F485882

General Info

Members Datasets Scaffolds Average Seq Length
925 351 1850 239

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100187673|Ga0070704_1001876732
Length 243
Sequence LRPLHWILIALLLAAVWGSFAYLSLDTGQLLSADAGAQMSKYVLSFFPPDLSLAYLAQTWRGAVETIAISAIGTALPASGRFGVIPRVIARLLLNFLRSIPELVWAALMVFAAGLGPLAGTLALAWHTTGVIGRLFAETLENAPPEPAQALRLAGARPLVTFLYGTLPSVTAQFVAYILYRWEINIRMAAILGVVGAGGLGQMLYMSLSLFQQSQAMTVILAMLMLVALVDAASAWLRQRLAQ

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
51 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
52 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
61 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
62 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
79 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
88 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
89 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
90 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
91 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
92 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
93 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
94 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
101 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
201 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
205 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
206 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
207 2511231004 Pseudomonas sp. GM102 Isolate Nodule
208 2511231007 Pseudomonas sp. GM18 Isolate Nodule
209 2511231008 Pseudomonas sp. GM21 Isolate Nodule
210 2511231010 Pseudomonas sp. GM25 Isolate Nodule
211 2511231011 Pseudomonas sp. GM30 Isolate Nodule
212 2511231012 Pseudomonas sp. GM33 Isolate Nodule
213 2511231014 Pseudomonas sp. GM48 Isolate Nodule
214 2511231015 Pseudomonas sp. GM49 Isolate Nodule
215 2511231016 Pseudomonas sp. GM50 Isolate Nodule
216 2511231017 Pseudomonas sp. GM55 Isolate Nodule
217 2511231020 Pseudomonas sp. GM74 Isolate Nodule
218 2511231021 Pseudomonas sp. GM78 Isolate Nodule
219 2511231022 Pseudomonas sp. GM79 Isolate Nodule
220 2511231023 Pseudomonas sp. GM80 Isolate Nodule
221 2511231024 Pseudomonas sp. GM84 Isolate Nodule
222 2511231031 Pseudomonas sp. GM16 Isolate Nodule
223 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
224 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
225 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
226 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
227 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
228 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
229 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
230 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
231 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
232 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
233 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
234 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
235 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
236 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
237 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
238 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
239 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
240 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
241 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
242 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
243 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
244 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
245 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
246 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
247 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
248 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
249 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
250 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
251 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
252 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
253 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
