F486032

General Info

Members Datasets Scaffolds Average Seq Length
931 365 1862 254

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100012357|Ga0070714_1000123577
Length 281
Sequence MALWVDQFLSGAGSGEAEFPSCMRFAMIDLFGIQGLHALVTGGSSGLGRFFATSLAARGALVTVGARRAEALAKTVDDIAAAKGQAQSVVMDVTVGASIETALDSAEARFGPIQIVVNNAGVTATRPALQQDETDWDKVVDTNLKGVWLVAQAAGRKMVANKVKGSIVNVASILGLRVASSVAPYAISKAGVVQMTKALALEWARYGIRVNALAPGYFETELNDDFFQEAAGQALIKRIPQRRLGELRELEGPLLLLASEAGSYMTGSVIVADGGHVVSTL

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
350 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
351 2643221621 Achromobacter sp. Root83 Isolate Unclassified
352 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
353 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
354 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
355 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
356 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
357 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
358 2902330777 Methylobacterium sp. 2A Isolate Unclassified
359 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
360 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
361 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
362 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
363 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
364 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
365 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0.43
Rhizoplane 5.8
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100012357 3300005435 Bacteria 6816
2 JGI24034J26672_10023738 3300002239 Bacteria 974
3 JGI24751J29686_10048055 3300002459 Bacteria 880
4 JGI25406J46586_10001111 3300003203 Bacteria 12608
5 rootL2_10282064 3300003322 Bacteria 1594
6 JGI25404J52841_10000240 3300003659 Bacteria 6868
7 JGI25405J52794_10030357 3300003911 Bacteria 1120
8 Ga0065715_10303549 3300005293 Bacteria 1024
9 Ga0070658_10149119 3300005327 Bacteria 1957
10 Ga0070676_10027703 3300005328 Bacteria 3215
11 Ga0070676_10212221 3300005328 Bacteria 1274
12 Ga0070676_10281374 3300005328 Bacteria 1121
13 Ga0070683_100034649 3300005329 Bacteria 4613
14 Ga0070683_100072024 3300005329 Bacteria 3225
15 Ga0070683_100482203 3300005329 Bacteria 1184
16 Ga0070690_100080742 3300005330 Bacteria 2127
17 Ga0070690_100220596 3300005330 Unclassified 1328
18 Ga0070690_100310698 3300005330 Bacteria 1133
19 Ga0070670_100329057 3300005331 Unclassified 1340
20 Ga0070677_10077039 3300005333 Unclassified 1417
21 Ga0068869_100020691 3300005334 Bacteria 4517
22 Ga0068869_100061149 3300005334 Bacteria 2762
23 Ga0070666_10004139 3300005335 Bacteria 8802
24 Ga0070666_10026855 3300005335 Bacteria 3766
25 Ga0070666_10060256 3300005335 Bacteria 2568
26 Ga0070666_10141782 3300005335 Bacteria 1674
27 Ga0070666_10247316 3300005335 Bacteria 1262
28 Ga0070680_100119833 3300005336 Bacteria 2196
29 Ga0070680_100639446 3300005336 Bacteria 914
30 Ga0070682_100175888 3300005337 Bacteria 1491
31 Ga0068868_100098577 3300005338 Bacteria 2363
32 Ga0068868_100179794 3300005338 Bacteria 1754
33 Ga0068868_100437731 3300005338 Bacteria 1135
34 Ga0068868_100472405 3300005338 Bacteria 1094
35 Ga0070660_100009904 3300005339 Bacteria 6722
36 Ga0070660_100019782 3300005339 Bacteria 4938
37 Ga0070660_100037023 3300005339 Bacteria 3698
38 Ga0070660_100048417 3300005339 Bacteria 3265
39 Ga0070660_100243265 3300005339 Bacteria 1466
40 Ga0070689_100003058 3300005340 Bacteria 11018
41 Ga0070689_100345765 3300005340 Unclassified 1246
42 Ga0070661_100019023 3300005344 Bacteria 4889
43 Ga0070661_100022594 3300005344 Bacteria 4504
44 Ga0070661_100031004 3300005344 Bacteria 3865
45 Ga0070692_10018833 3300005345 Bacteria 3327
46 Ga0070692_10033813 3300005345 Bacteria 2578
47 Ga0070668_100013378 3300005347 Bacteria 6123
48 Ga0070668_100116421 3300005347 Bacteria 2131
49 Ga0070668_100620644 3300005347 Bacteria 947
50 Ga0070669_100029099 3300005353 Bacteria 3981
51 Ga0070669_100100908 3300005353 Bacteria 2177
52 Ga0070669_100150514 3300005353 Bacteria 1801
53 Ga0070675_100038048 3300005354 Bacteria 3920
54 Ga0070675_100093182 3300005354 Bacteria 2526
55 Ga0070675_100299567 3300005354 Bacteria 1416
56 Ga0070671_100054368 3300005355 Bacteria 3329
57 Ga0070671_100058106 3300005355 Bacteria 3220
58 Ga0070671_100182612 3300005355 Bacteria 1776
59 Ga0070671_100322725 3300005355 Bacteria 1316
60 Ga0070671_100414339 3300005355 Bacteria 1153
61 Ga0070674_100005862 3300005356 Bacteria 7145
62 Ga0070674_100005913 3300005356 Bacteria 7115
63 Ga0070673_100091758 3300005364 Bacteria 2483
64 Ga0070673_100102820 3300005364 Bacteria 2356
65 Ga0070673_100229419 3300005364 Bacteria 1610
66 Ga0070673_100489738 3300005364 Bacteria 1111
67 Ga0070673_100550393 3300005364 Bacteria 1048
68 Ga0070688_100015320 3300005365 Bacteria 4360
69 Ga0070688_100093508 3300005365 Bacteria 1969
70 Ga0070659_100000182 3300005366 Bacteria 48054
71 Ga0070659_100002279 3300005366 Bacteria 13661
72 Ga0070659_100023880 3300005366 Bacteria 4683
73 Ga0070659_100041424 3300005366 Bacteria 3600
74 Ga0070659_100179291 3300005366 Bacteria 1738
75 Ga0070667_100001759 3300005367 Bacteria 19302
76 Ga0070667_100070917 3300005367 Bacteria 2967
77 Ga0070667_100093912 3300005367 Bacteria 2584
78 Ga0070667_100126209 3300005367 Bacteria 2230
79 Ga0070667_100290235 3300005367 Bacteria 1471
80 Ga0070667_100698337 3300005367 Bacteria 939
81 Ga0070709_10001020 3300005434 Bacteria 15489
82 Ga0070709_10001626 3300005434 Bacteria 12157
83 Ga0070709_10004665 3300005434 Bacteria 7402
84 Ga0070709_10008636 3300005434 Bacteria 5603
85 Ga0070709_10067302 3300005434 Bacteria 2300
86 Ga0070714_100002584 3300005435 Bacteria 13346
87 Ga0070714_100036631 3300005435 Bacteria 4115
88 Ga0070714_100039615 3300005435 Bacteria 3968
89 Ga0070714_100888778 3300005435 Bacteria 865
90 Ga0070713_100000018 3300005436 Bacteria 118409
91 Ga0070713_100001762 3300005436 Bacteria 13965
92 Ga0070713_100016897 3300005436 Bacteria 5498
93 Ga0070713_100031472 3300005436 Bacteria 4226
94 Ga0070713_100053328 3300005436 Bacteria 3351
95 Ga0070713_100073756 3300005436 Bacteria 2890
96 Ga0070713_100457964 3300005436 Bacteria 1199
97 Ga0070710_10000501 3300005437 Bacteria 18393
98 Ga0070710_10002329 3300005437 Bacteria 8993
99 Ga0070710_10008451 3300005437 Bacteria 5011
100 Ga0070710_10021411 3300005437 Bacteria 3369
101 Ga0070710_10044901 3300005437 Bacteria 2454
102 Ga0070710_10139780 3300005437 Bacteria 1484
103 Ga0070701_10016072 3300005438 Bacteria 3471
104 Ga0070711_100003966 3300005439 Bacteria 8698
105 Ga0070711_100009080 3300005439 Bacteria 6108
106 Ga0070711_100014864 3300005439 Bacteria 4916
107 Ga0070711_100031186 3300005439 Bacteria 3536
108 Ga0070711_100050933 3300005439 Bacteria 2841
109 Ga0070711_100127915 3300005439 Bacteria 1888
110 Ga0070711_100279395 3300005439 Bacteria 1320
111 Ga0070711_100477939 3300005439 Bacteria 1024
112 Ga0070700_100042872 3300005441 Bacteria 2781
113 Ga0070694_100263888 3300005444 Unclassified 1307
114 Ga0070663_100024357 3300005455 Bacteria 4072
115 Ga0070663_100148883 3300005455 Bacteria 1793
116 Ga0070663_100257400 3300005455 Bacteria 1383
117 Ga0070678_100000194 3300005456 Bacteria 26767
118 Ga0070678_100000941 3300005456 Bacteria 14965
119 Ga0070678_100028009 3300005456 Bacteria 3835
120 Ga0070678_100033427 3300005456 Bacteria 3571
121 Ga0070678_100069589 3300005456 Bacteria 2628
122 Ga0070678_100268470 3300005456 Bacteria 1438
123 Ga0070678_100532246 3300005456 Bacteria 1041
124 Ga0070678_100737353 3300005456 Bacteria 890
125 Ga0070662_100000120 3300005457 Bacteria 43782
126 Ga0070662_100014078 3300005457 Bacteria 5334
127 Ga0070662_100017566 3300005457 Bacteria 4825
128 Ga0070662_100078996 3300005457 Bacteria 2445
129 Ga0070662_100128597 3300005457 Bacteria 1950
130 Ga0070681_10050801 3300005458 Bacteria 4137
131 Ga0070681_10097627 3300005458 Bacteria 2885
132 Ga0068867_100062565 3300005459 Bacteria 2765
133 Ga0068867_100117031 3300005459 Bacteria 2055
134 Ga0068867_100547437 3300005459 Bacteria 1002
135 Ga0070685_10016352 3300005466 Bacteria 3952
136 Ga0070698_100160616 3300005471 Bacteria 2191
137 Ga0070679_100083118 3300005530 Bacteria 3191
138 Ga0070679_100350568 3300005530 Bacteria 1424
139 Ga0070684_100344952 3300005535 Bacteria 1369
140 Ga0070697_100199098 3300005536 Bacteria 1702
141 Ga0068853_100001080 3300005539 Bacteria 19275
142 Ga0068853_100031659 3300005539 Bacteria 4475
143 Ga0068853_100052626 3300005539 Bacteria 3507
144 Ga0068853_100117706 3300005539 Bacteria 2367
145 Ga0070672_100001583 3300005543 Bacteria 14108
146 Ga0070672_100052573 3300005543 Bacteria 3181
147 Ga0070686_100106246 3300005544 Bacteria 1905
148 Ga0070686_100106775 3300005544 Bacteria 1901
149 Ga0070695_100160857 3300005545 Unclassified 1576
