F486010

General Info

Members Datasets Scaffolds Average Seq Length
930 223 929 171

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10240107|Ga0070658_102401072
Length 184
Sequence MIGLGEAGAIPMSDVLLFERAAPSFAASLARRGHHIVYRANESNHCPGCGRSHWYIGRISAECGFCGTAVPLAETSVVEAAPHSSRPKASVTSADQRRFPRMPAKGRKLQLLIDGSPASFALQDISEGGVRGKTAPELVPGAKVHVRFEGGILVPAVVKWAEKGLVGLAFIDPIILDRSAQRQS

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.32
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.52
Rhizosphere 94.73
Stem 0
Stem Tuber 0.11
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001126 3300001979 Bacteria 12102
2 JGI24740J21852_10004688 3300001979 Bacteria 5857
3 JGI24739J22299_10141477 3300001989 Bacteria 713
4 JGI24737J22298_10003380 3300001990 Bacteria 5642
5 JGI24735J21928_10010414 3300002067 Bacteria 2965
6 JGI24735J21928_10017009 3300002067 Bacteria 2251
7 JGI24034J26672_10053221 3300002239 Bacteria 699
8 rootL2_10267806 3300003322 Unclassified 1031
9 rootH1_10278953 3300003323 Bacteria 1737
10 Ga0070658_10009104 3300005327 Bacteria 7985
11 Ga0070658_10012256 3300005327 Bacteria 6882
12 Ga0070658_10018898 3300005327 Bacteria 5521
13 Ga0070658_10050982 3300005327 Bacteria 3354
14 Ga0070658_10126304 3300005327 Bacteria 2129
15 Ga0070658_10137343 3300005327 Bacteria 2041
16 Ga0070658_10144517 3300005327 Unclassified 1988
17 Ga0070658_10189803 3300005327 Bacteria 1732
18 Ga0070658_10214334 3300005327 Bacteria 1627
19 Ga0070658_10240107 3300005327 Bacteria 1536
20 Ga0070658_10292776 3300005327 Bacteria 1387
21 Ga0070658_10318734 3300005327 Bacteria 1327
22 Ga0070658_10669328 3300005327 Bacteria 901
23 Ga0070676_10168981 3300005328 Bacteria 1413
24 Ga0070676_10181160 3300005328 Bacteria 1370
25 Ga0070676_10268988 3300005328 Bacteria 1144
26 Ga0070676_10553910 3300005328 Bacteria 823
27 Ga0070683_100024323 3300005329 Bacteria 5424
28 Ga0070683_100156382 3300005329 Bacteria 2162
29 Ga0070683_100222484 3300005329 Unclassified 1794
30 Ga0070683_100384525 3300005329 Bacteria 1337
31 Ga0070683_100542599 3300005329 Bacteria 1112
32 Ga0070683_100583260 3300005329 Bacteria 1069
33 Ga0070670_100067994 3300005331 Bacteria 3057
34 Ga0070670_100099710 3300005331 Bacteria 2499
35 Ga0070670_100162474 3300005331 Bacteria 1936
36 Ga0070670_100929619 3300005331 Bacteria 789
37 Ga0070670_100996201 3300005331 Bacteria 762
38 Ga0068869_100315233 3300005334 Unclassified 1267
39 Ga0070666_10020324 3300005335 Bacteria 4291
40 Ga0070666_10021333 3300005335 Bacteria 4198
41 Ga0070666_10021757 3300005335 Bacteria 4156
42 Ga0070666_10060975 3300005335 Bacteria 2553
43 Ga0070666_10173313 3300005335 Bacteria 1511
44 Ga0070680_100059955 3300005336 Bacteria 3114
45 Ga0070680_100080167 3300005336 Bacteria 2692
46 Ga0070680_100210135 3300005336 Bacteria 1642
47 Ga0070680_100375654 3300005336 Bacteria 1210
48 Ga0070682_100013855 3300005337 Bacteria 4649
49 Ga0070682_100229221 3300005337 Bacteria 1327
50 Ga0070682_101026883 3300005337 Unclassified 686
51 Ga0070682_101605724 3300005337 Bacteria 562
52 Ga0068868_100033262 3300005338 Bacteria 3973
53 Ga0068868_100051631 3300005338 Bacteria 3236
54 Ga0068868_100078620 3300005338 Bacteria 2641
55 Ga0068868_100129706 3300005338 Bacteria 2062
56 Ga0068868_100308483 3300005338 Bacteria 1346
57 Ga0068868_101100384 3300005338 Bacteria 731
58 Ga0070660_100003053 3300005339 Bacteria 11523
59 Ga0070660_100008261 3300005339 Bacteria 7275
60 Ga0070660_100031936 3300005339 Bacteria 3959
61 Ga0070660_100032328 3300005339 Bacteria 3936
62 Ga0070660_100057071 3300005339 Bacteria 3023
63 Ga0070660_100114235 3300005339 Bacteria 2151
64 Ga0070660_100117222 3300005339 Bacteria 2124
65 Ga0070660_100128950 3300005339 Bacteria 2023
66 Ga0070660_100306813 3300005339 Bacteria 1302
67 Ga0070660_100329855 3300005339 Unclassified 1254
68 Ga0070660_100447868 3300005339 Bacteria 1071
69 Ga0070660_100670327 3300005339 Bacteria 869
70 Ga0070660_100713793 3300005339 Bacteria 841
71 Ga0070689_101016397 3300005340 Unclassified 738
72 Ga0070691_10003582 3300005341 Bacteria 7010
73 Ga0070661_100026533 3300005344 Bacteria 4167
74 Ga0070661_100056051 3300005344 Bacteria 2886
75 Ga0070661_100099815 3300005344 Unclassified 2158
76 Ga0070661_100108040 3300005344 Bacteria 2075
77 Ga0070661_100126363 3300005344 Bacteria 1918
78 Ga0070661_100133516 3300005344 Bacteria 1866
79 Ga0070661_100259356 3300005344 Unclassified 1343
80 Ga0070661_100317045 3300005344 Bacteria 1217
81 Ga0070661_100474986 3300005344 Bacteria 998
82 Ga0070661_100485528 3300005344 Bacteria 987
83 Ga0070661_100598029 3300005344 Bacteria 891
84 Ga0070661_101188688 3300005344 Unclassified 637
85 Ga0070692_10006534 3300005345 Bacteria 5069
86 Ga0070675_100049667 3300005354 Bacteria 3443
87 Ga0070675_100257690 3300005354 Bacteria 1528
88 Ga0070675_100593569 3300005354 Bacteria 1004
89 Ga0070671_100002090 3300005355 Bacteria 15383
90 Ga0070671_100015766 3300005355 Bacteria 6106
91 Ga0070671_100024750 3300005355 Bacteria 4917
92 Ga0070671_100028475 3300005355 Bacteria 4600
93 Ga0070671_100056433 3300005355 Bacteria 3267
94 Ga0070671_100059294 3300005355 Unclassified 3185
95 Ga0070671_100126174 3300005355 Bacteria 2154
96 Ga0070671_100302705 3300005355 Bacteria 1361
97 Ga0070671_100441765 3300005355 Unclassified 1115
98 Ga0070674_100018560 3300005356 Bacteria 4401
99 Ga0070674_100028383 3300005356 Bacteria 3675
100 Ga0070674_100751110 3300005356 Bacteria 838
101 Ga0070673_100030023 3300005364 Bacteria 4062
102 Ga0070673_100039241 3300005364 Bacteria 3622
103 Ga0070673_100039882 3300005364 Bacteria 3598
104 Ga0070673_100324412 3300005364 Unclassified 1361
105 Ga0070659_100004452 3300005366 Bacteria 10009
106 Ga0070659_100009360 3300005366 Bacteria 7195
107 Ga0070659_100041705 3300005366 Bacteria 3588
108 Ga0070659_100050354 3300005366 Bacteria 3274
109 Ga0070659_100086992 3300005366 Bacteria 2502
110 Ga0070659_100095748 3300005366 Bacteria 2384
111 Ga0070659_100160934 3300005366 Bacteria 1835
112 Ga0070659_100202607 3300005366 Bacteria 1634
113 Ga0070659_100297472 3300005366 Unclassified 1345
114 Ga0070659_100341327 3300005366 Bacteria 1255
115 Ga0070659_100381757 3300005366 Bacteria 1187
116 Ga0070659_100730976 3300005366 Unclassified 857
117 Ga0070659_100885051 3300005366 Bacteria 780
118 Ga0070659_101235960 3300005366 Unclassified 661
119 Ga0070659_101331368 3300005366 Unclassified 637
120 Ga0070667_100010677 3300005367 Bacteria 7587
121 Ga0070667_100027546 3300005367 Bacteria 4728
122 Ga0070667_100029232 3300005367 Bacteria 4591
123 Ga0070667_100034693 3300005367 Bacteria 4223
124 Ga0070709_10182391 3300005434 Bacteria 1475
125 Ga0070714_100024648 3300005435 Bacteria 4957
126 Ga0070714_100051350 3300005435 Bacteria 3514
127 Ga0070714_100077427 3300005435 Bacteria 2889
128 Ga0070714_100083682 3300005435 Bacteria 2783
129 Ga0070714_100118908 3300005435 Bacteria 2348
130 Ga0070714_100124451 3300005435 Bacteria 2297
131 Ga0070714_100377650 3300005435 Bacteria 1336
132 Ga0070714_100515657 3300005435 Bacteria 1141
133 Ga0070713_100037787 3300005436 Bacteria 3905
134 Ga0070713_100060401 3300005436 Bacteria 3168
135 Ga0070713_100149553 3300005436 Bacteria 2076
136 Ga0070713_100283377 3300005436 Bacteria 1521
137 Ga0070710_10654621 3300005437 Bacteria 737
138 Ga0070701_10056286 3300005438 Bacteria 2057
139 Ga0070663_100081089 3300005455 Bacteria 2384
140 Ga0070663_100082406 3300005455 Bacteria 2366
141 Ga0070663_100111579 3300005455 Bacteria 2055
142 Ga0070663_100117144 3300005455 Unclassified 2008
143 Ga0070663_100126678 3300005455 Bacteria 1935
144 Ga0070663_100211025 3300005455 Unclassified 1520
145 Ga0070663_100215665 3300005455 Bacteria 1505
146 Ga0070678_100031044 3300005456 Bacteria 3680
147 Ga0070678_100393715 3300005456 Unclassified 1202
148 Ga0070662_100009880 3300005457 Bacteria 6251
149 Ga0070662_100109917 3300005457 Bacteria 2098
150 Ga0070662_100122792 3300005457 Bacteria 1992
151 Ga0070662_100192805 3300005457 Unclassified 1613
152 Ga0070662_100244743 3300005457 Bacteria 1439
153 Ga0070662_100432791 3300005457 Bacteria 1090
154 Ga0070662_100543652 3300005457 Bacteria 973
155 Ga0070681_10226833 3300005458 Bacteria 1783
156 Ga0070681_10242084 3300005458 Unclassified 1717
157 Ga0070681_10313255 3300005458 Bacteria 1479
158 Ga0070681_10356957 3300005458 Bacteria 1372
159 Ga0068867_100107486 3300005459 Bacteria 2138
160 Ga0068867_100296207 3300005459 Bacteria 1332
161 Ga0068867_100549656 3300005459 Bacteria 1000
162 Ga0068867_100758623 3300005459 Bacteria 862
163 Ga0070679_100038807 3300005530 Bacteria 4735
164 Ga0070679_100044440 3300005530 Bacteria 4425
165 Ga0070679_100079195 3300005530 Bacteria 3275
166 Ga0070679_100416136 3300005530 Unclassified 1290
167 Ga0070679_100709016 3300005530 Bacteria 949
168 Ga0070679_100945526 3300005530 Bacteria 805
169 Ga0070684_100002671 3300005535 Bacteria 13167
170 Ga0070684_100034298 3300005535 Bacteria 4338
171 Ga0070684_100353112 3300005535 Bacteria 1352
172 Ga0068853_100025015 3300005539 Bacteria 5010
173 Ga0068853_100095736 3300005539 Bacteria 2618
174 Ga0068853_100164720 3300005539 Bacteria 2003
175 Ga0068853_100275758 3300005539 Bacteria 1549
176 Ga0068853_101403305 3300005539 Bacteria 675
177 Ga0070672_100000461 3300005543 Bacteria 23612
178 Ga0070672_100275877 3300005543 Bacteria 1420
179 Ga0070672_100427333 3300005543 Bacteria 1138
180 Ga0070686_100218439 3300005544 Bacteria 1376
181 Ga0070686_100538375 3300005544 Unclassified 912
182 Ga0070693_100071516 3300005547 Unclassified 2044
183 Ga0070693_100783939 3300005547 Unclassified 705
184 Ga0070665_100012613 3300005548 Bacteria 8508
185 Ga0070665_100040150 3300005548 Bacteria 4704
186 Ga0070665_100169141 3300005548 Bacteria 2187
187 Ga0070665_100190168 3300005548 Bacteria 2054
188 Ga0070665_100680549 3300005548 Unclassified 1042
189 Ga0070665_100957088 3300005548 Bacteria 869
190 Ga0068855_100115015 3300005563 Bacteria 3084
191 Ga0068855_100124450 3300005563 Bacteria 2949
192 Ga0068855_100129420 3300005563 Bacteria 2884
193 Ga0068855_100160692 3300005563 Bacteria 2550
194 Ga0068855_100174522 3300005563 Bacteria 2433
195 Ga0068855_100178434 3300005563 Bacteria 2402
196 Ga0068855_100200788 3300005563 Bacteria 2244
197 Ga0068855_100217838 3300005563 Unclassified 2142
198 Ga0068855_100515666 3300005563 Bacteria 1297
199 Ga0070664_100002518 3300005564 Bacteria 14767
200 Ga0070664_100028887 3300005564 Bacteria 4618
201 Ga0070664_100040831 3300005564 Bacteria 3913
202 Ga0070664_100047412 3300005564 Bacteria 3629
203 Ga0070664_100063374 3300005564 Bacteria 3152
204 Ga0070664_100186882 3300005564 Bacteria 1844
205 Ga0070664_100244736 3300005564 Bacteria 1611
206 Ga0068857_100000489 3300005577 Bacteria 28341
207 Ga0068857_100039427 3300005577 Bacteria 4184
208 Ga0068857_100091002 3300005577 Bacteria 2730
209 Ga0068857_100190905 3300005577 Bacteria 1866
210 Ga0068857_100303721 3300005577 Bacteria 1471
211 Ga0068854_100012018 3300005578 Bacteria 5658
212 Ga0068854_100013400 3300005578 Bacteria 5380
213 Ga0068854_100030482 3300005578 Bacteria 3741
214 Ga0068854_100033456 3300005578 Bacteria 3584
215 Ga0068854_100080454 3300005578 Bacteria 2404
216 Ga0068854_100215840 3300005578 Bacteria 1515
217 Ga0068854_100276267 3300005578 Bacteria 1351
218 Ga0068854_100279508 3300005578 Unclassified 1343
219 Ga0068854_100300388 3300005578 Bacteria 1298
220 Ga0068854_100523488 3300005578 Bacteria 1002
221 Ga0068854_100622269 3300005578 Bacteria 924
222 Ga0068854_100958766 3300005578 Bacteria 755
223 Ga0068856_100013400 3300005614 Bacteria 7938
224 Ga0068856_100053557 3300005614 Bacteria 3978
225 Ga0068856_100067154 3300005614 Bacteria 3544
226 Ga0068856_100107491 3300005614 Bacteria 2785
227 Ga0068856_100116416 3300005614 Bacteria 2673
228 Ga0068856_100137905 3300005614 Bacteria 2445
229 Ga0068856_100242001 3300005614 Bacteria 1819
230 Ga0068856_100244315 3300005614 Bacteria 1810
231 Ga0068856_100359161 3300005614 Bacteria 1475
232 Ga0068856_100402279 3300005614 Bacteria 1389
233 Ga0068856_100543609 3300005614 Bacteria 1183
234 Ga0068856_100674668 3300005614 Bacteria 1054
235 Ga0068856_100706562 3300005614 Bacteria 1028
236 Ga0068856_101128147 3300005614 Bacteria 801
237 Ga0068856_101376511 3300005614 Bacteria 720
238 Ga0068852_100004443 3300005616 Bacteria 9913
239 Ga0068852_100021963 3300005616 Bacteria 5108
240 Ga0068852_100027753 3300005616 Bacteria 4619
241 Ga0068852_100031074 3300005616 Bacteria 4402
242 Ga0068852_100034952 3300005616 Bacteria 4187
243 Ga0068852_100053062 3300005616 Bacteria 3488
244 Ga0068852_100119684 3300005616 Bacteria 2408
245 Ga0068852_100220790 3300005616 Bacteria 1802
246 Ga0068852_100222790 3300005616 Bacteria 1794
247 Ga0068852_100328348 3300005616 Bacteria 1488
248 Ga0068852_100356102 3300005616 Bacteria 1430
