0081540_1041740 | 3300005983 | Bacteria | 2375 |
| 226 | Ga0081540_1050196 | 3300005983 | Bacteria | 2074 |
| 227 | Ga0081540_1081052 | 3300005983 | Bacteria | 1461 |
| 228 | Ga0081540_1134315 | 3300005983 | Bacteria | 1004 |
| 229 | Ga0081539_10001144 | 3300005985 | Bacteria | 48051 |
| 230 | Ga0081539_10049223 | 3300005985 | Bacteria | 2393 |
| 231 | Ga0081539_10052448 | 3300005985 | Bacteria | 2290 |
| 232 | Ga0070717_10001571 | 3300006028 | Bacteria | 15812 |
| 233 | Ga0070717_10355677 | 3300006028 | Bacteria | 1310 |
| 234 | Ga0075363_100123490 | 3300006048 | Bacteria | 1447 |
| 235 | Ga0075364_10000139 | 3300006051 | Bacteria | 31253 |
| 236 | Ga0075364_10013965 | 3300006051 | Bacteria | 4949 |
| 237 | Ga0075364_10072695 | 3300006051 | Bacteria | 2266 |
| 238 | Ga0075364_10126329 | 3300006051 | Bacteria | 1715 |
| 239 | Ga0075432_10015900 | 3300006058 | Bacteria | 2569 |
| 240 | Ga0070715_10001554 | 3300006163 | Bacteria | 6723 |
| 241 | Ga0070715_10007590 | 3300006163 | Bacteria | 3740 |
| 242 | Ga0070716_100001649 | 3300006173 | Bacteria | 10072 |
| 243 | Ga0070716_100004329 | 3300006173 | Bacteria | 6771 |
| 244 | Ga0070716_100010923 | 3300006173 | Bacteria | 4568 |
| 245 | Ga0070716_100040864 | 3300006173 | Bacteria | 2581 |
| 246 | Ga0070716_100053989 | 3300006173 | Bacteria | 2293 |
| 247 | Ga0070716_100162698 | 3300006173 | Bacteria | 1448 |
| 248 | Ga0070716_100223925 | 3300006173 | Bacteria | 1265 |
| 249 | Ga0070712_100004086 | 3300006175 | Bacteria | 8964 |
| 250 | Ga0070712_100083000 | 3300006175 | Bacteria | 2326 |
| 251 | Ga0070712_100156328 | 3300006175 | Bacteria | 1756 |
| 252 | Ga0070712_100204791 | 3300006175 | Bacteria | 1552 |
| 253 | Ga0075367_10108312 | 3300006178 | Bacteria | 1703 |
| 254 | Ga0075367_10172674 | 3300006178 | Bacteria | 1347 |
| 255 | Ga0075366_10025653 | 3300006195 | Bacteria | 3445 |
| 256 | Ga0075366_10103407 | 3300006195 | Bacteria | 1710 |
| 257 | Ga0097621_100000458 | 3300006237 | Bacteria | 28590 |
| 258 | Ga0097621_100078338 | 3300006237 | Bacteria | 2746 |
| 259 | Ga0068871_100000291 | 3300006358 | Bacteria | 35039 |
| 260 | Ga0068871_100061176 | 3300006358 | Bacteria | 3074 |
| 261 | Ga0068871_100073430 | 3300006358 | Bacteria | 2820 |
| 262 | Ga0068871_100266221 | 3300006358 | Bacteria | 1496 |
| 263 | Ga0068871_100295449 | 3300006358 | Bacteria | 1421 |
| 264 | Ga0068871_100425846 | 3300006358 | Bacteria | 1186 |
| 265 | Ga0075428_100001488 | 3300006844 | Bacteria | 25069 |
| 266 | Ga0075430_100121836 | 3300006846 | Bacteria | 2174 |
| 267 | Ga0075430_100209147 | 3300006846 | Bacteria | 1619 |
| 268 | Ga0075431_100000504 | 3300006847 | Bacteria | 32639 |
| 269 | Ga0075434_100039915 | 3300006871 | Bacteria | 4649 |
| 270 | Ga0075429_100000459 | 3300006880 | Bacteria | 30370 |
| 271 | Ga0075429_100416719 | 3300006880 | Bacteria | 1176 |
| 272 | Ga0068865_100010532 | 3300006881 | Bacteria | 5759 |
| 273 | Ga0068865_100106539 | 3300006881 | Bacteria | 2061 |
| 274 | Ga0068865_100215674 | 3300006881 | Bacteria | 1498 |
| 275 | Ga0068865_100265957 | 3300006881 | Unclassified | 1360 |
| 276 | Ga0068865_100288095 | 3300006881 | Bacteria | 1310 |
| 277 | Ga0075436_100321727 | 3300006914 | Bacteria | 1111 |
| 278 | Ga0097620_100044877 | 3300006931 | Bacteria | 4441 |
| 279 | Ga0097620_100084982 | 3300006931 | Bacteria | 3209 |
| 280 | Ga0097620_100440401 | 3300006931 | Bacteria | 1399 |
| 281 | Ga0097620_100798998 | 3300006931 | Bacteria | 1031 |
| 282 | Ga0075435_100027074 | 3300007076 | Bacteria | 4481 |
| 283 | Ga0075435_100586588 | 3300007076 | Bacteria | 966 |
| 284 | Ga0105240_10023182 | 3300009093 | Bacteria | 8219 |
| 285 | Ga0105240_10433924 | 3300009093 | Bacteria | 1473 |
| 286 | Ga0105240_10763200 | 3300009093 | Bacteria | 1050 |
| 287 | Ga0111539_10002196 | 3300009094 | Bacteria | 26061 |
| 288 | Ga0111539_10006967 | 3300009094 | Bacteria | 14509 |
| 289 | Ga0111539_10063702 | 3300009094 | Bacteria | 4362 |
| 290 | Ga0105245_10034600 | 3300009098 | Bacteria | 4482 |
| 291 | Ga0105245_10066003 | 3300009098 | Bacteria | 3274 |
| 292 | Ga0105245_10075278 | 3300009098 | Bacteria | 3073 |
| 293 | Ga0105245_10255076 | 3300009098 | Unclassified | 1705 |
| 294 | Ga0105245_10263303 | 3300009098 | Bacteria | 1679 |
| 295 | Ga0105245_10493065 | 3300009098 | Bacteria | 1240 |
| 296 | Ga0114129_10000593 | 3300009147 | Bacteria | 44778 |
| 297 | Ga0114129_11041476 | 3300009147 | Bacteria | 1028 |
| 298 | Ga0105243_10021629 | 3300009148 | Bacteria | 4883 |
| 299 | Ga0105243_10094039 | 3300009148 | Bacteria | 2475 |
| 300 | Ga0105243_10113817 | 3300009148 | Bacteria | 2269 |
| 301 | Ga0105243_10376049 | 3300009148 | Bacteria | 1312 |
| 302 | Ga0105243_10442189 | 3300009148 | Bacteria | 1218 |
| 303 | Ga0105241_10002214 | 3300009174 | Bacteria | 14629 |
| 304 | Ga0105241_10009474 | 3300009174 | Bacteria | 7155 |
| 305 | Ga0105241_10345929 | 3300009174 | Bacteria | 1290 |
| 306 | Ga0105242_10036944 | 3300009176 | Bacteria | 3921 |
| 307 | Ga0105242_10101044 | 3300009176 | Bacteria | 2444 |
| 308 | Ga0105242_10104288 | 3300009176 | Bacteria | 2407 |
| 309 | Ga0105242_10139739 | 3300009176 | Bacteria | 2100 |
| 310 | Ga0105242_10168506 | 3300009176 | Unclassified | 1923 |
| 311 | Ga0105242_10994125 | 3300009176 | Bacteria | 846 |
| 312 | Ga0105248_10006493 | 3300009177 | Bacteria | 12824 |
| 313 | Ga0105248_10051747 | 3300009177 | Bacteria | 4608 |
| 314 | Ga0105248_10104462 | 3300009177 | Bacteria | 3194 |
| 315 | Ga0105248_10116757 | 3300009177 | Bacteria | 3010 |
| 316 | Ga0105248_10496922 | 3300009177 | Bacteria | 1375 |
| 317 | Ga0105237_10177118 | 3300009545 | Bacteria | 2133 |
| 318 | Ga0105238_10013647 | 3300009551 | Bacteria | 8204 |
| 319 | Ga0105238_10044924 | 3300009551 | Bacteria | 4464 |
| 320 | Ga0105238_10062584 | 3300009551 | Bacteria | 3721 |
| 321 | Ga0105249_10019606 | 3300009553 | Bacteria | 6036 |
| 322 | Ga0105249_10073706 | 3300009553 | Bacteria | 3158 |
| 323 | Ga0105249_10236945 | 3300009553 | Unclassified | 1802 |
| 324 | Ga0099796_10002032 | 3300010159 | Bacteria | 4316 |
| 325 | Ga0105239_10042625 | 3300010375 | Bacteria | 4972 |
| 326 | Ga0105239_10084846 | 3300010375 | Bacteria | 3489 |
| 327 | Ga0105239_10140266 | 3300010375 | Bacteria | 2693 |
| 328 | Ga0105239_10204440 | 3300010375 | Bacteria | 2213 |
| 329 | Ga0105246_10032914 | 3300011119 | Bacteria | 3441 |
| 330 | Ga0105246_10060490 | 3300011119 | Bacteria | 2632 |
| 331 | Ga0105246_10064899 | 3300011119 | Bacteria | 2552 |
| 332 | Ga0105246_10189581 | 3300011119 | Bacteria | 1590 |
| 333 | Ga0105246_10218340 | 3300011119 | Bacteria | 1493 |
| 334 | Ga0105246_10650335 | 3300011119 | Bacteria | 918 |
| 335 | Ga0157327_1005464 | 3300012512 | Bacteria | 1031 |
| 336 | Ga0157373_10000824 | 3300013100 | Bacteria | 24025 |
| 337 | Ga0157373_10005021 | 3300013100 | Bacteria | 9939 |
| 338 | Ga0157371_10000769 | 3300013102 | Bacteria | 37033 |
| 339 | Ga0157371_10099752 | 3300013102 | Bacteria | 2059 |
| 340 | Ga0157371_10303600 | 3300013102 | Bacteria | 1156 |
| 341 | Ga0157370_10003726 | 3300013104 | Bacteria | 17814 |
| 342 | Ga0157370_10107283 | 3300013104 | Bacteria | 2612 |
| 343 | Ga0157370_10143609 | 3300013104 | Bacteria | 2223 |
| 344 | Ga0157370_10196144 | 3300013104 | Bacteria | 1874 |
| 345 | Ga0157370_10475022 | 3300013104 | Bacteria | 1149 |
| 346 | Ga0157369_10028062 | 3300013105 | Bacteria | 6233 |
| 347 | Ga0157369_10085368 | 3300013105 | Bacteria | 3374 |
| 348 | Ga0157369_10280726 | 3300013105 | Bacteria | 1734 |
| 349 | Ga0157369_10420906 | 3300013105 | Bacteria | 1385 |
| 350 | Ga0157374_10059054 | 3300013296 | Bacteria | 3585 |
| 351 | Ga0157374_10181773 | 3300013296 | Bacteria | 2054 |
| 352 | Ga0157374_10296608 | 3300013296 | Bacteria | 1599 |
| 353 | Ga0157374_10306473 | 3300013296 | Bacteria | 1572 |
| 354 | Ga0157378_10063263 | 3300013297 | Bacteria | 3306 |
| 355 | Ga0157378_10068127 | 3300013297 | Bacteria | 3191 |
| 356 | Ga0157378_10165162 | 3300013297 | Bacteria | 2073 |
| 357 | Ga0157378_10197025 | 3300013297 | Bacteria | 1903 |
| 358 | Ga0157378_10251308 | 3300013297 | Bacteria | 1693 |
| 359 | Ga0157378_10377978 | 3300013297 | Bacteria | 1391 |
| 360 | Ga0163162_10032188 | 3300013306 | Bacteria | 5206 |
| 361 | Ga0163162_10039769 | 3300013306 | Bacteria | 4700 |
| 362 | Ga0163162_10067406 | 3300013306 | Bacteria | 3629 |
| 363 | Ga0163162_10073390 | 3300013306 | Bacteria | 3477 |
| 364 | Ga0163162_10085192 | 3300013306 | Bacteria | 3237 |
| 365 | Ga0163162_10140412 | 3300013306 | Bacteria | 2529 |
| 366 | Ga0163162_10143832 | 3300013306 | Bacteria | 2499 |
| 367 | Ga0163162_10246251 | 3300013306 | Bacteria | 1919 |
| 368 | Ga0163162_10359423 | 3300013306 | Bacteria | 1589 |
| 369 | Ga0157372_10002479 | 3300013307 | Bacteria | 20002 |
| 370 | Ga0157372_10010519 | 3300013307 | Bacteria | 9846 |
| 371 | Ga0157372_10031751 | 3300013307 | Bacteria | 5785 |
| 372 | Ga0157372_10092578 | 3300013307 | Bacteria | 3439 |
| 373 | Ga0157372_10141524 | 3300013307 | Bacteria | 2772 |
| 374 | Ga0157372_10159884 | 3300013307 | Bacteria | 2603 |
| 375 | Ga0157372_10178656 | 3300013307 | Bacteria | 2457 |
| 376 | Ga0157372_10204695 | 3300013307 | Bacteria | 2287 |
| 377 | Ga0157372_10254272 | 3300013307 | Bacteria | 2040 |
| 378 | Ga0157372_10266343 | 3300013307 | Bacteria | 1990 |
| 379 | Ga0157375_10001717 | 3300013308 | Bacteria | 18818 |
| 380 | Ga0157375_10012282 | 3300013308 | Bacteria | 7595 |