254 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
255 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
256 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
257 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
258 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
259 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
260 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
261 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
262 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
263 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
264 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
265 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
266 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
267 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
268 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
269 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
270 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
271 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
272 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
273 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
274 2765235841 Pseudomonas putida AA7 Isolate Unclassified
275 2773857670 Pseudomonas sp. 478 Isolate Unclassified
276 2773857673 Pseudomonas sp. 443 Isolate Unclassified
277 2784132063 Pseudomonas sp. 424 Isolate Unclassified
278 2784132072 Pseudomonas sp. 460 Isolate Unclassified
279 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
280 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
281 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
282 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
283 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
284 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
285 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
286 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
287 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
288 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
289 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
290 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
291 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
292 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
293 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
294 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
295 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
296 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
297 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
298 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
299 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
300 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
301 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
302 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
303 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
304 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
305 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
306 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
307 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
308 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
309 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
310 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
311 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
312 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
313 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
314 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
315 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
316 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
317 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
318 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
319 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
320 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
321 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
322 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
323 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
324 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
325 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
326 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
327 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
328 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
329 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
330 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
331 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
332 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
333 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
334 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
335 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
336 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
337 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
338 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
339 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
340 8052494512 Pseudomonas putida LD6 Isolate Unclassified
341 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
342 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
343 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
344 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
345 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
346 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
347 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
348 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
349 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
350 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
351 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.32
Metatranscriptomes 0
Isolates 15.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 2.49
Rhizoplane 4.54
Rhizosphere 78.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100187673 3300005549 Bacteria 1659
2 MRS2a_Contig_18 2124908027 Bacteria 64424
3 MRS2a_Contig_8998 2124908027 Bacteria 2308
4 MRS2a_Contig_9449 2124908027 Bacteria 1857
5 SwRhRL2b_contig_3354362 2162886007 Bacteria 6540
6 Ga0055536_1000326 3300003781 Bacteria 35045
7 Ga0055530_10000123 3300003791 Bacteria 66893
8 Ga0055530_10000264 3300003791 Bacteria 47402
9 Ga0055530_10023133 3300003791 Bacteria 1792
10 Ga0055540_1000008 3300003792 Bacteria 309635
11 Ga0055540_1000159 3300003792 Bacteria 66893
12 Ga0055531_10000182 3300003794 Bacteria 70786
13 Ga0065714_10000094 3300005288 Bacteria 11756
14 Ga0065714_10002654 3300005288 Bacteria 15998
15 Ga0065714_10004889 3300005288 Bacteria 7710
16 Ga0065714_10011480 3300005288 Bacteria 4064
17 Ga0065714_10011782 3300005288 Bacteria 2078
18 Ga0065714_10093893 3300005288 Bacteria 1833
19 Ga0065704_10002237 3300005289 Bacteria 6732
20 Ga0065704_10002354 3300005289 Bacteria 7200
21 Ga0065704_10072581 3300005289 Bacteria 8302
22 Ga0065712_10068177 3300005290 Bacteria 13441
23 Ga0065715_10137665 3300005293 Bacteria 1903
24 Ga0070668_100689372 3300005347 Bacteria 900
25 Ga0070674_100512194 3300005356 Bacteria 1001
26 Ga0070697_100135876 3300005536 Bacteria 2065
27 Ga0070665_100074472 3300005548 Bacteria 3401
28 Ga0075432_10000899 3300006058 Bacteria 9356
29 Ga0075432_10004800 3300006058 Bacteria 4598
30 Ga0075432_10048725 3300006058 Bacteria 1491
31 Ga0075432_10081281 3300006058 Bacteria 1175
32 Ga0075362_10059773 3300006177 Bacteria 1722
33 Ga0075436_100067419 3300006914 Bacteria 2473
34 Ga0099823_1000053 3300006944 Bacteria 55681
35 Ga0099823_1032365 3300006944 Bacteria 4260
36 Ga0079104_1000142 3300006946 Bacteria 101403
37 Ga0079104_1006789 3300006946 Bacteria 4253
38 Ga0079104_1062563 3300006946 Bacteria 798
39 Ga0105251_10004550 3300009011 Bacteria 9390
40 Ga0105251_10011318 3300009011 Bacteria 5104
41 Ga0105251_10013120 3300009011 Bacteria 4650
42 Ga0105251_10040028 3300009011 Bacteria 2287
43 Ga0105251_10058019 3300009011 Bacteria 1829
44 Ga0105251_10152306 3300009011 Bacteria 1044
45 Ga0105244_10001121 3300009036 Bacteria 22286
46 Ga0105244_10001639 3300009036 Bacteria 17718
47 Ga0105244_10004838 3300009036 Bacteria 9135