150 Ga0070665_100010384 3300005548 Bacteria 9422
151 Ga0070665_100099334 3300005548 Bacteria 2914
152 Ga0070665_100109385 3300005548 Bacteria 2766
153 Ga0070665_100186781 3300005548 Bacteria 2073
154 Ga0070665_100395511 3300005548 Bacteria 1390
155 Ga0070665_100696448 3300005548 Bacteria 1029
156 Ga0068855_100001125 3300005563 Bacteria 33195
157 Ga0068855_100002492 3300005563 Bacteria 22681
158 Ga0068855_100003366 3300005563 Bacteria 19577
159 Ga0068855_100110719 3300005563 Bacteria 3152
160 Ga0068855_100132740 3300005563 Bacteria 2842
161 Ga0068855_100361975 3300005563 Bacteria 1596
162 Ga0070664_100000226 3300005564 Bacteria 40249
163 Ga0070664_100005943 3300005564 Bacteria 9859
164 Ga0070664_100017178 3300005564 Bacteria 5939
165 Ga0070664_100040115 3300005564 Bacteria 3946
166 Ga0070664_100193235 3300005564 Bacteria 1814
167 Ga0070664_100727509 3300005564 Bacteria 925
168 Ga0068857_100243412 3300005577 Bacteria 1647
169 Ga0068857_100403931 3300005577 Bacteria 1271
170 Ga0068857_100742663 3300005577 Bacteria 934
171 Ga0068854_100016658 3300005578 Bacteria 4904
172 Ga0068854_100104455 3300005578 Bacteria 2128
173 Ga0068854_100131156 3300005578 Bacteria 1914
174 Ga0068854_100652432 3300005578 Bacteria 904
175 Ga0068856_100001739 3300005614 Bacteria 22768
176 Ga0068856_100005592 3300005614 Bacteria 12370
177 Ga0068856_100006697 3300005614 Bacteria 11296
178 Ga0068856_100051747 3300005614 Bacteria 4049
179 Ga0068856_100490960 3300005614 Bacteria 1249
180 Ga0070702_100029406 3300005615 Bacteria 2987
181 Ga0068852_100041070 3300005616 Bacteria 3907
182 Ga0068852_100064062 3300005616 Bacteria 3203
183 Ga0068852_100072519 3300005616 Bacteria 3026
184 Ga0068852_100143948 3300005616 Bacteria 2209
185 Ga0068852_100523805 3300005616 Bacteria 1183
186 Ga0068859_100044877 3300005617 Bacteria 4441
187 Ga0068859_100084994 3300005617 Bacteria 3209
188 Ga0068859_100440374 3300005617 Bacteria 1399
189 Ga0068859_100798935 3300005617 Bacteria 1031
190 Ga0068864_100003834 3300005618 Bacteria 12396
191 Ga0068864_100044645 3300005618 Bacteria 3800
192 Ga0068864_100083910 3300005618 Bacteria 2798
193 Ga0068866_10027616 3300005718 Bacteria 2695
194 Ga0068866_10046747 3300005718 Bacteria 2178
195 Ga0068866_10064994 3300005718 Bacteria 1907
196 Ga0068861_100021195 3300005719 Bacteria 4670
197 Ga0068861_100040221 3300005719 Bacteria 3495
198 Ga0068861_100050631 3300005719 Bacteria 3150
199 Ga0068851_10004520 3300005834 Bacteria 6275
200 Ga0068851_10008957 3300005834 Bacteria 4642
201 Ga0068851_10050440 3300005834 Bacteria 2113
202 Ga0068870_10115568 3300005840 Unclassified 1538
203 Ga0068870_10218095 3300005840 Bacteria 1166
204 Ga0068863_100007860 3300005841 Bacteria 10426
205 Ga0068863_100049982 3300005841 Bacteria 3965
206 Ga0068863_100092096 3300005841 Bacteria 2875
207 Ga0068858_100022334 3300005842 Bacteria 5907
208 Ga0068858_100065327 3300005842 Bacteria 3366
209 Ga0068858_100358046 3300005842 Bacteria 1398
210 Ga0068858_100485784 3300005842 Bacteria 1192
211 Ga0068860_100083385 3300005843 Bacteria 3040
212 Ga0068860_100115849 3300005843 Bacteria 2563
213 Ga0068860_100160391 3300005843 Bacteria 2168
214 Ga0068860_100225608 3300005843 Bacteria 1820
215 Ga0068860_100335898 3300005843 Bacteria 1485
216 Ga0068862_100177399 3300005844 Bacteria 1910
217 Ga0081455_10002176 3300005937 Bacteria 23372
218 Ga0081455_10006640 3300005937 Bacteria 12369
219 Ga0081455_10155536 3300005937 Bacteria 1758
220 Ga0081540_1000096 3300005983 Bacteria 92520
221 Ga0081540_1001408 3300005983 Bacteria 20808
222 Ga0081540_1005726 3300005983 Bacteria 9218
223 Ga0081540_1022947 3300005983 Bacteria 3668
224 Ga0081540_1022965 3300005983 Bacteria 3666
225 Ga0081540_1041740 3300005983 Bacteria 2375
226 Ga0081540_1050196 3300005983 Bacteria 2074
227 Ga0081540_1081052 3300005983 Bacteria 1461
228 Ga0081540_1134315 3300005983 Bacteria 1004
229 Ga0081539_10001144 3300005985 Bacteria 48051
230 Ga0081539_10049223 3300005985 Bacteria 2393
231 Ga0081539_10052448 3300005985 Bacteria 2290
232 Ga0070717_10001571 3300006028 Bacteria 15812
233 Ga0070717_10355677 3300006028 Bacteria 1310
234 Ga0075363_100123490 3300006048 Bacteria 1447
235 Ga0075364_10000139 3300006051 Bacteria 31253
236 Ga0075364_10013965 3300006051 Bacteria 4949
237 Ga0075364_10072695 3300006051 Bacteria 2266
238 Ga0075364_10126329 3300006051 Bacteria 1715
239 Ga0075432_10015900 3300006058 Bacteria 2569
240 Ga0070715_10001554 3300006163 Bacteria 6723
241 Ga0070715_10007590 3300006163 Bacteria 3740
242 Ga0070716_100001649 3300006173 Bacteria 10072
243 Ga0070716_100004329 3300006173 Bacteria 6771
244 Ga0070716_100010923 3300006173 Bacteria 4568
245 Ga0070716_100040864 3300006173 Bacteria 2581
246 Ga0070716_100053989 3300006173 Bacteria 2293
247 Ga0070716_100162698 3300006173 Bacteria 1448
248 Ga0070716_100223925 3300006173 Bacteria 1265
249 Ga0070712_100004086 3300006175 Bacteria 8964
250 Ga0070712_100083000 3300006175 Bacteria 2326
251 Ga0070712_100156328 3300006175 Bacteria 1756
252 Ga0070712_100204791 3300006175 Bacteria 1552
253 Ga0075367_10108312 3300006178 Bacteria 1703
254 Ga0075367_10172674 3300006178 Bacteria 1347
255 Ga0075366_10025653 3300006195 Bacteria 3445
256 Ga0075366_10103407 3300006195 Bacteria 1710
257 Ga0097621_100000458 3300006237 Bacteria 28590
258 Ga0097621_100078338 3300006237 Bacteria 2746
259 Ga0068871_100000291 3300006358 Bacteria 35039
260 Ga0068871_100061176 3300006358 Bacteria 3074
261 Ga0068871_100073430 3300006358 Bacteria 2820
262 Ga0068871_100266221 3300006358 Bacteria 1496
263 Ga0068871_100295449 3300006358 Bacteria 1421
264 Ga0068871_100425846 3300006358 Bacteria 1186
265 Ga0075428_100001488 3300006844 Bacteria 25069
266 Ga0075430_100121836 3300006846 Bacteria 2174
267 Ga0075430_100209147 3300006846 Bacteria 1619
268 Ga0075431_100000504 3300006847 Bacteria 32639
269 Ga0075434_100039915 3300006871 Bacteria 4649
270 Ga0075429_100000459 3300006880 Bacteria 30370
271 Ga0075429_100416719 3300006880 Bacteria 1176
272 Ga0068865_100010532 3300006881 Bacteria 5759
273 Ga0068865_100106539 3300006881 Bacteria 2061
274 Ga0068865_100215674 3300006881 Bacteria 1498
275 Ga0068865_100265957 3300006881 Unclassified 1360
276 Ga0068865_100288095 3300006881 Bacteria 1310
277 Ga0075436_100321727 3300006914 Bacteria 1111
278 Ga0097620_100044877 3300006931 Bacteria 4441
279 Ga0097620_100084982 3300006931 Bacteria 3209
280 Ga0097620_100440401 3300006931 Bacteria 1399
281 Ga0097620_100798998 3300006931 Bacteria 1031
282 Ga0075435_100027074 3300007076 Bacteria 4481
283 Ga0075435_100586588 3300007076 Bacteria 966
284 Ga0105240_10023182 3300009093 Bacteria 8219
285 Ga0105240_10433924 3300009093 Bacteria 1473
286 Ga0105240_10763200 3300009093 Bacteria 1050
287 Ga0111539_10002196 3300009094 Bacteria 26061
288 Ga0111539_10006967 3300009094 Bacteria 14509
289 Ga0111539_10063702 3300009094 Bacteria 4362
290 Ga0105245_10034600 3300009098 Bacteria 4482
291 Ga0105245_10066003 3300009098 Bacteria 3274
292 Ga0105245_10075278 3300009098 Bacteria 3073
293 Ga0105245_10255076 3300009098 Unclassified 1705
294 Ga0105245_10263303 3300009098 Bacteria 1679
295 Ga0105245_10493065 3300009098 Bacteria 1240
296 Ga0114129_10000593 3300009147 Bacteria 44778
297 Ga0114129_11041476 3300009147 Bacteria 1028
298 Ga0105243_10021629 3300009148 Bacteria 4883
299 Ga0105243_10094039 3300009148 Bacteria 2475
300 Ga0105243_10113817 3300009148 Bacteria 2269
301 Ga0105243_10376049 3300009148 Bacteria 1312
302 Ga0105243_10442189 3300009148 Bacteria 1218
303 Ga0105241_10002214 3300009174 Bacteria 14629
304 Ga0105241_10009474 3300009174 Bacteria 7155
305 Ga0105241_10345929 3300009174 Bacteria 1290
306 Ga0105242_10036944 3300009176 Bacteria 3921
307 Ga0105242_10101044 3300009176 Bacteria 2444
308 Ga0105242_10104288 3300009176 Bacteria 2407
309 Ga0105242_10139739 3300009176 Bacteria 2100
310 Ga0105242_10168506 3300009176 Unclassified 1923
311 Ga0105242_10994125 3300009176 Bacteria 846
312 Ga0105248_10006493 3300009177 Bacteria 12824
313 Ga0105248_10051747 3300009177 Bacteria 4608
314 Ga0105248_10104462 3300009177 Bacteria 3194
315 Ga0105248_10116757 3300009177 Bacteria 3010
316 Ga0105248_10496922 3300009177 Bacteria 1375
317 Ga0105237_10177118 3300009545 Bacteria 2133
318 Ga0105238_10013647 3300009551 Bacteria 8204
319 Ga0105238_10044924 3300009551 Bacteria 4464
320 Ga0105238_10062584 3300009551 Bacteria 3721
321 Ga0105249_10019606 3300009553 Bacteria 6036
322 Ga0105249_10073706 3300009553 Bacteria 3158
323 Ga0105249_10236945 3300009553 Unclassified 1802
324 Ga0099796_10002032 3300010159 Bacteria 4316
325 Ga0105239_10042625 3300010375 Bacteria 4972
326 Ga0105239_10084846 3300010375 Bacteria 3489
327 Ga0105239_10140266 3300010375 Bacteria 2693
328 Ga0105239_10204440 3300010375 Bacteria 2213