| 381 | Ga0157375_10110716 | 3300013308 | Bacteria | 2844 |
| 382 | Ga0157375_10181771 | 3300013308 | Bacteria | 2255 |
| 383 | Ga0157375_10603888 | 3300013308 | Bacteria | 1256 |
| 384 | Ga0157375_10731325 | 3300013308 | Unclassified | 1142 |
| 385 | Ga0163163_10045052 | 3300014325 | Bacteria | 4329 |
| 386 | Ga0163163_10710470 | 3300014325 | Bacteria | 1069 |
| 387 | Ga0157380_10013259 | 3300014326 | Bacteria | 6004 |
| 388 | Ga0157380_10039591 | 3300014326 | Bacteria | 3667 |
| 389 | Ga0157380_10079154 | 3300014326 | Bacteria | 2683 |
| 390 | Ga0157380_10099241 | 3300014326 | Bacteria | 2421 |
| 391 | Ga0157380_10130913 | 3300014326 | Bacteria | 2140 |
| 392 | Ga0157380_10675784 | 3300014326 | Bacteria | 1034 |
| 393 | Ga0157377_10061685 | 3300014745 | Bacteria | 2143 |
| 394 | Ga0157377_10098481 | 3300014745 | Bacteria | 1738 |
| 395 | Ga0157377_10315761 | 3300014745 | Bacteria | 1036 |
| 396 | Ga0157379_10009759 | 3300014968 | Bacteria | 8364 |
| 397 | Ga0157379_10082823 | 3300014968 | Bacteria | 2875 |
| 398 | Ga0157379_10181755 | 3300014968 | Bacteria | 1900 |
| 399 | Ga0157376_10003346 | 3300014969 | Bacteria | 11026 |
| 400 | Ga0157376_10015103 | 3300014969 | Bacteria | 5821 |
| 401 | Ga0157376_10026515 | 3300014969 | Bacteria | 4581 |
| 402 | Ga0157376_10215245 | 3300014969 | Bacteria | 1776 |
| 403 | Ga0157376_10228096 | 3300014969 | Bacteria | 1729 |
| 404 | Ga0157376_10368435 | 3300014969 | Bacteria | 1380 |
| 405 | Ga0157376_10807638 | 3300014969 | Bacteria | 951 |
| 406 | Ga0157376_10939892 | 3300014969 | Bacteria | 885 |
| 407 | Ga0163161_10019650 | 3300017792 | Bacteria | 4738 |
| 408 | Ga0163161_10066810 | 3300017792 | Bacteria | 2626 |
| 409 | Ga0163161_10114306 | 3300017792 | Bacteria | 2022 |
| 410 | Ga0163161_10124692 | 3300017792 | Bacteria | 1938 |
| 411 | Ga0213874_10006091 | 3300021377 | Bacteria | 2840 |
| 412 | Ga0213876_10001691 | 3300021384 | Bacteria | 13417 |
| 413 | Ga0213876_10003521 | 3300021384 | Bacteria | 8929 |
| 414 | Ga0213876_10086506 | 3300021384 | Bacteria | 1659 |
| 415 | Ga0213875_10038294 | 3300021388 | Bacteria | 2259 |
| 416 | Ga0207673_1003356 | 3300025290 | Bacteria | 1869 |
| 417 | Ga0209256_1000689 | 3300025299 | Bacteria | 45269 |
| 418 | Ga0207697_10137385 | 3300025315 | Bacteria | 1059 |
| 419 | Ga0207656_10044825 | 3300025321 | Bacteria | 1890 |
| 420 | Ga0207682_10000872 | 3300025893 | Bacteria | 13986 |
| 421 | Ga0207692_10001173 | 3300025898 | Bacteria | 9689 |
| 422 | Ga0207692_10002425 | 3300025898 | Bacteria | 7152 |
| 423 | Ga0207692_10029057 | 3300025898 | Bacteria | 2622 |
| 424 | Ga0207642_10023701 | 3300025899 | Unclassified | 2456 |
| 425 | Ga0207642_10032431 | 3300025899 | Bacteria | 2199 |
| 426 | Ga0207688_10001682 | 3300025901 | Bacteria | 11710 |
| 427 | Ga0207688_10016260 | 3300025901 | Bacteria | 4034 |
| 428 | Ga0207688_10083971 | 3300025901 | Bacteria | 1822 |
| 429 | Ga0207688_10174175 | 3300025901 | Bacteria | 1280 |
| 430 | Ga0207688_10197177 | 3300025901 | Bacteria | 1206 |
| 431 | Ga0207680_10032448 | 3300025903 | Bacteria | 2969 |
| 432 | Ga0207680_10052152 | 3300025903 | Bacteria | 2449 |
| 433 | Ga0207685_10001412 | 3300025905 | Bacteria | 5012 |
| 434 | Ga0207685_10074320 | 3300025905 | Bacteria | 1387 |
| 435 | Ga0207699_10002658 | 3300025906 | Bacteria | 8439 |
| 436 | Ga0207699_10007883 | 3300025906 | Bacteria | 5223 |
| 437 | Ga0207699_10043223 | 3300025906 | Bacteria | 2616 |
| 438 | Ga0207645_10001481 | 3300025907 | Bacteria | 19198 |
| 439 | Ga0207645_10102929 | 3300025907 | Bacteria | 1843 |
| 440 | Ga0207643_10002283 | 3300025908 | Bacteria | 10438 |
| 441 | Ga0207643_10121590 | 3300025908 | Unclassified | 1547 |
| 442 | Ga0207705_10078878 | 3300025909 | Bacteria | 2397 |
| 443 | Ga0207705_10080683 | 3300025909 | Bacteria | 2370 |
| 444 | Ga0207705_10087369 | 3300025909 | Bacteria | 2280 |
| 445 | Ga0207654_10062334 | 3300025911 | Bacteria | 2184 |
| 446 | Ga0207654_10064587 | 3300025911 | Bacteria | 2152 |
| 447 | Ga0207707_10007412 | 3300025912 | Bacteria | 9557 |
| 448 | Ga0207707_10054164 | 3300025912 | Bacteria | 3492 |
| 449 | Ga0207707_10126079 | 3300025912 | Bacteria | 2239 |
| 450 | Ga0207695_10010787 | 3300025913 | Bacteria | 11142 |
| 451 | Ga0207695_10034941 | 3300025913 | Bacteria | 5458 |
| 452 | Ga0207695_10462875 | 3300025913 | Bacteria | 1151 |
| 453 | Ga0207671_10158982 | 3300025914 | Bacteria | 1749 |
| 454 | Ga0207693_10001660 | 3300025915 | Bacteria | 19619 |
| 455 | Ga0207693_10004561 | 3300025915 | Bacteria | 11693 |
| 456 | Ga0207693_10008700 | 3300025915 | Bacteria | 8301 |
| 457 | Ga0207693_10009095 | 3300025915 | Bacteria | 8107 |
| 458 | Ga0207693_10020362 | 3300025915 | Bacteria | 5277 |
| 459 | Ga0207693_10043024 | 3300025915 | Bacteria | 3555 |
| 460 | Ga0207693_10306071 | 3300025915 | Bacteria | 1244 |
| 461 | Ga0207663_10000327 | 3300025916 | Bacteria | 20836 |
| 462 | Ga0207663_10005738 | 3300025916 | Bacteria | 6283 |
| 463 | Ga0207663_10013842 | 3300025916 | Bacteria | 4398 |
| 464 | Ga0207663_10014468 | 3300025916 | Bacteria | 4320 |
| 465 | Ga0207663_10048493 | 3300025916 | Bacteria | 2629 |
| 466 | Ga0207663_10175642 | 3300025916 | Bacteria | 1525 |
| 467 | Ga0207663_10267885 | 3300025916 | Bacteria | 1264 |
| 468 | Ga0207663_10360754 | 3300025916 | Bacteria | 1102 |
| 469 | Ga0207663_10698042 | 3300025916 | Bacteria | 803 |
| 470 | Ga0207660_10007745 | 3300025917 | Bacteria | 6955 |
| 471 | Ga0207660_10015325 | 3300025917 | Bacteria | 5057 |
| 472 | Ga0207660_10058814 | 3300025917 | Bacteria | 2757 |
| 473 | Ga0207660_10135008 | 3300025917 | Bacteria | 1882 |
| 474 | Ga0207662_10001442 | 3300025918 | Bacteria | 11539 |
| 475 | Ga0207657_10000102 | 3300025919 | Bacteria | 82096 |
| 476 | Ga0207657_10000250 | 3300025919 | Bacteria | 57310 |
| 477 | Ga0207657_10016616 | 3300025919 | Bacteria | 7090 |
| 478 | Ga0207657_10039174 | 3300025919 | Bacteria | 4214 |
| 479 | Ga0207657_10081255 | 3300025919 | Bacteria | 2723 |
| 480 | Ga0207657_10337154 | 3300025919 | Bacteria | 1190 |
| 481 | Ga0207657_10403093 | 3300025919 | Bacteria | 1076 |
| 482 | Ga0207649_10025902 | 3300025920 | Bacteria | 3426 |
| 483 | Ga0207649_10245725 | 3300025920 | Bacteria | 1287 |
| 484 | Ga0207649_10275556 | 3300025920 | Bacteria | 1221 |
| 485 | Ga0207652_10003521 | 3300025921 | Bacteria | 12909 |
| 486 | Ga0207652_10077656 | 3300025921 | Bacteria | 2898 |
| 487 | Ga0207681_10008492 | 3300025923 | Bacteria | 6277 |
| 488 | Ga0207681_10041663 | 3300025923 | Bacteria | 3063 |
| 489 | Ga0207650_10002771 | 3300025925 | Bacteria | 12104 |
| 490 | Ga0207659_10011351 | 3300025926 | Bacteria | 5625 |
| 491 | Ga0207659_10216155 | 3300025926 | Bacteria | 1539 |
| 492 | Ga0207687_10139372 | 3300025927 | Unclassified | 1838 |
| 493 | Ga0207700_10000052 | 3300025928 | Bacteria | 76498 |
| 494 | Ga0207700_10009348 | 3300025928 | Bacteria | 6117 |
| 495 | Ga0207700_10024470 | 3300025928 | Bacteria | 4179 |
| 496 | Ga0207700_10106497 | 3300025928 | Bacteria | 2248 |
| 497 | Ga0207700_10314009 | 3300025928 | Bacteria | 1356 |
| 498 | Ga0207700_10453881 | 3300025928 | Bacteria | 1130 |
| 499 | Ga0207664_10012367 | 3300025929 | Bacteria | 6099 |
| 500 | Ga0207664_10015521 | 3300025929 | Bacteria | 5531 |
| 501 | Ga0207664_10018323 | 3300025929 | Bacteria | 5151 |
| 502 | Ga0207664_10130011 | 3300025929 | Bacteria | 2119 |
| 503 | Ga0207664_10196164 | 3300025929 | Bacteria | 1740 |
| 504 | Ga0207644_10003032 | 3300025931 | Bacteria | 10806 |
| 505 | Ga0207644_10003185 | 3300025931 | Bacteria | 10567 |
| 506 | Ga0207644_10140534 | 3300025931 | Bacteria | 1859 |
| 507 | Ga0207644_10173928 | 3300025931 | Bacteria | 1683 |
| 508 | Ga0207644_10471021 | 3300025931 | Bacteria | 1034 |
| 509 | Ga0207690_10000595 | 3300025932 | Bacteria | 23415 |
| 510 | Ga0207690_10011334 | 3300025932 | Bacteria | 5330 |
| 511 | Ga0207690_10021388 | 3300025932 | Bacteria | 4011 |
| 512 | Ga0207706_10000095 | 3300025933 | Bacteria | 92378 |
| 513 | Ga0207706_10002865 | 3300025933 | Bacteria | 16735 |
| 514 | Ga0207706_10003460 | 3300025933 | Bacteria | 15072 |
| 515 | Ga0207706_10015256 | 3300025933 | Bacteria | 6948 |
| 516 | Ga0207686_10095491 | 3300025934 | Unclassified | 1973 |
| 517 | Ga0207686_10182589 | 3300025934 | Bacteria | 1489 |
| 518 | Ga0207686_10210907 | 3300025934 | Bacteria | 1396 |
| 519 | Ga0207686_10249571 | 3300025934 | Bacteria | 1296 |
| 520 | Ga0207709_10006513 | 3300025935 | Bacteria | 6559 |
| 521 | Ga0207709_10076201 | 3300025935 | Bacteria | 2146 |
| 522 | Ga0207709_10280804 | 3300025935 | Unclassified | 1230 |
| 523 | Ga0207670_10062251 | 3300025936 | Bacteria | 2549 |
| 524 | Ga0207669_10004853 | 3300025937 | Bacteria | 5970 |
| 525 | Ga0207669_10120571 | 3300025937 | Bacteria | 1779 |
| 526 | Ga0207669_10511394 | 3300025937 | Unclassified | 963 |
| 527 | Ga0207704_10131322 | 3300025938 | Bacteria | 1735 |
| 528 | Ga0207704_10263558 | 3300025938 | Bacteria | 1300 |
| 529 | Ga0207665_10002675 | 3300025939 | Bacteria | 11969 |
| 530 | Ga0207665_10003693 | 3300025939 | Bacteria | 10226 |
| 531 | Ga0207665_10006131 | 3300025939 | Bacteria | 7983 |
| 532 | Ga0207665_10010080 | 3300025939 | Bacteria | 6207 |
| 533 | Ga0207665_10026007 | 3300025939 | Bacteria | 3862 |
| 534 | Ga0207665_10070391 | 3300025939 | Bacteria | 2387 |
| 535 | Ga0207665_10077543 | 3300025939 | Bacteria | 2281 |
| 536 | Ga0207691_10000894 | 3300025940 | Bacteria | 29574 |