249 Ga0068852_100399636 3300005616 Unclassified 1351
250 Ga0068852_100435479 3300005616 Bacteria 1295
251 Ga0068852_100526037 3300005616 Bacteria 1180
252 Ga0068852_100639315 3300005616 Bacteria 1071
253 Ga0068859_100180501 3300005617 Bacteria 2194
254 Ga0068864_100051914 3300005618 Bacteria 3533
255 Ga0068864_100053150 3300005618 Bacteria 3493
256 Ga0068864_100117483 3300005618 Bacteria 2374
257 Ga0068864_100340250 3300005618 Unclassified 1414
258 Ga0068866_10020801 3300005718 Bacteria 3012
259 Ga0068851_10007599 3300005834 Bacteria 4984
260 Ga0068851_10050154 3300005834 Bacteria 2119
261 Ga0068851_10085228 3300005834 Bacteria 1656
262 Ga0068851_10135629 3300005834 Bacteria 1334
263 Ga0068870_10405259 3300005840 Bacteria 888
264 Ga0068863_100029810 3300005841 Bacteria 5210
265 Ga0068863_100034080 3300005841 Bacteria 4850
266 Ga0068863_100046826 3300005841 Bacteria 4105
267 Ga0068863_100092486 3300005841 Unclassified 2869
268 Ga0068858_100013510 3300005842 Bacteria 7704
269 Ga0068858_100041013 3300005842 Bacteria 4293
270 Ga0068858_100193155 3300005842 Bacteria 1923
271 Ga0068860_100429669 3300005843 Bacteria 1310
272 Ga0068860_100615448 3300005843 Bacteria 1092
273 Ga0068862_100203121 3300005844 Bacteria 1788
274 Ga0081539_10030833 3300005985 Bacteria 3320
275 Ga0081539_10042787 3300005985 Bacteria 2634
276 Ga0081539_10101652 3300005985 Unclassified 1464
277 Ga0070717_10012042 3300006028 Bacteria 6589
278 Ga0070717_10832085 3300006028 Unclassified 840
279 Ga0075364_10664963 3300006051 Bacteria 711
280 Ga0070715_10181307 3300006163 Bacteria 1056
281 Ga0070716_100086756 3300006173 Bacteria 1883
282 Ga0075369_10199929 3300006186 Bacteria 922
283 Ga0097621_100209501 3300006237 Bacteria 1695
284 Ga0097621_101211207 3300006237 Bacteria 711
285 Ga0068871_100019390 3300006358 Bacteria 5193
286 Ga0068871_100079789 3300006358 Bacteria 2709
287 Ga0068871_100382945 3300006358 Bacteria 1250
288 Ga0075434_100785517 3300006871 Unclassified 968
289 Ga0068865_100025105 3300006881 Bacteria 3916
290 Ga0068865_100086744 3300006881 Bacteria 2260
291 Ga0068865_100256131 3300006881 Unclassified 1383
292 Ga0097620_100180502 3300006931 Bacteria 2194
293 Ga0105240_10024420 3300009093 Bacteria 7965
294 Ga0105240_10087322 3300009093 Bacteria 3819
295 Ga0105240_10393398 3300009093 Bacteria 1563
296 Ga0105245_10049870 3300009098 Bacteria 3750
297 Ga0105245_10599849 3300009098 Bacteria 1128
298 Ga0105247_10116345 3300009101 Bacteria 1727
299 Ga0105247_10210229 3300009101 Bacteria 1312
300 Ga0105241_10025711 3300009174 Bacteria 4376
301 Ga0105241_10140856 3300009174 Bacteria 1963
302 Ga0105241_10742811 3300009174 Unclassified 899
303 Ga0105242_10016709 3300009176 Bacteria 5708
304 Ga0105242_10579264 3300009176 Unclassified 1080
305 Ga0105248_10026359 3300009177 Bacteria 6465
306 Ga0105248_10038209 3300009177 Bacteria 5372
307 Ga0105248_10104194 3300009177 Bacteria 3198
308 Ga0105248_10114594 3300009177 Bacteria 3040
309 Ga0105248_10228183 3300009177 Bacteria 2096
310 Ga0105248_10490247 3300009177 Unclassified 1385
311 Ga0105248_10961257 3300009177 Bacteria 965
312 Ga0105248_11056138 3300009177 Unclassified 918
313 Ga0105237_10021095 3300009545 Bacteria 6701
314 Ga0105237_10142523 3300009545 Bacteria 2391
315 Ga0105238_10017635 3300009551 Bacteria 7257
316 Ga0105238_10135699 3300009551 Bacteria 2438
317 Ga0105238_10197199 3300009551 Bacteria 1989
318 Ga0105238_10236138 3300009551 Bacteria 1805
319 Ga0105238_10396735 3300009551 Bacteria 1372
320 Ga0105238_10439728 3300009551 Unclassified 1300
321 Ga0105238_10603691 3300009551 Bacteria 1105
322 Ga0105239_10027029 3300010375 Bacteria 6316
323 Ga0105246_10114352 3300011119 Bacteria 1988
324 Ga0105246_10158042 3300011119 Bacteria 1724
325 Ga0157373_10014198 3300013100 Bacteria 5842
326 Ga0157373_10014974 3300013100 Bacteria 5675
327 Ga0157373_10063395 3300013100 Bacteria 2617
328 Ga0157373_10109243 3300013100 Bacteria 1945
329 Ga0157373_10153236 3300013100 Bacteria 1621
330 Ga0157373_10238318 3300013100 Bacteria 1286
331 Ga0157373_10385557 3300013100 Bacteria 1003
332 Ga0157371_10121607 3300013102 Bacteria 1856
333 Ga0157371_10166613 3300013102 Unclassified 1574
334 Ga0157371_10489293 3300013102 Unclassified 908
335 Ga0157371_10996903 3300013102 Unclassified 639
336 Ga0157371_11134935 3300013102 Bacteria 600
337 Ga0157371_11249529 3300013102 Unclassified 573
338 Ga0157370_10002746 3300013104 Bacteria 21034
339 Ga0157370_10050746 3300013104 Bacteria 3964
340 Ga0157370_10069760 3300013104 Bacteria 3319
341 Ga0157370_10095543 3300013104 Bacteria 2788
342 Ga0157370_10133468 3300013104 Bacteria 2315
343 Ga0157370_10203545 3300013104 Unclassified 1836
344 Ga0157370_10476141 3300013104 Bacteria 1147
345 Ga0157370_10487620 3300013104 Unclassified 1132
346 Ga0157370_10530284 3300013104 Unclassified 1080
347 Ga0157369_10004619 3300013105 Bacteria 16188
348 Ga0157369_10023641 3300013105 Bacteria 6846
349 Ga0157369_10030800 3300013105 Bacteria 5914
350 Ga0157369_10034637 3300013105 Bacteria 5539
351 Ga0157369_10063178 3300013105 Bacteria 3990
352 Ga0157369_10102744 3300013105 Bacteria 3045
353 Ga0157369_10117807 3300013105 Bacteria 2819
354 Ga0157369_10160228 3300013105 Bacteria 2375
355 Ga0157369_10165280 3300013105 Bacteria 2334
356 Ga0157369_10186201 3300013105 Bacteria 2183
357 Ga0157369_10214914 3300013105 Bacteria 2014
358 Ga0157369_10303168 3300013105 Bacteria 1661
359 Ga0157369_10333383 3300013105 Bacteria 1576
360 Ga0157369_10850498 3300013105 Bacteria 936
361 Ga0157369_11817098 3300013105 Unclassified 619
362 Ga0157374_10021305 3300013296 Bacteria 5766
363 Ga0157374_10029007 3300013296 Bacteria 5004
364 Ga0157374_10063153 3300013296 Bacteria 3473
365 Ga0157374_10119412 3300013296 Bacteria 2543
366 Ga0157374_10293136 3300013296 Bacteria 1608
367 Ga0157374_10323900 3300013296 Bacteria 1528
368 Ga0157374_10643549 3300013296 Bacteria 1072
369 Ga0157378_10219689 3300013297 Bacteria 1806
370 Ga0157378_10480521 3300013297 Bacteria 1238
371 Ga0157378_10589598 3300013297 Bacteria 1121
372 Ga0163162_10019183 3300013306 Bacteria 6706
373 Ga0163162_10048537 3300013306 Bacteria 4254
374 Ga0163162_10287058 3300013306 Unclassified 1777
375 Ga0157372_10074479 3300013307 Bacteria 3828
376 Ga0157372_10159755 3300013307 Bacteria 2604
377 Ga0157372_10192727 3300013307 Unclassified 2361
378 Ga0157372_10206753 3300013307 Bacteria 2275
379 Ga0157372_10281459 3300013307 Bacteria 1934
380 Ga0157372_10381411 3300013307 Bacteria 1642
381 Ga0157372_10442817 3300013307 Bacteria 1514
382 Ga0157372_10448476 3300013307 Bacteria 1504
383 Ga0157372_11671906 3300013307 Bacteria 733
384 Ga0157375_10024280 3300013308 Bacteria 5607
385 Ga0157375_10052650 3300013308 Bacteria 4003
386 Ga0157375_10439554 3300013308 Bacteria 1470
387 Ga0157375_10832131 3300013308 Bacteria 1070
388 Ga0157375_11882243 3300013308 Unclassified 710
389 Ga0163163_10011842 3300014325 Bacteria 7929
390 Ga0163163_10034598 3300014325 Bacteria 4895
391 Ga0163163_10037142 3300014325 Bacteria 4737
392 Ga0157377_10085863 3300014745 Bacteria 1848
393 Ga0157379_10876979 3300014968 Bacteria 850
394 Ga0157376_10302569 3300014969 Bacteria 1514
395 Ga0206356_11797130 3300020070 Bacteria 2049
396 Ga0206355_1601105 3300020076 Bacteria 2043
397 Ga0213876_10015773 3300021384 Bacteria 3998
398 Ga0207697_10155619 3300025315 Bacteria 996
399 Ga0207656_10025258 3300025321 Bacteria 2410
400 Ga0207656_10113354 3300025321 Bacteria 1255
401 Ga0207656_10223640 3300025321 Bacteria 915
402 Ga0207642_10011605 3300025899 Bacteria 3150
403 Ga0207710_10218595 3300025900 Bacteria 945
404 Ga0207688_10207361 3300025901 Bacteria 1177
405 Ga0207680_10003692 3300025903 Bacteria 7193
406 Ga0207680_10010957 3300025903 Bacteria 4559
407 Ga0207680_10013553 3300025903 Bacteria 4193
408 Ga0207680_10112205 3300025903 Bacteria 1770
409 Ga0207647_10007000 3300025904 Bacteria 8179
410 Ga0207647_10014002 3300025904 Bacteria 5549
411 Ga0207647_10018752 3300025904 Bacteria 4670
412 Ga0207647_10022272 3300025904 Bacteria 4212
413 Ga0207647_10024348 3300025904 Bacteria 3992
414 Ga0207647_10036155 3300025904 Bacteria 3140
415 Ga0207647_10041018 3300025904 Bacteria 2912
416 Ga0207647_10048627 3300025904 Bacteria 2633
417 Ga0207647_10080059 3300025904 Bacteria 1960
418 Ga0207647_10089347 3300025904 Bacteria 1839
419 Ga0207685_10260262 3300025905 Unclassified 843
420 Ga0207699_10048389 3300025906 Bacteria 2498
421 Ga0207645_10051000 3300025907 Bacteria 2644
422 Ga0207645_10110365 3300025907 Bacteria 1780
423 Ga0207705_10000003 3300025909 Bacteria 709270
424 Ga0207705_10000493 3300025909 Bacteria 33656
425 Ga0207705_10001025 3300025909 Bacteria 22684
426 Ga0207705_10009697 3300025909 Bacteria 7003
427 Ga0207705_10019512 3300025909 Unclassified 4848
428 Ga0207705_10027645 3300025909 Bacteria 4046
429 Ga0207705_10028284 3300025909 Bacteria 3996
430 Ga0207705_10037912 3300025909 Bacteria 3449
431 Ga0207705_10042739 3300025909 Bacteria 3254
432 Ga0207705_10097045 3300025909 Bacteria 2164
433 Ga0207705_10255496 3300025909 Bacteria 1337
434 Ga0207705_10268769 3300025909 Bacteria 1304
435 Ga0207705_10356814 3300025909 Bacteria 1127
436 Ga0207707_10017647 3300025912 Bacteria 6225
437 Ga0207707_10077183 3300025912 Bacteria 2908
438 Ga0207707_10209630 3300025912 Bacteria 1698
439 Ga0207695_10008855 3300025913 Bacteria 12532
440 Ga0207695_10009362 3300025913 Bacteria 12112
441 Ga0207695_10057313 3300025913 Bacteria 4048
442 Ga0207695_10315334 3300025913 Bacteria 1454
443 Ga0207671_10024193 3300025914 Bacteria 4570
444 Ga0207671_10028319 3300025914 Bacteria 4186
445 Ga0207660_10000770 3300025917 Bacteria 21320
446 Ga0207660_10003208 3300025917 Bacteria 10700
447 Ga0207660_10382789 3300025917 Bacteria 1131
448 Ga0207660_10521874 3300025917 Unclassified 965
449 Ga0207657_10002261 3300025919 Bacteria 20877
450 Ga0207657_10003123 3300025919 Bacteria 17708
451 Ga0207657_10006107 3300025919 Bacteria 12524
452 Ga0207657_10018368 3300025919 Bacteria 6677
453 Ga0207657_10026360 3300025919 Bacteria 5343
454 Ga0207657_10040433 3300025919 Bacteria 4131
455 Ga0207657_10056349 3300025919 Bacteria 3392
456 Ga0207657_10066200 3300025919 Bacteria 3076
457 Ga0207657_10076653 3300025919 Bacteria 2820
458 Ga0207657_10109570 3300025919 Bacteria 2282
459 Ga0207657_10115485 3300025919 Bacteria 2212
460 Ga0207657_10174288 3300025919 Bacteria 1741
461 Ga0207657_10429289 3300025919 Bacteria 1038
462 Ga0207649_10006255 3300025920 Bacteria 6468
463 Ga0207649_10021154 3300025920 Bacteria 3740
464 Ga0207649_10033502 3300025920 Bacteria 3070
465 Ga0207649_10101062 3300025920 Bacteria 1908
466 Ga0207649_10135803 3300025920 Unclassified 1676
467 Ga0207649_10205843 3300025920 Bacteria 1393
468 Ga0207649_10234168 3300025920 Bacteria 1315
469 Ga0207649_10344207 3300025920 Bacteria 1102
470 Ga0207649_10525587 3300025920 Bacteria 903
471 Ga0207649_10573796 3300025920 Unclassified 865
472 Ga0207649_10603588 3300025920 Unclassified 844
473 Ga0207652_10000034 3300025921 Bacteria 138571
474 Ga0207652_10151864 3300025921 Bacteria 2074
475 Ga0207694_10024170 3300025924 Bacteria 4614
476 Ga0207694_10025296 3300025924 Bacteria 4511
477 Ga0207694_10671482 3300025924 Unclassified 873
478 Ga0207650_10087834 3300025925 Bacteria 2370
479 Ga0207650_10184267 3300025925 Unclassified 1665
480 Ga0207650_10286661 3300025925 Bacteria 1342
481 Ga0207650_10670192 3300025925 Unclassified 875
482 Ga0207659_10207770 3300025926 Bacteria 1567
483 Ga0207659_10274319 3300025926 Bacteria 1376
484 Ga0207687_10083000 3300025927 Bacteria 2319
485 Ga0207700_10037272 3300025928 Bacteria 3519
486 Ga0207700_10053420 3300025928 Bacteria 3027
487 Ga0207700_10118377 3300025928 Bacteria 2143
488 Ga0207664_10036282 3300025929 Bacteria 3810
489 Ga0207664_10252888 3300025929 Bacteria 1538
490 Ga0207644_10000747 3300025931 Bacteria 20633
491 Ga0207644_10006207 3300025931 Bacteria 7793
492 Ga0207644_10015057 3300025931 Bacteria 5188
493 Ga0207644_10016318 3300025931 Bacteria 4996
494 Ga0207644_10016718 3300025931 Bacteria 4939
495 Ga0207644_10023819 3300025931 Bacteria 4197
496 Ga0207644_10156432 3300025931 Bacteria 1768
497 Ga0207644_10702358 3300025931 Bacteria 843
498 Ga0207690_10008784 3300025932 Bacteria 5997
499 Ga0207690_10015093 3300025932 Bacteria 4677
500 Ga0207690_10060505 3300025932 Bacteria 2570
501 Ga0207690_10066579 3300025932 Bacteria 2468
502 Ga0207690_10152704 3300025932 Bacteria 1713
503 Ga0207690_10417273 3300025932 Bacteria 1073
504 Ga0207690_11017128 3300025932 Unclassified 690
505 Ga0207706_10008319 3300025933 Bacteria 9566
506 Ga0207706_10019826 3300025933 Bacteria 6045
507 Ga0207706_10037830 3300025933 Bacteria 4283
508 Ga0207706_10054006 3300025933 Bacteria 3546
509 Ga0207706_10131582 3300025933 Bacteria 2200
510 Ga0207706_10233077 3300025933 Bacteria 1610