329 Ga0105246_10032914 3300011119 Bacteria 3441
330 Ga0105246_10060490 3300011119 Bacteria 2632
331 Ga0105246_10064899 3300011119 Bacteria 2552
332 Ga0105246_10189581 3300011119 Bacteria 1590
333 Ga0105246_10218340 3300011119 Bacteria 1493
334 Ga0105246_10650335 3300011119 Bacteria 918
335 Ga0157327_1005464 3300012512 Bacteria 1031
336 Ga0157373_10000824 3300013100 Bacteria 24025
337 Ga0157373_10005021 3300013100 Bacteria 9939
338 Ga0157371_10000769 3300013102 Bacteria 37033
339 Ga0157371_10099752 3300013102 Bacteria 2059
340 Ga0157371_10303600 3300013102 Bacteria 1156
341 Ga0157370_10003726 3300013104 Bacteria 17814
342 Ga0157370_10107283 3300013104 Bacteria 2612
343 Ga0157370_10143609 3300013104 Bacteria 2223
344 Ga0157370_10196144 3300013104 Bacteria 1874
345 Ga0157370_10475022 3300013104 Bacteria 1149
346 Ga0157369_10028062 3300013105 Bacteria 6233
347 Ga0157369_10085368 3300013105 Bacteria 3374
348 Ga0157369_10280726 3300013105 Bacteria 1734
349 Ga0157369_10420906 3300013105 Bacteria 1385
350 Ga0157374_10059054 3300013296 Bacteria 3585
351 Ga0157374_10181773 3300013296 Bacteria 2054
352 Ga0157374_10296608 3300013296 Bacteria 1599
353 Ga0157374_10306473 3300013296 Bacteria 1572
354 Ga0157378_10063263 3300013297 Bacteria 3306
355 Ga0157378_10068127 3300013297 Bacteria 3191
356 Ga0157378_10165162 3300013297 Bacteria 2073
357 Ga0157378_10197025 3300013297 Bacteria 1903
358 Ga0157378_10251308 3300013297 Bacteria 1693
359 Ga0157378_10377978 3300013297 Bacteria 1391
360 Ga0163162_10032188 3300013306 Bacteria 5206
361 Ga0163162_10039769 3300013306 Bacteria 4700
362 Ga0163162_10067406 3300013306 Bacteria 3629
363 Ga0163162_10073390 3300013306 Bacteria 3477
364 Ga0163162_10085192 3300013306 Bacteria 3237
365 Ga0163162_10140412 3300013306 Bacteria 2529
366 Ga0163162_10143832 3300013306 Bacteria 2499
367 Ga0163162_10246251 3300013306 Bacteria 1919
368 Ga0163162_10359423 3300013306 Bacteria 1589
369 Ga0157372_10002479 3300013307 Bacteria 20002
370 Ga0157372_10010519 3300013307 Bacteria 9846
371 Ga0157372_10031751 3300013307 Bacteria 5785
372 Ga0157372_10092578 3300013307 Bacteria 3439
373 Ga0157372_10141524 3300013307 Bacteria 2772
374 Ga0157372_10159884 3300013307 Bacteria 2603
375 Ga0157372_10178656 3300013307 Bacteria 2457
376 Ga0157372_10204695 3300013307 Bacteria 2287
377 Ga0157372_10254272 3300013307 Bacteria 2040
378 Ga0157372_10266343 3300013307 Bacteria 1990
379 Ga0157375_10001717 3300013308 Bacteria 18818
380 Ga0157375_10012282 3300013308 Bacteria 7595
381 Ga0157375_10110716 3300013308 Bacteria 2844
382 Ga0157375_10181771 3300013308 Bacteria 2255
383 Ga0157375_10603888 3300013308 Bacteria 1256
384 Ga0157375_10731325 3300013308 Unclassified 1142
385 Ga0163163_10045052 3300014325 Bacteria 4329
386 Ga0163163_10710470 3300014325 Bacteria 1069
387 Ga0157380_10013259 3300014326 Bacteria 6004
388 Ga0157380_10039591 3300014326 Bacteria 3667
389 Ga0157380_10079154 3300014326 Bacteria 2683
390 Ga0157380_10099241 3300014326 Bacteria 2421
391 Ga0157380_10130913 3300014326 Bacteria 2140
392 Ga0157380_10675784 3300014326 Bacteria 1034
393 Ga0157377_10061685 3300014745 Bacteria 2143
394 Ga0157377_10098481 3300014745 Bacteria 1738
395 Ga0157377_10315761 3300014745 Bacteria 1036
396 Ga0157379_10009759 3300014968 Bacteria 8364
397 Ga0157379_10082823 3300014968 Bacteria 2875
398 Ga0157379_10181755 3300014968 Bacteria 1900
399 Ga0157376_10003346 3300014969 Bacteria 11026
400 Ga0157376_10015103 3300014969 Bacteria 5821
401 Ga0157376_10026515 3300014969 Bacteria 4581
402 Ga0157376_10215245 3300014969 Bacteria 1776
403 Ga0157376_10228096 3300014969 Bacteria 1729
404 Ga0157376_10368435 3300014969 Bacteria 1380
405 Ga0157376_10807638 3300014969 Bacteria 951
406 Ga0157376_10939892 3300014969 Bacteria 885
407 Ga0163161_10019650 3300017792 Bacteria 4738
408 Ga0163161_10066810 3300017792 Bacteria 2626
409 Ga0163161_10114306 3300017792 Bacteria 2022
410 Ga0163161_10124692 3300017792 Bacteria 1938
411 Ga0213874_10006091 3300021377 Bacteria 2840
412 Ga0213876_10001691 3300021384 Bacteria 13417
413 Ga0213876_10003521 3300021384 Bacteria 8929
414 Ga0213876_10086506 3300021384 Bacteria 1659
415 Ga0213875_10038294 3300021388 Bacteria 2259
416 Ga0207673_1003356 3300025290 Bacteria 1869
417 Ga0209256_1000689 3300025299 Bacteria 45269
418 Ga0207697_10137385 3300025315 Bacteria 1059
419 Ga0207656_10044825 3300025321 Bacteria 1890
420 Ga0207682_10000872 3300025893 Bacteria 13986
421 Ga0207692_10001173 3300025898 Bacteria 9689
422 Ga0207692_10002425 3300025898 Bacteria 7152
423 Ga0207692_10029057 3300025898 Bacteria 2622
424 Ga0207642_10023701 3300025899 Unclassified 2456
425 Ga0207642_10032431 3300025899 Bacteria 2199
426 Ga0207688_10001682 3300025901 Bacteria 11710
427 Ga0207688_10016260 3300025901 Bacteria 4034
428 Ga0207688_10083971 3300025901 Bacteria 1822
429 Ga0207688_10174175 3300025901 Bacteria 1280
430 Ga0207688_10197177 3300025901 Bacteria 1206
431 Ga0207680_10032448 3300025903 Bacteria 2969
432 Ga0207680_10052152 3300025903 Bacteria 2449
433 Ga0207685_10001412 3300025905 Bacteria 5012
434 Ga0207685_10074320 3300025905 Bacteria 1387
435 Ga0207699_10002658 3300025906 Bacteria 8439
436 Ga0207699_10007883 3300025906 Bacteria 5223
437 Ga0207699_10043223 3300025906 Bacteria 2616
438 Ga0207645_10001481 3300025907 Bacteria 19198
439 Ga0207645_10102929 3300025907 Bacteria 1843
440 Ga0207643_10002283 3300025908 Bacteria 10438
441 Ga0207643_10121590 3300025908 Unclassified 1547
442 Ga0207705_10078878 3300025909 Bacteria 2397
443 Ga0207705_10080683 3300025909 Bacteria 2370
444 Ga0207705_10087369 3300025909 Bacteria 2280
445 Ga0207654_10062334 3300025911 Bacteria 2184
446 Ga0207654_10064587 3300025911 Bacteria 2152
447 Ga0207707_10007412 3300025912 Bacteria 9557
448 Ga0207707_10054164 3300025912 Bacteria 3492
449 Ga0207707_10126079 3300025912 Bacteria 2239
450 Ga0207695_10010787 3300025913 Bacteria 11142
451 Ga0207695_10034941 3300025913 Bacteria 5458
452 Ga0207695_10462875 3300025913 Bacteria 1151
453 Ga0207671_10158982 3300025914 Bacteria 1749
454 Ga0207693_10001660 3300025915 Bacteria 19619
455 Ga0207693_10004561 3300025915 Bacteria 11693
456 Ga0207693_10008700 3300025915 Bacteria 8301
457 Ga0207693_10009095 3300025915 Bacteria 8107
458 Ga0207693_10020362 3300025915 Bacteria 5277
459 Ga0207693_10043024 3300025915 Bacteria 3555
460 Ga0207693_10306071 3300025915 Bacteria 1244
461 Ga0207663_10000327 3300025916 Bacteria 20836
462 Ga0207663_10005738 3300025916 Bacteria 6283
463 Ga0207663_10013842 3300025916 Bacteria 4398
464 Ga0207663_10014468 3300025916 Bacteria 4320
465 Ga0207663_10048493 3300025916 Bacteria 2629
466 Ga0207663_10175642 3300025916 Bacteria 1525
467 Ga0207663_10267885 3300025916 Bacteria 1264
468 Ga0207663_10360754 3300025916 Bacteria 1102
469 Ga0207663_10698042 3300025916 Bacteria 803
470 Ga0207660_10007745 3300025917 Bacteria 6955
471 Ga0207660_10015325 3300025917 Bacteria 5057
472 Ga0207660_10058814 3300025917 Bacteria 2757
473 Ga0207660_10135008 3300025917 Bacteria 1882
474 Ga0207662_10001442 3300025918 Bacteria 11539
475 Ga0207657_10000102 3300025919 Bacteria 82096
476 Ga0207657_10000250 3300025919 Bacteria 57310
477 Ga0207657_10016616 3300025919 Bacteria 7090
478 Ga0207657_10039174 3300025919 Bacteria 4214
479 Ga0207657_10081255 3300025919 Bacteria 2723
480 Ga0207657_10337154 3300025919 Bacteria 1190
481 Ga0207657_10403093 3300025919 Bacteria 1076
482 Ga0207649_10025902 3300025920 Bacteria 3426
483 Ga0207649_10245725 3300025920 Bacteria 1287
484 Ga0207649_10275556 3300025920 Bacteria 1221
485 Ga0207652_10003521 3300025921 Bacteria 12909
486 Ga0207652_10077656 3300025921 Bacteria 2898
487 Ga0207681_10008492 3300025923 Bacteria 6277
488 Ga0207681_10041663 3300025923 Bacteria 3063
489 Ga0207650_10002771 3300025925 Bacteria 12104
490 Ga0207659_10011351 3300025926 Bacteria 5625
491 Ga0207659_10216155 3300025926 Bacteria 1539
492 Ga0207687_10139372 3300025927 Unclassified 1838
493 Ga0207700_10000052 3300025928 Bacteria 76498
494 Ga0207700_10009348 3300025928 Bacteria 6117
495 Ga0207700_10024470 3300025928 Bacteria 4179
496 Ga0207700_10106497 3300025928 Bacteria 2248
497 Ga0207700_10314009 3300025928 Bacteria 1356
498 Ga0207700_10453881 3300025928 Bacteria 1130
499 Ga0207664_10012367 3300025929 Bacteria 6099
500 Ga0207664_10015521 3300025929 Bacteria 5531
501 Ga0207664_10018323 3300025929 Bacteria 5151
502 Ga0207664_10130011 3300025929 Bacteria 2119
503 Ga0207664_10196164 3300025929 Bacteria 1740
504 Ga0207644_10003032 3300025931 Bacteria 10806
505 Ga0207644_10003185 3300025931 Bacteria 10567
506 Ga0207644_10140534 3300025931 Bacteria 1859
507 Ga0207644_10173928 3300025931 Bacteria 1683
508 Ga0207644_10471021 3300025931 Bacteria 1034
509 Ga0207690_10000595 3300025932 Bacteria 23415
510 Ga0207690_10011334 3300025932 Bacteria 5330