| 537 | Ga0207691_10004886 | 3300025940 | Bacteria | 12955 |
| 538 | Ga0207691_10102875 | 3300025940 | Bacteria | 2547 |
| 539 | Ga0207711_10007597 | 3300025941 | Bacteria | 9068 |
| 540 | Ga0207711_10051104 | 3300025941 | Bacteria | 3539 |
| 541 | Ga0207711_10114357 | 3300025941 | Bacteria | 2403 |
| 542 | Ga0207711_10151761 | 3300025941 | Bacteria | 2091 |
| 543 | Ga0207711_10582592 | 3300025941 | Bacteria | 1044 |
| 544 | Ga0207689_10018574 | 3300025942 | Bacteria | 5865 |
| 545 | Ga0207689_10105947 | 3300025942 | Bacteria | 2310 |
| 546 | Ga0207689_10146286 | 3300025942 | Bacteria | 1947 |
| 547 | Ga0207661_10187983 | 3300025944 | Bacteria | 1809 |
| 548 | Ga0207661_10361023 | 3300025944 | Bacteria | 1312 |
| 549 | Ga0207661_10743673 | 3300025944 | Bacteria | 902 |
| 550 | Ga0207679_10001787 | 3300025945 | Bacteria | 13382 |
| 551 | Ga0207679_10009965 | 3300025945 | Bacteria | 6105 |
| 552 | Ga0207679_10063511 | 3300025945 | Bacteria | 2756 |
| 553 | Ga0207679_10148665 | 3300025945 | Bacteria | 1904 |
| 554 | Ga0207679_10183893 | 3300025945 | Bacteria | 1731 |
| 555 | Ga0207667_10000233 | 3300025949 | Bacteria | 77272 |
| 556 | Ga0207667_10012539 | 3300025949 | Bacteria | 9756 |
| 557 | Ga0207667_10028313 | 3300025949 | Bacteria | 6087 |
| 558 | Ga0207667_10036146 | 3300025949 | Bacteria | 5296 |
| 559 | Ga0207667_10087482 | 3300025949 | Bacteria | 3223 |
| 560 | Ga0207667_10109962 | 3300025949 | Bacteria | 2843 |
| 561 | Ga0207667_10154801 | 3300025949 | Bacteria | 2359 |
| 562 | Ga0207651_10016952 | 3300025960 | Bacteria | 4288 |
| 563 | Ga0207651_10277452 | 3300025960 | Bacteria | 1383 |
| 564 | Ga0207712_10018971 | 3300025961 | Bacteria | 4487 |
| 565 | Ga0207712_10664453 | 3300025961 | Bacteria | 907 |
| 566 | Ga0207668_10014214 | 3300025972 | Bacteria | 4923 |
| 567 | Ga0207668_10015143 | 3300025972 | Bacteria | 4787 |
| 568 | Ga0207668_10016667 | 3300025972 | Bacteria | 4590 |
| 569 | Ga0207668_10155437 | 3300025972 | Bacteria | 1776 |
| 570 | Ga0207668_10475962 | 3300025972 | Bacteria | 1070 |
| 571 | Ga0207640_10231774 | 3300025981 | Bacteria | 1421 |
| 572 | Ga0207658_10001269 | 3300025986 | Bacteria | 19957 |
| 573 | Ga0207658_10047079 | 3300025986 | Bacteria | 3154 |
| 574 | Ga0207658_10050170 | 3300025986 | Bacteria | 3069 |
| 575 | Ga0207677_10149957 | 3300026023 | Bacteria | 1797 |
| 576 | Ga0207677_10441179 | 3300026023 | Bacteria | 1113 |
| 577 | Ga0207703_10027561 | 3300026035 | Bacteria | 4473 |
| 578 | Ga0207703_10069412 | 3300026035 | Bacteria | 2906 |
| 579 | Ga0207703_10220414 | 3300026035 | Bacteria | 1696 |
| 580 | Ga0207703_10306462 | 3300026035 | Bacteria | 1450 |
| 581 | Ga0207703_10443575 | 3300026035 | Bacteria | 1211 |
| 582 | Ga0207703_10607823 | 3300026035 | Bacteria | 1035 |
| 583 | Ga0207703_10644066 | 3300026035 | Bacteria | 1005 |
| 584 | Ga0207703_10838066 | 3300026035 | Bacteria | 879 |
| 585 | Ga0207639_10027371 | 3300026041 | Bacteria | 4154 |
| 586 | Ga0207639_10032866 | 3300026041 | Bacteria | 3823 |
| 587 | Ga0207639_10043431 | 3300026041 | Bacteria | 3374 |
| 588 | Ga0207639_10091583 | 3300026041 | Bacteria | 2435 |
| 589 | Ga0207639_10355285 | 3300026041 | Bacteria | 1310 |
| 590 | Ga0207678_10001717 | 3300026067 | Bacteria | 20059 |
| 591 | Ga0207678_10003576 | 3300026067 | Bacteria | 13974 |
| 592 | Ga0207678_10004513 | 3300026067 | Bacteria | 12518 |
| 593 | Ga0207678_10031337 | 3300026067 | Bacteria | 4638 |
| 594 | Ga0207678_10105656 | 3300026067 | Bacteria | 2402 |
| 595 | Ga0207678_10121418 | 3300026067 | Bacteria | 2230 |
| 596 | Ga0207708_10000558 | 3300026075 | Bacteria | 28801 |
| 597 | Ga0207708_10042552 | 3300026075 | Bacteria | 3462 |
| 598 | Ga0207708_10078335 | 3300026075 | Bacteria | 2537 |
| 599 | Ga0207702_10003371 | 3300026078 | Bacteria | 14642 |
| 600 | Ga0207702_10008525 | 3300026078 | Bacteria | 8644 |
| 601 | Ga0207702_10056084 | 3300026078 | Bacteria | 3344 |
| 602 | Ga0207702_10078347 | 3300026078 | Bacteria | 2861 |
| 603 | Ga0207702_10176980 | 3300026078 | Bacteria | 1961 |
| 604 | Ga0207641_10008303 | 3300026088 | Bacteria | 8580 |
| 605 | Ga0207641_10213201 | 3300026088 | Bacteria | 1787 |
| 606 | Ga0207648_10021284 | 3300026089 | Bacteria | 5829 |
| 607 | Ga0207648_10042493 | 3300026089 | Bacteria | 3990 |
| 608 | Ga0207648_10243989 | 3300026089 | Bacteria | 1600 |
| 609 | Ga0207676_10027045 | 3300026095 | Bacteria | 4269 |
| 610 | Ga0207674_10000326 | 3300026116 | Bacteria | 60670 |
| 611 | Ga0207674_10002376 | 3300026116 | Bacteria | 23789 |
| 612 | Ga0207674_10099180 | 3300026116 | Bacteria | 2895 |
| 613 | Ga0207674_10156104 | 3300026116 | Bacteria | 2237 |
| 614 | Ga0207674_10278224 | 3300026116 | Bacteria | 1621 |
| 615 | Ga0207675_100002315 | 3300026118 | Bacteria | 18913 |
| 616 | Ga0207675_100031636 | 3300026118 | Bacteria | 4930 |
| 617 | Ga0207675_100076680 | 3300026118 | Bacteria | 3131 |
| 618 | Ga0207675_100173538 | 3300026118 | Bacteria | 2062 |
| 619 | Ga0207675_100266389 | 3300026118 | Unclassified | 1662 |
| 620 | Ga0207683_10006767 | 3300026121 | Bacteria | 9810 |
| 621 | Ga0207683_10009942 | 3300026121 | Bacteria | 8114 |
| 622 | Ga0207683_10012309 | 3300026121 | Bacteria | 7303 |
| 623 | Ga0207683_10030660 | 3300026121 | Bacteria | 4661 |
| 624 | Ga0207683_10036404 | 3300026121 | Bacteria | 4286 |
| 625 | Ga0207683_10073358 | 3300026121 | Bacteria | 3027 |
| 626 | Ga0207683_10094761 | 3300026121 | Bacteria | 2661 |
| 627 | Ga0207683_10202154 | 3300026121 | Bacteria | 1806 |
| 628 | Ga0207698_10026071 | 3300026142 | Bacteria | 4130 |
| 629 | Ga0207698_10151859 | 3300026142 | Bacteria | 2011 |
| 630 | Ga0209982_1012290 | 3300027552 | Bacteria | 1283 |
| 631 | Ga0209966_1019300 | 3300027695 | Bacteria | 1312 |
| 632 | Ga0209974_10001061 | 3300027876 | Bacteria | 9744 |
| 633 | Ga0209974_10006336 | 3300027876 | Bacteria | 4134 |
| 634 | Ga0207428_10007060 | 3300027907 | Bacteria | 10283 |
| 635 | Ga0207428_10099895 | 3300027907 | Bacteria | 2243 |
| 636 | Ga0268266_10083840 | 3300028379 | Bacteria | 2782 |
| 637 | Ga0268266_10103401 | 3300028379 | Bacteria | 2513 |
| 638 | Ga0268266_10123252 | 3300028379 | Bacteria | 2309 |
| 639 | Ga0268266_10135196 | 3300028379 | Bacteria | 2208 |
| 640 | Ga0268266_10322461 | 3300028379 | Bacteria | 1446 |
| 641 | Ga0268266_10617226 | 3300028379 | Bacteria | 1042 |
| 642 | Ga0268265_10110725 | 3300028380 | Bacteria | 2241 |
| 643 | Ga0268265_10906437 | 3300028380 | Bacteria | 866 |
| 644 | Ga0268264_10038116 | 3300028381 | Bacteria | 3965 |
| 645 | Ga0268264_10292694 | 3300028381 | Bacteria | 1530 |
| 646 | Ga0268264_10559880 | 3300028381 | Bacteria | 1122 |
| 647 | Ga0307408_100010802 | 3300031548 | Bacteria | 6025 |
| 648 | Ga0316576_10248069 | 3300031727 | Unclassified | 1337 |
| 649 | Ga0307516_10178619 | 3300031730 | Bacteria | 1858 |
| 650 | Ga0307413_10545539 | 3300031824 | Bacteria | 939 |
| 651 | Ga0307410_10062735 | 3300031852 | Bacteria | 2547 |
| 652 | Ga0307406_10005700 | 3300031901 | Bacteria | 6817 |
| 653 | Ga0307412_10071352 | 3300031911 | Bacteria | 2371 |
| 654 | Ga0307409_100017959 | 3300031995 | Bacteria | 4734 |
| 655 | Ga0307416_100002602 | 3300032002 | Bacteria | 10424 |
| 656 | Ga0307416_100028588 | 3300032002 | Bacteria | 4149 |
| 657 | Ga0307416_100094609 | 3300032002 | Bacteria | 2577 |
| 658 | Ga0307510_10073939 | 3300033180 | Bacteria | 3372 |
| 659 | Ga0373929_0020363 | 3300035085 | Bacteria | 1337 |
| 660 | Ga0373945_0003413 | 3300035116 | Bacteria | 4998 |
| 661 | Ga0373945_0056554 | 3300035116 | Bacteria | 1455 |
| 662 | Ga0373954_0029083 | 3300035118 | Bacteria | 2544 |
| 663 | Ga0373956_0200311 | 3300035119 | Bacteria | 946 |
| 664 | Ga0373943_0009284 | 3300035170 | Bacteria | 4407 |
| 665 | Ga0373943_0043916 | 3300035170 | Bacteria | 2173 |
| 666 | Ga0373943_0148731 | 3300035170 | Unclassified | 1267 |
| 667 | Ga0373946_0059070 | 3300035171 | Bacteria | 1626 |
| 668 | Ga0373946_0261798 | 3300035171 | Bacteria | 846 |
| 669 | Ga0316574_0000860 | 3300035398 | Bacteria | 13359 |
| 670 | Ga0316574_0052741 | 3300035398 | Bacteria | 2537 |
| 671 | Ga0373931_0013132 | 3300035691 | Bacteria | 4028 |
| 672 | Ga0373935_0005109 | 3300035692 | Bacteria | 7727 |
| 673 | Ga0373935_0204223 | 3300035692 | Bacteria | 1367 |
| 674 | Ga0373927_0001870 | 3300035695 | Bacteria | 15587 |
| 675 | Ga0373927_0014378 | 3300035695 | Bacteria | 5239 |
| 676 | Ga0373927_0107770 | 3300035695 | Bacteria | 1815 |
| 677 | Ga0373927_0147662 | 3300035695 | Unclassified | 1539 |
| 678 | Ga0373933_0105186 | 3300035724 | Bacteria | 1755 |
| 679 | Ga0373947_0004918 | 3300035725 | Bacteria | 7814 |
| 680 | Ga0373947_0082924 | 3300035725 | Bacteria | 1988 |
| 681 | Ga0373937_0021190 | 3300036401 | Bacteria | 5833 |
| 682 | Ga0373937_0213932 | 3300036401 | Bacteria | 1814 |
| 683 | Ga0316582_0140697 | 3300036647 | Bacteria | 1627 |
| 684 | Ga0373925_0003141 | 3300037068 | Bacteria | 12962 |
| 685 | Ga0373925_0004558 | 3300037068 | Bacteria | 10469 |
| 686 | Ga0373925_0020423 | 3300037068 | Bacteria | 4822 |
| 687 | Ga0373925_0066467 | 3300037068 | Bacteria | 2718 |
| 688 | Ga0373925_0377574 | 3300037068 | Bacteria | 1154 |
| 689 | Ga0395899_0148967 | 3300037312 | Unclassified | 1660 |
| 690 | Ga0395900_0086129 | 3300037418 | Bacteria | 3229 |
| 691 | Ga0395898_0002249 | 3300037466 | Bacteria | 23453 |
| 692 | Ga0395898_0592444 | 3300037466 | Bacteria | 1051 |
| 693 | Ga0395905_0110789 | 3300037471 | Bacteria | 2578 |