48 Ga0105244_10006107 3300009036 Bacteria 7867
49 Ga0105244_10015579 3300009036 Bacteria 4357
50 Ga0105244_10017468 3300009036 Bacteria 4053
51 Ga0105244_10029717 3300009036 Bacteria 2916
52 Ga0105244_10030400 3300009036 Bacteria 2874
53 Ga0105244_10043792 3300009036 Bacteria 2307
54 Ga0105244_10056700 3300009036 Bacteria 1982
55 Ga0105244_10075351 3300009036 Bacteria 1677
56 Ga0105250_10000155 3300009092 Bacteria 59663
57 Ga0105250_10003962 3300009092 Bacteria 6910
58 Ga0105250_10010355 3300009092 Bacteria 3886
59 Ga0105243_10000060 3300009148 Bacteria 128124
60 Ga0105243_10004215 3300009148 Bacteria 11391
61 Ga0105243_10010557 3300009148 Bacteria 7013
62 Ga0105243_10329813 3300009148 Bacteria 1393
63 Ga0105246_10002304 3300011119 Bacteria 11522
64 Ga0105246_10026464 3300011119 Bacteria 3790
65 Ga0157345_1000033 3300012498 Bacteria 34662
66 Ga0157373_10000374 3300013100 Bacteria 35786
67 Ga0157373_10009374 3300013100 Bacteria 7233
68 Ga0157373_10090453 3300013100 Bacteria 2156
69 Ga0157371_10000535 3300013102 Bacteria 45229
70 Ga0157371_10003129 3300013102 Bacteria 15287
71 Ga0157371_10154263 3300013102 Bacteria 1639
72 Ga0157370_10006679 3300013104 Bacteria 12666
73 Ga0157370_10033641 3300013104 Bacteria 4998
74 Ga0157370_10091334 3300013104 Bacteria 2858
75 Ga0157370_10349023 3300013104 Bacteria 1364
76 Ga0157369_10001093 3300013105 Bacteria 33888
77 Ga0157369_10105343 3300013105 Bacteria 3003
78 Ga0157369_10206559 3300013105 Bacteria 2060
79 Ga0163162_10000137 3300013306 Bacteria 66670
80 Ga0157372_10004578 3300013307 Bacteria 14708
81 Ga0157372_10075658 3300013307 Bacteria 3799
82 Ga0157375_10123671 3300013308 Bacteria 2700
83 Ga0157375_10299898 3300013308 Bacteria 1771
84 Ga0182008_10002912 3300014497 Bacteria 10586
85 Ga0182008_10010555 3300014497 Bacteria 4941
86 Ga0182008_10060072 3300014497 Bacteria 1875
87 Ga0182008_10097186 3300014497 Bacteria 1454
88 Ga0182008_10120832 3300014497 Bacteria 1302
89 Ga0182006_1000701 3300015261 Bacteria 23188
90 Ga0182006_1001574 3300015261 Bacteria 13603
91 Ga0182006_1002883 3300015261 Bacteria 9139
92 Ga0182006_1003069 3300015261 Bacteria 8760
93 Ga0182006_1003138 3300015261 Bacteria 8648
94 Ga0182006_1009054 3300015261 Bacteria 4479
95 Ga0182006_1079368 3300015261 Bacteria 1200
96 Ga0182007_10002465 3300015262 Bacteria 9185
97 Ga0182005_1001174 3300015265 Bacteria 10827
98 Ga0182005_1005064 3300015265 Bacteria 4158
99 Ga0182005_1006236 3300015265 Bacteria 3662
100 Ga0182005_1006585 3300015265 Bacteria 3534
101 Ga0182005_1036085 3300015265 Bacteria 1344
102 Ga0182005_1058587 3300015265 Bacteria 1051
103 Ga0163161_10000054 3300017792 Bacteria 117153
104 Ga0163161_10008562 3300017792 Bacteria 7076
105 Ga0163161_10037541 3300017792 Bacteria 3473
106 Ga0163161_10165085 3300017792 Bacteria 1690
107 Ga0209563_100549 3300025230 Bacteria 12534
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000050 3300025292 Bacteria 398350
110 Ga0209676_1000306 3300025292 Bacteria 97332
111 Ga0209676_1001444 3300025292 Bacteria 22371
112 Ga0209676_1002014 3300025292 Bacteria 16005
113 Ga0209050_1000006 3300025298 Bacteria 1359702
114 Ga0209050_1000013 3300025298 Bacteria 811408
115 Ga0209050_1000973 3300025298 Bacteria 36681
116 Ga0209050_1008518 3300025298 Bacteria 5460
117 Ga0209051_1000001 3300025303 Bacteria 1732974
118 Ga0209051_1000007 3300025303 Bacteria 811408
119 Ga0209051_1001630 3300025303 Bacteria 18200
120 Ga0209257_1000029 3300025304 Bacteria 695617
121 Ga0207696_1000120 3300025711 Bacteria 146581
122 Ga0207696_1000223 3300025711 Bacteria 82090
123 Ga0207696_1003244 3300025711 Bacteria 7505
124 Ga0207696_1006777 3300025711 Bacteria 4568
125 Ga0207655_1000076 3300025728 Bacteria 226359
126 Ga0207655_1000917 3300025728 Bacteria 30594
127 Ga0207655_1000950 3300025728 Bacteria 30016
128 Ga0207655_1003134 3300025728 Bacteria 12512
129 Ga0207655_1003660 3300025728 Bacteria 11341
130 Ga0207655_1004390 3300025728 Bacteria 10017
131 Ga0207655_1006716 3300025728 Bacteria 7577
132 Ga0207655_1010927 3300025728 Bacteria 5460