511 Ga0207690_10021388 3300025932 Bacteria 4011
512 Ga0207706_10000095 3300025933 Bacteria 92378
513 Ga0207706_10002865 3300025933 Bacteria 16735
514 Ga0207706_10003460 3300025933 Bacteria 15072
515 Ga0207706_10015256 3300025933 Bacteria 6948
516 Ga0207686_10095491 3300025934 Unclassified 1973
517 Ga0207686_10182589 3300025934 Bacteria 1489
518 Ga0207686_10210907 3300025934 Bacteria 1396
519 Ga0207686_10249571 3300025934 Bacteria 1296
520 Ga0207709_10006513 3300025935 Bacteria 6559
521 Ga0207709_10076201 3300025935 Bacteria 2146
522 Ga0207709_10280804 3300025935 Unclassified 1230
523 Ga0207670_10062251 3300025936 Bacteria 2549
524 Ga0207669_10004853 3300025937 Bacteria 5970
525 Ga0207669_10120571 3300025937 Bacteria 1779
526 Ga0207669_10511394 3300025937 Unclassified 963
527 Ga0207704_10131322 3300025938 Bacteria 1735
528 Ga0207704_10263558 3300025938 Bacteria 1300
529 Ga0207665_10002675 3300025939 Bacteria 11969
530 Ga0207665_10003693 3300025939 Bacteria 10226
531 Ga0207665_10006131 3300025939 Bacteria 7983
532 Ga0207665_10010080 3300025939 Bacteria 6207
533 Ga0207665_10026007 3300025939 Bacteria 3862
534 Ga0207665_10070391 3300025939 Bacteria 2387
535 Ga0207665_10077543 3300025939 Bacteria 2281
536 Ga0207691_10000894 3300025940 Bacteria 29574
537 Ga0207691_10004886 3300025940 Bacteria 12955
538 Ga0207691_10102875 3300025940 Bacteria 2547
539 Ga0207711_10007597 3300025941 Bacteria 9068
540 Ga0207711_10051104 3300025941 Bacteria 3539
541 Ga0207711_10114357 3300025941 Bacteria 2403
542 Ga0207711_10151761 3300025941 Bacteria 2091
543 Ga0207711_10582592 3300025941 Bacteria 1044
544 Ga0207689_10018574 3300025942 Bacteria 5865
545 Ga0207689_10105947 3300025942 Bacteria 2310
546 Ga0207689_10146286 3300025942 Bacteria 1947
547 Ga0207661_10187983 3300025944 Bacteria 1809
548 Ga0207661_10361023 3300025944 Bacteria 1312
549 Ga0207661_10743673 3300025944 Bacteria 902
550 Ga0207679_10001787 3300025945 Bacteria 13382
551 Ga0207679_10009965 3300025945 Bacteria 6105
552 Ga0207679_10063511 3300025945 Bacteria 2756
553 Ga0207679_10148665 3300025945 Bacteria 1904
554 Ga0207679_10183893 3300025945 Bacteria 1731
555 Ga0207667_10000233 3300025949 Bacteria 77272
556 Ga0207667_10012539 3300025949 Bacteria 9756
557 Ga0207667_10028313 3300025949 Bacteria 6087
558 Ga0207667_10036146 3300025949 Bacteria 5296
559 Ga0207667_10087482 3300025949 Bacteria 3223
560 Ga0207667_10109962 3300025949 Bacteria 2843
561 Ga0207667_10154801 3300025949 Bacteria 2359
562 Ga0207651_10016952 3300025960 Bacteria 4288
563 Ga0207651_10277452 3300025960 Bacteria 1383
564 Ga0207712_10018971 3300025961 Bacteria 4487
565 Ga0207712_10664453 3300025961 Bacteria 907
566 Ga0207668_10014214 3300025972 Bacteria 4923
567 Ga0207668_10015143 3300025972 Bacteria 4787
568 Ga0207668_10016667 3300025972 Bacteria 4590
569 Ga0207668_10155437 3300025972 Bacteria 1776
570 Ga0207668_10475962 3300025972 Bacteria 1070
571 Ga0207640_10231774 3300025981 Bacteria 1421
572 Ga0207658_10001269 3300025986 Bacteria 19957
573 Ga0207658_10047079 3300025986 Bacteria 3154
574 Ga0207658_10050170 3300025986 Bacteria 3069
575 Ga0207677_10149957 3300026023 Bacteria 1797
576 Ga0207677_10441179 3300026023 Bacteria 1113
577 Ga0207703_10027561 3300026035 Bacteria 4473
578 Ga0207703_10069412 3300026035 Bacteria 2906
579 Ga0207703_10220414 3300026035 Bacteria 1696
580 Ga0207703_10306462 3300026035 Bacteria 1450
581 Ga0207703_10443575 3300026035 Bacteria 1211
582 Ga0207703_10607823 3300026035 Bacteria 1035
583 Ga0207703_10644066 3300026035 Bacteria 1005
584 Ga0207703_10838066 3300026035 Bacteria 879
585 Ga0207639_10027371 3300026041 Bacteria 4154
586 Ga0207639_10032866 3300026041 Bacteria 3823
587 Ga0207639_10043431 3300026041 Bacteria 3374
588 Ga0207639_10091583 3300026041 Bacteria 2435
589 Ga0207639_10355285 3300026041 Bacteria 1310
590 Ga0207678_10001717 3300026067 Bacteria 20059
591 Ga0207678_10003576 3300026067 Bacteria 13974
592 Ga0207678_10004513 3300026067 Bacteria 12518
593 Ga0207678_10031337 3300026067 Bacteria 4638
594 Ga0207678_10105656 3300026067 Bacteria 2402
595 Ga0207678_10121418 3300026067 Bacteria 2230
596 Ga0207708_10000558 3300026075 Bacteria 28801
597 Ga0207708_10042552 3300026075 Bacteria 3462
598 Ga0207708_10078335 3300026075 Bacteria 2537
599 Ga0207702_10003371 3300026078 Bacteria 14642
600 Ga0207702_10008525 3300026078 Bacteria 8644
601 Ga0207702_10056084 3300026078 Bacteria 3344
602 Ga0207702_10078347 3300026078 Bacteria 2861
603 Ga0207702_10176980 3300026078 Bacteria 1961
604 Ga0207641_10008303 3300026088 Bacteria 8580
605 Ga0207641_10213201 3300026088 Bacteria 1787
606 Ga0207648_10021284 3300026089 Bacteria 5829
607 Ga0207648_10042493 3300026089 Bacteria 3990
608 Ga0207648_10243989 3300026089 Bacteria 1600
609 Ga0207676_10027045 3300026095 Bacteria 4269
610 Ga0207674_10000326 3300026116 Bacteria 60670
611 Ga0207674_10002376 3300026116 Bacteria 23789
612 Ga0207674_10099180 3300026116 Bacteria 2895
613 Ga0207674_10156104 3300026116 Bacteria 2237
614 Ga0207674_10278224 3300026116 Bacteria 1621
615 Ga0207675_100002315 3300026118 Bacteria 18913
616 Ga0207675_100031636 3300026118 Bacteria 4930
617 Ga0207675_100076680 3300026118 Bacteria 3131
618 Ga0207675_100173538 3300026118 Bacteria 2062
619 Ga0207675_100266389 3300026118 Unclassified 1662
620 Ga0207683_10006767 3300026121 Bacteria 9810
621 Ga0207683_10009942 3300026121 Bacteria 8114
622 Ga0207683_10012309 3300026121 Bacteria 7303
623 Ga0207683_10030660 3300026121 Bacteria 4661
624 Ga0207683_10036404 3300026121 Bacteria 4286
625 Ga0207683_10073358 3300026121 Bacteria 3027
626 Ga0207683_10094761 3300026121 Bacteria 2661
627 Ga0207683_10202154 3300026121 Bacteria 1806
628 Ga0207698_10026071 3300026142 Bacteria 4130
629 Ga0207698_10151859 3300026142 Bacteria 2011
630 Ga0209982_1012290 3300027552 Bacteria 1283
631 Ga0209966_1019300 3300027695 Bacteria 1312
632 Ga0209974_10001061 3300027876 Bacteria 9744
633 Ga0209974_10006336 3300027876 Bacteria 4134
634 Ga0207428_10007060 3300027907 Bacteria 10283
635 Ga0207428_10099895 3300027907 Bacteria 2243
636 Ga0268266_10083840 3300028379 Bacteria 2782
637 Ga0268266_10103401 3300028379 Bacteria 2513
638 Ga0268266_10123252 3300028379 Bacteria 2309
639 Ga0268266_10135196 3300028379 Bacteria 2208
640 Ga0268266_10322461 3300028379 Bacteria 1446
641 Ga0268266_10617226 3300028379 Bacteria 1042
642 Ga0268265_10110725 3300028380 Bacteria 2241
643 Ga0268265_10906437 3300028380 Bacteria 866
644 Ga0268264_10038116 3300028381 Bacteria 3965
645 Ga0268264_10292694 3300028381 Bacteria 1530
646 Ga0268264_10559880 3300028381 Bacteria 1122
647 Ga0307408_100010802 3300031548 Bacteria 6025
648 Ga0316576_10248069 3300031727 Unclassified 1337
649 Ga0307516_10178619 3300031730 Bacteria 1858
650 Ga0307413_10545539 3300031824 Bacteria 939
651 Ga0307410_10062735 3300031852 Bacteria 2547
652 Ga0307406_10005700 3300031901 Bacteria 6817
653 Ga0307412_10071352 3300031911 Bacteria 2371
654 Ga0307409_100017959 3300031995 Bacteria 4734
655 Ga0307416_100002602 3300032002 Bacteria 10424
656 Ga0307416_100028588 3300032002 Bacteria 4149
657 Ga0307416_100094609 3300032002 Bacteria 2577
658 Ga0307510_10073939 3300033180 Bacteria 3372
659 Ga0373929_0020363 3300035085 Bacteria 1337
660 Ga0373945_0003413 3300035116 Bacteria 4998
661 Ga0373945_0056554 3300035116 Bacteria 1455
662 Ga0373954_0029083 3300035118 Bacteria 2544
663 Ga0373956_0200311 3300035119 Bacteria 946
664 Ga0373943_0009284 3300035170 Bacteria 4407
665 Ga0373943_0043916 3300035170 Bacteria 2173
666 Ga0373943_0148731 3300035170 Unclassified 1267
667 Ga0373946_0059070 3300035171 Bacteria 1626
668 Ga0373946_0261798 3300035171 Bacteria 846
669 Ga0316574_0000860 3300035398 Bacteria 13359
670 Ga0316574_0052741 3300035398 Bacteria 2537
671 Ga0373931_0013132 3300035691 Bacteria 4028
672 Ga0373935_0005109 3300035692 Bacteria 7727
673 Ga0373935_0204223 3300035692 Bacteria 1367
674 Ga0373927_0001870 3300035695 Bacteria 15587
675 Ga0373927_0014378 3300035695 Bacteria 5239
676 Ga0373927_0107770 3300035695 Bacteria 1815
677 Ga0373927_0147662 3300035695 Unclassified 1539
678 Ga0373933_0105186 3300035724 Bacteria 1755
679 Ga0373947_0004918 3300035725 Bacteria 7814
680 Ga0373947_0082924 3300035725 Bacteria 1988
681 Ga0373937_0021190 3300036401 Bacteria 5833
682 Ga0373937_0213932 3300036401 Bacteria 1814
683 Ga0316582_0140697 3300036647 Bacteria 1627
684 Ga0373925_0003141 3300037068 Bacteria 12962
685 Ga0373925_0004558 3300037068 Bacteria 10469
686 Ga0373925_0020423 3300037068 Bacteria 4822
687 Ga0373925_0066467 3300037068 Bacteria 2718
688 Ga0373925_0377574 3300037068 Bacteria 1154
689 Ga0395899_0148967 3300037312 Unclassified 1660
690 Ga0395900_0086129 3300037418 Bacteria 3229
691 Ga0395898_0002249 3300037466 Bacteria 23453