| 694 | Ga0395905_0519260 | 3300037471 | Bacteria | 1091 |
| 695 | Ga0436364_0269804 | 3300037853 | Bacteria | 37417 |
| 696 | Ga0395901_0064332 | 3300038443 | Bacteria | 3818 |
| 697 | Ga0395901_0096935 | 3300038443 | Bacteria | 3091 |
| 698 | Ga0395901_0276939 | 3300038443 | Bacteria | 1744 |
| 699 | Ga0436365_0011381 | 3300039437 | Bacteria | 1150 |
| 700 | Ga0436365_0265841 | 3300039437 | Bacteria | 1036 |
| 701 | Ga0436365_0321374 | 3300039437 | Bacteria | 2518 |
| 702 | Ga0436365_0350464 | 3300039437 | Bacteria | 938 |
| 703 | Ga0436365_0954239 | 3300039437 | Bacteria | 40865 |
| 704 | Ga0436360_0539211 | 3300039438 | Bacteria | 2601 |
| 705 | Ga0436360_1089733 | 3300039438 | Bacteria | 1242 |
| 706 | Ga0436363_0538486 | 3300039450 | Bacteria | 18425 |
| 707 | Ga0436362_0223954 | 3300039453 | Bacteria | 1435 |
| 708 | Ga0451853_3234775 | 3300041512 | Bacteria | 1698 |
| 709 | Ga0451853_3961465 | 3300041512 | Bacteria | 1745 |
| 710 | Ga0439435_0043784 | 3300042436 | Bacteria | 1260 |
| 711 | Ga0466967_0062646 | 3300045976 | Bacteria | 3302 |
| 712 | Ga0495617_029819 | 3300046452 | Bacteria | 1834 |
| 713 | Ga0495592_0060981 | 3300046454 | Bacteria | 2773 |
| 714 | Ga0495603_0000298 | 3300046455 | Bacteria | 26417 |
| 715 | Ga0495603_0006456 | 3300046455 | Bacteria | 7023 |
| 716 | Ga0495603_0070400 | 3300046455 | Bacteria | 2056 |
| 717 | Ga0495603_0186634 | 3300046455 | Bacteria | 1199 |
| 718 | Ga0495629_0000336 | 3300046459 | Bacteria | 40110 |
| 719 | Ga0495641_0001543 | 3300046461 | Bacteria | 19560 |
| 720 | Ga0495651_0000461 | 3300046462 | Bacteria | 31219 |
| 721 | Ga0495580_0004668 | 3300046472 | Bacteria | 11493 |
| 722 | Ga0495580_0053641 | 3300046472 | Bacteria | 2844 |
| 723 | Ga0495580_0135281 | 3300046472 | Bacteria | 1709 |
| 724 | Ga0495580_0297421 | 3300046472 | Bacteria | 1099 |
| 725 | Ga0495582_0000134 | 3300046473 | Bacteria | 39810 |
| 726 | Ga0495582_0093755 | 3300046473 | Bacteria | 1676 |
| 727 | Ga0495582_0243400 | 3300046473 | Bacteria | 1031 |
| 728 | Ga0495639_0001666 | 3300046475 | Bacteria | 9877 |
| 729 | Ga0495639_0116832 | 3300046475 | Bacteria | 1270 |
| 730 | Ga0495662_0000247 | 3300046476 | Bacteria | 22850 |
| 731 | Ga0495664_0002841 | 3300046477 | Bacteria | 9325 |
| 732 | Ga0495664_0007422 | 3300046477 | Bacteria | 6088 |
| 733 | Ga0495664_0036424 | 3300046477 | Bacteria | 2900 |
| 734 | Ga0495585_0124186 | 3300046492 | Bacteria | 1363 |
| 735 | Ga0495594_0001158 | 3300046499 | Bacteria | 13771 |
| 736 | Ga0495594_0048999 | 3300046499 | Bacteria | 2321 |
| 737 | Ga0495594_0147168 | 3300046499 | Bacteria | 1337 |
| 738 | Ga0495594_0171646 | 3300046499 | Bacteria | 1234 |
| 739 | Ga0495594_0199645 | 3300046499 | Bacteria | 1140 |
| 740 | Ga0495583_0009837 | 3300046506 | Bacteria | 5662 |
| 741 | Ga0495608_0011744 | 3300046511 | Bacteria | 6091 |
| 742 | Ga0495628_0031305 | 3300046516 | Bacteria | 4304 |
| 743 | Ga0495630_0003037 | 3300046517 | Bacteria | 11649 |
| 744 | Ga0495630_0015478 | 3300046517 | Bacteria | 5570 |
| 745 | Ga0495630_0038590 | 3300046517 | Bacteria | 3573 |
| 746 | Ga0495666_0019067 | 3300046526 | Bacteria | 3407 |
| 747 | Ga0495652_0004619 | 3300046529 | Bacteria | 13125 |
| 748 | Ga0495652_0158194 | 3300046529 | Bacteria | 1762 |
| 749 | Ga0495665_0001246 | 3300046531 | Bacteria | 13568 |
| 750 | Ga0495665_0079272 | 3300046531 | Bacteria | 1728 |
| 751 | Ga0495665_0081794 | 3300046531 | Bacteria | 1698 |
| 752 | Ga0495665_0090623 | 3300046531 | Bacteria | 1606 |
| 753 | Ga0495640_0063685 | 3300046533 | Bacteria | 2496 |
| 754 | Ga0495640_0249758 | 3300046533 | Bacteria | 1111 |
| 755 | Ga0495598_0004079 | 3300046537 | Bacteria | 3142 |
| 756 | Ga0495598_0026502 | 3300046537 | Bacteria | 1590 |
| 757 | Ga0495621_0038723 | 3300046539 | Bacteria | 1664 |
| 758 | Ga0495621_0116440 | 3300046539 | Bacteria | 1029 |
| 759 | Ga0495645_0007613 | 3300046543 | Bacteria | 7536 |
| 760 | Ga0495645_0311419 | 3300046543 | Unclassified | 1025 |
| 761 | Ga0495622_0009872 | 3300046557 | Bacteria | 4415 |
| 762 | Ga0495622_0011954 | 3300046557 | Bacteria | 4015 |
| 763 | Ga0495667_0302633 | 3300046559 | Bacteria | 1013 |
| 764 | Ga0495656_0003709 | 3300046615 | Bacteria | 5181 |
| 765 | Ga0495656_0038433 | 3300046615 | Bacteria | 1982 |
| 766 | Ga0495668_0013420 | 3300046616 | Bacteria | 4832 |
| 767 | Ga0495668_0077758 | 3300046616 | Bacteria | 1822 |
| 768 | Ga0495634_0002604 | 3300046642 | Bacteria | 14839 |
| 769 | Ga0495634_0059610 | 3300046642 | Bacteria | 2542 |
| 770 | Ga0495635_0003952 | 3300046663 | Bacteria | 10310 |
| 771 | Ga0495635_0014916 | 3300046663 | Bacteria | 5437 |
| 772 | Ga0495635_0343783 | 3300046663 | Bacteria | 996 |
| 773 | Ga0495659_0012651 | 3300046664 | Bacteria | 2738 |
| 774 | Ga0495661_0080600 | 3300046665 | Bacteria | 1878 |
| 775 | Ga0495588_0028098 | 3300046674 | Bacteria | 2814 |
| 776 | Ga0495657_0002772 | 3300046675 | Bacteria | 14592 |
| 777 | Ga0495599_0018332 | 3300046678 | Bacteria | 4361 |
| 778 | Ga0495646_0018795 | 3300046680 | Bacteria | 4378 |
| 779 | Ga0495647_0000802 | 3300046681 | Bacteria | 9386 |
| 780 | Ga0495647_0183242 | 3300046681 | Bacteria | 912 |
| 781 | Ga0495669_0027987 | 3300046684 | Bacteria | 2466 |
| 782 | Ga0495669_0115017 | 3300046684 | Bacteria | 1258 |
| 783 | Ga0495613_0002024 | 3300046689 | Bacteria | 15396 |
| 784 | Ga0495613_0036184 | 3300046689 | Bacteria | 3661 |
| 785 | Ga0495624_0002097 | 3300046690 | Bacteria | 15207 |
| 786 | Ga0495624_0072338 | 3300046690 | Unclassified | 2145 |
| 787 | Ga0495624_0166516 | 3300046690 | Bacteria | 1345 |
| 788 | Ga0495624_0296288 | 3300046690 | Bacteria | 976 |
| 789 | Ga0495589_0027704 | 3300046794 | Bacteria | 2864 |
| 790 | Ga0495600_0001622 | 3300046809 | Bacteria | 12548 |
| 791 | Ga0495600_0194366 | 3300046809 | Bacteria | 1304 |
| 792 | Ga0495581_0000072 | 3300047315 | Bacteria | 39847 |
| 793 | Ga0495581_0223432 | 3300047315 | Bacteria | 1101 |
| 794 | Ga0495604_0004466 | 3300047317 | Bacteria | 11081 |
| 795 | Ga0495604_0069222 | 3300047317 | Bacteria | 2675 |
| 796 | Ga0495636_0007176 | 3300047318 | Bacteria | 4387 |
| 797 | Ga0495674_0002364 | 3300047319 | Bacteria | 18466 |
| 798 | Ga0495674_0004841 | 3300047319 | Bacteria | 12948 |
| 799 | Ga0495674_0021885 | 3300047319 | Bacteria | 5906 |
| 800 | Ga0495676_0045738 | 3300047321 | Bacteria | 3559 |
| 801 | Ga0495680_0002271 | 3300047322 | Bacteria | 19777 |
| 802 | Ga0495680_0115104 | 3300047322 | Bacteria | 1990 |
| 803 | Ga0495677_0070328 | 3300047445 | Bacteria | 1304 |
| 804 | Ga0495685_096513 | 3300047447 | Bacteria | 977 |
| 805 | Ga0495681_0086279 | 3300047470 | Bacteria | 1393 |
| 806 | Ga0495684_0065597 | 3300047471 | Bacteria | 2760 |
| 807 | Ga0495684_0393264 | 3300047471 | Bacteria | 975 |
| 808 | Ga0495593_0000094 | 3300047673 | Bacteria | 39807 |
| 809 | Ga0496100_0013147 | 3300048903 | Bacteria | 4766 |
| 810 | Ga0496100_0246514 | 3300048903 | Bacteria | 1320 |
| 811 | Ga0496100_0257105 | 3300048903 | Bacteria | 1294 |
| 812 | Ga0496100_0307379 | 3300048903 | Bacteria | 1188 |
| 813 | Ga0496101_0005202 | 3300048904 | Bacteria | 8276 |
| 814 | Ga0496101_0072512 | 3300048904 | Bacteria | 2528 |
| 815 | Ga0496102_0014347 | 3300048905 | Bacteria | 6884 |
| 816 | Ga0496102_0021844 | 3300048905 | Bacteria | 5664 |
| 817 | Ga0496102_0070862 | 3300048905 | Bacteria | 3201 |
| 818 | Ga0496102_0110863 | 3300048905 | Bacteria | 2558 |
| 819 | Ga0496102_0617425 | 3300048905 | Bacteria | 1007 |
| 820 | Ga0496102_0670214 | 3300048905 | Bacteria | 960 |
| 821 | Ga0496102_0744377 | 3300048905 | Bacteria | 903 |
| 822 | Ga0496103_0028243 | 3300048906 | Bacteria | 3403 |
| 823 | Ga0496103_0109623 | 3300048906 | Bacteria | 1753 |
| 824 | Ga0496103_0123584 | 3300048906 | Bacteria | 1650 |
| 825 | Ga0496103_0124684 | 3300048906 | Bacteria | 1642 |
| 826 | Ga0496103_0143809 | 3300048906 | Bacteria | 1526 |
| 827 | Ga0496104_0087324 | 3300048907 | Bacteria | 2978 |
| 828 | Ga0496104_0118705 | 3300048907 | Bacteria | 2539 |
| 829 | Ga0496104_0161115 | 3300048907 | Bacteria | 2152 |
| 830 | Ga0496105_0031262 | 3300048908 | Bacteria | 4365 |
| 831 | Ga0496105_0309405 | 3300048908 | Bacteria | 1269 |
| 832 | Ga0496106_0009999 | 3300048909 | Bacteria | 7006 |
| 833 | Ga0496106_0073243 | 3300048909 | Bacteria | 2620 |
| 834 | Ga0496106_0099608 | 3300048909 | Bacteria | 2253 |
| 835 | Ga0496106_0102249 | 3300048909 | Bacteria | 2223 |
| 836 | Ga0496106_0282857 | 3300048909 | Bacteria | 1329 |
| 837 | Ga0496106_0303783 | 3300048909 | Bacteria | 1280 |
| 838 | Ga0496107_0012533 | 3300048910 | Bacteria | 5919 |
| 839 | Ga0496107_0090508 | 3300048910 | Bacteria | 2235 |
| 840 | Ga0496107_0277551 | 3300048910 | Bacteria | 1247 |
| 841 | Ga0496107_0594055 | 3300048910 | Bacteria | 818 |
| 842 | Ga0496108_0005893 | 3300048911 | Bacteria | 9933 |
| 843 | Ga0496108_0102157 | 3300048911 | Bacteria | 2446 |
| 844 | Ga0496108_0141751 | 3300048911 | Bacteria | 2071 |
| 845 | Ga0496109_0008278 | 3300048912 | Bacteria | 8830 |
| 846 | Ga0496109_0029898 | 3300048912 | Bacteria | 4882 |
| 847 | Ga0496109_0048437 | 3300048912 | Bacteria | 3867 |
| 848 | Ga0496110_0007982 | 3300048913 | Bacteria | 8480 |
| 849 | Ga0496110_0020252 | 3300048913 | Bacteria | 5615 |
| 850 | Ga0496111_0022826 | 3300048914 | Bacteria | 4385 |
| 851 | Ga0496112_0004983 | 3300048915 | Bacteria | 11386 |
| 852 | Ga0496112_0069737 | 3300048915 | Bacteria | 3472 |