133 Ga0207655_1037001 3300025728 Bacteria 2155
134 Ga0207655_1044751 3300025728 Bacteria 1856
135 Ga0207655_1070120 3300025728 Bacteria 1307
136 Ga0207713_1000271 3300025735 Bacteria 63332
137 Ga0207713_1000924 3300025735 Bacteria 26352
138 Ga0207713_1004288 3300025735 Bacteria 9295
139 Ga0207713_1004346 3300025735 Bacteria 9222
140 Ga0207713_1007615 3300025735 Bacteria 6343
141 Ga0207713_1010844 3300025735 Bacteria 5010
142 Ga0207713_1016140 3300025735 Bacteria 3801
143 Ga0207713_1028298 3300025735 Bacteria 2530
144 Ga0207713_1040769 3300025735 Bacteria 1945
145 Ga0207713_1061643 3300025735 Bacteria 1426
146 Ga0207707_10028584 3300025912 Bacteria 4873
147 Ga0207646_10287715 3300025922 Bacteria 1485
148 Ga0207709_10000004 3300025935 Bacteria 825156
149 Ga0207709_10002110 3300025935 Bacteria 12791
150 Ga0207709_10032131 3300025935 Bacteria 3072
151 Ga0209281_1000262 3300027111 Bacteria 101417
152 Ga0209389_1000058 3300027296 Bacteria 107349
153 Ga0209371_1000422 3300027312 Bacteria 43590
154 Ga0209371_1000474 3300027312 Bacteria 39389
155 Ga0209981_1003924 3300027378 Bacteria 1937
156 Ga0209996_1004065 3300027395 Bacteria 1854
157 Ga0209968_1001905 3300027526 Bacteria 3172
158 Ga0209983_1008384 3300027665 Bacteria 2114
159 Ga0207428_10017734 3300027907 Bacteria 6106
160 Ga0207428_10021135 3300027907 Bacteria 5513
161 Ga0207428_10028742 3300027907 Bacteria 4616
162 Ga0207428_10118283 3300027907 Bacteria 2034
163 Ga0268266_10046510 3300028379 Bacteria 3715
164 Ga0268256_1000348 3300030500 Bacteria 44758
165 Ga0268256_1000401 3300030500 Bacteria 39389
166 Ga0314311_1064093 3300030733 Bacteria 1685
167 Ga0316178_1161168 3300030735 Bacteria 3445
168 Ga0316183_1060334 3300030742 Bacteria 2193
169 Ga0307408_100000047 3300031548 Bacteria 166310
170 Ga0307408_100000145 3300031548 Bacteria 79041
171 Ga0307408_100012110 3300031548 Bacteria 5708
172 Ga0307408_100137637 3300031548 Bacteria 1912
173 Ga0307405_10000105 3300031731 Bacteria 34490
174 Ga0307413_10013538 3300031824 Bacteria 4105
175 Ga0307413_10159575 3300031824 Bacteria 1582
176 Ga0307406_10004668 3300031901 Bacteria 7463
177 Ga0307406_10062570 3300031901 Bacteria 2408
178 Ga0307412_10000316 3300031911 Bacteria 30467
179 Ga0307412_10000393 3300031911 Bacteria 26995
180 Ga0307412_10420155 3300031911 Bacteria 1093
181 Ga0307409_100153959 3300031995 Bacteria 2000
182 Ga0307416_100110681 3300032002 Bacteria 2419
183 Ga0307416_100372618 3300032002 Bacteria 1454
184 Ga0307414_10011515 3300032004 Bacteria 5191
185 Ga0307414_10031191 3300032004 Bacteria 3493
186 Ga0307414_10036272 3300032004 Bacteria 3290
187 Ga0307414_10211772 3300032004 Bacteria 1584
188 Ga0307414_10215522 3300032004 Bacteria 1572
189 Ga0307411_10006919 3300032005 Bacteria 5720
190 Ga0307510_10002563 3300033180 Bacteria 20701
191 Ga0237819_01250 3300038705 Bacteria 6994
192 Ga0439438_000082 3300041405 Bacteria 44059
193 Ga0439438_000084 3300041405 Bacteria 43384
194 Ga0439438_000129 3300041405 Bacteria 34152
195 Ga0439438_000142 3300041405 Bacteria 32669
196 Ga0439438_000381 3300041405 Bacteria 19932
197 Ga0439438_000587 3300041405 Bacteria 16488
198 Ga0439438_001301 3300041405 Bacteria 11050
199 Ga0439438_006911 3300041405 Bacteria 3946
200 Ga0439438_012069 3300041405 Bacteria 2662
201 Ga0439438_028491 3300041405 Bacteria 1502
202 Ga0439447_000016 3300041407 Bacteria 61120
203 Ga0439447_000944 3300041407 Bacteria 10621
204 Ga0439447_004202 3300041407 Bacteria 4998
205 Ga0439447_007618 3300041407 Bacteria 3414
206 Ga0439447_012008 3300041407 Bacteria 2506
207 Ga0439447_016519 3300041407 Bacteria 2024
208 Ga0439447_017394 3300041407 Bacteria 1957
209 Ga0439447_032972 3300041407 Bacteria 1292
210 Ga0439447_038248 3300041407 Bacteria 1179
211 Ga0439466_0003255 3300041411 Bacteria 6324
212 Ga0439466_0006422 3300041411 Bacteria 4469
213 Ga0439466_0012649 3300041411 Bacteria 3102
214 Ga0439466_0014866 3300041411 Bacteria 2830
215 Ga0439466_0022528 3300041411 Bacteria 2223
216 Ga0439466_0022734 3300041411 Bacteria 2210
217 Ga0439466_0028195 3300041411 Bacteria 1939