692 Ga0395898_0592444 3300037466 Bacteria 1051
693 Ga0395905_0110789 3300037471 Bacteria 2578
694 Ga0395905_0519260 3300037471 Bacteria 1091
695 Ga0436364_0269804 3300037853 Bacteria 37417
696 Ga0395901_0064332 3300038443 Bacteria 3818
697 Ga0395901_0096935 3300038443 Bacteria 3091
698 Ga0395901_0276939 3300038443 Bacteria 1744
699 Ga0436365_0011381 3300039437 Bacteria 1150
700 Ga0436365_0265841 3300039437 Bacteria 1036
701 Ga0436365_0321374 3300039437 Bacteria 2518
702 Ga0436365_0350464 3300039437 Bacteria 938
703 Ga0436365_0954239 3300039437 Bacteria 40865
704 Ga0436360_0539211 3300039438 Bacteria 2601
705 Ga0436360_1089733 3300039438 Bacteria 1242
706 Ga0436363_0538486 3300039450 Bacteria 18425
707 Ga0436362_0223954 3300039453 Bacteria 1435
708 Ga0451853_3234775 3300041512 Bacteria 1698
709 Ga0451853_3961465 3300041512 Bacteria 1745
710 Ga0439435_0043784 3300042436 Bacteria 1260
711 Ga0466967_0062646 3300045976 Bacteria 3302
712 Ga0495617_029819 3300046452 Bacteria 1834
713 Ga0495592_0060981 3300046454 Bacteria 2773
714 Ga0495603_0000298 3300046455 Bacteria 26417
715 Ga0495603_0006456 3300046455 Bacteria 7023
716 Ga0495603_0070400 3300046455 Bacteria 2056
717 Ga0495603_0186634 3300046455 Bacteria 1199
718 Ga0495629_0000336 3300046459 Bacteria 40110
719 Ga0495641_0001543 3300046461 Bacteria 19560
720 Ga0495651_0000461 3300046462 Bacteria 31219
721 Ga0495580_0004668 3300046472 Bacteria 11493
722 Ga0495580_0053641 3300046472 Bacteria 2844
723 Ga0495580_0135281 3300046472 Bacteria 1709
724 Ga0495580_0297421 3300046472 Bacteria 1099
725 Ga0495582_0000134 3300046473 Bacteria 39810
726 Ga0495582_0093755 3300046473 Bacteria 1676
727 Ga0495582_0243400 3300046473 Bacteria 1031
728 Ga0495639_0001666 3300046475 Bacteria 9877
729 Ga0495639_0116832 3300046475 Bacteria 1270
730 Ga0495662_0000247 3300046476 Bacteria 22850
731 Ga0495664_0002841 3300046477 Bacteria 9325
732 Ga0495664_0007422 3300046477 Bacteria 6088
733 Ga0495664_0036424 3300046477 Bacteria 2900
734 Ga0495585_0124186 3300046492 Bacteria 1363
735 Ga0495594_0001158 3300046499 Bacteria 13771
736 Ga0495594_0048999 3300046499 Bacteria 2321
737 Ga0495594_0147168 3300046499 Bacteria 1337
738 Ga0495594_0171646 3300046499 Bacteria 1234
739 Ga0495594_0199645 3300046499 Bacteria 1140
740 Ga0495583_0009837 3300046506 Bacteria 5662
741 Ga0495608_0011744 3300046511 Bacteria 6091
742 Ga0495628_0031305 3300046516 Bacteria 4304
743 Ga0495630_0003037 3300046517 Bacteria 11649
744 Ga0495630_0015478 3300046517 Bacteria 5570
745 Ga0495630_0038590 3300046517 Bacteria 3573
746 Ga0495666_0019067 3300046526 Bacteria 3407
747 Ga0495652_0004619 3300046529 Bacteria 13125
748 Ga0495652_0158194 3300046529 Bacteria 1762
749 Ga0495665_0001246 3300046531 Bacteria 13568
750 Ga0495665_0079272 3300046531 Bacteria 1728
751 Ga0495665_0081794 3300046531 Bacteria 1698
752 Ga0495665_0090623 3300046531 Bacteria 1606
753 Ga0495640_0063685 3300046533 Bacteria 2496
754 Ga0495640_0249758 3300046533 Bacteria 1111
755 Ga0495598_0004079 3300046537 Bacteria 3142
756 Ga0495598_0026502 3300046537 Bacteria 1590
757 Ga0495621_0038723 3300046539 Bacteria 1664
758 Ga0495621_0116440 3300046539 Bacteria 1029
759 Ga0495645_0007613 3300046543 Bacteria 7536
760 Ga0495645_0311419 3300046543 Unclassified 1025
761 Ga0495622_0009872 3300046557 Bacteria 4415
762 Ga0495622_0011954 3300046557 Bacteria 4015
763 Ga0495667_0302633 3300046559 Bacteria 1013
764 Ga0495656_0003709 3300046615 Bacteria 5181
765 Ga0495656_0038433 3300046615 Bacteria 1982
766 Ga0495668_0013420 3300046616 Bacteria 4832
767 Ga0495668_0077758 3300046616 Bacteria 1822
768 Ga0495634_0002604 3300046642 Bacteria 14839
769 Ga0495634_0059610 3300046642 Bacteria 2542
770 Ga0495635_0003952 3300046663 Bacteria 10310
771 Ga0495635_0014916 3300046663 Bacteria 5437
772 Ga0495635_0343783 3300046663 Bacteria 996
773 Ga0495659_0012651 3300046664 Bacteria 2738
774 Ga0495661_0080600 3300046665 Bacteria 1878
775 Ga0495588_0028098 3300046674 Bacteria 2814
776 Ga0495657_0002772 3300046675 Bacteria 14592
777 Ga0495599_0018332 3300046678 Bacteria 4361
778 Ga0495646_0018795 3300046680 Bacteria 4378
779 Ga0495647_0000802 3300046681 Bacteria 9386
780 Ga0495647_0183242 3300046681 Bacteria 912
781 Ga0495669_0027987 3300046684 Bacteria 2466
782 Ga0495669_0115017 3300046684 Bacteria 1258
783 Ga0495613_0002024 3300046689 Bacteria 15396
784 Ga0495613_0036184 3300046689 Bacteria 3661
785 Ga0495624_0002097 3300046690 Bacteria 15207
786 Ga0495624_0072338 3300046690 Unclassified 2145
787 Ga0495624_0166516 3300046690 Bacteria 1345
788 Ga0495624_0296288 3300046690 Bacteria 976
789 Ga0495589_0027704 3300046794 Bacteria 2864
790 Ga0495600_0001622 3300046809 Bacteria 12548
791 Ga0495600_0194366 3300046809 Bacteria 1304
792 Ga0495581_0000072 3300047315 Bacteria 39847
793 Ga0495581_0223432 3300047315 Bacteria 1101
794 Ga0495604_0004466 3300047317 Bacteria 11081
795 Ga0495604_0069222 3300047317 Bacteria 2675
796 Ga0495636_0007176 3300047318 Bacteria 4387
797 Ga0495674_0002364 3300047319 Bacteria 18466
798 Ga0495674_0004841 3300047319 Bacteria 12948
799 Ga0495674_0021885 3300047319 Bacteria 5906
800 Ga0495676_0045738 3300047321 Bacteria 3559
801 Ga0495680_0002271 3300047322 Bacteria 19777
802 Ga0495680_0115104 3300047322 Bacteria 1990
803 Ga0495677_0070328 3300047445 Bacteria 1304
804 Ga0495685_096513 3300047447 Bacteria 977
805 Ga0495681_0086279 3300047470 Bacteria 1393
806 Ga0495684_0065597 3300047471 Bacteria 2760
807 Ga0495684_0393264 3300047471 Bacteria 975
808 Ga0495593_0000094 3300047673 Bacteria 39807
809 Ga0496100_0013147 3300048903 Bacteria 4766
810 Ga0496100_0246514 3300048903 Bacteria 1320
811 Ga0496100_0257105 3300048903 Bacteria 1294
812 Ga0496100_0307379 3300048903 Bacteria 1188
813 Ga0496101_0005202 3300048904 Bacteria 8276
814 Ga0496101_0072512 3300048904 Bacteria 2528
815 Ga0496102_0014347 3300048905 Bacteria 6884
816 Ga0496102_0021844 3300048905 Bacteria 5664
817 Ga0496102_0070862 3300048905 Bacteria 3201
818 Ga0496102_0110863 3300048905 Bacteria 2558
819 Ga0496102_0617425 3300048905 Bacteria 1007
820 Ga0496102_0670214 3300048905 Bacteria 960
821 Ga0496102_0744377 3300048905 Bacteria 903
822 Ga0496103_0028243 3300048906 Bacteria 3403
823 Ga0496103_0109623 3300048906 Bacteria 1753
824 Ga0496103_0123584 3300048906 Bacteria 1650
825 Ga0496103_0124684 3300048906 Bacteria 1642
826 Ga0496103_0143809 3300048906 Bacteria 1526
827 Ga0496104_0087324 3300048907 Bacteria 2978
828 Ga0496104_0118705 3300048907 Bacteria 2539
829 Ga0496104_0161115 3300048907 Bacteria 2152
830 Ga0496105_0031262 3300048908 Bacteria 4365
831 Ga0496105_0309405 3300048908 Bacteria 1269
832 Ga0496106_0009999 3300048909 Bacteria 7006
833 Ga0496106_0073243 3300048909 Bacteria 2620
834 Ga0496106_0099608 3300048909 Bacteria 2253
835 Ga0496106_0102249 3300048909 Bacteria 2223
836 Ga0496106_0282857 3300048909 Bacteria 1329
837 Ga0496106_0303783 3300048909 Bacteria 1280
838 Ga0496107_0012533 3300048910 Bacteria 5919
839 Ga0496107_0090508 3300048910 Bacteria 2235
840 Ga0496107_0277551 3300048910 Bacteria 1247
841 Ga0496107_0594055 3300048910 Bacteria 818
842 Ga0496108_0005893 3300048911 Bacteria 9933
843 Ga0496108_0102157 3300048911 Bacteria 2446
844 Ga0496108_0141751 3300048911 Bacteria 2071
845 Ga0496109_0008278 3300048912 Bacteria 8830
846 Ga0496109_0029898 3300048912 Bacteria 4882
847 Ga0496109_0048437 3300048912 Bacteria 3867
848 Ga0496110_0007982 3300048913 Bacteria 8480
849 Ga0496110_0020252 3300048913 Bacteria 5615
850 Ga0496111_0022826 3300048914 Bacteria 4385
851 Ga0496112_0004983 3300048915 Bacteria 11386
852 Ga0496112_0069737 3300048915 Bacteria 3472
853 Ga0496112_0515236 3300048915 Bacteria 1131
854 Ga0496112_0732571 3300048915 Bacteria 916
855 Ga0496113_0001782 3300048916 Bacteria 12213
856 Ga0496113_0040675 3300048916 Bacteria 3427
857 Ga0496114_0148434 3300048917 Bacteria 2033
858 Ga0496114_0238178 3300048917 Bacteria 1600
859 Ga0496114_0274230 3300048917 Bacteria 1486
860 Ga0496114_0796416 3300048917 Bacteria 824
861 Ga0496115_0024226 3300048918 Bacteria 4715
862 Ga0496115_0132400 3300048918 Bacteria 2055
863 Ga0496116_0002454 3300048919 Bacteria 19457
864 Ga0496116_0071661 3300048919 Bacteria 2193
865 Ga0496116_0087783 3300048919 Bacteria 1902
866 Ga0496121_0043033 3300048924 Bacteria 3917
867 Ga0496124_0005968 3300048927 Bacteria 13453
868 Ga0496125_0140450 3300048928 Bacteria 1681
869 Ga0496126_0030132 3300048929 Bacteria 5145
870 Ga0495678_020678 3300049459 Bacteria 2910
871 Ga0501031_0029699 3300049568 Bacteria 3567
872 Ga0501031_0103369 3300049568 Bacteria 1859
873 Ga0501033_0073806 3300049570 Bacteria 2505
874 Ga0501034_0000050 3300049571 Bacteria 213092
875 Ga0501038_0139096 3300049574 Bacteria 1988
876 Ga0501040_0127742 3300049576 Bacteria 1786