| 853 | Ga0496112_0515236 | 3300048915 | Bacteria | 1131 |
| 854 | Ga0496112_0732571 | 3300048915 | Bacteria | 916 |
| 855 | Ga0496113_0001782 | 3300048916 | Bacteria | 12213 |
| 856 | Ga0496113_0040675 | 3300048916 | Bacteria | 3427 |
| 857 | Ga0496114_0148434 | 3300048917 | Bacteria | 2033 |
| 858 | Ga0496114_0238178 | 3300048917 | Bacteria | 1600 |
| 859 | Ga0496114_0274230 | 3300048917 | Bacteria | 1486 |
| 860 | Ga0496114_0796416 | 3300048917 | Bacteria | 824 |
| 861 | Ga0496115_0024226 | 3300048918 | Bacteria | 4715 |
| 862 | Ga0496115_0132400 | 3300048918 | Bacteria | 2055 |
| 863 | Ga0496116_0002454 | 3300048919 | Bacteria | 19457 |
| 864 | Ga0496116_0071661 | 3300048919 | Bacteria | 2193 |
| 865 | Ga0496116_0087783 | 3300048919 | Bacteria | 1902 |
| 866 | Ga0496121_0043033 | 3300048924 | Bacteria | 3917 |
| 867 | Ga0496124_0005968 | 3300048927 | Bacteria | 13453 |
| 868 | Ga0496125_0140450 | 3300048928 | Bacteria | 1681 |
| 869 | Ga0496126_0030132 | 3300048929 | Bacteria | 5145 |
| 870 | Ga0495678_020678 | 3300049459 | Bacteria | 2910 |
| 871 | Ga0501031_0029699 | 3300049568 | Bacteria | 3567 |
| 872 | Ga0501031_0103369 | 3300049568 | Bacteria | 1859 |
| 873 | Ga0501033_0073806 | 3300049570 | Bacteria | 2505 |
| 874 | Ga0501034_0000050 | 3300049571 | Bacteria | 213092 |
| 875 | Ga0501038_0139096 | 3300049574 | Bacteria | 1988 |
| 876 | Ga0501040_0127742 | 3300049576 | Bacteria | 1786 |
| 877 | Ga0501042_0079862 | 3300049578 | Bacteria | 2344 |
| 878 | Ga0501042_0097326 | 3300049578 | Bacteria | 2115 |
| 879 | Ga0501043_0093945 | 3300049579 | Bacteria | 2358 |
| 880 | Ga0501047_0259251 | 3300049581 | Bacteria | 1587 |
| 881 | Ga0501071_0131322 | 3300049587 | Bacteria | 1861 |
| 882 | Ga0501074_0108192 | 3300049590 | Bacteria | 1990 |
| 883 | Ga0501076_0144048 | 3300049592 | Bacteria | 1937 |
| 884 | Ga0501077_0262542 | 3300049593 | Bacteria | 1098 |
| 885 | Ga0501081_0171991 | 3300049743 | Bacteria | 1564 |
| 886 | Ga0501035_0155510 | 3300049822 | Bacteria | 1982 |
| 887 | nmdc:mga00v17_155380_c1 | 3300050491 | Bacteria | 1471 |
| 888 | nmdc:mga00v17_23592_c1 | 3300050491 | Bacteria | 3559 |
| 889 | nmdc:mga00v17_39556_c1 | 3300050491 | Bacteria | 2825 |
| 890 | nmdc:mga0yw44_215377_c1 | 3300050492 | Bacteria | 1271 |
| 891 | nmdc:mga06z11_84102_c1 | 3300050494 | Bacteria | 1714 |
| 892 | nmdc:mga05p37_233_c1 | 3300050507 | Bacteria | 56600 |
| 893 | nmdc:mga09592_276293_c1 | 3300050508 | Bacteria | 1457 |
| 894 | nmdc:mga09592_800_c1 | 3300050508 | Bacteria | 24361 |
| 895 | nmdc:mga0qj67_99316_c1 | 3300050509 | Bacteria | 2345 |
| 896 | nmdc:mga06r32_94_c1 | 3300050510 | Bacteria | 61840 |
| 897 | nmdc:mga08y16_251518_c1 | 3300050511 | Bacteria | 1826 |
| 898 | nmdc:mga08y16_2747_c1 | 3300050511 | Bacteria | 18041 |
| 899 | nmdc:mga0n895_524772_c1 | 3300050512 | Bacteria | 1191 |
| 900 | nmdc:mga0n895_63502_c1 | 3300050512 | Bacteria | 3652 |
| 901 | nmdc:mga0rr50_8887_c1 | 3300050513 | Bacteria | 6274 |
| 902 | nmdc:mga08x19_211792_c1 | 3300050514 | Bacteria | 1330 |
| 903 | Ga0495612_0098788 | 3300053078 | Unclassified | 1242 |
| 904 | Ga0495655_0053431 | 3300053083 | Bacteria | 1078 |
| 905 | Ga0495619_0315074 | 3300053085 | Bacteria | 1083 |
| 906 | Ga0500646_0121605 | 3300053090 | Bacteria | 840 |
| 907 | Ga0500651_0167979 | 3300053093 | Bacteria | 1309 |
| 908 | Ga0500566_0242572 | 3300053094 | Bacteria | 882 |
| 909 | Ga0500555_012495 | 3300053103 | Bacteria | 2446 |
| 910 | Ga0500658_0011685 | 3300053134 | Bacteria | 3235 |
| 911 | Ga0500588_0092697 | 3300053146 | Bacteria | 1029 |
| 912 | Ga0500604_0021080 | 3300053151 | Bacteria | 1840 |
| 913 | Ga0500627_0032682 | 3300053158 | Bacteria | 2195 |
| 914 | Ga0500634_0130932 | 3300053161 | Bacteria | 1204 |
| 915 | Ga0530510_0187102 | 3300061734 | Bacteria | 1537 |
| 916 | 2513894375 | 2513237141 | Bacteria | 8496279 |
| 917 | 2644123516 | 2643221621 | Bacteria | 6212786 |
| 918 | 2858694263 | 2858688981 | Bacteria | 8184122 |
| 919 | 2883577728 | 2883577096 | Bacteria | 4709178 |
| 920 | 2885412758 | 2885409591 | Bacteria | 9235467 |
| 921 | 2889310900 | 2889306138 | Bacteria | 6358934 |
| 922 | 2894777252 | 2894772417 | Bacteria | 5305674 |
| 923 | 2901305424 | 2901300506 | Bacteria | 8463898 |
| 924 | 2902336719 | 2902330777 | Bacteria | 6395352 |
| 925 | 2928126853 | 2928125067 | Bacteria | 5937560 |
| 926 | 2929200800 | 2929199973 | Bacteria | 7260745 |
| 927 | 2935742982 | 2935741537 | Bacteria | 9707219 |
| 928 | 8019556053 | 8019555841 | Bacteria | 9642137 |
| 929 | 8019569257 | 8019565922 | Bacteria | 9639779 |
| 930 | 8048749888 | 8048746797 | Bacteria | 3557226 |
| 931 | 8055914016 | 8055909800 | Bacteria | 7278581 |
| 932 | Ga0070714_100012357 | |||
| 933 | JGI24034J26672_10023738 | |||
| 934 | JGI24751J29686_10048055 | |||
| 935 | JGI25406J46586_10001111 | |||
| 936 | rootL2_10282064 | |||
| 937 | JGI25404J52841_10000240 | |||
| 938 | JGI25405J52794_10030357 | |||
| 939 | Ga0065715_10303549 | |||
| 940 | Ga0070658_10149119 | |||
| 941 | Ga0070676_10027703 | |||
| 942 | Ga0070676_10212221 | |||
| 943 | Ga0070676_10281374 | |||
| 944 | Ga0070683_100034649 | |||
| 945 | Ga0070683_100072024 | |||
| 946 | Ga0070683_100482203 | |||
| 947 | Ga0070690_100080742 | |||
| 948 | Ga0070690_100220596 | |||
| 949 | Ga0070690_100310698 | |||
| 950 | Ga0070670_100329057 | |||
| 951 | Ga0070677_10077039 | |||
| 952 | Ga0068869_100020691 | |||
| 953 | Ga0068869_100061149 | |||
| 954 | Ga0070666_10004139 | |||
| 955 | Ga0070666_10026855 | |||
| 956 | Ga0070666_10060256 | |||
| 957 | Ga0070666_10141782 | |||
| 958 | Ga0070666_10247316 | |||
| 959 | Ga0070680_100119833 | |||
| 960 | Ga0070680_100639446 | |||
| 961 | Ga0070682_100175888 | |||
| 962 | Ga0068868_100098577 | |||
| 963 | Ga0068868_100179794 | |||
| 964 | Ga0068868_100437731 | |||
| 965 | Ga0068868_100472405 | |||
| 966 | Ga0070660_100009904 | |||
| 967 | Ga0070660_100019782 | |||
| 968 | Ga0070660_100037023 | |||
| 969 | Ga0070660_100048417 | |||
| 970 | Ga0070660_100243265 | |||
| 971 | Ga0070689_100003058 | |||
| 972 | Ga0070689_100345765 | |||
| 973 | Ga0070661_100019023 | |||
| 974 | Ga0070661_100022594 | |||
| 975 | Ga0070661_100031004 | |||
| 976 | Ga0070692_10018833 | |||
| 977 | Ga0070692_10033813 | |||
| 978 | Ga0070668_100013378 | |||
| 979 | Ga0070668_100116421 | |||
| 980 | Ga0070668_100620644 | |||
| 981 | Ga0070669_100029099 | |||
| 982 | Ga0070669_100100908 | |||
| 983 | Ga0070669_100150514 | |||
| 984 | Ga0070675_100038048 | |||
| 985 | Ga0070675_100093182 | |||
| 986 | Ga0070675_100299567 | |||
| 987 | Ga0070671_100054368 | |||
| 988 | Ga0070671_100058106 | |||
| 989 | Ga0070671_100182612 | |||
| 990 | Ga0070671_100322725 | |||
| 991 | Ga0070671_100414339 | |||
| 992 | Ga0070674_100005862 | |||
| 993 | Ga0070674_100005913 | |||
| 994 | Ga0070673_100091758 | |||
| 995 | Ga0070673_100102820 | |||
| 996 | Ga0070673_100229419 | |||
| 997 | Ga0070673_100489738 | |||
| 998 | Ga0070673_100550393 | |||
| 999 | Ga0070688_100015320 | |||
| 1000 | Ga0070688_100093508 | |||
| 1001 | Ga0070659_100000182 | |||
| 1002 | Ga0070659_100002279 | |||
| 1003 | Ga0070659_100023880 | |||
| 1004 | Ga0070659_100041424 | |||
| 1005 | Ga0070659_100179291 | |||
| 1006 | Ga0070667_100001759 | |||
| 1007 | Ga0070667_100070917 | |||
| 1008 | Ga0070667_100093912 | |||
| 1009 | Ga0070667_100126209 | |||
| 1010 | Ga0070667_100290235 | |||
| 1011 | Ga0070667_100698337 | |||
| 1012 | Ga0070709_10001020 | |||
| 1013 | Ga0070709_10001626 | |||
| 1014 | Ga0070709_10004665 | |||
| 1015 | Ga0070709_10008636 | |||
| 1016 | Ga0070709_10067302 | |||
| 1017 | Ga0070714_100002584 | |||
| 1018 | Ga0070714_100036631 | |||
| 1019 | Ga0070714_100039615 | |||
| 1020 | Ga0070714_100888778 | |||
| 1021 | Ga0070713_100000018 | |||
| 1022 | Ga0070713_100001762 | |||
| 1023 | Ga0070713_100016897 | |||
| 1024 | Ga0070713_100031472 | |||
| 1025 | Ga0070713_100053328 | |||
| 1026 | Ga0070713_100073756 | |||
| 1027 | Ga0070713_100457964 | |||
| 1028 | Ga0070710_10000501 | |||
| 1029 | Ga0070710_10002329 | |||
| 1030 | Ga0070710_10008451 | |||
| 1031 | Ga0070710_10021411 | |||
| 1032 | Ga0070710_10044901 | |||
| 1033 | Ga0070710_10139780 | |||
| 1034 | Ga0070701_10016072 | |||
| 1035 | Ga0070711_100003966 | |||
| 1036 | Ga0070711_100009080 | |||
| 1037 | Ga0070711_100014864 | |||
| 1038 | Ga0070711_100031186 | |||
| 1039 | Ga0070711_100050933 | |||
| 1040 | Ga0070711_100127915 | |||
| 1041 | Ga0070711_100279395 | |||
| 1042 | Ga0070711_100477939 | |||
| 1043 | Ga0070700_100042872 | |||
| 1044 | Ga0070694_100263888 | |||
| 1045 | Ga0070663_100024357 | |||
| 1046 | Ga0070663_100148883 | |||
| 1047 | Ga0070663_100257400 | |||
| 1048 | Ga0070678_100000194 | |||
| 1049 | Ga0070678_100000941 | |||
| 1050 | Ga0070678_100028009 | |||
| 1051 | Ga0070678_100033427 | |||
| 1052 | Ga0070678_100069589 | |||
| 1053 | Ga0070678_100268470 | |||
| 1054 | Ga0070678_100532246 | |||
| 1055 | Ga0070678_100737353 | |||
| 1056 | Ga0070662_100000120 | |||
| 1057 | Ga0070662_100014078 | |||
| 1058 | Ga0070662_100017566 | |||
| 1059 | Ga0070662_100078996 | |||
| 1060 | Ga0070662_100128597 | |||
| 1061 | Ga0070681_10050801 | |||
| 1062 | Ga0070681_10097627 | |||
| 1063 | Ga0068867_100062565 | |||
| 1064 | Ga0068867_100117031 | |||
| 1065 | Ga0068867_100547437 | |||
| 1066 | Ga0070685_10016352 | |||
| 1067 | Ga0070698_100160616 | |||
| 1068 | Ga0070679_100083118 | |||