511 Ga0207706_10254876 3300025933 Bacteria 1532
512 Ga0207706_10310147 3300025933 Bacteria 1374
513 Ga0207706_10441557 3300025933 Bacteria 1126
514 Ga0207706_10541087 3300025933 Bacteria 1003
515 Ga0207706_10578983 3300025933 Bacteria 965
516 Ga0207686_10064988 3300025934 Bacteria 2324
517 Ga0207670_10644647 3300025936 Bacteria 873
518 Ga0207669_10027200 3300025937 Bacteria 3127
519 Ga0207669_10081406 3300025937 Bacteria 2074
520 Ga0207669_10281606 3300025937 Bacteria 1254
521 Ga0207704_10032107 3300025938 Bacteria 2967
522 Ga0207704_10975778 3300025938 Unclassified 716
523 Ga0207665_10049456 3300025939 Bacteria 2825
524 Ga0207665_10132756 3300025939 Bacteria 1769
525 Ga0207691_10004673 3300025940 Bacteria 13258
526 Ga0207691_10005523 3300025940 Bacteria 12217
527 Ga0207691_10013134 3300025940 Bacteria 7928
528 Ga0207691_10269925 3300025940 Bacteria 1465
529 Ga0207711_10007240 3300025941 Bacteria 9299
530 Ga0207711_10007576 3300025941 Bacteria 9084
531 Ga0207711_10014416 3300025941 Bacteria 6564
532 Ga0207711_10020622 3300025941 Bacteria 5500
533 Ga0207711_10033837 3300025941 Bacteria 4326
534 Ga0207711_10204330 3300025941 Bacteria 1803
535 Ga0207711_10311060 3300025941 Bacteria 1454
536 Ga0207711_10637293 3300025941 Bacteria 994
537 Ga0207711_10827109 3300025941 Unclassified 862
538 Ga0207711_11044215 3300025941 Bacteria 757
539 Ga0207661_10002378 3300025944 Bacteria 12950
540 Ga0207661_10012640 3300025944 Bacteria 6145
541 Ga0207661_10594680 3300025944 Unclassified 1015
542 Ga0207661_10737127 3300025944 Unclassified 907
543 Ga0207679_10007576 3300025945 Bacteria 6892
544 Ga0207679_10020448 3300025945 Bacteria 4467
545 Ga0207679_10059420 3300025945 Bacteria 2837
546 Ga0207679_10069570 3300025945 Bacteria 2649
547 Ga0207679_10117050 3300025945 Bacteria 2114
548 Ga0207679_10125411 3300025945 Bacteria 2051
549 Ga0207679_10299494 3300025945 Bacteria 1386
550 Ga0207679_10478083 3300025945 Bacteria 1109
551 Ga0207679_10798141 3300025945 Bacteria 860
552 Ga0207667_10004710 3300025949 Bacteria 16697
553 Ga0207667_10022167 3300025949 Bacteria 7025
554 Ga0207667_10026666 3300025949 Bacteria 6306
555 Ga0207667_10078827 3300025949 Bacteria 3413
556 Ga0207667_10178420 3300025949 Bacteria 2182
557 Ga0207667_10261594 3300025949 Unclassified 1769
558 Ga0207667_10313539 3300025949 Unclassified 1602
559 Ga0207667_10790375 3300025949 Bacteria 946
560 Ga0207667_10945478 3300025949 Unclassified 851
561 Ga0207667_10948104 3300025949 Bacteria 850
562 Ga0207667_11219828 3300025949 Unclassified 731
563 Ga0207651_10012099 3300025960 Bacteria 4864
564 Ga0207651_10014049 3300025960 Bacteria 4609
565 Ga0207651_10015757 3300025960 Bacteria 4404
566 Ga0207651_10017768 3300025960 Bacteria 4210
567 Ga0207651_10029038 3300025960 Bacteria 3498
568 Ga0207651_10078455 3300025960 Bacteria 2369
569 Ga0207640_10025603 3300025981 Bacteria 3573
570 Ga0207640_10037577 3300025981 Bacteria 3048
571 Ga0207640_10095945 3300025981 Bacteria 2066
572 Ga0207640_10153773 3300025981 Bacteria 1693
573 Ga0207640_10177872 3300025981 Unclassified 1592
574 Ga0207640_10219580 3300025981 Bacteria 1454
575 Ga0207640_10522418 3300025981 Bacteria 992
576 Ga0207640_10707786 3300025981 Bacteria 864
577 Ga0207640_11116681 3300025981 Unclassified 698
578 Ga0207658_10013412 3300025986 Bacteria 5598
579 Ga0207658_10065328 3300025986 Bacteria 2732
580 Ga0207658_10309592 3300025986 Bacteria 1364
581 Ga0207658_10405856 3300025986 Bacteria 1198
582 Ga0207677_10006373 3300026023 Bacteria 6471
583 Ga0207677_10081189 3300026023 Bacteria 2326
584 Ga0207677_10150836 3300026023 Bacteria 1793
585 Ga0207677_10174809 3300026023 Bacteria 1683
586 Ga0207677_11277365 3300026023 Unclassified 674
587 Ga0207703_10012807 3300026035 Bacteria 6538
588 Ga0207703_10028733 3300026035 Bacteria 4386
589 Ga0207703_10112271 3300026035 Bacteria 2328
590 Ga0207703_10288547 3300026035 Unclassified 1492
591 Ga0207639_10000923 3300026041 Bacteria 19909
592 Ga0207639_10001159 3300026041 Bacteria 17877
593 Ga0207639_10706898 3300026041 Bacteria 935
594 Ga0207639_10866551 3300026041 Bacteria 843
595 Ga0207639_10917004 3300026041 Unclassified 819
596 Ga0207678_10006063 3300026067 Bacteria 10752
597 Ga0207678_10009081 3300026067 Bacteria 8752
598 Ga0207678_10046333 3300026067 Bacteria 3760
599 Ga0207678_10053830 3300026067 Bacteria 3467
600 Ga0207678_10055524 3300026067 Bacteria 3412
601 Ga0207678_10138920 3300026067 Bacteria 2073
602 Ga0207678_10143449 3300026067 Bacteria 2038
603 Ga0207678_10164425 3300026067 Unclassified 1895
604 Ga0207678_10558145 3300026067 Unclassified 1002
605 Ga0207678_10617858 3300026067 Bacteria 951
606 Ga0207702_10002063 3300026078 Bacteria 19455
607 Ga0207702_10019681 3300026078 Bacteria 5588
608 Ga0207702_10025645 3300026078 Bacteria 4893
609 Ga0207702_10059906 3300026078 Bacteria 3244
610 Ga0207702_10060514 3300026078 Bacteria 3229
611 Ga0207702_10074449 3300026078 Bacteria 2931
612 Ga0207702_10177756 3300026078 Bacteria 1957
613 Ga0207702_10221564 3300026078 Bacteria 1763
614 Ga0207702_10244287 3300026078 Unclassified 1683
615 Ga0207702_10330691 3300026078 Bacteria 1453
616 Ga0207641_10073824 3300026088 Bacteria 2940
617 Ga0207641_10710167 3300026088 Bacteria 990
618 Ga0207648_10008762 3300026089 Bacteria 9748
619 Ga0207648_10010578 3300026089 Bacteria 8729
620 Ga0207648_10088236 3300026089 Bacteria 2708
621 Ga0207648_10348933 3300026089 Bacteria 1334
622 Ga0207676_10033010 3300026095 Bacteria 3907
623 Ga0207676_10093212 3300026095 Bacteria 2479
624 Ga0207676_10233662 3300026095 Bacteria 1645
625 Ga0207676_10277997 3300026095 Bacteria 1519
626 Ga0207674_10006843 3300026116 Bacteria 13372
627 Ga0207674_10012374 3300026116 Bacteria 9538
628 Ga0207674_10077107 3300026116 Bacteria 3339
629 Ga0207674_10080912 3300026116 Bacteria 3251
630 Ga0207674_10115084 3300026116 Bacteria 2661
631 Ga0207674_10157321 3300026116 Bacteria 2228
632 Ga0207674_10193343 3300026116 Bacteria 1984
633 Ga0207674_10818294 3300026116 Unclassified 899
634 Ga0207674_11400548 3300026116 Unclassified 668
635 Ga0207683_10014680 3300026121 Bacteria 6670
636 Ga0207683_10021530 3300026121 Bacteria 5522
637 Ga0207683_10222611 3300026121 Bacteria 1719
638 Ga0207698_10000896 3300026142 Bacteria 17309
639 Ga0207698_10003271 3300026142 Bacteria 9734
640 Ga0207698_10006737 3300026142 Bacteria 7176
641 Ga0207698_10008977 3300026142 Bacteria 6344
642 Ga0207698_10022783 3300026142 Bacteria 4362
643 Ga0207698_10035355 3300026142 Bacteria 3654
644 Ga0207698_10043850 3300026142 Bacteria 3355
645 Ga0207698_10216528 3300026142 Bacteria 1727
646 Ga0207698_10219416 3300026142 Unclassified 1717
647 Ga0207698_10310425 3300026142 Bacteria 1472
648 Ga0207698_10535537 3300026142 Bacteria 1145
649 Ga0207698_10746658 3300026142 Unclassified 977
650 Ga0207698_10975881 3300026142 Unclassified 857
651 Ga0207698_11139976 3300026142 Unclassified 793
652 Ga0207698_12055493 3300026142 Unclassified 585
653 Ga0268266_10000767 3300028379 Bacteria 42918
654 Ga0268266_10029135 3300028379 Bacteria 4693
655 Ga0268266_10045135 3300028379 Bacteria 3769
656 Ga0268266_10212037 3300028379 Bacteria 1776
657 Ga0268266_10665544 3300028379 Bacteria 1002
658 Ga0268266_11375540 3300028379 Unclassified 681
659 Ga0268265_10363928 3300028380 Bacteria 1325
660 Ga0268264_10266424 3300028381 Bacteria 1599
661 Ga0268264_10399541 3300028381 Bacteria 1320
662 Ga0307408_100039656 3300031548 Bacteria 3331
663 Ga0307405_10148856 3300031731 Bacteria 1643
664 Ga0307413_10014680 3300031824 Bacteria 3988
665 Ga0307413_10035173 3300031824 Bacteria 2870
666 Ga0307410_10010532 3300031852 Bacteria 5244
667 Ga0307410_10031141 3300031852 Bacteria 3419
668 Ga0307410_10128545 3300031852 Bacteria 1858
669 Ga0307406_10101720 3300031901 Bacteria 1959
670 Ga0307406_10547227 3300031901 Bacteria 946
671 Ga0307407_10105882 3300031903 Bacteria 1755
672 Ga0307407_10218692 3300031903 Bacteria 1287
673 Ga0307412_10154743 3300031911 Bacteria 1696
674 Ga0307409_100031493 3300031995 Bacteria 3829
675 Ga0307409_100115218 3300031995 Bacteria 2262
676 Ga0307409_100148144 3300031995 Bacteria 2033
677 Ga0307416_100020756 3300032002 Bacteria 4697
678 Ga0307416_100023349 3300032002 Bacteria 4487
679 Ga0307414_10009432 3300032004 Bacteria 5607
680 Ga0307414_10040743 3300032004 Bacteria 3139
681 Ga0307414_10391625 3300032004 Bacteria 1204
682 Ga0307411_10007591 3300032005 Bacteria 5543
683 Ga0307411_10024440 3300032005 Bacteria 3602
684 Ga0307411_10119092 3300032005 Bacteria 1906
685 Ga0307415_100004410 3300032126 Bacteria 7295
686 Ga0307415_100066475 3300032126 Bacteria 2516
687 Ga0373923_0112263 3300035111 Bacteria 1211
688 Ga0373954_0049544 3300035118 Bacteria 1969
689 Ga0373956_0097486 3300035119 Bacteria 1361
690 Ga0373960_0244112 3300035121 Unclassified 650
691 Ga0373946_0050901 3300035171 Bacteria 1732
692 Ga0373931_0094472 3300035691 Bacteria 1672
693 Ga0373935_0153284 3300035692 Bacteria 1565
694 Ga0373933_0014251 3300035724 Unclassified 4417
695 Ga0373933_0653287 3300035724 Unclassified 691
696 Ga0373947_0577649 3300035725 Unclassified 766
697 Ga0373937_0004829 3300036401 Bacteria 11457
698 Ga0395899_0021048 3300037312 Bacteria 4946
699 Ga0395899_0036604 3300037312 Bacteria 3680
700 Ga0395899_0042007 3300037312 Bacteria 3414
701 Ga0395899_0048839 3300037312 Bacteria 3147
702 Ga0395899_0050645 3300037312 Bacteria 3083
703 Ga0395899_0051337 3300037312 Bacteria 3060
704 Ga0395899_0053501 3300037312 Bacteria 2989
705 Ga0395899_0090055 3300037312 Bacteria 2224
706 Ga0395899_0102274 3300037312 Bacteria 2067
707 Ga0395899_0162413 3300037312 Bacteria 1577
708 Ga0395899_0194735 3300037312 Unclassified 1417
709 Ga0395899_0213622 3300037312 Bacteria 1339
710 Ga0395899_0285816 3300037312 Unclassified 1120
711 Ga0395899_0292103 3300037312 Unclassified 1105
712 Ga0395900_0003085 3300037418 Bacteria 18103
713 Ga0395900_0009276 3300037418 Bacteria 10089
714 Ga0395900_0010484 3300037418 Bacteria 9479
715 Ga0395900_0030431 3300037418 Bacteria 5544
716 Ga0395900_0030498 3300037418 Bacteria 5536
717 Ga0395900_0050997 3300037418 Bacteria 4262
718 Ga0395900_0053926 3300037418 Unclassified 4139
719 Ga0395900_0062637 3300037418 Bacteria 3823
720 Ga0395900_0073419 3300037418 Bacteria 3517
721 Ga0395900_0088171 3300037418 Bacteria 3189
722 Ga0395900_0102036 3300037418 Bacteria 2947
723 Ga0395900_0115343 3300037418 Bacteria 2756
724 Ga0395900_0130385 3300037418 Bacteria 2577
725 Ga0395900_0131903 3300037418 Bacteria 2560
726 Ga0395900_0133413 3300037418 Bacteria 2544
727 Ga0395900_0164577 3300037418 Bacteria 2261
728 Ga0395900_0172571 3300037418 Bacteria 2200
729 Ga0395900_0262255 3300037418 Bacteria 1725
730 Ga0395900_0308123 3300037418 Unclassified 1567
731 Ga0395900_0415743 3300037418 Unclassified 1306
732 Ga0395900_0505633 3300037418 Unclassified 1158
733 Ga0395900_0542483 3300037418 Unclassified 1108
734 Ga0395900_0572365 3300037418 Bacteria 1072
735 Ga0395900_0694432 3300037418 Unclassified 951
736 Ga0395900_1028220 3300037418 Unclassified 743
737 Ga0395900_1333342 3300037418 Unclassified 631
738 Ga0395898_0011721 3300037466 Bacteria 9089
739 Ga0395898_0015329 3300037466 Bacteria 7861
740 Ga0395898_0019188 3300037466 Bacteria 6961
741 Ga0395898_0025785 3300037466 Bacteria 5920
742 Ga0395898_0053789 3300037466 Bacteria 3930
743 Ga0395898_0055306 3300037466 Bacteria 3870
744 Ga0395898_0087550 3300037466 Bacteria 3000
745 Ga0395898_0178684 3300037466 Unclassified 2028
746 Ga0395898_0217297 3300037466 Bacteria 1823
747 Ga0395898_0226204 3300037466 Bacteria 1784
748 Ga0395898_0337753 3300037466 Bacteria 1436
749 Ga0395898_0381880 3300037466 Bacteria 1343
750 Ga0395898_0678779 3300037466 Bacteria 972
751 Ga0395898_0689444 3300037466 Unclassified 963
752 Ga0395905_0001169 3300037471 Bacteria 32772
753 Ga0395905_0001983 3300037471 Bacteria 23389
754 Ga0395905_0006012 3300037471 Bacteria 12289
755 Ga0395905_0006135 3300037471 Bacteria 12132
756 Ga0395905_0008256 3300037471 Bacteria 10285
757 Ga0395905_0028510 3300037471 Bacteria 5263
758 Ga0395905_0033050 3300037471 Bacteria 4863
759 Ga0395905_0033437 3300037471 Bacteria 4830
760 Ga0395905_0034571 3300037471 Bacteria 4746
761 Ga0395905_0037838 3300037471 Bacteria 4527
762 Ga0395905_0045884 3300037471 Bacteria 4099
763 Ga0395905_0051435 3300037471 Bacteria 3859
764 Ga0395905_0057078 3300037471 Bacteria 3651
765 Ga0395905_0062402 3300037471 Bacteria 3486
766 Ga0395905_0084238 3300037471 Bacteria 2978
767 Ga0395905_0092392 3300037471 Bacteria 2838
768 Ga0395905_0128774 3300037471 Bacteria 2380
769 Ga0395905_0144847 3300037471 Bacteria 2235
770 Ga0395905_0212009 3300037471 Bacteria 1814
771 Ga0395905_0294178 3300037471 Bacteria 1511
772 Ga0395905_0413108 3300037471 Bacteria 1245
773 Ga0395905_0433132 3300037471 Bacteria 1212