877 Ga0501042_0079862 3300049578 Bacteria 2344
878 Ga0501042_0097326 3300049578 Bacteria 2115
879 Ga0501043_0093945 3300049579 Bacteria 2358
880 Ga0501047_0259251 3300049581 Bacteria 1587
881 Ga0501071_0131322 3300049587 Bacteria 1861
882 Ga0501074_0108192 3300049590 Bacteria 1990
883 Ga0501076_0144048 3300049592 Bacteria 1937
884 Ga0501077_0262542 3300049593 Bacteria 1098
885 Ga0501081_0171991 3300049743 Bacteria 1564
886 Ga0501035_0155510 3300049822 Bacteria 1982
887 nmdc:mga00v17_155380_c1 3300050491 Bacteria 1471
888 nmdc:mga00v17_23592_c1 3300050491 Bacteria 3559
889 nmdc:mga00v17_39556_c1 3300050491 Bacteria 2825
890 nmdc:mga0yw44_215377_c1 3300050492 Bacteria 1271
891 nmdc:mga06z11_84102_c1 3300050494 Bacteria 1714
892 nmdc:mga05p37_233_c1 3300050507 Bacteria 56600
893 nmdc:mga09592_276293_c1 3300050508 Bacteria 1457
894 nmdc:mga09592_800_c1 3300050508 Bacteria 24361
895 nmdc:mga0qj67_99316_c1 3300050509 Bacteria 2345
896 nmdc:mga06r32_94_c1 3300050510 Bacteria 61840
897 nmdc:mga08y16_251518_c1 3300050511 Bacteria 1826
898 nmdc:mga08y16_2747_c1 3300050511 Bacteria 18041
899 nmdc:mga0n895_524772_c1 3300050512 Bacteria 1191
900 nmdc:mga0n895_63502_c1 3300050512 Bacteria 3652
901 nmdc:mga0rr50_8887_c1 3300050513 Bacteria 6274
902 nmdc:mga08x19_211792_c1 3300050514 Bacteria 1330
903 Ga0495612_0098788 3300053078 Unclassified 1242
904 Ga0495655_0053431 3300053083 Bacteria 1078
905 Ga0495619_0315074 3300053085 Bacteria 1083
906 Ga0500646_0121605 3300053090 Bacteria 840
907 Ga0500651_0167979 3300053093 Bacteria 1309
908 Ga0500566_0242572 3300053094 Bacteria 882
909 Ga0500555_012495 3300053103 Bacteria 2446
910 Ga0500658_0011685 3300053134 Bacteria 3235
911 Ga0500588_0092697 3300053146 Bacteria 1029
912 Ga0500604_0021080 3300053151 Bacteria 1840
913 Ga0500627_0032682 3300053158 Bacteria 2195
914 Ga0500634_0130932 3300053161 Bacteria 1204
915 Ga0530510_0187102 3300061734 Bacteria 1537
916 2513894375 2513237141 Bacteria 8496279
917 2644123516 2643221621 Bacteria 6212786
918 2858694263 2858688981 Bacteria 8184122
919 2883577728 2883577096 Bacteria 4709178
920 2885412758 2885409591 Bacteria 9235467
921 2889310900 2889306138 Bacteria 6358934
922 2894777252 2894772417 Bacteria 5305674
923 2901305424 2901300506 Bacteria 8463898
924 2902336719 2902330777 Bacteria 6395352
925 2928126853 2928125067 Bacteria 5937560
926 2929200800 2929199973 Bacteria 7260745
927 2935742982 2935741537 Bacteria 9707219
928 8019556053 8019555841 Bacteria 9642137
929 8019569257 8019565922 Bacteria 9639779
930 8048749888 8048746797 Bacteria 3557226
931 8055914016 8055909800 Bacteria 7278581
932 Ga0070714_100012357
933 JGI24034J26672_10023738
934 JGI24751J29686_10048055
935 JGI25406J46586_10001111
936 rootL2_10282064
937 JGI25404J52841_10000240
938 JGI25405J52794_10030357
939 Ga0065715_10303549
940 Ga0070658_10149119
941 Ga0070676_10027703
942 Ga0070676_10212221
943 Ga0070676_10281374
944 Ga0070683_100034649
945 Ga0070683_100072024
946 Ga0070683_100482203
947 Ga0070690_100080742
948 Ga0070690_100220596
949 Ga0070690_100310698
950 Ga0070670_100329057
951 Ga0070677_10077039
952 Ga0068869_100020691
953 Ga0068869_100061149
954 Ga0070666_10004139
955 Ga0070666_10026855
956 Ga0070666_10060256
957 Ga0070666_10141782
958 Ga0070666_10247316
959 Ga0070680_100119833
960 Ga0070680_100639446
961 Ga0070682_100175888
962 Ga0068868_100098577
963 Ga0068868_100179794
964 Ga0068868_100437731
965 Ga0068868_100472405
966 Ga0070660_100009904
967 Ga0070660_100019782
968 Ga0070660_100037023
969 Ga0070660_100048417
970 Ga0070660_100243265
971 Ga0070689_100003058
972 Ga0070689_100345765
973 Ga0070661_100019023
974 Ga0070661_100022594
975 Ga0070661_100031004
976 Ga0070692_10018833
977 Ga0070692_10033813
978 Ga0070668_100013378
979 Ga0070668_100116421
980 Ga0070668_100620644
981 Ga0070669_100029099
982 Ga0070669_100100908
983 Ga0070669_100150514
984 Ga0070675_100038048
985 Ga0070675_100093182
986 Ga0070675_100299567
987 Ga0070671_100054368
988 Ga0070671_100058106
989 Ga0070671_100182612
990 Ga0070671_100322725
991 Ga0070671_100414339
992 Ga0070674_100005862
993 Ga0070674_100005913
994 Ga0070673_100091758
995 Ga0070673_100102820
996 Ga0070673_100229419
997 Ga0070673_100489738
998 Ga0070673_100550393
999 Ga0070688_100015320
1000 Ga0070688_100093508
1001 Ga0070659_100000182
1002 Ga0070659_100002279
1003 Ga0070659_100023880
1004 Ga0070659_100041424
1005 Ga0070659_100179291
1006 Ga0070667_100001759
1007 Ga0070667_100070917
1008 Ga0070667_100093912
1009 Ga0070667_100126209
1010 Ga0070667_100290235
1011 Ga0070667_100698337
1012 Ga0070709_10001020
1013 Ga0070709_10001626
1014 Ga0070709_10004665
1015 Ga0070709_10008636
1016 Ga0070709_10067302
1017 Ga0070714_100002584
1018 Ga0070714_100036631
1019 Ga0070714_100039615
1020 Ga0070714_100888778
1021 Ga0070713_100000018
1022 Ga0070713_100001762
1023 Ga0070713_100016897
1024 Ga0070713_100031472
1025 Ga0070713_100053328
1026 Ga0070713_100073756
1027 Ga0070713_100457964
1028 Ga0070710_10000501
1029 Ga0070710_10002329
1030 Ga0070710_10008451
1031 Ga0070710_10021411
1032 Ga0070710_10044901
1033 Ga0070710_10139780
1034 Ga0070701_10016072
1035 Ga0070711_100003966
1036 Ga0070711_100009080
1037 Ga0070711_100014864
1038 Ga0070711_100031186
1039 Ga0070711_100050933
1040 Ga0070711_100127915
1041 Ga0070711_100279395
1042 Ga0070711_100477939
1043 Ga0070700_100042872
1044 Ga0070694_100263888
1045 Ga0070663_100024357
1046 Ga0070663_100148883
1047 Ga0070663_100257400
1048 Ga0070678_100000194
1049 Ga0070678_100000941
1050 Ga0070678_100028009
1051 Ga0070678_100033427
1052 Ga0070678_100069589
1053 Ga0070678_100268470
1054 Ga0070678_100532246
1055 Ga0070678_100737353
1056 Ga0070662_100000120
1057 Ga0070662_100014078
1058 Ga0070662_100017566
1059 Ga0070662_100078996
1060 Ga0070662_100128597
1061 Ga0070681_10050801
1062 Ga0070681_10097627
1063 Ga0068867_100062565
1064 Ga0068867_100117031
1065 Ga0068867_100547437
1066 Ga0070685_10016352
1067 Ga0070698_100160616
1068 Ga0070679_100083118
1069 Ga0070679_100350568
1070 Ga0070684_100344952
1071 Ga0070697_100199098
1072 Ga0068853_100001080
1073 Ga0068853_100031659
1074 Ga0068853_100052626
1075 Ga0068853_100117706
1076 Ga0070672_100001583
1077 Ga0070672_100052573
1078 Ga0070686_100106246
1079 Ga0070686_100106775
1080 Ga0070695_100160857
1081 Ga0070665_100010384
1082 Ga0070665_100099334
1083 Ga0070665_100109385
1084 Ga0070665_100186781
1085 Ga0070665_100395511
1086 Ga0070665_100696448
1087 Ga0068855_100001125
1088 Ga0068855_100002492
1089 Ga0068855_100003366
1090 Ga0068855_100110719
1091 Ga0068855_100132740
1092 Ga0068855_100361975
1093 Ga0070664_100000226
1094 Ga0070664_100005943
1095 Ga0070664_100017178
1096 Ga0070664_100040115
1097 Ga0070664_100193235
1098 Ga0070664_100727509
1099 Ga0068857_100243412
1100 Ga0068857_100403931
1101 Ga0068857_100742663
1102 Ga0068854_100016658
1103 Ga0068854_100104455
1104 Ga0068854_100131156
1105 Ga0068854_100652432
1106 Ga0068856_100001739
1107 Ga0068856_100005592
1108 Ga0068856_100006697
1109 Ga0068856_100051747
1110 Ga0068856_100490960
1111 Ga0070702_100029406
1112 Ga0068852_100041070
1113 Ga0068852_100064062
1114 Ga0068852_100072519
1115 Ga0068852_100143948
1116 Ga0068852_100523805
1117 Ga0068859_100044877
1118 Ga0068859_100084994
1119 Ga0068859_100440374
1120 Ga0068859_100798935
1121 Ga0068864_100003834
1122 Ga0068864_100044645
1123 Ga0068864_100083910
1124 Ga0068866_10027616
1125 Ga0068866_10046747
1126 Ga0068866_10064994
1127 Ga0068861_100021195
1128 Ga0068861_100040221
1129 Ga0068861_100050631
1130 Ga0068851_10004520
1131 Ga0068851_10008957
1132 Ga0068851_10050440
1133 Ga0068870_10115568
1134 Ga0068870_10218095
1135 Ga0068863_100007860
1136 Ga0068863_100049982
1137 Ga0068863_100092096
1138 Ga0068858_100022334
1139 Ga0068858_100065327
1140 Ga0068858_100358046
1141 Ga0068858_100485784
1142 Ga0068860_100083385
1143 Ga0068860_100115849
1144 Ga0068860_100160391
1145 Ga0068860_100225608
1146 Ga0068860_100335898
1147 Ga0068862_100177399
1148 Ga0081455_10002176
1149 Ga0081455_10006640
1150 Ga0081455_10155536
1151 Ga0081540_1000096
1152 Ga0081540_1001408
1153 Ga0081540_1005726
1154 Ga0081540_1022947
1155 Ga0081540_1022965
1156 Ga0081540_1041740
1157 Ga0081540_1050196
1158 Ga0081540_1081052
1159 Ga0081540_1134315
1160 Ga0081539_10001144
1161 Ga0081539_10049223
1162 Ga0081539_10052448
1163 Ga0070717_10001571
1164 Ga0070717_10355677
1165 Ga0075363_100123490
1166 Ga0075364_10000139
1167 Ga0075364_10013965
1168 Ga0075364_10072695
1169 Ga0075364_10126329
1170 Ga0075432_10015900
1171 Ga0070715_10001554
1172 Ga0070715_10007590
1173 Ga0070716_100001649
1174 Ga0070716_100004329
1175 Ga0070716_100010923
1176 Ga0070716_100040864
1177 Ga0070716_100053989
1178 Ga0070716_100162698
1179 Ga0070716_100223925
1180 Ga0070712_100004086
1181 Ga0070712_100083000
1182 Ga0070712_100156328