| 1069 | Ga0070679_100350568 | |||
| 1070 | Ga0070684_100344952 | |||
| 1071 | Ga0070697_100199098 | |||
| 1072 | Ga0068853_100001080 | |||
| 1073 | Ga0068853_100031659 | |||
| 1074 | Ga0068853_100052626 | |||
| 1075 | Ga0068853_100117706 | |||
| 1076 | Ga0070672_100001583 | |||
| 1077 | Ga0070672_100052573 | |||
| 1078 | Ga0070686_100106246 | |||
| 1079 | Ga0070686_100106775 | |||
| 1080 | Ga0070695_100160857 | |||
| 1081 | Ga0070665_100010384 | |||
| 1082 | Ga0070665_100099334 | |||
| 1083 | Ga0070665_100109385 | |||
| 1084 | Ga0070665_100186781 | |||
| 1085 | Ga0070665_100395511 | |||
| 1086 | Ga0070665_100696448 | |||
| 1087 | Ga0068855_100001125 | |||
| 1088 | Ga0068855_100002492 | |||
| 1089 | Ga0068855_100003366 | |||
| 1090 | Ga0068855_100110719 | |||
| 1091 | Ga0068855_100132740 | |||
| 1092 | Ga0068855_100361975 | |||
| 1093 | Ga0070664_100000226 | |||
| 1094 | Ga0070664_100005943 | |||
| 1095 | Ga0070664_100017178 | |||
| 1096 | Ga0070664_100040115 | |||
| 1097 | Ga0070664_100193235 | |||
| 1098 | Ga0070664_100727509 | |||
| 1099 | Ga0068857_100243412 | |||
| 1100 | Ga0068857_100403931 | |||
| 1101 | Ga0068857_100742663 | |||
| 1102 | Ga0068854_100016658 | |||
| 1103 | Ga0068854_100104455 | |||
| 1104 | Ga0068854_100131156 | |||
| 1105 | Ga0068854_100652432 | |||
| 1106 | Ga0068856_100001739 | |||
| 1107 | Ga0068856_100005592 | |||
| 1108 | Ga0068856_100006697 | |||
| 1109 | Ga0068856_100051747 | |||
| 1110 | Ga0068856_100490960 | |||
| 1111 | Ga0070702_100029406 | |||
| 1112 | Ga0068852_100041070 | |||
| 1113 | Ga0068852_100064062 | |||
| 1114 | Ga0068852_100072519 | |||
| 1115 | Ga0068852_100143948 | |||
| 1116 | Ga0068852_100523805 | |||
| 1117 | Ga0068859_100044877 | |||
| 1118 | Ga0068859_100084994 | |||
| 1119 | Ga0068859_100440374 | |||
| 1120 | Ga0068859_100798935 | |||
| 1121 | Ga0068864_100003834 | |||
| 1122 | Ga0068864_100044645 | |||
| 1123 | Ga0068864_100083910 | |||
| 1124 | Ga0068866_10027616 | |||
| 1125 | Ga0068866_10046747 | |||
| 1126 | Ga0068866_10064994 | |||
| 1127 | Ga0068861_100021195 | |||
| 1128 | Ga0068861_100040221 | |||
| 1129 | Ga0068861_100050631 | |||
| 1130 | Ga0068851_10004520 | |||
| 1131 | Ga0068851_10008957 | |||
| 1132 | Ga0068851_10050440 | |||
| 1133 | Ga0068870_10115568 | |||
| 1134 | Ga0068870_10218095 | |||
| 1135 | Ga0068863_100007860 | |||
| 1136 | Ga0068863_100049982 | |||
| 1137 | Ga0068863_100092096 | |||
| 1138 | Ga0068858_100022334 | |||
| 1139 | Ga0068858_100065327 | |||
| 1140 | Ga0068858_100358046 | |||
| 1141 | Ga0068858_100485784 | |||
| 1142 | Ga0068860_100083385 | |||
| 1143 | Ga0068860_100115849 | |||
| 1144 | Ga0068860_100160391 | |||
| 1145 | Ga0068860_100225608 | |||
| 1146 | Ga0068860_100335898 | |||
| 1147 | Ga0068862_100177399 | |||
| 1148 | Ga0081455_10002176 | |||
| 1149 | Ga0081455_10006640 | |||
| 1150 | Ga0081455_10155536 | |||
| 1151 | Ga0081540_1000096 | |||
| 1152 | Ga0081540_1001408 | |||
| 1153 | Ga0081540_1005726 | |||
| 1154 | Ga0081540_1022947 | |||
| 1155 | Ga0081540_1022965 | |||
| 1156 | Ga0081540_1041740 | |||
| 1157 | Ga0081540_1050196 | |||
| 1158 | Ga0081540_1081052 | |||
| 1159 | Ga0081540_1134315 | |||
| 1160 | Ga0081539_10001144 | |||
| 1161 | Ga0081539_10049223 | |||
| 1162 | Ga0081539_10052448 | |||
| 1163 | Ga0070717_10001571 | |||
| 1164 | Ga0070717_10355677 | |||
| 1165 | Ga0075363_100123490 | |||
| 1166 | Ga0075364_10000139 | |||
| 1167 | Ga0075364_10013965 | |||
| 1168 | Ga0075364_10072695 | |||
| 1169 | Ga0075364_10126329 | |||
| 1170 | Ga0075432_10015900 | |||
| 1171 | Ga0070715_10001554 | |||
| 1172 | Ga0070715_10007590 | |||
| 1173 | Ga0070716_100001649 | |||
| 1174 | Ga0070716_100004329 | |||
| 1175 | Ga0070716_100010923 | |||
| 1176 | Ga0070716_100040864 | |||
| 1177 | Ga0070716_100053989 | |||
| 1178 | Ga0070716_100162698 | |||
| 1179 | Ga0070716_100223925 | |||
| 1180 | Ga0070712_100004086 | |||
| 1181 | Ga0070712_100083000 | |||
| 1182 | Ga0070712_100156328 | |||
| 1183 | Ga0070712_100204791 | |||
| 1184 | Ga0075367_10108312 | |||
| 1185 | Ga0075367_10172674 | |||
| 1186 | Ga0075366_10025653 | |||
| 1187 | Ga0075366_10103407 | |||
| 1188 | Ga0097621_100000458 | |||
| 1189 | Ga0097621_100078338 | |||
| 1190 | Ga0068871_100000291 | |||
| 1191 | Ga0068871_100061176 | |||
| 1192 | Ga0068871_100073430 | |||
| 1193 | Ga0068871_100266221 | |||
| 1194 | Ga0068871_100295449 | |||
| 1195 | Ga0068871_100425846 | |||
| 1196 | Ga0075428_100001488 | |||
| 1197 | Ga0075430_100121836 | |||
| 1198 | Ga0075430_100209147 | |||
| 1199 | Ga0075431_100000504 | |||
| 1200 | Ga0075434_100039915 | |||
| 1201 | Ga0075429_100000459 | |||
| 1202 | Ga0075429_100416719 | |||
| 1203 | Ga0068865_100010532 | |||
| 1204 | Ga0068865_100106539 | |||
| 1205 | Ga0068865_100215674 | |||
| 1206 | Ga0068865_100265957 | |||
| 1207 | Ga0068865_100288095 | |||
| 1208 | Ga0075436_100321727 | |||
| 1209 | Ga0097620_100044877 | |||
| 1210 | Ga0097620_100084982 | |||
| 1211 | Ga0097620_100440401 | |||
| 1212 | Ga0097620_100798998 | |||
| 1213 | Ga0075435_100027074 | |||
| 1214 | Ga0075435_100586588 | |||
| 1215 | Ga0105240_10023182 | |||
| 1216 | Ga0105240_10433924 | |||
| 1217 | Ga0105240_10763200 | |||
| 1218 | Ga0111539_10002196 | |||
| 1219 | Ga0111539_10006967 | |||
| 1220 | Ga0111539_10063702 | |||
| 1221 | Ga0105245_10034600 | |||
| 1222 | Ga0105245_10066003 | |||
| 1223 | Ga0105245_10075278 | |||
| 1224 | Ga0105245_10255076 | |||
| 1225 | Ga0105245_10263303 | |||
| 1226 | Ga0105245_10493065 | |||
| 1227 | Ga0114129_10000593 | |||
| 1228 | Ga0114129_11041476 | |||
| 1229 | Ga0105243_10021629 | |||
| 1230 | Ga0105243_10094039 | |||
| 1231 | Ga0105243_10113817 | |||
| 1232 | Ga0105243_10376049 | |||
| 1233 | Ga0105243_10442189 | |||
| 1234 | Ga0105241_10002214 | |||
| 1235 | Ga0105241_10009474 | |||
| 1236 | Ga0105241_10345929 | |||
| 1237 | Ga0105242_10036944 | |||
| 1238 | Ga0105242_10101044 | |||
| 1239 | Ga0105242_10104288 | |||
| 1240 | Ga0105242_10139739 | |||
| 1241 | Ga0105242_10168506 | |||
| 1242 | Ga0105242_10994125 | |||
| 1243 | Ga0105248_10006493 | |||
| 1244 | Ga0105248_10051747 | |||
| 1245 | Ga0105248_10104462 | |||
| 1246 | Ga0105248_10116757 | |||
| 1247 | Ga0105248_10496922 | |||
| 1248 | Ga0105237_10177118 | |||
| 1249 | Ga0105238_10013647 | |||
| 1250 | Ga0105238_10044924 | |||
| 1251 | Ga0105238_10062584 | |||
| 1252 | Ga0105249_10019606 | |||
| 1253 | Ga0105249_10073706 | |||
| 1254 | Ga0105249_10236945 | |||
| 1255 | Ga0099796_10002032 | |||
| 1256 | Ga0105239_10042625 | |||
| 1257 | Ga0105239_10084846 | |||
| 1258 | Ga0105239_10140266 | |||
| 1259 | Ga0105239_10204440 | |||
| 1260 | Ga0105246_10032914 | |||
| 1261 | Ga0105246_10060490 | |||
| 1262 | Ga0105246_10064899 | |||
| 1263 | Ga0105246_10189581 | |||
| 1264 | Ga0105246_10218340 | |||
| 1265 | Ga0105246_10650335 | |||
| 1266 | Ga0157327_1005464 | |||
| 1267 | Ga0157373_10000824 | |||
| 1268 | Ga0157373_10005021 | |||
| 1269 | Ga0157371_10000769 | |||
| 1270 | Ga0157371_10099752 | |||
| 1271 | Ga0157371_10303600 | |||
| 1272 | Ga0157370_10003726 | |||
| 1273 | Ga0157370_10107283 | |||
| 1274 | Ga0157370_10143609 | |||
| 1275 | Ga0157370_10196144 | |||
| 1276 | Ga0157370_10475022 | |||
| 1277 | Ga0157369_10028062 | |||
| 1278 | Ga0157369_10085368 | |||
| 1279 | Ga0157369_10280726 | |||
| 1280 | Ga0157369_10420906 | |||
| 1281 | Ga0157374_10059054 | |||
| 1282 | Ga0157374_10181773 | |||
| 1283 | Ga0157374_10296608 | |||
| 1284 | Ga0157374_10306473 | |||
| 1285 | Ga0157378_10063263 | |||
| 1286 | Ga0157378_10068127 | |||
| 1287 | Ga0157378_10165162 | |||
| 1288 | Ga0157378_10197025 | |||
| 1289 | Ga0157378_10251308 | |||
| 1290 | Ga0157378_10377978 | |||
| 1291 | Ga0163162_10032188 | |||
| 1292 | Ga0163162_10039769 | |||
| 1293 | Ga0163162_10067406 | |||
| 1294 | Ga0163162_10073390 | |||
| 1295 | Ga0163162_10085192 | |||
| 1296 | Ga0163162_10140412 | |||
| 1297 | Ga0163162_10143832 | |||
| 1298 | Ga0163162_10246251 | |||
| 1299 | Ga0163162_10359423 | |||
| 1300 | Ga0157372_10002479 | |||
| 1301 | Ga0157372_10010519 | |||
| 1302 | Ga0157372_10031751 | |||
| 1303 | Ga0157372_10092578 | |||
| 1304 | Ga0157372_10141524 | |||
| 1305 | Ga0157372_10159884 | |||
| 1306 | Ga0157372_10178656 | |||
| 1307 | Ga0157372_10204695 | |||
| 1308 | Ga0157372_10254272 | |||
| 1309 | Ga0157372_10266343 | |||
| 1310 | Ga0157375_10001717 | |||
| 1311 | Ga0157375_10012282 | |||
| 1312 | Ga0157375_10110716 | |||
| 1313 | Ga0157375_10181771 | |||
| 1314 | Ga0157375_10603888 | |||
| 1315 | Ga0157375_10731325 | |||
| 1316 | Ga0163163_10045052 | |||
| 1317 | Ga0163163_10710470 | |||
| 1318 | Ga0157380_10013259 | |||
| 1319 | Ga0157380_10039591 | |||
| 1320 | Ga0157380_10079154 | |||
| 1321 | Ga0157380_10099241 | |||
| 1322 | Ga0157380_10130913 | |||
| 1323 | Ga0157380_10675784 | |||
| 1324 | Ga0157377_10061685 | |||
| 1325 | Ga0157377_10098481 | |||
| 1326 | Ga0157377_10315761 | |||
| 1327 | Ga0157379_10009759 | |||
| 1328 | Ga0157379_10082823 | |||
| 1329 | Ga0157379_10181755 | |||
| 1330 | Ga0157376_10003346 | |||
| 1331 | Ga0157376_10015103 | |||
| 1332 | Ga0157376_10026515 | |||
| 1333 | Ga0157376_10215245 | |||
| 1334 | Ga0157376_10228096 | |||
| 1335 | Ga0157376_10368435 | |||
| 1336 | Ga0157376_10807638 | |||
| 1337 | Ga0157376_10939892 | |||
| 1338 | Ga0163161_10019650 | |||
| 1339 | Ga0163161_10066810 | |||
| 1340 | Ga0163161_10114306 | |||
| 1341 | Ga0163161_10124692 | |||
| 1342 | Ga0213874_10006091 | |||