774 Ga0395905_0543099 3300037471 Unclassified 1063
775 Ga0395905_0647645 3300037471 Bacteria 958
776 Ga0395905_0665994 3300037471 Bacteria 943
777 Ga0395905_0667690 3300037471 Bacteria 941
778 Ga0395905_0945837 3300037471 Unclassified 764
779 Ga0395905_0999755 3300037471 Bacteria 739
780 Ga0395905_1223661 3300037471 Unclassified 654
781 Ga0395901_0006031 3300038443 Bacteria 12280
782 Ga0395901_0028506 3300038443 Bacteria 5742
783 Ga0395901_0050004 3300038443 Bacteria 4344
784 Ga0395901_0067878 3300038443 Bacteria 3714
785 Ga0395901_0082714 3300038443 Bacteria 3354
786 Ga0395901_0101199 3300038443 Bacteria 3024
787 Ga0395901_0106570 3300038443 Bacteria 2941
788 Ga0395901_0115762 3300038443 Bacteria 2816
789 Ga0395901_0116588 3300038443 Bacteria 2805
790 Ga0395901_0121033 3300038443 Bacteria 2750
791 Ga0395901_0125924 3300038443 Bacteria 2692
792 Ga0395901_0130740 3300038443 Bacteria 2638
793 Ga0395901_0133252 3300038443 Bacteria 2611
794 Ga0395901_0175992 3300038443 Bacteria 2244
795 Ga0395901_0230494 3300038443 Bacteria 1933
796 Ga0395901_0319888 3300038443 Bacteria 1605
797 Ga0395901_0347379 3300038443 Bacteria 1531
798 Ga0395901_0440675 3300038443 Unclassified 1333
799 Ga0395901_0495449 3300038443 Bacteria 1244
800 Ga0395901_0508607 3300038443 Unclassified 1225
801 Ga0395901_0554006 3300038443 Unclassified 1165
802 Ga0395901_0602161 3300038443 Bacteria 1108
803 Ga0395901_0642761 3300038443 Bacteria 1065
804 Ga0395901_0777050 3300038443 Bacteria 948
805 Ga0395901_0902722 3300038443 Bacteria 865
806 Ga0436365_0481817 3300039437 Bacteria 15552
807 Ga0439448_0004598 3300042005 Bacteria 3902
808 Ga0439458_0000480 3300042157 Bacteria 10247
809 Ga0439458_0001207 3300042157 Bacteria 6549
810 Ga0439458_0007205 3300042157 Bacteria 2475
811 Ga0466969_0053154 3300044656 Bacteria 1988
812 Ga0466972_0119841 3300044658 Bacteria 1241
813 Ga0466966_0000001 3300044684 Bacteria 410376
814 Ga0466966_0010135 3300044684 Bacteria 6252
815 Ga0466966_0045027 3300044684 Bacteria 2822
816 Ga0466966_0050485 3300044684 Bacteria 2645
817 Ga0466966_0102144 3300044684 Bacteria 1772
818 Ga0466966_0705909 3300044684 Unclassified 608
819 Ga0466961_0009876 3300044693 Bacteria 6080
820 Ga0466961_0168457 3300044693 Bacteria 1363
821 Ga0466963_0006272 3300044694 Bacteria 7029
822 Ga0466963_0010178 3300044694 Bacteria 5686
823 Ga0466963_0150551 3300044694 Unclassified 1615
824 Ga0466963_0378012 3300044694 Bacteria 998
825 Ga0466963_0467005 3300044694 Unclassified 890
826 Ga0466964_0059314 3300044706 Bacteria 1589
827 Ga0466964_0347434 3300044706 Unclassified 761
828 Ga0466971_0064787 3300044719 Unclassified 1654
829 Ga0466971_0241360 3300044719 Unclassified 859
830 Ga0466970_0008343 3300044765 Bacteria 5211
831 Ga0466970_0033889 3300044765 Bacteria 2701
832 Ga0466957_0000183 3300044842 Bacteria 28401
833 Ga0466957_0008937 3300044842 Bacteria 5710
834 Ga0466957_0011371 3300044842 Bacteria 5133
835 Ga0466957_0128657 3300044842 Bacteria 1620
836 Ga0466957_0172057 3300044842 Bacteria 1411
837 Ga0466957_0469958 3300044842 Bacteria 869
838 Ga0466957_0480373 3300044842 Bacteria 859
839 Ga0466957_0560413 3300044842 Unclassified 797
840 Ga0466957_0575264 3300044842 Unclassified 787
841 Ga0466960_0013146 3300044901 Bacteria 3510
842 Ga0466960_0158182 3300044901 Bacteria 1215
843 Ga0466959_0004304 3300045049 Bacteria 9503
844 Ga0466959_0083054 3300045049 Bacteria 2307
845 Ga0466959_0089032 3300045049 Bacteria 2218
846 Ga0466959_0103432 3300045049 Bacteria 2037
847 Ga0466959_0132379 3300045049 Bacteria 1767
848 Ga0466958_0010395 3300045836 Bacteria 5211
849 Ga0466958_0047500 3300045836 Bacteria 2592
850 Ga0466958_0085191 3300045836 Bacteria 1949
851 Ga0466958_0130082 3300045836 Unclassified 1580
852 Ga0466958_0154575 3300045836 Bacteria 1448
853 Ga0466958_0221517 3300045836 Unclassified 1207
854 Ga0466967_0007477 3300045976 Bacteria 7884
855 Ga0466967_0011797 3300045976 Bacteria 6644
856 Ga0466967_0062028 3300045976 Bacteria 3318
857 Ga0466967_0113070 3300045976 Bacteria 2497
858 Ga0466967_0118782 3300045976 Bacteria 2439
859 Ga0466967_0134561 3300045976 Bacteria 2298
860 Ga0466967_0320165 3300045976 Viruses 1495
861 Ga0466967_0402360 3300045976 Bacteria 1332
862 Ga0466967_0520729 3300045976 Bacteria 1168
863 Ga0466967_0578979 3300045976 Bacteria 1106
864 Ga0466967_0724920 3300045976 Unclassified 985
865 Ga0466967_0745784 3300045976 Bacteria 971
866 Ga0466967_0778481 3300045976 Unclassified 949
867 Ga0466967_0786938 3300045976 Unclassified 944
868 Ga0466967_0996193 3300045976 Unclassified 834
869 Ga0495663_0125449 3300046525 Unclassified 862
870 Ga0495586_0392618 3300046535 Unclassified 798
871 Ga0495598_0002244 3300046537 Bacteria 3976
872 Ga0495621_0000972 3300046539 Bacteria 7305
873 Ga0495633_0042594 3300046558 Bacteria 2155
874 Ga0495668_0077275 3300046616 Bacteria 1827
875 Ga0495623_0064093 3300046679 Bacteria 2300
876 Ga0495669_0029165 3300046684 Bacteria 2419
877 Ga0495669_0080319 3300046684 Bacteria 1496
878 Ga0495669_0243949 3300046684 Bacteria 862
879 Ga0495670_0000071 3300046691 Bacteria 45180
880 Ga0495600_0265660 3300046809 Bacteria 1089
881 Ga0495602_0043086 3300048088 Unclassified 4107
882 Ga0496100_0083922 3300048903 Bacteria 2158
883 Ga0496101_0115149 3300048904 Bacteria 2027
884 Ga0496101_0144671 3300048904 Bacteria 1815
885 Ga0496101_0216755 3300048904 Unclassified 1484
886 Ga0496102_0063070 3300048905 Bacteria 3393
887 Ga0496102_0673775 3300048905 Bacteria 957
888 Ga0496104_0065814 3300048907 Bacteria 3440
889 Ga0496105_0039333 3300048908 Bacteria 3898
890 Ga0496105_0137137 3300048908 Bacteria 2015
891 Ga0496106_0017617 3300048909 Bacteria 5284
892 Ga0496106_0705234 3300048909 Unclassified 804
893 Ga0496107_0011494 3300048910 Bacteria 6167
894 Ga0496107_0189121 3300048910 Unclassified 1529
895 Ga0496107_0316958 3300048910 Bacteria 1160
896 Ga0496108_0006177 3300048911 Bacteria 9691
897 Ga0496108_0034647 3300048911 Bacteria 4194
898 Ga0496108_0046784 3300048911 Bacteria 3615
899 Ga0496109_0021950 3300048912 Bacteria 5653
900 Ga0496109_0034955 3300048912 Bacteria 4530
901 Ga0496109_0068968 3300048912 Bacteria 3241
902 Ga0496109_0219805 3300048912 Bacteria 1787
903 Ga0496110_0013619 3300048913 Bacteria 6732
904 Ga0496110_0427452 3300048913 Unclassified 1207
905 Ga0496111_0005193 3300048914 Bacteria 8304
906 Ga0496111_0007572 3300048914 Bacteria 7126
907 Ga0496111_0029259 3300048914 Bacteria 3911
908 Ga0496112_0012266 3300048915 Bacteria 7870
909 Ga0496112_0054746 3300048915 Bacteria 3921
910 Ga0496112_0095037 3300048915 Bacteria 2951
911 Ga0496112_0163559 3300048915 Bacteria 2191
912 Ga0496112_0263820 3300048915 Bacteria 1671
913 Ga0496112_0264652 3300048915 Bacteria 1668
914 Ga0496112_0886951 3300048915 Bacteria 814
915 Ga0496113_0012069 3300048916 Bacteria 5795
916 Ga0496113_0120879 3300048916 Bacteria 2047
917 Ga0496113_0381671 3300048916 Unclassified 1131
918 Ga0496113_0536789 3300048916 Unclassified 938
919 Ga0496113_0695847 3300048916 Bacteria 811
920 Ga0496114_0012137 3300048917 Bacteria 6894
921 Ga0496114_0215334 3300048917 Bacteria 1685
922 Ga0496114_0358059 3300048917 Bacteria 1291
923 Ga0496115_0015819 3300048918 Bacteria 5729
924 nmdc:mga0n895_901262_c1 3300050512 Unclassified 870
925 Ga0587090_014290 3300059510 Unclassified 1159
926 Ga0466962_0006344 3300061719 Bacteria 5677
927 Ga0466962_0013258 3300061719 Bacteria 3964
928 Ga0466962_0015820 3300061719 Bacteria 3640
929 Ga0466962_0044372 3300061719 Bacteria 2126

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_101235960 Ga0070659_1012359601 147
2 3300005366 Ga0070659_100730976 Ga0070659_1007309762 148
3 3300025932 Ga0207690_11017128 Ga0207690_110171282 148
4 3300005339 Ga0070660_100031936 Ga0070660_1000319365 149
5 3300005614 Ga0068856_101376511 Ga0068856_1013765111 149
6 3300005616 Ga0068852_100399636 Ga0068852_1003996362 149
7 3300025919 Ga0207657_10056349 Ga0207657_100563495 149
8 3300026142 Ga0207698_10746658 Ga0207698_107466582 149
9 3300026078 Ga0207702_10019681 Ga0207702_100196817 150
10 3300005327 Ga0070658_10318734 Ga0070658_103187342 151
11 3300005530 Ga0070679_100079195 Ga0070679_1000791951 151
12 3300025909 Ga0207705_10037912 Ga0207705_100379125 151
13 3300005327 Ga0070658_10012256 Ga0070658_100122567 153
14 3300005334 Ga0068869_100315233 Ga0068869_1003152332 153
15 3300005335 Ga0070666_10173313 Ga0070666_101733132 153
16 3300005338 Ga0068868_100078620 Ga0068868_1000786202 153
17 3300005339 Ga0070660_100117222 Ga0070660_1001172223 153
18 3300005354 Ga0070675_100257690 Ga0070675_1002576902 153
19 3300005366 Ga0070659_100381757 Ga0070659_1003817572 153
20 3300005367 Ga0070667_100029232 Ga0070667_1000292325 153
21 3300005457 Ga0070662_100122792 Ga0070662_1001227922 153
22 3300005459 Ga0068867_100758623 Ga0068867_1007586231 153
23 3300005543 Ga0070672_100427333 Ga0070672_1004273332 153
24 3300005544 Ga0070686_100538375 Ga0070686_1005383751 153
25 3300005548 Ga0070665_100680549 Ga0070665_1006805492 153
26 3300005563 Ga0068855_100178434 Ga0068855_1001784344 153
27 3300005614 Ga0068856_100067154 Ga0068856_1000671545 153
28 3300005616 Ga0068852_100526037 Ga0068852_1005260372 153
29 3300005617 Ga0068859_100180501 Ga0068859_1001805012 153
30 3300005618 Ga0068864_100053150 Ga0068864_1000531504 153
31 3300005841 Ga0068863_100034080 Ga0068863_1000340802 153
32 3300005843 Ga0068860_100429669 Ga0068860_1004296692 153
33 3300006163 Ga0070715_10181307 Ga0070715_101813072 153
34 3300006358 Ga0068871_100019390 Ga0068871_1000193903 153
35 3300006881 Ga0068865_100025105 Ga0068865_1000251056 153
36 3300006931 Ga0097620_100180502 Ga0097620_1001805022 153
37 3300009093 Ga0105240_10393398 Ga0105240_103933982 153
38 3300009098 Ga0105245_10049870 Ga0105245_100498706 153
39 3300009101 Ga0105247_10116345 Ga0105247_101163452 153
40 3300009174 Ga0105241_10742811 Ga0105241_107428111 153
41 3300009176 Ga0105242_10016709 Ga0105242_100167093 153
42 3300009551 Ga0105238_10603691 Ga0105238_106036912 153
43 3300013105 Ga0157369_10034637 Ga0157369_100346375 153
44 3300013296 Ga0157374_10119412 Ga0157374_101194122 153
45 3300013297 Ga0157378_10589598 Ga0157378_105895982 153
46 3300013308 Ga0157375_10439554 Ga0157375_104395542 153
47 3300014325 Ga0163163_10037142 Ga0163163_100371424 153
48 3300014745 Ga0157377_10085863 Ga0157377_100858632 153
49 3300014968 Ga0157379_10876979 Ga0157379_108769791 153
50 3300025315 Ga0207697_10155619 Ga0207697_101556192 153
51 3300025321 Ga0207656_10223640 Ga0207656_102236402 153
52 3300025900 Ga0207710_10218595 Ga0207710_102185951 153
53 3300025901 Ga0207688_10207361 Ga0207688_102073611 153
54 3300025903 Ga0207680_10003692 Ga0207680_100036923 153
55 3300025905 Ga0207685_10260262 Ga0207685_102602621 153
56 3300025919 Ga0207657_10066200 Ga0207657_100662003 153
57 3300025920 Ga0207649_10603588 Ga0207649_106035881 153
58 3300025924 Ga0207694_10671482 Ga0207694_106714822 153
59 3300025925 Ga0207650_10670192 Ga0207650_106701922 153
60 3300025926 Ga0207659_10274319 Ga0207659_102743192 153
61 3300025927 Ga0207687_10083000 Ga0207687_100830002 153
62 3300025931 Ga0207644_10015057 Ga0207644_100150576 153
63 3300025933 Ga0207706_10054006 Ga0207706_100540063 153
64 3300025934 Ga0207686_10064988 Ga0207686_100649882 153
65 3300025937 Ga0207669_10281606 Ga0207669_102816062 153
66 3300025938 Ga0207704_10032107 Ga0207704_100321072 153
67 3300025940 Ga0207691_10005523 Ga0207691_100055235 153
68 3300025941 Ga0207711_10014416 Ga0207711_100144166 153
69 3300025949 Ga0207667_10945478 Ga0207667_109454782 153
70 3300025960 Ga0207651_10014049 Ga0207651_100140492 153
71 3300026023 Ga0207677_10150836 Ga0207677_101508362 153
72 3300026035 Ga0207703_10028733 Ga0207703_100287331 153
73 3300026078 Ga0207702_10221564 Ga0207702_102215642 153
74 3300026088 Ga0207641_10073824 Ga0207641_100738244 153
75 3300026089 Ga0207648_10008762 Ga0207648_100087625 153
76 3300026095 Ga0207676_10233662 Ga0207676_102336622 153
77 3300026116 Ga0207674_10080912 Ga0207674_100809122 153
78 3300026121 Ga0207683_10021530 Ga0207683_100215304 153
79 3300026142 Ga0207698_10216528 Ga0207698_102165282 153
80 3300028379 Ga0268266_10665544 Ga0268266_106655442 153
81 3300028381 Ga0268264_10399541 Ga0268264_103995412 153
82 3300035691 Ga0373931_0094472 Ga0373931_0094472_17_535 153
83 3300048903 Ga0496100_0083922 Ga0496100_0083922_606_1124 153
84 3300048904 Ga0496101_0115149 Ga0496101_0115149_752_1270 153
85 3300048905 Ga0496102_0063070 Ga0496102_0063070_2735_3253 153
86 3300048907 Ga0496104_0065814 Ga0496104_0065814_456_974 153
87 3300048908 Ga0496105_0039333 Ga0496105_0039333_15_533 153
88 3300048909 Ga0496106_0017617 Ga0496106_0017617_4541_5059 153
89 3300048910 Ga0496107_0316958 Ga0496107_0316958_421_939 153
90 3300048911 Ga0496108_0034647 Ga0496108_0034647_3186_3704 153