1183 Ga0070712_100204791
1184 Ga0075367_10108312
1185 Ga0075367_10172674
1186 Ga0075366_10025653
1187 Ga0075366_10103407
1188 Ga0097621_100000458
1189 Ga0097621_100078338
1190 Ga0068871_100000291
1191 Ga0068871_100061176
1192 Ga0068871_100073430
1193 Ga0068871_100266221
1194 Ga0068871_100295449
1195 Ga0068871_100425846
1196 Ga0075428_100001488
1197 Ga0075430_100121836
1198 Ga0075430_100209147
1199 Ga0075431_100000504
1200 Ga0075434_100039915
1201 Ga0075429_100000459
1202 Ga0075429_100416719
1203 Ga0068865_100010532
1204 Ga0068865_100106539
1205 Ga0068865_100215674
1206 Ga0068865_100265957
1207 Ga0068865_100288095
1208 Ga0075436_100321727
1209 Ga0097620_100044877
1210 Ga0097620_100084982
1211 Ga0097620_100440401
1212 Ga0097620_100798998
1213 Ga0075435_100027074
1214 Ga0075435_100586588
1215 Ga0105240_10023182
1216 Ga0105240_10433924
1217 Ga0105240_10763200
1218 Ga0111539_10002196
1219 Ga0111539_10006967
1220 Ga0111539_10063702
1221 Ga0105245_10034600
1222 Ga0105245_10066003
1223 Ga0105245_10075278
1224 Ga0105245_10255076
1225 Ga0105245_10263303
1226 Ga0105245_10493065
1227 Ga0114129_10000593
1228 Ga0114129_11041476
1229 Ga0105243_10021629
1230 Ga0105243_10094039
1231 Ga0105243_10113817
1232 Ga0105243_10376049
1233 Ga0105243_10442189
1234 Ga0105241_10002214
1235 Ga0105241_10009474
1236 Ga0105241_10345929
1237 Ga0105242_10036944
1238 Ga0105242_10101044
1239 Ga0105242_10104288
1240 Ga0105242_10139739
1241 Ga0105242_10168506
1242 Ga0105242_10994125
1243 Ga0105248_10006493
1244 Ga0105248_10051747
1245 Ga0105248_10104462
1246 Ga0105248_10116757
1247 Ga0105248_10496922
1248 Ga0105237_10177118
1249 Ga0105238_10013647
1250 Ga0105238_10044924
1251 Ga0105238_10062584
1252 Ga0105249_10019606
1253 Ga0105249_10073706
1254 Ga0105249_10236945
1255 Ga0099796_10002032
1256 Ga0105239_10042625
1257 Ga0105239_10084846
1258 Ga0105239_10140266
1259 Ga0105239_10204440
1260 Ga0105246_10032914
1261 Ga0105246_10060490
1262 Ga0105246_10064899
1263 Ga0105246_10189581
1264 Ga0105246_10218340
1265 Ga0105246_10650335
1266 Ga0157327_1005464
1267 Ga0157373_10000824
1268 Ga0157373_10005021
1269 Ga0157371_10000769
1270 Ga0157371_10099752
1271 Ga0157371_10303600
1272 Ga0157370_10003726
1273 Ga0157370_10107283
1274 Ga0157370_10143609
1275 Ga0157370_10196144
1276 Ga0157370_10475022
1277 Ga0157369_10028062
1278 Ga0157369_10085368
1279 Ga0157369_10280726
1280 Ga0157369_10420906
1281 Ga0157374_10059054
1282 Ga0157374_10181773
1283 Ga0157374_10296608
1284 Ga0157374_10306473
1285 Ga0157378_10063263
1286 Ga0157378_10068127
1287 Ga0157378_10165162
1288 Ga0157378_10197025
1289 Ga0157378_10251308
1290 Ga0157378_10377978
1291 Ga0163162_10032188
1292 Ga0163162_10039769
1293 Ga0163162_10067406
1294 Ga0163162_10073390
1295 Ga0163162_10085192
1296 Ga0163162_10140412
1297 Ga0163162_10143832
1298 Ga0163162_10246251
1299 Ga0163162_10359423
1300 Ga0157372_10002479
1301 Ga0157372_10010519
1302 Ga0157372_10031751
1303 Ga0157372_10092578
1304 Ga0157372_10141524
1305 Ga0157372_10159884
1306 Ga0157372_10178656
1307 Ga0157372_10204695
1308 Ga0157372_10254272
1309 Ga0157372_10266343
1310 Ga0157375_10001717
1311 Ga0157375_10012282
1312 Ga0157375_10110716
1313 Ga0157375_10181771
1314 Ga0157375_10603888
1315 Ga0157375_10731325
1316 Ga0163163_10045052
1317 Ga0163163_10710470
1318 Ga0157380_10013259
1319 Ga0157380_10039591
1320 Ga0157380_10079154
1321 Ga0157380_10099241
1322 Ga0157380_10130913
1323 Ga0157380_10675784
1324 Ga0157377_10061685
1325 Ga0157377_10098481
1326 Ga0157377_10315761
1327 Ga0157379_10009759
1328 Ga0157379_10082823
1329 Ga0157379_10181755
1330 Ga0157376_10003346
1331 Ga0157376_10015103
1332 Ga0157376_10026515
1333 Ga0157376_10215245
1334 Ga0157376_10228096
1335 Ga0157376_10368435
1336 Ga0157376_10807638
1337 Ga0157376_10939892
1338 Ga0163161_10019650
1339 Ga0163161_10066810
1340 Ga0163161_10114306
1341 Ga0163161_10124692
1342 Ga0213874_10006091
1343 Ga0213876_10001691
1344 Ga0213876_10003521
1345 Ga0213876_10086506
1346 Ga0213875_10038294
1347 Ga0207673_1003356
1348 Ga0209256_1000689
1349 Ga0207697_10137385
1350 Ga0207656_10044825
1351 Ga0207682_10000872
1352 Ga0207692_10001173
1353 Ga0207692_10002425
1354 Ga0207692_10029057
1355 Ga0207642_10023701
1356 Ga0207642_10032431
1357 Ga0207688_10001682
1358 Ga0207688_10016260
1359 Ga0207688_10083971
1360 Ga0207688_10174175
1361 Ga0207688_10197177
1362 Ga0207680_10032448
1363 Ga0207680_10052152
1364 Ga0207685_10001412
1365 Ga0207685_10074320
1366 Ga0207699_10002658
1367 Ga0207699_10007883
1368 Ga0207699_10043223
1369 Ga0207645_10001481
1370 Ga0207645_10102929
1371 Ga0207643_10002283
1372 Ga0207643_10121590
1373 Ga0207705_10078878
1374 Ga0207705_10080683
1375 Ga0207705_10087369
1376 Ga0207654_10062334
1377 Ga0207654_10064587
1378 Ga0207707_10007412
1379 Ga0207707_10054164
1380 Ga0207707_10126079
1381 Ga0207695_10010787
1382 Ga0207695_10034941
1383 Ga0207695_10462875
1384 Ga0207671_10158982
1385 Ga0207693_10001660
1386 Ga0207693_10004561
1387 Ga0207693_10008700
1388 Ga0207693_10009095
1389 Ga0207693_10020362
1390 Ga0207693_10043024
1391 Ga0207693_10306071
1392 Ga0207663_10000327
1393 Ga0207663_10005738
1394 Ga0207663_10013842
1395 Ga0207663_10014468
1396 Ga0207663_10048493
1397 Ga0207663_10175642
1398 Ga0207663_10267885
1399 Ga0207663_10360754
1400 Ga0207663_10698042
1401 Ga0207660_10007745
1402 Ga0207660_10015325
1403 Ga0207660_10058814
1404 Ga0207660_10135008
1405 Ga0207662_10001442
1406 Ga0207657_10000102
1407 Ga0207657_10000250
1408 Ga0207657_10016616
1409 Ga0207657_10039174
1410 Ga0207657_10081255
1411 Ga0207657_10337154
1412 Ga0207657_10403093
1413 Ga0207649_10025902
1414 Ga0207649_10245725
1415 Ga0207649_10275556
1416 Ga0207652_10003521
1417 Ga0207652_10077656
1418 Ga0207681_10008492
1419 Ga0207681_10041663
1420 Ga0207650_10002771
1421 Ga0207659_10011351
1422 Ga0207659_10216155
1423 Ga0207687_10139372
1424 Ga0207700_10000052
1425 Ga0207700_10009348
1426 Ga0207700_10024470
1427 Ga0207700_10106497
1428 Ga0207700_10314009
1429 Ga0207700_10453881
1430 Ga0207664_10012367
1431 Ga0207664_10015521
1432 Ga0207664_10018323
1433 Ga0207664_10130011
1434 Ga0207664_10196164
1435 Ga0207644_10003032
1436 Ga0207644_10003185
1437 Ga0207644_10140534
1438 Ga0207644_10173928
1439 Ga0207644_10471021
1440 Ga0207690_10000595
1441 Ga0207690_10011334
1442 Ga0207690_10021388
1443 Ga0207706_10000095
1444 Ga0207706_10002865
1445 Ga0207706_10003460
1446 Ga0207706_10015256
1447 Ga0207686_10095491
1448 Ga0207686_10182589
1449 Ga0207686_10210907
1450 Ga0207686_10249571
1451 Ga0207709_10006513
1452 Ga0207709_10076201
1453 Ga0207709_10280804
1454 Ga0207670_10062251
1455 Ga0207669_10004853
1456 Ga0207669_10120571
1457 Ga0207669_10511394
1458 Ga0207704_10131322
1459 Ga0207704_10263558
1460 Ga0207665_10002675
1461 Ga0207665_10003693
1462 Ga0207665_10006131
1463 Ga0207665_10010080
1464 Ga0207665_10026007
1465 Ga0207665_10070391
1466 Ga0207665_10077543
1467 Ga0207691_10000894
1468 Ga0207691_10004886
1469 Ga0207691_10102875
1470 Ga0207711_10007597
1471 Ga0207711_10051104
1472 Ga0207711_10114357
1473 Ga0207711_10151761
1474 Ga0207711_10582592
1475 Ga0207689_10018574
1476 Ga0207689_10105947
1477 Ga0207689_10146286
1478 Ga0207661_10187983
1479 Ga0207661_10361023
1480 Ga0207661_10743673
1481 Ga0207679_10001787
1482 Ga0207679_10009965
1483 Ga0207679_10063511
1484 Ga0207679_10148665
1485 Ga0207679_10183893
1486 Ga0207667_10000233
1487 Ga0207667_10012539
1488 Ga0207667_10028313
1489 Ga0207667_10036146
1490 Ga0207667_10087482
1491 Ga0207667_10109962
1492 Ga0207667_10154801
1493 Ga0207651_10016952
1494 Ga0207651_10277452
1495 Ga0207712_10018971
1496 Ga0207712_10664453
1497 Ga0207668_10014214
1498 Ga0207668_10015143
1499 Ga0207668_10016667
1500 Ga0207668_10155437
1501 Ga0207668_10475962
1502 Ga0207640_10231774
1503 Ga0207658_10001269
1504 Ga0207658_10047079
1505 Ga0207658_10050170
1506 Ga0207677_10149957
1507 Ga0207677_10441179
1508 Ga0207703_10027561
1509 Ga0207703_10069412
1510 Ga0207703_10220414
1511 Ga0207703_10306462
1512 Ga0207703_10443575
1513 Ga0207703_10607823
1514 Ga0207703_10644066
1515 Ga0207703_10838066
1516 Ga0207639_10027371
1517 Ga0207639_10032866
1518 Ga0207639_10043431
1519 Ga0207639_10091583
1520 Ga0207639_10355285
1521 Ga0207678_10001717
1522 Ga0207678_10003576
1523 Ga0207678_10004513
1524 Ga0207678_10031337
1525 Ga0207678_10105656
1526 Ga0207678_10121418
1527 Ga0207708_10000558
1528 Ga0207708_10042552
1529 Ga0207708_10078335
1530 Ga0207702_10003371
1531 Ga0207702_10008525
1532 Ga0207702_10056084
1533 Ga0207702_10078347
1534 Ga0207702_10176980
1535 Ga0207641_10008303
1536 Ga0207641_10213201
1537 Ga0207648_10021284
1538 Ga0207648_10042493
1539 Ga0207648_10243989
1540 Ga0207676_10027045
1541 Ga0207674_10000326
1542 Ga0207674_10002376
1543 Ga0207674_10099180
1544 Ga0207674_10156104
1545 Ga0207674_10278224