| 1343 | Ga0213876_10001691 | |||
| 1344 | Ga0213876_10003521 | |||
| 1345 | Ga0213876_10086506 | |||
| 1346 | Ga0213875_10038294 | |||
| 1347 | Ga0207673_1003356 | |||
| 1348 | Ga0209256_1000689 | |||
| 1349 | Ga0207697_10137385 | |||
| 1350 | Ga0207656_10044825 | |||
| 1351 | Ga0207682_10000872 | |||
| 1352 | Ga0207692_10001173 | |||
| 1353 | Ga0207692_10002425 | |||
| 1354 | Ga0207692_10029057 | |||
| 1355 | Ga0207642_10023701 | |||
| 1356 | Ga0207642_10032431 | |||
| 1357 | Ga0207688_10001682 | |||
| 1358 | Ga0207688_10016260 | |||
| 1359 | Ga0207688_10083971 | |||
| 1360 | Ga0207688_10174175 | |||
| 1361 | Ga0207688_10197177 | |||
| 1362 | Ga0207680_10032448 | |||
| 1363 | Ga0207680_10052152 | |||
| 1364 | Ga0207685_10001412 | |||
| 1365 | Ga0207685_10074320 | |||
| 1366 | Ga0207699_10002658 | |||
| 1367 | Ga0207699_10007883 | |||
| 1368 | Ga0207699_10043223 | |||
| 1369 | Ga0207645_10001481 | |||
| 1370 | Ga0207645_10102929 | |||
| 1371 | Ga0207643_10002283 | |||
| 1372 | Ga0207643_10121590 | |||
| 1373 | Ga0207705_10078878 | |||
| 1374 | Ga0207705_10080683 | |||
| 1375 | Ga0207705_10087369 | |||
| 1376 | Ga0207654_10062334 | |||
| 1377 | Ga0207654_10064587 | |||
| 1378 | Ga0207707_10007412 | |||
| 1379 | Ga0207707_10054164 | |||
| 1380 | Ga0207707_10126079 | |||
| 1381 | Ga0207695_10010787 | |||
| 1382 | Ga0207695_10034941 | |||
| 1383 | Ga0207695_10462875 | |||
| 1384 | Ga0207671_10158982 | |||
| 1385 | Ga0207693_10001660 | |||
| 1386 | Ga0207693_10004561 | |||
| 1387 | Ga0207693_10008700 | |||
| 1388 | Ga0207693_10009095 | |||
| 1389 | Ga0207693_10020362 | |||
| 1390 | Ga0207693_10043024 | |||
| 1391 | Ga0207693_10306071 | |||
| 1392 | Ga0207663_10000327 | |||
| 1393 | Ga0207663_10005738 | |||
| 1394 | Ga0207663_10013842 | |||
| 1395 | Ga0207663_10014468 | |||
| 1396 | Ga0207663_10048493 | |||
| 1397 | Ga0207663_10175642 | |||
| 1398 | Ga0207663_10267885 | |||
| 1399 | Ga0207663_10360754 | |||
| 1400 | Ga0207663_10698042 | |||
| 1401 | Ga0207660_10007745 | |||
| 1402 | Ga0207660_10015325 | |||
| 1403 | Ga0207660_10058814 | |||
| 1404 | Ga0207660_10135008 | |||
| 1405 | Ga0207662_10001442 | |||
| 1406 | Ga0207657_10000102 | |||
| 1407 | Ga0207657_10000250 | |||
| 1408 | Ga0207657_10016616 | |||
| 1409 | Ga0207657_10039174 | |||
| 1410 | Ga0207657_10081255 | |||
| 1411 | Ga0207657_10337154 | |||
| 1412 | Ga0207657_10403093 | |||
| 1413 | Ga0207649_10025902 | |||
| 1414 | Ga0207649_10245725 | |||
| 1415 | Ga0207649_10275556 | |||
| 1416 | Ga0207652_10003521 | |||
| 1417 | Ga0207652_10077656 | |||
| 1418 | Ga0207681_10008492 | |||
| 1419 | Ga0207681_10041663 | |||
| 1420 | Ga0207650_10002771 | |||
| 1421 | Ga0207659_10011351 | |||
| 1422 | Ga0207659_10216155 | |||
| 1423 | Ga0207687_10139372 | |||
| 1424 | Ga0207700_10000052 | |||
| 1425 | Ga0207700_10009348 | |||
| 1426 | Ga0207700_10024470 | |||
| 1427 | Ga0207700_10106497 | |||
| 1428 | Ga0207700_10314009 | |||
| 1429 | Ga0207700_10453881 | |||
| 1430 | Ga0207664_10012367 | |||
| 1431 | Ga0207664_10015521 | |||
| 1432 | Ga0207664_10018323 | |||
| 1433 | Ga0207664_10130011 | |||
| 1434 | Ga0207664_10196164 | |||
| 1435 | Ga0207644_10003032 | |||
| 1436 | Ga0207644_10003185 | |||
| 1437 | Ga0207644_10140534 | |||
| 1438 | Ga0207644_10173928 | |||
| 1439 | Ga0207644_10471021 | |||
| 1440 | Ga0207690_10000595 | |||
| 1441 | Ga0207690_10011334 | |||
| 1442 | Ga0207690_10021388 | |||
| 1443 | Ga0207706_10000095 | |||
| 1444 | Ga0207706_10002865 | |||
| 1445 | Ga0207706_10003460 | |||
| 1446 | Ga0207706_10015256 | |||
| 1447 | Ga0207686_10095491 | |||
| 1448 | Ga0207686_10182589 | |||
| 1449 | Ga0207686_10210907 | |||
| 1450 | Ga0207686_10249571 | |||
| 1451 | Ga0207709_10006513 | |||
| 1452 | Ga0207709_10076201 | |||
| 1453 | Ga0207709_10280804 | |||
| 1454 | Ga0207670_10062251 | |||
| 1455 | Ga0207669_10004853 | |||
| 1456 | Ga0207669_10120571 | |||
| 1457 | Ga0207669_10511394 | |||
| 1458 | Ga0207704_10131322 | |||
| 1459 | Ga0207704_10263558 | |||
| 1460 | Ga0207665_10002675 | |||
| 1461 | Ga0207665_10003693 | |||
| 1462 | Ga0207665_10006131 | |||
| 1463 | Ga0207665_10010080 | |||
| 1464 | Ga0207665_10026007 | |||
| 1465 | Ga0207665_10070391 | |||
| 1466 | Ga0207665_10077543 | |||
| 1467 | Ga0207691_10000894 | |||
| 1468 | Ga0207691_10004886 | |||
| 1469 | Ga0207691_10102875 | |||
| 1470 | Ga0207711_10007597 | |||
| 1471 | Ga0207711_10051104 | |||
| 1472 | Ga0207711_10114357 | |||
| 1473 | Ga0207711_10151761 | |||
| 1474 | Ga0207711_10582592 | |||
| 1475 | Ga0207689_10018574 | |||
| 1476 | Ga0207689_10105947 | |||
| 1477 | Ga0207689_10146286 | |||
| 1478 | Ga0207661_10187983 | |||
| 1479 | Ga0207661_10361023 | |||
| 1480 | Ga0207661_10743673 | |||
| 1481 | Ga0207679_10001787 | |||
| 1482 | Ga0207679_10009965 | |||
| 1483 | Ga0207679_10063511 | |||
| 1484 | Ga0207679_10148665 | |||
| 1485 | Ga0207679_10183893 | |||
| 1486 | Ga0207667_10000233 | |||
| 1487 | Ga0207667_10012539 | |||
| 1488 | Ga0207667_10028313 | |||
| 1489 | Ga0207667_10036146 | |||
| 1490 | Ga0207667_10087482 | |||
| 1491 | Ga0207667_10109962 | |||
| 1492 | Ga0207667_10154801 | |||
| 1493 | Ga0207651_10016952 | |||
| 1494 | Ga0207651_10277452 | |||
| 1495 | Ga0207712_10018971 | |||
| 1496 | Ga0207712_10664453 | |||
| 1497 | Ga0207668_10014214 | |||
| 1498 | Ga0207668_10015143 | |||
| 1499 | Ga0207668_10016667 | |||
| 1500 | Ga0207668_10155437 | |||
| 1501 | Ga0207668_10475962 | |||
| 1502 | Ga0207640_10231774 | |||
| 1503 | Ga0207658_10001269 | |||
| 1504 | Ga0207658_10047079 | |||
| 1505 | Ga0207658_10050170 | |||
| 1506 | Ga0207677_10149957 | |||
| 1507 | Ga0207677_10441179 | |||
| 1508 | Ga0207703_10027561 | |||
| 1509 | Ga0207703_10069412 | |||
| 1510 | Ga0207703_10220414 | |||
| 1511 | Ga0207703_10306462 | |||
| 1512 | Ga0207703_10443575 | |||
| 1513 | Ga0207703_10607823 | |||
| 1514 | Ga0207703_10644066 | |||
| 1515 | Ga0207703_10838066 | |||
| 1516 | Ga0207639_10027371 | |||
| 1517 | Ga0207639_10032866 | |||
| 1518 | Ga0207639_10043431 | |||
| 1519 | Ga0207639_10091583 | |||
| 1520 | Ga0207639_10355285 | |||
| 1521 | Ga0207678_10001717 | |||
| 1522 | Ga0207678_10003576 | |||
| 1523 | Ga0207678_10004513 | |||
| 1524 | Ga0207678_10031337 | |||
| 1525 | Ga0207678_10105656 | |||
| 1526 | Ga0207678_10121418 | |||
| 1527 | Ga0207708_10000558 | |||
| 1528 | Ga0207708_10042552 | |||
| 1529 | Ga0207708_10078335 | |||
| 1530 | Ga0207702_10003371 | |||
| 1531 | Ga0207702_10008525 | |||
| 1532 | Ga0207702_10056084 | |||
| 1533 | Ga0207702_10078347 | |||
| 1534 | Ga0207702_10176980 | |||
| 1535 | Ga0207641_10008303 | |||
| 1536 | Ga0207641_10213201 | |||
| 1537 | Ga0207648_10021284 | |||
| 1538 | Ga0207648_10042493 | |||
| 1539 | Ga0207648_10243989 | |||
| 1540 | Ga0207676_10027045 | |||
| 1541 | Ga0207674_10000326 | |||
| 1542 | Ga0207674_10002376 | |||
| 1543 | Ga0207674_10099180 | |||
| 1544 | Ga0207674_10156104 | |||
| 1545 | Ga0207674_10278224 | |||
| 1546 | Ga0207675_100002315 | |||
| 1547 | Ga0207675_100031636 | |||
| 1548 | Ga0207675_100076680 | |||
| 1549 | Ga0207675_100173538 | |||
| 1550 | Ga0207675_100266389 | |||
| 1551 | Ga0207683_10006767 | |||
| 1552 | Ga0207683_10009942 | |||
| 1553 | Ga0207683_10012309 | |||
| 1554 | Ga0207683_10030660 | |||
| 1555 | Ga0207683_10036404 | |||
| 1556 | Ga0207683_10073358 | |||
| 1557 | Ga0207683_10094761 | |||
| 1558 | Ga0207683_10202154 | |||
| 1559 | Ga0207698_10026071 | |||
| 1560 | Ga0207698_10151859 | |||
| 1561 | Ga0209982_1012290 | |||
| 1562 | Ga0209966_1019300 | |||
| 1563 | Ga0209974_10001061 | |||
| 1564 | Ga0209974_10006336 | |||
| 1565 | Ga0207428_10007060 | |||
| 1566 | Ga0207428_10099895 | |||
| 1567 | Ga0268266_10083840 | |||
| 1568 | Ga0268266_10103401 | |||
| 1569 | Ga0268266_10123252 | |||
| 1570 | Ga0268266_10135196 | |||
| 1571 | Ga0268266_10322461 | |||
| 1572 | Ga0268266_10617226 | |||
| 1573 | Ga0268265_10110725 | |||
| 1574 | Ga0268265_10906437 | |||
| 1575 | Ga0268264_10038116 | |||
| 1576 | Ga0268264_10292694 | |||
| 1577 | Ga0268264_10559880 | |||
| 1578 | Ga0307408_100010802 | |||
| 1579 | Ga0316576_10248069 | |||
| 1580 | Ga0307516_10178619 | |||
| 1581 | Ga0307413_10545539 | |||
| 1582 | Ga0307410_10062735 | |||
| 1583 | Ga0307406_10005700 | |||
| 1584 | Ga0307412_10071352 | |||
| 1585 | Ga0307409_100017959 | |||
| 1586 | Ga0307416_100002602 | |||
| 1587 | Ga0307416_100028588 | |||
| 1588 | Ga0307416_100094609 | |||
| 1589 | Ga0307510_10073939 | |||
| 1590 | Ga0373929_0020363 | |||
| 1591 | Ga0373945_0003413 | |||
| 1592 | Ga0373945_0056554 | |||
| 1593 | Ga0373954_0029083 | |||
| 1594 | Ga0373956_0200311 | |||
| 1595 | Ga0373943_0009284 | |||
| 1596 | Ga0373943_0043916 | |||
| 1597 | Ga0373943_0148731 | |||
| 1598 | Ga0373946_0059070 | |||
| 1599 | Ga0373946_0261798 | |||
| 1600 | Ga0316574_0000860 | |||
| 1601 | Ga0316574_0052741 | |||
| 1602 | Ga0373931_0013132 | |||
| 1603 | Ga0373935_0005109 | |||
| 1604 | Ga0373935_0204223 | |||
| 1605 | Ga0373927_0001870 | |||
| 1606 | Ga0373927_0014378 | |||
| 1607 | Ga0373927_0107770 | |||
| 1608 | Ga0373927_0147662 | |||
| 1609 | Ga0373933_0105186 | |||
| 1610 | Ga0373947_0004918 | |||
| 1611 | Ga0373947_0082924 | |||
| 1612 | Ga0373937_0021190 | |||
| 1613 | Ga0373937_0213932 | |||
| 1614 | Ga0316582_0140697 | |||
| 1615 | Ga0373925_0003141 | |||
| 1616 | Ga0373925_0004558 | |||
| 1617 | Ga0373925_0020423 | |||
| 1618 | Ga0373925_0066467 | |||
| 1619 | Ga0373925_0377574 | |||
| 1620 | Ga0395899_0148967 | |||