91 3300048912 Ga0496109_0021950 Ga0496109_0021950_2893_3411 153
92 3300048913 Ga0496110_0013619 Ga0496110_0013619_4808_5326 153
93 3300048914 Ga0496111_0007572 Ga0496111_0007572_3734_4252 153
94 3300048915 Ga0496112_0163559 Ga0496112_0163559_1192_1710 153
95 3300048916 Ga0496113_0012069 Ga0496113_0012069_1473_1991 153
96 3300048917 Ga0496114_0358059 Ga0496114_0358059_346_864 153
97 3300005337 Ga0070682_101026883 Ga0070682_1010268831 154
98 3300005344 Ga0070661_101188688 Ga0070661_1011886881 154
99 3300005457 Ga0070662_100244743 Ga0070662_1002447432 154
100 3300005458 Ga0070681_10242084 Ga0070681_102420842 154
101 3300005539 Ga0068853_100275758 Ga0068853_1002757581 154
102 3300005563 Ga0068855_100160692 Ga0068855_1001606922 154
103 3300005578 Ga0068854_100279508 Ga0068854_1002795082 154
104 3300009551 Ga0105238_10197199 Ga0105238_101971992 154
105 3300025321 Ga0207656_10113354 Ga0207656_101133542 154
106 3300025904 Ga0207647_10041018 Ga0207647_100410184 154
107 3300025933 Ga0207706_10254876 Ga0207706_102548762 154
108 3300025981 Ga0207640_11116681 Ga0207640_111166811 154
109 3300026041 Ga0207639_10917004 Ga0207639_109170042 154
110 3300026067 Ga0207678_10138920 Ga0207678_101389202 154
111 3300044842 Ga0466957_0560413 Ga0466957_0560413_266_787 154
112 3300013104 Ga0157370_10203545 Ga0157370_102035452 156
113 3300037418 Ga0395900_0694432 Ga0395900_0694432_72_593 158
114 3300037466 Ga0395898_0087550 Ga0395898_0087550_189_710 158
115 3300038443 Ga0395901_0130740 Ga0395901_0130740_456_977 158
116 3300048915 Ga0496112_0095037 Ga0496112_0095037_233_751 159
117 3300005327 Ga0070658_10009104 Ga0070658_1000910412 162
118 3300005339 Ga0070660_100057071 Ga0070660_1000570712 162
119 3300005366 Ga0070659_100009360 Ga0070659_1000093604 162
120 3300005455 Ga0070663_100215665 Ga0070663_1002156652 162
121 3300005616 Ga0068852_100639315 Ga0068852_1006393152 162
122 3300005834 Ga0068851_10007599 Ga0068851_100075991 162
123 3300025909 Ga0207705_10009697 Ga0207705_100096973 162
124 3300025919 Ga0207657_10018368 Ga0207657_100183683 162
125 3300025945 Ga0207679_10117050 Ga0207679_101170502 162
126 3300026067 Ga0207678_10617858 Ga0207678_106178582 162
127 3300031548 Ga0307408_100039656 Ga0307408_1000396563 167
128 3300031824 Ga0307413_10014680 Ga0307413_100146802 167
129 3300031852 Ga0307410_10128545 Ga0307410_101285452 167
130 3300031901 Ga0307406_10101720 Ga0307406_101017202 167
131 3300031903 Ga0307407_10218692 Ga0307407_102186921 167
132 3300031911 Ga0307412_10154743 Ga0307412_101547432 167
133 3300031995 Ga0307409_100148144 Ga0307409_1001481442 167
134 3300032002 Ga0307416_100023349 Ga0307416_1000233493 167
135 3300032004 Ga0307414_10009432 Ga0307414_100094323 167
136 3300032005 Ga0307411_10024440 Ga0307411_100244402 167
137 3300037312 Ga0395899_0050645 Ga0395899_0050645_1690_2208 167
138 3300037418 Ga0395900_0009276 Ga0395900_0009276_8328_8846 167
139 3300038443 Ga0395901_0050004 Ga0395901_0050004_1853_2371 167
140 3300037418 Ga0395900_0505633 Ga0395900_0505633_453_971 168
141 3300005329 Ga0070683_100542599 Ga0070683_1005425991 170
142 3300005339 Ga0070660_100114235 Ga0070660_1001142353 170
143 3300005366 Ga0070659_100004452 Ga0070659_1000044523 170
144 3300005434 Ga0070709_10182391 Ga0070709_101823911 170
145 3300005435 Ga0070714_100077427 Ga0070714_1000774274 170
146 3300005435 Ga0070714_100515657 Ga0070714_1005156572 170
147 3300005436 Ga0070713_100037787 Ga0070713_1000377875 170
148 3300005455 Ga0070663_100111579 Ga0070663_1001115792 170
149 3300005455 Ga0070663_100117144 Ga0070663_1001171442 170
150 3300005563 Ga0068855_100200788 Ga0068855_1002007882 170
151 3300005563 Ga0068855_100217838 Ga0068855_1002178382 170
152 3300005577 Ga0068857_100190905 Ga0068857_1001909053 170
153 3300005578 Ga0068854_100033456 Ga0068854_1000334565 170
154 3300005614 Ga0068856_100053557 Ga0068856_1000535572 170
155 3300005614 Ga0068856_100107491 Ga0068856_1001074912 170
156 3300005614 Ga0068856_100543609 Ga0068856_1005436092 170
157 3300005614 Ga0068856_100706562 Ga0068856_1007065622 170
158 3300005616 Ga0068852_100004443 Ga0068852_1000044438 170
159 3300005616 Ga0068852_100222790 Ga0068852_1002227902 170
160 3300005834 Ga0068851_10135629 Ga0068851_101356292 170
161 3300005985 Ga0081539_10042787 Ga0081539_100427872 170
162 3300006173 Ga0070716_100086756 Ga0070716_1000867563 170
163 3300009093 Ga0105240_10024420 Ga0105240_100244207 170
164 3300009174 Ga0105241_10140856 Ga0105241_101408563 170
165 3300009551 Ga0105238_10439728 Ga0105238_104397282 170
166 3300013100 Ga0157373_10109243 Ga0157373_101092432 170
167 3300013100 Ga0157373_10153236 Ga0157373_101532362 170
168 3300013102 Ga0157371_10121607 Ga0157371_101216072 170
169 3300013102 Ga0157371_10489293 Ga0157371_104892931 170
170 3300013104 Ga0157370_10133468 Ga0157370_101334682 170
171 3300013104 Ga0157370_10476141 Ga0157370_104761412 170
172 3300013104 Ga0157370_10530284 Ga0157370_105302842 170
173 3300013105 Ga0157369_10023641 Ga0157369_100236412 170
174 3300013105 Ga0157369_10030800 Ga0157369_100308005 170
175 3300013105 Ga0157369_10063178 Ga0157369_100631785 170
176 3300013105 Ga0157369_10160228 Ga0157369_101602282 170
177 3300013296 Ga0157374_10063153 Ga0157374_100631532 170
178 3300013307 Ga0157372_10381411 Ga0157372_103814112 170
179 3300013307 Ga0157372_10448476 Ga0157372_104484762 170
180 3300025904 Ga0207647_10018752 Ga0207647_100187524 170
181 3300025906 Ga0207699_10048389 Ga0207699_100483892 170
182 3300025909 Ga0207705_10000003 Ga0207705_10000003475 170
183 3300025913 Ga0207695_10009362 Ga0207695_100093625 170
184 3300025913 Ga0207695_10057313 Ga0207695_100573134 170
185 3300025919 Ga0207657_10109570 Ga0207657_101095702 170
186 3300025920 Ga0207649_10234168 Ga0207649_102341682 170
187 3300025928 Ga0207700_10118377 Ga0207700_101183774 170
188 3300025929 Ga0207664_10252888 Ga0207664_102528882 170
189 3300025932 Ga0207690_10008784 Ga0207690_100087848 170
190 3300025939 Ga0207665_10049456 Ga0207665_100494562 170
191 3300025949 Ga0207667_10022167 Ga0207667_1002216710 170
192 3300025949 Ga0207667_10026666 Ga0207667_100266664 170
193 3300025949 Ga0207667_10078827 Ga0207667_100788274 170
194 3300025981 Ga0207640_10037577 Ga0207640_100375772 170
195 3300026067 Ga0207678_10053830 Ga0207678_100538302 170
196 3300026067 Ga0207678_10055524 Ga0207678_100555244 170
197 3300026078 Ga0207702_10059906 Ga0207702_100599064 170
198 3300026078 Ga0207702_10060514 Ga0207702_100605144 170
199 3300026078 Ga0207702_10244287 Ga0207702_102442872 170
200 3300026116 Ga0207674_10157321 Ga0207674_101573213 170
201 3300026142 Ga0207698_10035355 Ga0207698_100353553 170
202 3300035171 Ga0373946_0050901 Ga0373946_0050901_399_911 170
203 3300035692 Ga0373935_0153284 Ga0373935_0153284_246_758 170
204 3300035725 Ga0373947_0577649 Ga0373947_0577649_46_558 170
205 3300037312 Ga0395899_0036604 Ga0395899_0036604_2649_3167 170
206 3300037312 Ga0395899_0053501 Ga0395899_0053501_944_1462 170
207 3300037418 Ga0395900_0030431 Ga0395900_0030431_90_608 170
208 3300037418 Ga0395900_0415743 Ga0395900_0415743_410_928 170
209 3300037418 Ga0395900_0572365 Ga0395900_0572365_518_1036 170
210 3300037466 Ga0395898_0015329 Ga0395898_0015329_1829_2347 170
211 3300037466 Ga0395898_0025785 Ga0395898_0025785_5026_5544 170
212 3300038443 Ga0395901_0495449 Ga0395901_0495449_615_1133 170
213 3300044656 Ga0466969_0053154 Ga0466969_0053154_34_552 170
214 3300044684 Ga0466966_0000001 Ga0466966_0000001_404831_405349 170
215 3300044684 Ga0466966_0102144 Ga0466966_0102144_254_772 170
216 3300044765 Ga0466970_0008343 Ga0466970_0008343_2361_2879 170
217 3300044842 Ga0466957_0008937 Ga0466957_0008937_1581_2099 170
218 3300045049 Ga0466959_0004304 Ga0466959_0004304_8543_9061 170
219 3300045836 Ga0466958_0130082 Ga0466958_0130082_1001_1519 170
220 3300045976 Ga0466967_0062028 Ga0466967_0062028_2235_2753 170
221 3300046684 Ga0495669_0080319 Ga0495669_0080319_10_522 170
222 3300061719 Ga0466962_0044372 Ga0466962_0044372_1571_2089 170
223 iso_pu_bacteria 2885427238 2885429574 170
224 3300005329 Ga0070683_100583260 Ga0070683_1005832601 171
225 3300005331 Ga0070670_100099710 Ga0070670_1000997103 171
226 3300005335 Ga0070666_10021333 Ga0070666_100213333 171
227 3300005336 Ga0070680_100210135 Ga0070680_1002101352 171
228 3300005337 Ga0070682_101605724 Ga0070682_1016057241 171
229 3300005339 Ga0070660_100329855 Ga0070660_1003298552 171
230 3300005344 Ga0070661_100026533 Ga0070661_1000265333 171
231 3300005344 Ga0070661_100259356 Ga0070661_1002593562 171
232 3300005354 Ga0070675_100049667 Ga0070675_1000496673 171
233 3300005355 Ga0070671_100056433 Ga0070671_1000564332 171
234 3300005355 Ga0070671_100302705 Ga0070671_1003027052 171
235 3300005364 Ga0070673_100030023 Ga0070673_1000300234 171
236 3300005366 Ga0070659_100297472 Ga0070659_1002974722 171
237 3300005366 Ga0070659_100885051 Ga0070659_1008850512 171
238 3300005367 Ga0070667_100010677 Ga0070667_1000106772 171
239 3300005435 Ga0070714_100118908 Ga0070714_1001189082 171
240 3300005455 Ga0070663_100211025 Ga0070663_1002110252 171
241 3300005456 Ga0070678_100393715 Ga0070678_1003937152 171
242 3300005457 Ga0070662_100192805 Ga0070662_1001928052 171
243 3300005458 Ga0070681_10226833 Ga0070681_102268333 171
244 3300005530 Ga0070679_100945526 Ga0070679_1009455262 171
245 3300005535 Ga0070684_100353112 Ga0070684_1003531121 171
246 3300005543 Ga0070672_100000461 Ga0070672_10000046128 171
247 3300005548 Ga0070665_100190168 Ga0070665_1001901682 171
248 3300005564 Ga0070664_100028887 Ga0070664_1000288873 171
249 3300005578 Ga0068854_100080454 Ga0068854_1000804542 171
250 3300005578 Ga0068854_100958766 Ga0068854_1009587662 171
251 3300005614 Ga0068856_101128147 Ga0068856_1011281472 171
252 3300005616 Ga0068852_100119684 Ga0068852_1001196843 171
253 3300005841 Ga0068863_100029810 Ga0068863_1000298105 171
254 3300005842 Ga0068858_100041013 Ga0068858_1000410134 171
255 3300005843 Ga0068860_100615448 Ga0068860_1006154482 171
256 3300006237 Ga0097621_100209501 Ga0097621_1002095012 171
257 3300006358 Ga0068871_100079789 Ga0068871_1000797893 171
258 3300006881 Ga0068865_100256131 Ga0068865_1002561311 171
259 3300009101 Ga0105247_10210229 Ga0105247_102102292 171
260 3300009176 Ga0105242_10579264 Ga0105242_105792641 171
261 3300009177 Ga0105248_10490247 Ga0105248_104902471 171
262 3300009177 Ga0105248_10961257 Ga0105248_109612571 171
263 3300013100 Ga0157373_10063395 Ga0157373_100633952 171
264 3300013102 Ga0157371_10166613 Ga0157371_101666132 171
265 3300013104 Ga0157370_10050746 Ga0157370_100507466 171
266 3300013105 Ga0157369_10117807 Ga0157369_101178072 171
267 3300013105 Ga0157369_10214914 Ga0157369_102149142 171
268 3300013296 Ga0157374_10021305 Ga0157374_100213055 171
269 3300013306 Ga0163162_10019183 Ga0163162_100191833 171
270 3300013307 Ga0157372_10192727 Ga0157372_101927272 171
271 3300013307 Ga0157372_10281459 Ga0157372_102814592 171
272 3300013308 Ga0157375_10024280 Ga0157375_100242808 171
273 3300014325 Ga0163163_10011842 Ga0163163_100118422 171
274 3300025909 Ga0207705_10001025 Ga0207705_1000102515 171
275 3300025913 Ga0207695_10315334 Ga0207695_103153342 171
276 3300025917 Ga0207660_10382789 Ga0207660_103827892 171
277 3300025919 Ga0207657_10076653 Ga0207657_100766534 171
278 3300025920 Ga0207649_10021154 Ga0207649_100211543 171
279 3300025925 Ga0207650_10184267 Ga0207650_101842673 171
280 3300025926 Ga0207659_10207770 Ga0207659_102077702 171
281 3300025931 Ga0207644_10023819 Ga0207644_100238193 171
282 3300025931 Ga0207644_10702358 Ga0207644_107023582 171
283 3300025933 Ga0207706_10008319 Ga0207706_100083196 171
284 3300025938 Ga0207704_10975778 Ga0207704_109757781 171
285 3300025940 Ga0207691_10004673 Ga0207691_100046734 171
286 3300025941 Ga0207711_10827109 Ga0207711_108271092 171
287 3300025941 Ga0207711_11044215 Ga0207711_110442151 171
288 3300025945 Ga0207679_10020448 Ga0207679_100204483 171
289 3300025960 Ga0207651_10017768 Ga0207651_100177682 171
290 3300025981 Ga0207640_10153773 Ga0207640_101537732 171
291 3300025981 Ga0207640_10522418 Ga0207640_105224182 171
292 3300025986 Ga0207658_10405856 Ga0207658_104058562 171
293 3300026035 Ga0207703_10288547 Ga0207703_102885472 171
294 3300026067 Ga0207678_10164425 Ga0207678_101644252 171
295 3300026095 Ga0207676_10033010 Ga0207676_100330103 171
296 3300026121 Ga0207683_10014680 Ga0207683_100146803 171
297 3300026142 Ga0207698_10043850 Ga0207698_100438504 171
298 3300026142 Ga0207698_10219416 Ga0207698_102194162 171
299 3300028379 Ga0268266_10029135 Ga0268266_100291352 171
300 3300028381 Ga0268264_10266424 Ga0268264_102664242 171
301 3300037312 Ga0395899_0194735 Ga0395899_0194735_525_1040 171
302 3300037312 Ga0395899_0285816 Ga0395899_0285816_234_749 171
303 3300037418 Ga0395900_0172571 Ga0395900_0172571_811_1326 171