1546 Ga0207675_100002315
1547 Ga0207675_100031636
1548 Ga0207675_100076680
1549 Ga0207675_100173538
1550 Ga0207675_100266389
1551 Ga0207683_10006767
1552 Ga0207683_10009942
1553 Ga0207683_10012309
1554 Ga0207683_10030660
1555 Ga0207683_10036404
1556 Ga0207683_10073358
1557 Ga0207683_10094761
1558 Ga0207683_10202154
1559 Ga0207698_10026071
1560 Ga0207698_10151859
1561 Ga0209982_1012290
1562 Ga0209966_1019300
1563 Ga0209974_10001061
1564 Ga0209974_10006336
1565 Ga0207428_10007060
1566 Ga0207428_10099895
1567 Ga0268266_10083840
1568 Ga0268266_10103401
1569 Ga0268266_10123252
1570 Ga0268266_10135196
1571 Ga0268266_10322461
1572 Ga0268266_10617226
1573 Ga0268265_10110725
1574 Ga0268265_10906437
1575 Ga0268264_10038116
1576 Ga0268264_10292694
1577 Ga0268264_10559880
1578 Ga0307408_100010802
1579 Ga0316576_10248069
1580 Ga0307516_10178619
1581 Ga0307413_10545539
1582 Ga0307410_10062735
1583 Ga0307406_10005700
1584 Ga0307412_10071352
1585 Ga0307409_100017959
1586 Ga0307416_100002602
1587 Ga0307416_100028588
1588 Ga0307416_100094609
1589 Ga0307510_10073939
1590 Ga0373929_0020363
1591 Ga0373945_0003413
1592 Ga0373945_0056554
1593 Ga0373954_0029083
1594 Ga0373956_0200311
1595 Ga0373943_0009284
1596 Ga0373943_0043916
1597 Ga0373943_0148731
1598 Ga0373946_0059070
1599 Ga0373946_0261798
1600 Ga0316574_0000860
1601 Ga0316574_0052741
1602 Ga0373931_0013132
1603 Ga0373935_0005109
1604 Ga0373935_0204223
1605 Ga0373927_0001870
1606 Ga0373927_0014378
1607 Ga0373927_0107770
1608 Ga0373927_0147662
1609 Ga0373933_0105186
1610 Ga0373947_0004918
1611 Ga0373947_0082924
1612 Ga0373937_0021190
1613 Ga0373937_0213932
1614 Ga0316582_0140697
1615 Ga0373925_0003141
1616 Ga0373925_0004558
1617 Ga0373925_0020423
1618 Ga0373925_0066467
1619 Ga0373925_0377574
1620 Ga0395899_0148967
1621 Ga0395900_0086129
1622 Ga0395898_0002249
1623 Ga0395898_0592444
1624 Ga0395905_0110789
1625 Ga0395905_0519260
1626 Ga0436364_0269804
1627 Ga0395901_0064332
1628 Ga0395901_0096935
1629 Ga0395901_0276939
1630 Ga0436365_0011381
1631 Ga0436365_0265841
1632 Ga0436365_0321374
1633 Ga0436365_0350464
1634 Ga0436365_0954239
1635 Ga0436360_0539211
1636 Ga0436360_1089733
1637 Ga0436363_0538486
1638 Ga0436362_0223954
1639 Ga0451853_3234775
1640 Ga0451853_3961465
1641 Ga0439435_0043784
1642 Ga0466967_0062646
1643 Ga0495617_029819
1644 Ga0495592_0060981
1645 Ga0495603_0000298
1646 Ga0495603_0006456
1647 Ga0495603_0070400
1648 Ga0495603_0186634
1649 Ga0495629_0000336
1650 Ga0495641_0001543
1651 Ga0495651_0000461
1652 Ga0495580_0004668
1653 Ga0495580_0053641
1654 Ga0495580_0135281
1655 Ga0495580_0297421
1656 Ga0495582_0000134
1657 Ga0495582_0093755
1658 Ga0495582_0243400
1659 Ga0495639_0001666
1660 Ga0495639_0116832
1661 Ga0495662_0000247
1662 Ga0495664_0002841
1663 Ga0495664_0007422
1664 Ga0495664_0036424
1665 Ga0495585_0124186
1666 Ga0495594_0001158
1667 Ga0495594_0048999
1668 Ga0495594_0147168
1669 Ga0495594_0171646
1670 Ga0495594_0199645
1671 Ga0495583_0009837
1672 Ga0495608_0011744
1673 Ga0495628_0031305
1674 Ga0495630_0003037
1675 Ga0495630_0015478
1676 Ga0495630_0038590
1677 Ga0495666_0019067
1678 Ga0495652_0004619
1679 Ga0495652_0158194
1680 Ga0495665_0001246
1681 Ga0495665_0079272
1682 Ga0495665_0081794
1683 Ga0495665_0090623
1684 Ga0495640_0063685
1685 Ga0495640_0249758
1686 Ga0495598_0004079
1687 Ga0495598_0026502
1688 Ga0495621_0038723
1689 Ga0495621_0116440
1690 Ga0495645_0007613
1691 Ga0495645_0311419
1692 Ga0495622_0009872
1693 Ga0495622_0011954
1694 Ga0495667_0302633
1695 Ga0495656_0003709
1696 Ga0495656_0038433
1697 Ga0495668_0013420
1698 Ga0495668_0077758
1699 Ga0495634_0002604
1700 Ga0495634_0059610
1701 Ga0495635_0003952
1702 Ga0495635_0014916
1703 Ga0495635_0343783
1704 Ga0495659_0012651
1705 Ga0495661_0080600
1706 Ga0495588_0028098
1707 Ga0495657_0002772
1708 Ga0495599_0018332
1709 Ga0495646_0018795
1710 Ga0495647_0000802
1711 Ga0495647_0183242
1712 Ga0495669_0027987
1713 Ga0495669_0115017
1714 Ga0495613_0002024
1715 Ga0495613_0036184
1716 Ga0495624_0002097
1717 Ga0495624_0072338
1718 Ga0495624_0166516
1719 Ga0495624_0296288
1720 Ga0495589_0027704
1721 Ga0495600_0001622
1722 Ga0495600_0194366
1723 Ga0495581_0000072
1724 Ga0495581_0223432
1725 Ga0495604_0004466
1726 Ga0495604_0069222
1727 Ga0495636_0007176
1728 Ga0495674_0002364
1729 Ga0495674_0004841
1730 Ga0495674_0021885
1731 Ga0495676_0045738
1732 Ga0495680_0002271
1733 Ga0495680_0115104
1734 Ga0495677_0070328
1735 Ga0495685_096513
1736 Ga0495681_0086279
1737 Ga0495684_0065597
1738 Ga0495684_0393264
1739 Ga0495593_0000094
1740 Ga0496100_0013147
1741 Ga0496100_0246514
1742 Ga0496100_0257105
1743 Ga0496100_0307379
1744 Ga0496101_0005202
1745 Ga0496101_0072512
1746 Ga0496102_0014347
1747 Ga0496102_0021844
1748 Ga0496102_0070862
1749 Ga0496102_0110863
1750 Ga0496102_0617425
1751 Ga0496102_0670214
1752 Ga0496102_0744377
1753 Ga0496103_0028243
1754 Ga0496103_0109623
1755 Ga0496103_0123584
1756 Ga0496103_0124684
1757 Ga0496103_0143809
1758 Ga0496104_0087324
1759 Ga0496104_0118705
1760 Ga0496104_0161115
1761 Ga0496105_0031262
1762 Ga0496105_0309405
1763 Ga0496106_0009999
1764 Ga0496106_0073243
1765 Ga0496106_0099608
1766 Ga0496106_0102249
1767 Ga0496106_0282857
1768 Ga0496106_0303783
1769 Ga0496107_0012533
1770 Ga0496107_0090508
1771 Ga0496107_0277551
1772 Ga0496107_0594055
1773 Ga0496108_0005893
1774 Ga0496108_0102157
1775 Ga0496108_0141751
1776 Ga0496109_0008278
1777 Ga0496109_0029898
1778 Ga0496109_0048437
1779 Ga0496110_0007982
1780 Ga0496110_0020252
1781 Ga0496111_0022826
1782 Ga0496112_0004983
1783 Ga0496112_0069737
1784 Ga0496112_0515236
1785 Ga0496112_0732571
1786 Ga0496113_0001782
1787 Ga0496113_0040675
1788 Ga0496114_0148434
1789 Ga0496114_0238178
1790 Ga0496114_0274230
1791 Ga0496114_0796416
1792 Ga0496115_0024226
1793 Ga0496115_0132400
1794 Ga0496116_0002454
1795 Ga0496116_0071661
1796 Ga0496116_0087783
1797 Ga0496121_0043033
1798 Ga0496124_0005968
1799 Ga0496125_0140450
1800 Ga0496126_0030132
1801 Ga0495678_020678
1802 Ga0501031_0029699
1803 Ga0501031_0103369
1804 Ga0501033_0073806
1805 Ga0501034_0000050
1806 Ga0501038_0139096
1807 Ga0501040_0127742
1808 Ga0501042_0079862
1809 Ga0501042_0097326
1810 Ga0501043_0093945
1811 Ga0501047_0259251
1812 Ga0501071_0131322
1813 Ga0501074_0108192
1814 Ga0501076_0144048
1815 Ga0501077_0262542
1816 Ga0501081_0171991
1817 Ga0501035_0155510
1818 nmdc:mga00v17_155380_c1
1819 nmdc:mga00v17_23592_c1
1820 nmdc:mga00v17_39556_c1
1821 nmdc:mga0yw44_215377_c1
1822 nmdc:mga06z11_84102_c1
1823 nmdc:mga05p37_233_c1
1824 nmdc:mga09592_276293_c1
1825 nmdc:mga09592_800_c1
1826 nmdc:mga0qj67_99316_c1
1827 nmdc:mga06r32_94_c1
1828 nmdc:mga08y16_251518_c1
1829 nmdc:mga08y16_2747_c1
1830 nmdc:mga0n895_524772_c1
1831 nmdc:mga0n895_63502_c1
1832 nmdc:mga0rr50_8887_c1
1833 nmdc:mga08x19_211792_c1
1834 Ga0495612_0098788
1835 Ga0495655_0053431
1836 Ga0495619_0315074
1837 Ga0500646_0121605
1838 Ga0500651_0167979
1839 Ga0500566_0242572
1840 Ga0500555_012495
1841 Ga0500658_0011685
1842 Ga0500588_0092697
1843 Ga0500604_0021080
1844 Ga0500627_0032682
1845 Ga0500634_0130932
1846 Ga0530510_0187102
1847 2513894375
1848 2644123516
1849 2858694263
1850 2883577728
1851 2885412758
1852 2889310900
1853 2894777252
1854 2901305424
1855 2902336719
1856 2928126853
1857 2929200800
1858 2935742982
1859 8019556053
1860 8019569257
1861 8048749888
1862 8055914016

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

231

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

277

0.95

PF08659

KR

KR domain

37

220

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

250

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9741 3 250
4iuy-assembly2.cif.gz_G crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c 0.9714 1 251
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.9654 4 250
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9652 2 249
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9648 5 248
ID Description Score Start End Superfamily
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9741 3 250 3.40.50.720
4iuyC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 1 253 3.40.50.720
af_A0A1D8PPB1_4_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 3 248 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 5 248 3.40.50.720
4iuyC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 1 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A258K2D8-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9887 63 253 GO:0016616
AF-A0A537R720-F1-model_v4 SDR family oxidoreductase 0.9875 52 250 GO:0016616
GO:0030497
AF-A0A520NW44-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.987 3 253 GO:0016616
AF-A0A8A7CQC7-F1-model_v4 deleted 0.9864 1 253
AF-A0A1X9NLD9-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9863 2 253 GO:0016616

Map