218 Ga0439466_0086446 3300041411 Bacteria 985
219 Ga0439431_0014914 3300041997 Bacteria 1805
220 Ga0439437_000265 3300042000 Bacteria 4804
221 Ga0439445_0041075 3300042004 Bacteria 1229
222 Ga0439432_000256 3300042006 Bacteria 19094
223 Ga0439432_003928 3300042006 Bacteria 5469
224 Ga0439432_006190 3300042006 Bacteria 4285
225 Ga0439432_019451 3300042006 Bacteria 2261
226 Ga0439432_022984 3300042006 Bacteria 2056
227 Ga0439432_106663 3300042006 Bacteria 835
228 Ga0439451_004218 3300042009 Bacteria 2916
229 Ga0439452_000045 3300042010 Bacteria 131508
230 Ga0439452_000077 3300042010 Bacteria 84014
231 Ga0439452_000093 3300042010 Bacteria 77343
232 Ga0439452_000986 3300042010 Bacteria 12720
233 Ga0439452_034871 3300042010 Bacteria 1213
234 Ga0439455_0012960 3300042012 Bacteria 1880
235 Ga0439456_000138 3300042013 Bacteria 22270
236 Ga0439456_015871 3300042013 Bacteria 1574
237 Ga0439456_017372 3300042013 Bacteria 1508
238 Ga0439456_025626 3300042013 Bacteria 1253
239 Ga0450911_000007 3300042115 Bacteria 212322
240 Ga0450911_000095 3300042115 Bacteria 35787
241 Ga0450911_001049 3300042115 Bacteria 7049
242 Ga0450920_009359 3300042122 Bacteria 1801
243 Ga0450922_000353 3300042124 Bacteria 4898
244 Ga0450923_010659 3300042125 Bacteria 1637
245 Ga0450900_000727 3300042136 Bacteria 2809
246 Ga0450900_007245 3300042136 Bacteria 1362
247 Ga0450900_009735 3300042136 Bacteria 1222
248 Ga0450902_000218 3300042137 Bacteria 6758
249 Ga0450902_003090 3300042137 Bacteria 2407
250 Ga0450902_004520 3300042137 Bacteria 2073
251 Ga0450903_011456 3300042138 Bacteria 1428
252 Ga0450903_018574 3300042138 Bacteria 1082
253 Ga0450904_000052 3300042139 Bacteria 26235
254 Ga0450905_000698 3300042142 Bacteria 4110
255 Ga0450905_000982 3300042142 Bacteria 3573
256 Ga0450905_004594 3300042142 Bacteria 1834
257 Ga0450905_005801 3300042142 Bacteria 1658
258 Ga0450905_020448 3300042142 Bacteria 974
259 Ga0450906_000099 3300042145 Bacteria 14667
260 Ga0450907_000001 3300042146 Bacteria 236562
261 Ga0450907_006178 3300042146 Bacteria 2005
262 Ga0439446_0000430 3300042156 Bacteria 8219
263 Ga0439446_0011500 3300042156 Bacteria 2403
264 Ga0450909_008840 3300042185 Bacteria 1467
265 Ga0439434_0002321 3300042435 Bacteria 5536
266 Ga0439459_0006033 3300042438 Bacteria 2008
267 Ga0450893_0003380 3300042532 Bacteria 2512
268 Ga0450893_0013005 3300042532 Bacteria 1385
269 Ga0450901_000299 3300042533 Bacteria 6074
270 Ga0451577_0033632 3300042876 Bacteria 4622
271 Ga0495617_001175 3300046452 Bacteria 11840
272 Ga0495617_001262 3300046452 Bacteria 11330
273 Ga0495617_001894 3300046452 Bacteria 8807
274 Ga0495617_002189 3300046452 Bacteria 7996
275 Ga0495617_009618 3300046452 Bacteria 3316
276 Ga0495617_018367 3300046452 Bacteria 2364
277 Ga0495617_019752 3300046452 Bacteria 2277
278 Ga0495627_000497 3300046453 Bacteria 32934
279 Ga0495627_001769 3300046453 Bacteria 11609
280 Ga0495627_003412 3300046453 Bacteria 7032
281 Ga0495627_007118 3300046453 Bacteria 4324
282 Ga0495627_007299 3300046453 Bacteria 4251
283 Ga0495627_060990 3300046453 Bacteria 1116
284 Ga0495592_0008121 3300046454 Bacteria 7882
285 Ga0495603_0027901 3300046455 Bacteria 3404
286 Ga0495590_0000153 3300046457 Bacteria 41540
287 Ga0495590_0000173 3300046457 Bacteria 37961
288 Ga0495590_0003010 3300046457 Bacteria 6902
289 Ga0495590_0006207 3300046457 Bacteria 4678
290 Ga0495590_0009621 3300046457 Bacteria 3666
291 Ga0495591_000021 3300046458 Bacteria 203554
292 Ga0495591_000197 3300046458 Bacteria 61590
293 Ga0495591_000215 3300046458 Bacteria 58398
294 Ga0495591_000263 3300046458 Bacteria 49869
295 Ga0495591_000424 3300046458 Bacteria 34889
296 Ga0495591_001323 3300046458 Bacteria 15586
297 Ga0495591_001467 3300046458 Bacteria 14602
298 Ga0495591_001651 3300046458 Bacteria 13438
299 Ga0495591_005378 3300046458 Bacteria 5945
300 Ga0495591_008864 3300046458 Bacteria 4063
301 Ga0495591_013667 3300046458 Bacteria 2955
302 Ga0495591_016643 3300046458 Bacteria 2551
303 Ga0495638_0000417 3300046460 Bacteria 51723