304 3300037466 Ga0395898_0337753 Ga0395898_0337753_878_1393 171
305 3300037471 Ga0395905_0001983 Ga0395905_0001983_5711_6226 171
306 3300037471 Ga0395905_0008256 Ga0395905_0008256_5026_5541 171
307 3300037471 Ga0395905_0945837 Ga0395905_0945837_113_628 171
308 3300038443 Ga0395901_0230494 Ga0395901_0230494_811_1326 171
309 3300038443 Ga0395901_0347379 Ga0395901_0347379_10_525 171
310 3300044684 Ga0466966_0010135 Ga0466966_0010135_3853_4374 171
311 3300044693 Ga0466961_0009876 Ga0466961_0009876_4462_4983 171
312 3300045049 Ga0466959_0103432 Ga0466959_0103432_966_1487 171
313 3300048904 Ga0496101_0216755 Ga0496101_0216755_847_1362 171
314 3300048905 Ga0496102_0673775 Ga0496102_0673775_421_936 171
315 3300048909 Ga0496106_0705234 Ga0496106_0705234_95_610 171
316 3300048910 Ga0496107_0189121 Ga0496107_0189121_522_1037 171
317 3300048911 Ga0496108_0046784 Ga0496108_0046784_562_1077 171
318 3300048912 Ga0496109_0034955 Ga0496109_0034955_375_890 171
319 3300048913 Ga0496110_0427452 Ga0496110_0427452_529_1044 171
320 3300048914 Ga0496111_0005193 Ga0496111_0005193_7022_7537 171
321 3300048915 Ga0496112_0012266 Ga0496112_0012266_4748_5263 171
322 3300048916 Ga0496113_0536789 Ga0496113_0536789_90_605 171
323 3300048917 Ga0496114_0012137 Ga0496114_0012137_445_960 171
324 3300003323 rootH1_10278953 rootH1_102789531 172
325 3300005327 Ga0070658_10669328 Ga0070658_106693281 172
326 3300005328 Ga0070676_10168981 Ga0070676_101689812 172
327 3300005338 Ga0068868_100129706 Ga0068868_1001297063 172
328 3300005344 Ga0070661_100099815 Ga0070661_1000998152 172
329 3300005435 Ga0070714_100083682 Ga0070714_1000836822 172
330 3300005436 Ga0070713_100149553 Ga0070713_1001495532 172
331 3300005436 Ga0070713_100283377 Ga0070713_1002833772 172
332 3300005564 Ga0070664_100002518 Ga0070664_1000025185 172
333 3300006028 Ga0070717_10832085 Ga0070717_108320852 172
334 3300009098 Ga0105245_10599849 Ga0105245_105998491 172
335 3300013104 Ga0157370_10095543 Ga0157370_100955434 172
336 3300013296 Ga0157374_10643549 Ga0157374_106435492 172
337 3300013297 Ga0157378_10219689 Ga0157378_102196893 172
338 3300025928 Ga0207700_10037272 Ga0207700_100372723 172
339 3300025945 Ga0207679_10007576 Ga0207679_100075765 172
340 3300026116 Ga0207674_10077107 Ga0207674_100771073 172
341 3300037312 Ga0395899_0090055 Ga0395899_0090055_433_951 172
342 3300037466 Ga0395898_0217297 Ga0395898_0217297_1223_1741 172
343 3300038443 Ga0395901_0319888 Ga0395901_0319888_882_1400 172
344 3300038443 Ga0395901_0777050 Ga0395901_0777050_367_885 172
345 3300044842 Ga0466957_0172057 Ga0466957_0172057_828_1349 172
346 3300045976 Ga0466967_0745784 Ga0466967_0745784_316_834 172
347 3300045976 Ga0466967_0996193 Ga0466967_0996193_166_687 172
348 3300001979 JGI24740J21852_10004688 JGI24740J21852_100046881 173
349 3300001989 JGI24739J22299_10141477 JGI24739J22299_101414772 173
350 3300001990 JGI24737J22298_10003380 JGI24737J22298_100033806 173
351 3300002067 JGI24735J21928_10010414 JGI24735J21928_100104142 173
352 3300002239 JGI24034J26672_10053221 JGI24034J26672_100532212 173
353 3300003322 rootL2_10267806 rootL2_102678062 173
354 3300005327 Ga0070658_10018898 Ga0070658_100188985 173
355 3300005327 Ga0070658_10050982 Ga0070658_100509822 173
356 3300005327 Ga0070658_10137343 Ga0070658_101373432 173
357 3300005327 Ga0070658_10144517 Ga0070658_101445172 173
358 3300005327 Ga0070658_10189803 Ga0070658_101898032 173
359 3300005327 Ga0070658_10240107 Ga0070658_102401072 173
360 3300005328 Ga0070676_10181160 Ga0070676_101811602 173
361 3300005328 Ga0070676_10268988 Ga0070676_102689882 173
362 3300005328 Ga0070676_10553910 Ga0070676_105539101 173
363 3300005329 Ga0070683_100156382 Ga0070683_1001563822 173
364 3300005329 Ga0070683_100222484 Ga0070683_1002224842 173
365 3300005331 Ga0070670_100067994 Ga0070670_1000679941 173
366 3300005331 Ga0070670_100162474 Ga0070670_1001624742 173
367 3300005331 Ga0070670_100996201 Ga0070670_1009962011 173
368 3300005335 Ga0070666_10020324 Ga0070666_100203245 173
369 3300005335 Ga0070666_10060975 Ga0070666_100609752 173
370 3300005336 Ga0070680_100080167 Ga0070680_1000801671 173
371 3300005336 Ga0070680_100375654 Ga0070680_1003756542 173
372 3300005337 Ga0070682_100229221 Ga0070682_1002292211 173
373 3300005338 Ga0068868_100033262 Ga0068868_1000332622 173
374 3300005338 Ga0068868_100308483 Ga0068868_1003084832 173
375 3300005338 Ga0068868_101100384 Ga0068868_1011003842 173
376 3300005339 Ga0070660_100003053 Ga0070660_10000305314 173
377 3300005339 Ga0070660_100008261 Ga0070660_1000082611 173
378 3300005339 Ga0070660_100128950 Ga0070660_1001289502 173
379 3300005339 Ga0070660_100306813 Ga0070660_1003068131 173
380 3300005339 Ga0070660_100670327 Ga0070660_1006703272 173
381 3300005339 Ga0070660_100713793 Ga0070660_1007137931 173
382 3300005340 Ga0070689_101016397 Ga0070689_1010163971 173
383 3300005344 Ga0070661_100108040 Ga0070661_1001080402 173
384 3300005344 Ga0070661_100126363 Ga0070661_1001263632 173
385 3300005344 Ga0070661_100133516 Ga0070661_1001335162 173
386 3300005344 Ga0070661_100474986 Ga0070661_1004749862 173
387 3300005344 Ga0070661_100598029 Ga0070661_1005980291 173
388 3300005345 Ga0070692_10006534 Ga0070692_100065344 173
389 3300005354 Ga0070675_100593569 Ga0070675_1005935692 173
390 3300005355 Ga0070671_100024750 Ga0070671_1000247507 173
391 3300005355 Ga0070671_100059294 Ga0070671_1000592942 173
392 3300005355 Ga0070671_100126174 Ga0070671_1001261743 173
393 3300005355 Ga0070671_100441765 Ga0070671_1004417652 173
394 3300005356 Ga0070674_100018560 Ga0070674_1000185606 173
395 3300005356 Ga0070674_100028383 Ga0070674_1000283832 173
396 3300005364 Ga0070673_100039882 Ga0070673_1000398823 173
397 3300005364 Ga0070673_100324412 Ga0070673_1003244122 173
398 3300005366 Ga0070659_100041705 Ga0070659_1000417052 173
399 3300005366 Ga0070659_100050354 Ga0070659_1000503543 173
400 3300005366 Ga0070659_100086992 Ga0070659_1000869921 173
401 3300005366 Ga0070659_100095748 Ga0070659_1000957482 173
402 3300005367 Ga0070667_100034693 Ga0070667_1000346934 173
403 3300005435 Ga0070714_100024648 Ga0070714_1000246484 173
404 3300005435 Ga0070714_100051350 Ga0070714_1000513502 173
405 3300005435 Ga0070714_100124451 Ga0070714_1001244512 173
406 3300005435 Ga0070714_100377650 Ga0070714_1003776501 173
407 3300005436 Ga0070713_100060401 Ga0070713_1000604012 173
408 3300005437 Ga0070710_10654621 Ga0070710_106546211 173
409 3300005438 Ga0070701_10056286 Ga0070701_100562862 173
410 3300005455 Ga0070663_100081089 Ga0070663_1000810892 173
411 3300005457 Ga0070662_100109917 Ga0070662_1001099173 173
412 3300005457 Ga0070662_100543652 Ga0070662_1005436522 173
413 3300005458 Ga0070681_10356957 Ga0070681_103569571 173
414 3300005459 Ga0068867_100107486 Ga0068867_1001074862 173
415 3300005459 Ga0068867_100296207 Ga0068867_1002962072 173
416 3300005459 Ga0068867_100549656 Ga0068867_1005496562 173
417 3300005530 Ga0070679_100038807 Ga0070679_1000388073 173
418 3300005530 Ga0070679_100416136 Ga0070679_1004161362 173
419 3300005530 Ga0070679_100709016 Ga0070679_1007090161 173
420 3300005535 Ga0070684_100034298 Ga0070684_1000342982 173
421 3300005539 Ga0068853_100095736 Ga0068853_1000957364 173
422 3300005539 Ga0068853_100164720 Ga0068853_1001647202 173
423 3300005543 Ga0070672_100275877 Ga0070672_1002758772 173
424 3300005544 Ga0070686_100218439 Ga0070686_1002184392 173
425 3300005547 Ga0070693_100071516 Ga0070693_1000715162 173
426 3300005547 Ga0070693_100783939 Ga0070693_1007839391 173
427 3300005548 Ga0070665_100012613 Ga0070665_1000126132 173
428 3300005548 Ga0070665_100169141 Ga0070665_1001691412 173
429 3300005548 Ga0070665_100957088 Ga0070665_1009570882 173
430 3300005563 Ga0068855_100115015 Ga0068855_1001150155 173
431 3300005563 Ga0068855_100129420 Ga0068855_1001294203 173
432 3300005563 Ga0068855_100174522 Ga0068855_1001745222 173
433 3300005563 Ga0068855_100515666 Ga0068855_1005156661 173
434 3300005564 Ga0070664_100244736 Ga0070664_1002447362 173
435 3300005577 Ga0068857_100000489 Ga0068857_10000048928 173
436 3300005577 Ga0068857_100039427 Ga0068857_1000394276 173
437 3300005578 Ga0068854_100012018 Ga0068854_1000120183 173
438 3300005578 Ga0068854_100215840 Ga0068854_1002158402 173
439 3300005578 Ga0068854_100276267 Ga0068854_1002762672 173
440 3300005578 Ga0068854_100300388 Ga0068854_1003003882 173
441 3300005578 Ga0068854_100523488 Ga0068854_1005234881 173
442 3300005578 Ga0068854_100622269 Ga0068854_1006222691 173
443 3300005614 Ga0068856_100013400 Ga0068856_1000134001 173
444 3300005614 Ga0068856_100116416 Ga0068856_1001164162 173
445 3300005614 Ga0068856_100137905 Ga0068856_1001379053 173
446 3300005614 Ga0068856_100242001 Ga0068856_1002420012 173
447 3300005614 Ga0068856_100402279 Ga0068856_1004022792 173
448 3300005614 Ga0068856_100674668 Ga0068856_1006746682 173
449 3300005616 Ga0068852_100021963 Ga0068852_1000219636 173
450 3300005616 Ga0068852_100027753 Ga0068852_1000277533 173
451 3300005616 Ga0068852_100034952 Ga0068852_1000349526 173
452 3300005616 Ga0068852_100053062 Ga0068852_1000530623 173
453 3300005616 Ga0068852_100328348 Ga0068852_1003283482 173
454 3300005616 Ga0068852_100356102 Ga0068852_1003561022 173
455 3300005618 Ga0068864_100340250 Ga0068864_1003402502 173
456 3300005718 Ga0068866_10020801 Ga0068866_100208014 173
457 3300005834 Ga0068851_10050154 Ga0068851_100501544 173
458 3300005834 Ga0068851_10085228 Ga0068851_100852282 173
459 3300005840 Ga0068870_10405259 Ga0068870_104052591 173
460 3300005841 Ga0068863_100092486 Ga0068863_1000924864 173
461 3300005842 Ga0068858_100013510 Ga0068858_1000135106 173
462 3300005844 Ga0068862_100203121 Ga0068862_1002031212 173
463 3300006028 Ga0070717_10012042 Ga0070717_100120425 173
464 3300006051 Ga0075364_10664963 Ga0075364_106649631 173
465 3300006186 Ga0075369_10199929 Ga0075369_101999291 173
466 3300006871 Ga0075434_100785517 Ga0075434_1007855172 173
467 3300006881 Ga0068865_100086744 Ga0068865_1000867442 173
468 3300009177 Ga0105248_10026359 Ga0105248_100263593 173
469 3300009177 Ga0105248_10038209 Ga0105248_100382097 173
470 3300009545 Ga0105237_10142523 Ga0105237_101425232 173
471 3300009551 Ga0105238_10135699 Ga0105238_101356992 173
472 3300009551 Ga0105238_10236138 Ga0105238_102361381 173
473 3300009551 Ga0105238_10396735 Ga0105238_103967352 173
474 3300010375 Ga0105239_10027029 Ga0105239_100270293 173
475 3300011119 Ga0105246_10114352 Ga0105246_101143523 173
476 3300013100 Ga0157373_10014974 Ga0157373_100149747 173
477 3300013100 Ga0157373_10238318 Ga0157373_102383182 173
478 3300013100 Ga0157373_10385557 Ga0157373_103855571 173
479 3300013102 Ga0157371_10996903 Ga0157371_109969031 173
480 3300013104 Ga0157370_10002746 Ga0157370_100027463 173
481 3300013104 Ga0157370_10069760 Ga0157370_100697602 173
482 3300013104 Ga0157370_10487620 Ga0157370_104876201 173
483 3300013105 Ga0157369_10004619 Ga0157369_100046193 173
484 3300013105 Ga0157369_10102744 Ga0157369_101027442 173
485 3300013105 Ga0157369_10186201 Ga0157369_101862012 173
486 3300013105 Ga0157369_10333383 Ga0157369_103333831 173
487 3300013105 Ga0157369_10850498 Ga0157369_108504982 173
488 3300013105 Ga0157369_11817098 Ga0157369_118170981 173
489 3300013296 Ga0157374_10029007 Ga0157374_100290076 173
490 3300013297 Ga0157378_10480521 Ga0157378_104805211 173
491 3300013307 Ga0157372_10206753 Ga0157372_102067533 173
492 3300013307 Ga0157372_10442817 Ga0157372_104428172 173
493 3300013307 Ga0157372_11671906 Ga0157372_116719061 173
494 3300013308 Ga0157375_11882243 Ga0157375_118822431 173
495 3300014325 Ga0163163_10034598 Ga0163163_100345982 173
496 3300014969 Ga0157376_10302569 Ga0157376_103025691 173
497 3300020076 Ga0206355_1601105 Ga0206355_16011052 173
498 3300021384 Ga0213876_10015773 Ga0213876_100157734 173
499 3300025321 Ga0207656_10025258 Ga0207656_100252583 173
500 3300025899 Ga0207642_10011605 Ga0207642_100116052 173
501 3300025903 Ga0207680_10010957 Ga0207680_100109574 173
502 3300025903 Ga0207680_10112205 Ga0207680_101122052 173
503 3300025904 Ga0207647_10014002 Ga0207647_100140023 173
504 3300025904 Ga0207647_10022272 Ga0207647_100222723 173
505 3300025904 Ga0207647_10024348 Ga0207647_100243483 173
506 3300025904 Ga0207647_10048627 Ga0207647_100486273 173
507 3300025904 Ga0207647_10080059 Ga0207647_100800591 173
508 3300025904 Ga0207647_10089347 Ga0207647_100893472 173
509 3300025907 Ga0207645_10051000 Ga0207645_100510002 173
510 3300025907 Ga0207645_10110365 Ga0207645_101103652 173
511 3300025909 Ga0207705_10000493 Ga0207705_1000049315 173
512 3300025909 Ga0207705_10019512 Ga0207705_100195123 173
513 3300025909 Ga0207705_10027645 Ga0207705_100276454 173
514 3300025909 Ga0207705_10097045 Ga0207705_100970452 173
515 3300025909 Ga0207705_10255496 Ga0207705_102554962 173