| 1621 | Ga0395900_0086129 | |||
| 1622 | Ga0395898_0002249 | |||
| 1623 | Ga0395898_0592444 | |||
| 1624 | Ga0395905_0110789 | |||
| 1625 | Ga0395905_0519260 | |||
| 1626 | Ga0436364_0269804 | |||
| 1627 | Ga0395901_0064332 | |||
| 1628 | Ga0395901_0096935 | |||
| 1629 | Ga0395901_0276939 | |||
| 1630 | Ga0436365_0011381 | |||
| 1631 | Ga0436365_0265841 | |||
| 1632 | Ga0436365_0321374 | |||
| 1633 | Ga0436365_0350464 | |||
| 1634 | Ga0436365_0954239 | |||
| 1635 | Ga0436360_0539211 | |||
| 1636 | Ga0436360_1089733 | |||
| 1637 | Ga0436363_0538486 | |||
| 1638 | Ga0436362_0223954 | |||
| 1639 | Ga0451853_3234775 | |||
| 1640 | Ga0451853_3961465 | |||
| 1641 | Ga0439435_0043784 | |||
| 1642 | Ga0466967_0062646 | |||
| 1643 | Ga0495617_029819 | |||
| 1644 | Ga0495592_0060981 | |||
| 1645 | Ga0495603_0000298 | |||
| 1646 | Ga0495603_0006456 | |||
| 1647 | Ga0495603_0070400 | |||
| 1648 | Ga0495603_0186634 | |||
| 1649 | Ga0495629_0000336 | |||
| 1650 | Ga0495641_0001543 | |||
| 1651 | Ga0495651_0000461 | |||
| 1652 | Ga0495580_0004668 | |||
| 1653 | Ga0495580_0053641 | |||
| 1654 | Ga0495580_0135281 | |||
| 1655 | Ga0495580_0297421 | |||
| 1656 | Ga0495582_0000134 | |||
| 1657 | Ga0495582_0093755 | |||
| 1658 | Ga0495582_0243400 | |||
| 1659 | Ga0495639_0001666 | |||
| 1660 | Ga0495639_0116832 | |||
| 1661 | Ga0495662_0000247 | |||
| 1662 | Ga0495664_0002841 | |||
| 1663 | Ga0495664_0007422 | |||
| 1664 | Ga0495664_0036424 | |||
| 1665 | Ga0495585_0124186 | |||
| 1666 | Ga0495594_0001158 | |||
| 1667 | Ga0495594_0048999 | |||
| 1668 | Ga0495594_0147168 | |||
| 1669 | Ga0495594_0171646 | |||
| 1670 | Ga0495594_0199645 | |||
| 1671 | Ga0495583_0009837 | |||
| 1672 | Ga0495608_0011744 | |||
| 1673 | Ga0495628_0031305 | |||
| 1674 | Ga0495630_0003037 | |||
| 1675 | Ga0495630_0015478 | |||
| 1676 | Ga0495630_0038590 | |||
| 1677 | Ga0495666_0019067 | |||
| 1678 | Ga0495652_0004619 | |||
| 1679 | Ga0495652_0158194 | |||
| 1680 | Ga0495665_0001246 | |||
| 1681 | Ga0495665_0079272 | |||
| 1682 | Ga0495665_0081794 | |||
| 1683 | Ga0495665_0090623 | |||
| 1684 | Ga0495640_0063685 | |||
| 1685 | Ga0495640_0249758 | |||
| 1686 | Ga0495598_0004079 | |||
| 1687 | Ga0495598_0026502 | |||
| 1688 | Ga0495621_0038723 | |||
| 1689 | Ga0495621_0116440 | |||
| 1690 | Ga0495645_0007613 | |||
| 1691 | Ga0495645_0311419 | |||
| 1692 | Ga0495622_0009872 | |||
| 1693 | Ga0495622_0011954 | |||
| 1694 | Ga0495667_0302633 | |||
| 1695 | Ga0495656_0003709 | |||
| 1696 | Ga0495656_0038433 | |||
| 1697 | Ga0495668_0013420 | |||
| 1698 | Ga0495668_0077758 | |||
| 1699 | Ga0495634_0002604 | |||
| 1700 | Ga0495634_0059610 | |||
| 1701 | Ga0495635_0003952 | |||
| 1702 | Ga0495635_0014916 | |||
| 1703 | Ga0495635_0343783 | |||
| 1704 | Ga0495659_0012651 | |||
| 1705 | Ga0495661_0080600 | |||
| 1706 | Ga0495588_0028098 | |||
| 1707 | Ga0495657_0002772 | |||
| 1708 | Ga0495599_0018332 | |||
| 1709 | Ga0495646_0018795 | |||
| 1710 | Ga0495647_0000802 | |||
| 1711 | Ga0495647_0183242 | |||
| 1712 | Ga0495669_0027987 | |||
| 1713 | Ga0495669_0115017 | |||
| 1714 | Ga0495613_0002024 | |||
| 1715 | Ga0495613_0036184 | |||
| 1716 | Ga0495624_0002097 | |||
| 1717 | Ga0495624_0072338 | |||
| 1718 | Ga0495624_0166516 | |||
| 1719 | Ga0495624_0296288 | |||
| 1720 | Ga0495589_0027704 | |||
| 1721 | Ga0495600_0001622 | |||
| 1722 | Ga0495600_0194366 | |||
| 1723 | Ga0495581_0000072 | |||
| 1724 | Ga0495581_0223432 | |||
| 1725 | Ga0495604_0004466 | |||
| 1726 | Ga0495604_0069222 | |||
| 1727 | Ga0495636_0007176 | |||
| 1728 | Ga0495674_0002364 | |||
| 1729 | Ga0495674_0004841 | |||
| 1730 | Ga0495674_0021885 | |||
| 1731 | Ga0495676_0045738 | |||
| 1732 | Ga0495680_0002271 | |||
| 1733 | Ga0495680_0115104 | |||
| 1734 | Ga0495677_0070328 | |||
| 1735 | Ga0495685_096513 | |||
| 1736 | Ga0495681_0086279 | |||
| 1737 | Ga0495684_0065597 | |||
| 1738 | Ga0495684_0393264 | |||
| 1739 | Ga0495593_0000094 | |||
| 1740 | Ga0496100_0013147 | |||
| 1741 | Ga0496100_0246514 | |||
| 1742 | Ga0496100_0257105 | |||
| 1743 | Ga0496100_0307379 | |||
| 1744 | Ga0496101_0005202 | |||
| 1745 | Ga0496101_0072512 | |||
| 1746 | Ga0496102_0014347 | |||
| 1747 | Ga0496102_0021844 | |||
| 1748 | Ga0496102_0070862 | |||
| 1749 | Ga0496102_0110863 | |||
| 1750 | Ga0496102_0617425 | |||
| 1751 | Ga0496102_0670214 | |||
| 1752 | Ga0496102_0744377 | |||
| 1753 | Ga0496103_0028243 | |||
| 1754 | Ga0496103_0109623 | |||
| 1755 | Ga0496103_0123584 | |||
| 1756 | Ga0496103_0124684 | |||
| 1757 | Ga0496103_0143809 | |||
| 1758 | Ga0496104_0087324 | |||
| 1759 | Ga0496104_0118705 | |||
| 1760 | Ga0496104_0161115 | |||
| 1761 | Ga0496105_0031262 | |||
| 1762 | Ga0496105_0309405 | |||
| 1763 | Ga0496106_0009999 | |||
| 1764 | Ga0496106_0073243 | |||
| 1765 | Ga0496106_0099608 | |||
| 1766 | Ga0496106_0102249 | |||
| 1767 | Ga0496106_0282857 | |||
| 1768 | Ga0496106_0303783 | |||
| 1769 | Ga0496107_0012533 | |||
| 1770 | Ga0496107_0090508 | |||
| 1771 | Ga0496107_0277551 | |||
| 1772 | Ga0496107_0594055 | |||
| 1773 | Ga0496108_0005893 | |||
| 1774 | Ga0496108_0102157 | |||
| 1775 | Ga0496108_0141751 | |||
| 1776 | Ga0496109_0008278 | |||
| 1777 | Ga0496109_0029898 | |||
| 1778 | Ga0496109_0048437 | |||
| 1779 | Ga0496110_0007982 | |||
| 1780 | Ga0496110_0020252 | |||
| 1781 | Ga0496111_0022826 | |||
| 1782 | Ga0496112_0004983 | |||
| 1783 | Ga0496112_0069737 | |||
| 1784 | Ga0496112_0515236 | |||
| 1785 | Ga0496112_0732571 | |||
| 1786 | Ga0496113_0001782 | |||
| 1787 | Ga0496113_0040675 | |||
| 1788 | Ga0496114_0148434 | |||
| 1789 | Ga0496114_0238178 | |||
| 1790 | Ga0496114_0274230 | |||
| 1791 | Ga0496114_0796416 | |||
| 1792 | Ga0496115_0024226 | |||
| 1793 | Ga0496115_0132400 | |||
| 1794 | Ga0496116_0002454 | |||
| 1795 | Ga0496116_0071661 | |||
| 1796 | Ga0496116_0087783 | |||
| 1797 | Ga0496121_0043033 | |||
| 1798 | Ga0496124_0005968 | |||
| 1799 | Ga0496125_0140450 | |||
| 1800 | Ga0496126_0030132 | |||
| 1801 | Ga0495678_020678 | |||
| 1802 | Ga0501031_0029699 | |||
| 1803 | Ga0501031_0103369 | |||
| 1804 | Ga0501033_0073806 | |||
| 1805 | Ga0501034_0000050 | |||
| 1806 | Ga0501038_0139096 | |||
| 1807 | Ga0501040_0127742 | |||
| 1808 | Ga0501042_0079862 | |||
| 1809 | Ga0501042_0097326 | |||
| 1810 | Ga0501043_0093945 | |||
| 1811 | Ga0501047_0259251 | |||
| 1812 | Ga0501071_0131322 | |||
| 1813 | Ga0501074_0108192 | |||
| 1814 | Ga0501076_0144048 | |||
| 1815 | Ga0501077_0262542 | |||
| 1816 | Ga0501081_0171991 | |||
| 1817 | Ga0501035_0155510 | |||
| 1818 | nmdc:mga00v17_155380_c1 | |||
| 1819 | nmdc:mga00v17_23592_c1 | |||
| 1820 | nmdc:mga00v17_39556_c1 | |||
| 1821 | nmdc:mga0yw44_215377_c1 | |||
| 1822 | nmdc:mga06z11_84102_c1 | |||
| 1823 | nmdc:mga05p37_233_c1 | |||
| 1824 | nmdc:mga09592_276293_c1 | |||
| 1825 | nmdc:mga09592_800_c1 | |||
| 1826 | nmdc:mga0qj67_99316_c1 | |||
| 1827 | nmdc:mga06r32_94_c1 | |||
| 1828 | nmdc:mga08y16_251518_c1 | |||
| 1829 | nmdc:mga08y16_2747_c1 | |||
| 1830 | nmdc:mga0n895_524772_c1 | |||
| 1831 | nmdc:mga0n895_63502_c1 | |||
| 1832 | nmdc:mga0rr50_8887_c1 | |||
| 1833 | nmdc:mga08x19_211792_c1 | |||
| 1834 | Ga0495612_0098788 | |||
| 1835 | Ga0495655_0053431 | |||
| 1836 | Ga0495619_0315074 | |||
| 1837 | Ga0500646_0121605 | |||
| 1838 | Ga0500651_0167979 | |||
| 1839 | Ga0500566_0242572 | |||
| 1840 | Ga0500555_012495 | |||
| 1841 | Ga0500658_0011685 | |||
| 1842 | Ga0500588_0092697 | |||
| 1843 | Ga0500604_0021080 | |||
| 1844 | Ga0500627_0032682 | |||
| 1845 | Ga0500634_0130932 | |||
| 1846 | Ga0530510_0187102 | |||
| 1847 | 2513894375 | |||
| 1848 | 2644123516 | |||
| 1849 | 2858694263 | |||
| 1850 | 2883577728 | |||
| 1851 | 2885412758 | |||
| 1852 | 2889310900 | |||
| 1853 | 2894777252 | |||
| 1854 | 2901305424 | |||
| 1855 | 2902336719 | |||
| 1856 | 2928126853 | |||
| 1857 | 2929200800 | |||
| 1858 | 2935742982 | |||
| 1859 | 8019556053 | |||
| 1860 | 8019569257 | |||
| 1861 | 8048749888 | |||
| 1862 | 8055914016 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4npc-assembly1.cif.gz_A | crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis | 0.9741 | 3 | 250 |
| 4iuy-assembly2.cif.gz_G | crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c | 0.9714 | 1 | 251 |
| 4ure-assembly1.cif.gz_A | molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 | 0.9654 | 4 | 250 |
| 4za2-assembly1.cif.gz_C | crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ | 0.9652 | 2 | 249 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.9648 | 5 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9741 | 3 | 250 | 3.40.50.720 |
| 4iuyC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9666 | 1 | 253 | 3.40.50.720 |
| af_A0A1D8PPB1_4_280_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9656 | 3 | 248 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9648 | 5 | 248 | 3.40.50.720 |
| 4iuyC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9629 | 1 | 253 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258K2D8-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9887 | 63 | 253 |
GO:0016616
|
| AF-A0A537R720-F1-model_v4 | SDR family oxidoreductase | 0.9875 | 52 | 250 |
GO:0016616
GO:0030497 |
| AF-A0A520NW44-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.987 | 3 | 253 |
GO:0016616
|
| AF-A0A8A7CQC7-F1-model_v4 | deleted | 0.9864 | 1 | 253 |
|
| AF-A0A1X9NLD9-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9863 | 2 | 253 |
GO:0016616
|