516 3300025909 Ga0207705_10356814 Ga0207705_103568142 173
517 3300025912 Ga0207707_10017647 Ga0207707_100176472 173
518 3300025912 Ga0207707_10077183 Ga0207707_100771831 173
519 3300025914 Ga0207671_10024193 Ga0207671_100241932 173
520 3300025917 Ga0207660_10000770 Ga0207660_100007701 173
521 3300025919 Ga0207657_10002261 Ga0207657_100022613 173
522 3300025919 Ga0207657_10003123 Ga0207657_1000312319 173
523 3300025919 Ga0207657_10026360 Ga0207657_100263607 173
524 3300025919 Ga0207657_10040433 Ga0207657_100404336 173
525 3300025919 Ga0207657_10115485 Ga0207657_101154852 173
526 3300025919 Ga0207657_10174288 Ga0207657_101742882 173
527 3300025919 Ga0207657_10429289 Ga0207657_104292891 173
528 3300025920 Ga0207649_10033502 Ga0207649_100335024 173
529 3300025920 Ga0207649_10101062 Ga0207649_101010622 173
530 3300025920 Ga0207649_10135803 Ga0207649_101358032 173
531 3300025920 Ga0207649_10205843 Ga0207649_102058432 173
532 3300025920 Ga0207649_10573796 Ga0207649_105737961 173
533 3300025921 Ga0207652_10000034 Ga0207652_10000034127 173
534 3300025924 Ga0207694_10024170 Ga0207694_100241702 173
535 3300025925 Ga0207650_10087834 Ga0207650_100878342 173
536 3300025928 Ga0207700_10053420 Ga0207700_100534202 173
537 3300025929 Ga0207664_10036282 Ga0207664_100362822 173
538 3300025931 Ga0207644_10016318 Ga0207644_100163182 173
539 3300025932 Ga0207690_10015093 Ga0207690_100150932 173
540 3300025932 Ga0207690_10060505 Ga0207690_100605052 173
541 3300025932 Ga0207690_10066579 Ga0207690_100665792 173
542 3300025932 Ga0207690_10417273 Ga0207690_104172732 173
543 3300025933 Ga0207706_10233077 Ga0207706_102330772 173
544 3300025933 Ga0207706_10541087 Ga0207706_105410871 173
545 3300025933 Ga0207706_10578983 Ga0207706_105789832 173
546 3300025936 Ga0207670_10644647 Ga0207670_106446472 173
547 3300025937 Ga0207669_10027200 Ga0207669_100272004 173
548 3300025937 Ga0207669_10081406 Ga0207669_100814062 173
549 3300025939 Ga0207665_10132756 Ga0207665_101327562 173
550 3300025940 Ga0207691_10269925 Ga0207691_102699252 173
551 3300025941 Ga0207711_10007240 Ga0207711_1000724011 173
552 3300025941 Ga0207711_10020622 Ga0207711_100206226 173
553 3300025941 Ga0207711_10311060 Ga0207711_103110601 173
554 3300025944 Ga0207661_10594680 Ga0207661_105946801 173
555 3300025944 Ga0207661_10737127 Ga0207661_107371272 173
556 3300025945 Ga0207679_10125411 Ga0207679_101254112 173
557 3300025949 Ga0207667_10178420 Ga0207667_101784201 173
558 3300025949 Ga0207667_10261594 Ga0207667_102615941 173
559 3300025949 Ga0207667_10313539 Ga0207667_103135392 173
560 3300025949 Ga0207667_10948104 Ga0207667_109481041 173
561 3300025960 Ga0207651_10012099 Ga0207651_100120997 173
562 3300025960 Ga0207651_10015757 Ga0207651_100157576 173
563 3300025960 Ga0207651_10078455 Ga0207651_100784553 173
564 3300025981 Ga0207640_10025603 Ga0207640_100256031 173
565 3300025981 Ga0207640_10177872 Ga0207640_101778722 173
566 3300025981 Ga0207640_10707786 Ga0207640_107077862 173
567 3300025986 Ga0207658_10013412 Ga0207658_100134126 173
568 3300025986 Ga0207658_10309592 Ga0207658_103095922 173
569 3300026023 Ga0207677_10006373 Ga0207677_100063735 173
570 3300026023 Ga0207677_10081189 Ga0207677_100811892 173
571 3300026023 Ga0207677_11277365 Ga0207677_112773651 173
572 3300026035 Ga0207703_10012807 Ga0207703_100128077 173
573 3300026041 Ga0207639_10000923 Ga0207639_100009235 173
574 3300026041 Ga0207639_10706898 Ga0207639_107068981 173
575 3300026067 Ga0207678_10009081 Ga0207678_100090816 173
576 3300026067 Ga0207678_10046333 Ga0207678_100463333 173
577 3300026067 Ga0207678_10558145 Ga0207678_105581452 173
578 3300026078 Ga0207702_10025645 Ga0207702_100256456 173
579 3300026078 Ga0207702_10074449 Ga0207702_100744494 173
580 3300026078 Ga0207702_10177756 Ga0207702_101777562 173
581 3300026078 Ga0207702_10330691 Ga0207702_103306912 173
582 3300026088 Ga0207641_10710167 Ga0207641_107101672 173
583 3300026089 Ga0207648_10010578 Ga0207648_100105782 173
584 3300026089 Ga0207648_10088236 Ga0207648_100882364 173
585 3300026089 Ga0207648_10348933 Ga0207648_103489332 173
586 3300026095 Ga0207676_10277997 Ga0207676_102779972 173
587 3300026116 Ga0207674_10006843 Ga0207674_1000684310 173
588 3300026116 Ga0207674_10115084 Ga0207674_101150842 173
589 3300026116 Ga0207674_10818294 Ga0207674_108182942 173
590 3300026116 Ga0207674_11400548 Ga0207674_114005481 173
591 3300026142 Ga0207698_10003271 Ga0207698_100032714 173
592 3300026142 Ga0207698_10006737 Ga0207698_100067379 173
593 3300026142 Ga0207698_10008977 Ga0207698_100089779 173
594 3300026142 Ga0207698_10022783 Ga0207698_100227837 173
595 3300026142 Ga0207698_10535537 Ga0207698_105355371 173
596 3300026142 Ga0207698_10975881 Ga0207698_109758811 173
597 3300026142 Ga0207698_11139976 Ga0207698_111399762 173
598 3300028379 Ga0268266_10000767 Ga0268266_100007672 173
599 3300028379 Ga0268266_10212037 Ga0268266_102120371 173
600 3300028379 Ga0268266_11375540 Ga0268266_113755401 173
601 3300028380 Ga0268265_10363928 Ga0268265_103639282 173
602 3300031852 Ga0307410_10031141 Ga0307410_100311412 173
603 3300031995 Ga0307409_100031493 Ga0307409_1000314931 173
604 3300032004 Ga0307414_10391625 Ga0307414_103916251 173
605 3300032005 Ga0307411_10119092 Ga0307411_101190922 173
606 3300032126 Ga0307415_100066475 Ga0307415_1000664752 173
607 3300035111 Ga0373923_0112263 Ga0373923_0112263_287_808 173
608 3300035118 Ga0373954_0049544 Ga0373954_0049544_398_919 173
609 3300035119 Ga0373956_0097486 Ga0373956_0097486_685_1206 173
610 3300035724 Ga0373933_0014251 Ga0373933_0014251_868_1389 173
611 3300036401 Ga0373937_0004829 Ga0373937_0004829_2647_3168 173
612 3300037312 Ga0395899_0042007 Ga0395899_0042007_1325_1852 173
613 3300037312 Ga0395899_0051337 Ga0395899_0051337_398_919 173
614 3300037312 Ga0395899_0162413 Ga0395899_0162413_802_1323 173
615 3300037312 Ga0395899_0292103 Ga0395899_0292103_228_755 173
616 3300037418 Ga0395900_0003085 Ga0395900_0003085_5814_6341 173
617 3300037418 Ga0395900_0010484 Ga0395900_0010484_6842_7363 173
618 3300037418 Ga0395900_0050997 Ga0395900_0050997_180_701 173
619 3300037418 Ga0395900_0053926 Ga0395900_0053926_1642_2163 173
620 3300037418 Ga0395900_0073419 Ga0395900_0073419_2818_3339 173
621 3300037418 Ga0395900_0088171 Ga0395900_0088171_33_554 173
622 3300037418 Ga0395900_0115343 Ga0395900_0115343_354_875 173
623 3300037418 Ga0395900_0131903 Ga0395900_0131903_525_1046 173
624 3300037418 Ga0395900_0133413 Ga0395900_0133413_578_1099 173
625 3300037418 Ga0395900_0262255 Ga0395900_0262255_796_1329 173
626 3300037418 Ga0395900_0542483 Ga0395900_0542483_228_755 173
627 3300037466 Ga0395898_0053789 Ga0395898_0053789_1752_2273 173
628 3300037466 Ga0395898_0178684 Ga0395898_0178684_401_922 173
629 3300037466 Ga0395898_0226204 Ga0395898_0226204_726_1247 173
630 3300037466 Ga0395898_0381880 Ga0395898_0381880_768_1289 173
631 3300037466 Ga0395898_0689444 Ga0395898_0689444_345_872 173
632 3300037471 Ga0395905_0001169 Ga0395905_0001169_25881_26402 173
633 3300037471 Ga0395905_0006012 Ga0395905_0006012_3421_3942 173
634 3300037471 Ga0395905_0006135 Ga0395905_0006135_9034_9555 173
635 3300037471 Ga0395905_0033050 Ga0395905_0033050_3396_3917 173
636 3300037471 Ga0395905_0033437 Ga0395905_0033437_1960_2481 173
637 3300037471 Ga0395905_0034571 Ga0395905_0034571_831_1352 173
638 3300037471 Ga0395905_0051435 Ga0395905_0051435_1055_1576 173
639 3300037471 Ga0395905_0057078 Ga0395905_0057078_590_1111 173
640 3300037471 Ga0395905_0062402 Ga0395905_0062402_2257_2778 173
641 3300037471 Ga0395905_0092392 Ga0395905_0092392_1772_2293 173
642 3300037471 Ga0395905_0294178 Ga0395905_0294178_12_533 173
643 3300037471 Ga0395905_0433132 Ga0395905_0433132_304_825 173
644 3300037471 Ga0395905_0543099 Ga0395905_0543099_347_868 173
645 3300037471 Ga0395905_0667690 Ga0395905_0667690_406_927 173
646 3300037471 Ga0395905_1223661 Ga0395905_1223661_119_640 173
647 3300038443 Ga0395901_0006031 Ga0395901_0006031_10853_11374 173
648 3300038443 Ga0395901_0028506 Ga0395901_0028506_1624_2145 173
649 3300038443 Ga0395901_0067878 Ga0395901_0067878_1863_2390 173
650 3300038443 Ga0395901_0082714 Ga0395901_0082714_2753_3274 173
651 3300038443 Ga0395901_0101199 Ga0395901_0101199_1854_2375 173
652 3300038443 Ga0395901_0106570 Ga0395901_0106570_1555_2076 173
653 3300038443 Ga0395901_0175992 Ga0395901_0175992_780_1301 173
654 3300038443 Ga0395901_0440675 Ga0395901_0440675_715_1236 173
655 3300038443 Ga0395901_0508607 Ga0395901_0508607_354_881 173
656 3300038443 Ga0395901_0554006 Ga0395901_0554006_529_1050 173
657 3300038443 Ga0395901_0602161 Ga0395901_0602161_203_724 173
658 3300039437 Ga0436365_0481817 Ga0436365_0481817_13473_13994 173
659 3300042157 Ga0439458_0001207 Ga0439458_0001207_1641_2162 173
660 3300042157 Ga0439458_0007205 Ga0439458_0007205_1663_2184 173
661 3300044658 Ga0466972_0119841 Ga0466972_0119841_305_835 173
662 3300044684 Ga0466966_0045027 Ga0466966_0045027_1031_1552 173
663 3300044684 Ga0466966_0050485 Ga0466966_0050485_1595_2116 173
664 3300044694 Ga0466963_0010178 Ga0466963_0010178_457_978 173
665 3300044694 Ga0466963_0378012 Ga0466963_0378012_393_923 173
666 3300044706 Ga0466964_0059314 Ga0466964_0059314_771_1295 173
667 3300044706 Ga0466964_0347434 Ga0466964_0347434_10_531 173
668 3300044765 Ga0466970_0033889 Ga0466970_0033889_959_1483 173
669 3300044842 Ga0466957_0000183 Ga0466957_0000183_22558_23079 173
670 3300044842 Ga0466957_0128657 Ga0466957_0128657_950_1474 173
671 3300044842 Ga0466957_0480373 Ga0466957_0480373_17_538 173
672 3300044901 Ga0466960_0013146 Ga0466960_0013146_2884_3414 173
673 3300044901 Ga0466960_0158182 Ga0466960_0158182_213_734 173
674 3300045049 Ga0466959_0083054 Ga0466959_0083054_35_565 173
675 3300045049 Ga0466959_0089032 Ga0466959_0089032_1615_2136 173
676 3300045836 Ga0466958_0010395 Ga0466958_0010395_231_752 173
677 3300045836 Ga0466958_0047500 Ga0466958_0047500_768_1289 173
678 3300045836 Ga0466958_0085191 Ga0466958_0085191_1194_1724 173
679 3300045836 Ga0466958_0154575 Ga0466958_0154575_142_663 173
680 3300045976 Ga0466967_0007477 Ga0466967_0007477_6535_7056 173
681 3300045976 Ga0466967_0011797 Ga0466967_0011797_5007_5531 173
682 3300045976 Ga0466967_0113070 Ga0466967_0113070_261_782 173
683 3300045976 Ga0466967_0118782 Ga0466967_0118782_506_1027 173
684 3300045976 Ga0466967_0134561 Ga0466967_0134561_289_810 173
685 3300045976 Ga0466967_0320165 Ga0466967_0320165_781_1302 173
686 3300045976 Ga0466967_0402360 Ga0466967_0402360_438_959 173
687 3300045976 Ga0466967_0520729 Ga0466967_0520729_484_1005 173
688 3300045976 Ga0466967_0578979 Ga0466967_0578979_54_584 173
689 3300045976 Ga0466967_0778481 Ga0466967_0778481_226_747 173
690 3300045976 Ga0466967_0786938 Ga0466967_0786938_77_598 173
691 3300046616 Ga0495668_0077275 Ga0495668_0077275_785_1306 173
692 3300046679 Ga0495623_0064093 Ga0495623_0064093_1530_2051 173
693 3300046684 Ga0495669_0243949 Ga0495669_0243949_244_765 173
694 3300048088 Ga0495602_0043086 Ga0495602_0043086_2479_3000 173
695 3300048912 Ga0496109_0219805 Ga0496109_0219805_1017_1550 173
696 3300048915 Ga0496112_0264652 Ga0496112_0264652_111_644 173
697 3300048915 Ga0496112_0886951 Ga0496112_0886951_225_746 173
698 3300048916 Ga0496113_0381671 Ga0496113_0381671_541_1074 173
699 3300050512 nmdc:mga0n895_901262_c1 nmdc:mga0n895_901262_c1_192_713 173
700 3300061719 Ga0466962_0013258 Ga0466962_0013258_3275_3796 173
701 3300061719 Ga0466962_0015820 Ga0466962_0015820_2175_2705 173
702 3300005327 Ga0070658_10214334 Ga0070658_102143342 174
703 3300005327 Ga0070658_10292776 Ga0070658_102927762 174
704 3300005329 Ga0070683_100384525 Ga0070683_1003845252 174
705 3300005331 Ga0070670_100929619 Ga0070670_1009296191 174
706 3300005335 Ga0070666_10021757 Ga0070666_100217572 174
707 3300005338 Ga0068868_100051631 Ga0068868_1000516314 174
708 3300005339 Ga0070660_100447868 Ga0070660_1004478682 174
709 3300005344 Ga0070661_100485528 Ga0070661_1004855282 174
710 3300005355 Ga0070671_100002090 Ga0070671_10000209011 174
711 3300005355 Ga0070671_100028475 Ga0070671_1000284756 174
712 3300005356 Ga0070674_100751110 Ga0070674_1007511101 174
713 3300005364 Ga0070673_100039241 Ga0070673_1000392413 174
714 3300005366 Ga0070659_100202607 Ga0070659_1002026072 174
715 3300005366 Ga0070659_100341327 Ga0070659_1003413272 174
716 3300005366 Ga0070659_101331368 Ga0070659_1013313681 174
717 3300005367 Ga0070667_100027546 Ga0070667_1000275466 174
718 3300005455 Ga0070663_100082406 Ga0070663_1000824062 174
719 3300005456 Ga0070678_100031044 Ga0070678_1000310445 174
720 3300005457 Ga0070662_100009880 Ga0070662_1000098805 174
721 3300005539 Ga0068853_101403305 Ga0068853_1014033051 174
722 3300005548 Ga0070665_100040150 Ga0070665_1000401505 174
723 3300005564 Ga0070664_100063374 Ga0070664_1000633745 174
724 3300005564 Ga0070664_100186882 Ga0070664_1001868822 174
725 3300005577 Ga0068857_100303721 Ga0068857_1003037212 174
726 3300005578 Ga0068854_100013400 Ga0068854_1000134003 174
727 3300005614 Ga0068856_100244315 Ga0068856_1002443153 174
728 3300005616 Ga0068852_100435479 Ga0068852_1004354792 174
729 3300005618 Ga0068864_100051914 Ga0068864_1000519142 174
730 3300005841 Ga0068863_100046826 Ga0068863_1000468263 174
731 3300005842 Ga0068858_100193155 Ga0068858_1001931553 174
732 3300005985 Ga0081539_10030833 Ga0081539_100308332 174
733 3300005985 Ga0081539_10101652 Ga0081539_101016522 174
734 3300006237 Ga0097621_101211207 Ga0097621_1012112071 174
735 3300009177 Ga0105248_10114594 Ga0105248_101145943 174
736 3300009177 Ga0105248_11056138 Ga0105248_110561381 174
737 3300011119 Ga0105246_10158042 Ga0105246_101580422 174
738 3300013102 Ga0157371_11134935 Ga0157371_111349351 174
739 3300013102 Ga0157371_11249529 Ga0157371_112495291 174
740 3300013105 Ga0157369_10303168 Ga0157369_103031682 174
741 3300013306 Ga0163162_10048537 Ga0163162_100485376 174
742 3300013306 Ga0163162_10287058 Ga0163162_102870582 174
743 3300013307 Ga0157372_10074479 Ga0157372_100744792 174
744 3300013308 Ga0157375_10052650 Ga0157375_100526505 174
745 3300013308 Ga0157375_10832131 Ga0157375_108321311 174
746 3300025903 Ga0207680_10013553 Ga0207680_100135532 174
747 3300025904 Ga0207647_10036155 Ga0207647_100361552 174
748 3300025909 Ga0207705_10268769 Ga0207705_102687692 174
749 3300025917 Ga0207660_10521874 Ga0207660_105218742 174
750 3300025920 Ga0207649_10525587 Ga0207649_105255871 174
751 3300025925 Ga0207650_10286661 Ga0207650_102866612 174
752 3300025931 Ga0207644_10000747 Ga0207644_100007472 174
753 3300025931 Ga0207644_10016718 Ga0207644_100167186 174
754 3300025931 Ga0207644_10156432 Ga0207644_101564322 174
755 3300025933 Ga0207706_10019826 Ga0207706_100198265 174
756 3300025933 Ga0207706_10131582 Ga0207706_101315822 174
757 3300025933 Ga0207706_10310147 Ga0207706_103101472 174
758 3300025940 Ga0207691_10013134 Ga0207691_1001313411 174
759 3300025941 Ga0207711_10007576 Ga0207711_1000757610 174
760 3300025941 Ga0207711_10033837 Ga0207711_100338372 174
761 3300025944 Ga0207661_10002378 Ga0207661_100023784 174
762 3300025945 Ga0207679_10069570 Ga0207679_100695703 174
763 3300025945 Ga0207679_10299494 Ga0207679_102994942 174
764 3300025945 Ga0207679_10478083 Ga0207679_104780832 174
765 3300025949 Ga0207667_10790375 Ga0207667_107903751 174
766 3300025949 Ga0207667_11219828 Ga0207667_112198281 174
767 3300025960 Ga0207651_10029038 Ga0207651_100290385 174
768 3300025981 Ga0207640_10219580 Ga0207640_102195803 174
769 3300025986 Ga0207658_10065328 Ga0207658_100653282 174
770 3300026023 Ga0207677_10174809 Ga0207677_101748092 174
771 3300026035 Ga0207703_10112271 Ga0207703_101122712 174
772 3300026041 Ga0207639_10866551 Ga0207639_108665512 174
773 3300026067 Ga0207678_10006063 Ga0207678_100060632 174
774 3300026116 Ga0207674_10193343 Ga0207674_101933432 174
775 3300026121 Ga0207683_10222611 Ga0207683_102226112 174
776 3300026142 Ga0207698_12055493 Ga0207698_120554931 174
777 3300028379 Ga0268266_10045135 Ga0268266_100451352 174
778 3300031731 Ga0307405_10148856 Ga0307405_101488562 174
779 3300031824 Ga0307413_10035173 Ga0307413_100351732 174
780 3300031852 Ga0307410_10010532 Ga0307410_100105322 174
781 3300031901 Ga0307406_10547227 Ga0307406_105472272 174
782 3300031903 Ga0307407_10105882 Ga0307407_101058822 174
783 3300031995 Ga0307409_100115218 Ga0307409_1001152182 174
784 3300032002 Ga0307416_100020756 Ga0307416_1000207563 174
785 3300032004 Ga0307414_10040743 Ga0307414_100407432 174
786 3300032005 Ga0307411_10007591 Ga0307411_100075912 174
787 3300032126 Ga0307415_100004410 Ga0307415_1000044103 174
788 3300035724 Ga0373933_0653287 Ga0373933_0653287_16_543 174
789 3300037312 Ga0395899_0048839 Ga0395899_0048839_142_666 174
790 3300037312 Ga0395899_0102274 Ga0395899_0102274_1466_1990 174
791 3300037312 Ga0395899_0213622 Ga0395899_0213622_499_1023 174
792 3300037418 Ga0395900_0062637 Ga0395900_0062637_728_1252 174
793 3300037418 Ga0395900_0130385 Ga0395900_0130385_598_1122 174
794 3300037418 Ga0395900_0164577 Ga0395900_0164577_596_1120 174
795 3300037418 Ga0395900_0308123 Ga0395900_0308123_1019_1543 174
796 3300037418 Ga0395900_1333342 Ga0395900_1333342_47_571 174
797 3300037466 Ga0395898_0019188 Ga0395898_0019188_4161_4685 174
798 3300037466 Ga0395898_0055306 Ga0395898_0055306_1024_1548 174
799 3300037466 Ga0395898_0678779 Ga0395898_0678779_187_711 174
800 3300037471 Ga0395905_0028510 Ga0395905_0028510_1470_1994 174
801 3300037471 Ga0395905_0037838 Ga0395905_0037838_2289_2813 174
802 3300037471 Ga0395905_0128774 Ga0395905_0128774_1828_2352 174
803 3300037471 Ga0395905_0144847 Ga0395905_0144847_204_728 174
804 3300037471 Ga0395905_0212009 Ga0395905_0212009_293_817 174
805 3300037471 Ga0395905_0647645 Ga0395905_0647645_154_678 174
806 3300037471 Ga0395905_0665994 Ga0395905_0665994_211_735 174
807 3300037471 Ga0395905_0999755 Ga0395905_0999755_159_683 174
808 3300038443 Ga0395901_0115762 Ga0395901_0115762_1337_1861 174
809 3300038443 Ga0395901_0116588 Ga0395901_0116588_93_617 174
810 3300038443 Ga0395901_0121033 Ga0395901_0121033_406_930 174
811 3300038443 Ga0395901_0133252 Ga0395901_0133252_2057_2581 174
812 3300038443 Ga0395901_0642761 Ga0395901_0642761_414_938 174
813 3300038443 Ga0395901_0902722 Ga0395901_0902722_190_714 174
814 3300042005 Ga0439448_0004598 Ga0439448_0004598_1411_1935 174
815 3300042157 Ga0439458_0000480 Ga0439458_0000480_1977_2501 174
816 3300044684 Ga0466966_0705909 Ga0466966_0705909_17_541 174
817 3300044694 Ga0466963_0006272 Ga0466963_0006272_2854_3378 174
818 3300044694 Ga0466963_0150551 Ga0466963_0150551_343_867 174
819 3300044694 Ga0466963_0467005 Ga0466963_0467005_218_742 174
820 3300044719 Ga0466971_0064787 Ga0466971_0064787_1071_1595 174
821 3300044842 Ga0466957_0011371 Ga0466957_0011371_278_802 174
822 3300044842 Ga0466957_0575264 Ga0466957_0575264_33_557 174
823 3300045836 Ga0466958_0221517 Ga0466958_0221517_475_999 174
824 3300045976 Ga0466967_0724920 Ga0466967_0724920_401_925 174
825 3300046525 Ga0495663_0125449 Ga0495663_0125449_56_583 174
826 3300046535 Ga0495586_0392618 Ga0495586_0392618_236_763 174
827 3300046537 Ga0495598_0002244 Ga0495598_0002244_1790_2317 174
828 3300046539 Ga0495621_0000972 Ga0495621_0000972_3734_4261 174
829 3300046558 Ga0495633_0042594 Ga0495633_0042594_1161_1688 174
830 3300046684 Ga0495669_0029165 Ga0495669_0029165_612_1139 174
831 3300046691 Ga0495670_0000071 Ga0495670_0000071_31344_31871 174
832 3300046809 Ga0495600_0265660 Ga0495600_0265660_321_848 174
833 3300048911 Ga0496108_0006177 Ga0496108_0006177_1353_1877 174
834 3300048915 Ga0496112_0263820 Ga0496112_0263820_784_1308 174
835 3300048916 Ga0496113_0695847 Ga0496113_0695847_20_544 174
836 3300059510 Ga0587090_014290 Ga0587090_014290_187_711 174
837 3300061719 Ga0466962_0006344 Ga0466962_0006344_1556_2080 174
838 3300001979 JGI24740J21852_10001126 JGI24740J21852_1000112614 175
839 3300002067 JGI24735J21928_10017009 JGI24735J21928_100170095 175
840 3300005327 Ga0070658_10126304 Ga0070658_101263042 175
841 3300005329 Ga0070683_100024323 Ga0070683_1000243232 175
842 3300005336 Ga0070680_100059955 Ga0070680_1000599555 175
843 3300005337 Ga0070682_100013855 Ga0070682_1000138555 175
844 3300005339 Ga0070660_100032328 Ga0070660_1000323283 175
845 3300005341 Ga0070691_10003582 Ga0070691_100035827 175
846 3300005344 Ga0070661_100056051 Ga0070661_1000560511 175
847 3300005344 Ga0070661_100317045 Ga0070661_1003170452 175
848 3300005355 Ga0070671_100015766 Ga0070671_1000157662 175
849 3300005366 Ga0070659_100160934 Ga0070659_1001609341 175
850 3300005455 Ga0070663_100126678 Ga0070663_1001266781 175
851 3300005457 Ga0070662_100432791 Ga0070662_1004327912 175
852 3300005458 Ga0070681_10313255 Ga0070681_103132552 175
853 3300005530 Ga0070679_100044440 Ga0070679_1000444404 175
854 3300005535 Ga0070684_100002671 Ga0070684_1000026719 175
855 3300005539 Ga0068853_100025015 Ga0068853_1000250154 175
856 3300005563 Ga0068855_100124450 Ga0068855_1001244502 175
857 3300005564 Ga0070664_100040831 Ga0070664_1000408314 175
858 3300005564 Ga0070664_100047412 Ga0070664_1000474122 175
859 3300005577 Ga0068857_100091002 Ga0068857_1000910022 175
860 3300005578 Ga0068854_100030482 Ga0068854_1000304823 175
861 3300005614 Ga0068856_100359161 Ga0068856_1003591611 175
862 3300005616 Ga0068852_100031074 Ga0068852_1000310742 175
863 3300005616 Ga0068852_100220790 Ga0068852_1002207901 175
864 3300005618 Ga0068864_100117483 Ga0068864_1001174831 175
865 3300006358 Ga0068871_100382945 Ga0068871_1003829452 175
866 3300009093 Ga0105240_10087322 Ga0105240_100873223 175
867 3300009174 Ga0105241_10025711 Ga0105241_100257114 175
868 3300009177 Ga0105248_10104194 Ga0105248_101041943 175
869 3300009177 Ga0105248_10228183 Ga0105248_102281832 175
870 3300009545 Ga0105237_10021095 Ga0105237_100210955 175
871 3300009551 Ga0105238_10017635 Ga0105238_100176358 175
872 3300013100 Ga0157373_10014198 Ga0157373_100141987 175
873 3300013105 Ga0157369_10165280 Ga0157369_101652802 175
874 3300013296 Ga0157374_10293136 Ga0157374_102931362 175
875 3300013296 Ga0157374_10323900 Ga0157374_103239002 175
876 3300013307 Ga0157372_10159755 Ga0157372_101597552 175
877 3300020070 Ga0206356_11797130 Ga0206356_117971302 175
878 3300025904 Ga0207647_10007000 Ga0207647_1000700010 175
879 3300025909 Ga0207705_10028284 Ga0207705_100282842 175
880 3300025909 Ga0207705_10042739 Ga0207705_100427392 175
881 3300025912 Ga0207707_10209630 Ga0207707_102096302 175
882 3300025913 Ga0207695_10008855 Ga0207695_100088555 175
883 3300025914 Ga0207671_10028319 Ga0207671_100283192 175
884 3300025917 Ga0207660_10003208 Ga0207660_100032087 175
885 3300025919 Ga0207657_10006107 Ga0207657_100061074 175
886 3300025920 Ga0207649_10006255 Ga0207649_100062552 175
887 3300025920 Ga0207649_10344207 Ga0207649_103442072 175
888 3300025921 Ga0207652_10151864 Ga0207652_101518641 175
889 3300025924 Ga0207694_10025296 Ga0207694_100252965 175
890 3300025931 Ga0207644_10006207 Ga0207644_100062076 175
891 3300025932 Ga0207690_10152704 Ga0207690_101527042 175
892 3300025933 Ga0207706_10037830 Ga0207706_100378306 175
893 3300025933 Ga0207706_10441557 Ga0207706_104415572 175
894 3300025941 Ga0207711_10204330 Ga0207711_102043302 175
895 3300025941 Ga0207711_10637293 Ga0207711_106372932 175
896 3300025944 Ga0207661_10012640 Ga0207661_100126407 175
897 3300025945 Ga0207679_10059420 Ga0207679_100594204 175
898 3300025945 Ga0207679_10798141 Ga0207679_107981412 175
899 3300025949 Ga0207667_10004710 Ga0207667_1000471010 175
900 3300025981 Ga0207640_10095945 Ga0207640_100959452 175
901 3300026041 Ga0207639_10001159 Ga0207639_1000115922 175
902 3300026067 Ga0207678_10143449 Ga0207678_101434492 175
903 3300026078 Ga0207702_10002063 Ga0207702_1000206324 175
904 3300026095 Ga0207676_10093212 Ga0207676_100932122 175
905 3300026116 Ga0207674_10012374 Ga0207674_1001237411 175
906 3300026142 Ga0207698_10000896 Ga0207698_1000089610 175
907 3300026142 Ga0207698_10310425 Ga0207698_103104251 175
908 3300035121 Ga0373960_0244112 Ga0373960_0244112_27_554 175
909 3300037312 Ga0395899_0021048 Ga0395899_0021048_2398_2925 175
910 3300037418 Ga0395900_0030498 Ga0395900_0030498_4191_4718 175
911 3300037418 Ga0395900_0102036 Ga0395900_0102036_1492_2019 175
912 3300037418 Ga0395900_1028220 Ga0395900_1028220_177_704 175
913 3300037466 Ga0395898_0011721 Ga0395898_0011721_6444_6971 175
914 3300037471 Ga0395905_0045884 Ga0395905_0045884_276_803 175
915 3300037471 Ga0395905_0084238 Ga0395905_0084238_844_1371 175
916 3300037471 Ga0395905_0413108 Ga0395905_0413108_412_939 175
917 3300038443 Ga0395901_0125924 Ga0395901_0125924_800_1327 175
918 3300044693 Ga0466961_0168457 Ga0466961_0168457_412_939 175
919 3300044719 Ga0466971_0241360 Ga0466971_0241360_247_774 175
920 3300044842 Ga0466957_0469958 Ga0466957_0469958_76_603 175
921 3300045049 Ga0466959_0132379 Ga0466959_0132379_592_1119 175
922 3300048904 Ga0496101_0144671 Ga0496101_0144671_36_563 175
923 3300048908 Ga0496105_0137137 Ga0496105_0137137_1166_1693 175
924 3300048910 Ga0496107_0011494 Ga0496107_0011494_4273_4800 175
925 3300048912 Ga0496109_0068968 Ga0496109_0068968_1902_2429 175
926 3300048914 Ga0496111_0029259 Ga0496111_0029259_949_1476 175
927 3300048915 Ga0496112_0054746 Ga0496112_0054746_3153_3680 175
928 3300048916 Ga0496113_0120879 Ga0496113_0120879_1007_1534 175
929 3300048917 Ga0496114_0215334 Ga0496114_0215334_920_1447 175
930 3300048918 Ga0496115_0015819 Ga0496115_0015819_4935_5462 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

95

182

0.88

Feature Viewer

pLDDT pTM Quality
60.34 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map