304 Ga0495638_0001489 3300046460 Bacteria 21175
305 Ga0495638_0003874 3300046460 Bacteria 11599
306 Ga0495638_0004178 3300046460 Bacteria 11003
307 Ga0495638_0007715 3300046460 Bacteria 7689
308 Ga0495638_0007972 3300046460 Bacteria 7553
309 Ga0495638_0032197 3300046460 Bacteria 3364
310 Ga0495638_0058356 3300046460 Bacteria 2391
311 Ga0495638_0073273 3300046460 Bacteria 2091
312 Ga0495638_0192605 3300046460 Bacteria 1156
313 Ga0495638_0204759 3300046460 Bacteria 1111
314 Ga0495638_0249273 3300046460 Bacteria 980
315 Ga0495653_0010448 3300046463 Bacteria 7596
316 Ga0495653_0031584 3300046463 Bacteria 4208
317 Ga0495650_0001410 3300046471 Bacteria 23440
318 Ga0495650_0009288 3300046471 Bacteria 5611
319 Ga0495650_0018577 3300046471 Bacteria 3449
320 Ga0495650_0025036 3300046471 Bacteria 2807
321 Ga0495650_0034670 3300046471 Bacteria 2230
322 Ga0495650_0065037 3300046471 Bacteria 1448
323 Ga0495605_0000631 3300046474 Bacteria 27198
324 Ga0495605_0000642 3300046474 Bacteria 26793
325 Ga0495605_0010341 3300046474 Bacteria 5223
326 Ga0495605_0010825 3300046474 Bacteria 5095
327 Ga0495605_0011230 3300046474 Bacteria 5000
328 Ga0495605_0014049 3300046474 Bacteria 4392
329 Ga0495605_0034965 3300046474 Bacteria 2541
330 Ga0495605_0048502 3300046474 Bacteria 2078
331 Ga0495605_0051715 3300046474 Bacteria 1999
332 Ga0495605_0059902 3300046474 Bacteria 1826
333 Ga0495605_0073641 3300046474 Bacteria 1608
334 Ga0495639_0000976 3300046475 Bacteria 12890
335 Ga0495584_0000038 3300046491 Bacteria 93590
336 Ga0495584_0002610 3300046491 Bacteria 10155
337 Ga0495584_0003775 3300046491 Bacteria 8257
338 Ga0495584_0022319 3300046491 Bacteria 3212
339 Ga0495584_0025026 3300046491 Bacteria 3026
340 Ga0495584_0035860 3300046491 Bacteria 2506
341 Ga0495584_0039421 3300046491 Bacteria 2386
342 Ga0495584_0056071 3300046491 Bacteria 1982
343 Ga0495584_0152872 3300046491 Bacteria 1172
344 Ga0495584_0163000 3300046491 Bacteria 1133
345 Ga0495585_0000030 3300046492 Bacteria 145184
346 Ga0495585_0000978 3300046492 Bacteria 23984
347 Ga0495585_0000991 3300046492 Bacteria 23790
348 Ga0495585_0002454 3300046492 Bacteria 13277
349 Ga0495585_0004028 3300046492 Bacteria 9675
350 Ga0495585_0004818 3300046492 Bacteria 8668
351 Ga0495585_0010922 3300046492 Bacteria 5396
352 Ga0495585_0020734 3300046492 Bacteria 3778
353 Ga0495585_0157892 3300046492 Bacteria 1178
354 Ga0495585_0211342 3300046492 Bacteria 983
355 Ga0495594_0161312 3300046499 Bacteria 1275
356 Ga0495596_0000128 3300046500 Bacteria 52409
357 Ga0495596_0093589 3300046500 Bacteria 1166
358 Ga0495596_0105197 3300046500 Bacteria 1096
359 Ga0495607_0000259 3300046501 Bacteria 56558
360 Ga0495607_0000271 3300046501 Bacteria 55714
361 Ga0495607_0002455 3300046501 Bacteria 15063
362 Ga0495607_0007174 3300046501 Bacteria 7744
363 Ga0495607_0009311 3300046501 Bacteria 6655
364 Ga0495607_0029413 3300046501 Bacteria 3381
365 Ga0495607_0030262 3300046501 Bacteria 3325
366 Ga0495607_0031242 3300046501 Bacteria 3261
367 Ga0495607_0036326 3300046501 Bacteria 2969
368 Ga0495607_0103287 3300046501 Bacteria 1523
369 Ga0495607_0104726 3300046501 Bacteria 1509
370 Ga0495607_0133962 3300046501 Bacteria 1285
371 Ga0495583_0004024 3300046506 Bacteria 10827
372 Ga0495583_0012601 3300046506 Bacteria 4772
373 Ga0495583_0023322 3300046506 Bacteria 3133
374 Ga0495606_0000682 3300046507 Bacteria 53150
375 Ga0495606_0000706 3300046507 Bacteria 51756
376 Ga0495606_0001735 3300046507 Bacteria 28008
377 Ga0495606_0005536 3300046507 Bacteria 12052
378 Ga0495606_0018967 3300046507 Bacteria 5139
379 Ga0495606_0019110 3300046507 Bacteria 5111
380 Ga0495606_0027951 3300046507 Bacteria 3987
381 Ga0495606_0060228 3300046507 Bacteria 2432
382 Ga0495610_0002828 3300046512 Bacteria 14135
383 Ga0495610_0003987 3300046512 Bacteria 11154
384 Ga0495610_0004167 3300046512 Bacteria 10811
385 Ga0495610_0006782 3300046512 Bacteria 7767
386 Ga0495610_0007526 3300046512 Bacteria 7217
387 Ga0495610_0026697 3300046512 Bacteria 3079
388 Ga0495610_0027204 3300046512 Bacteria 3043
389 Ga0495610_0060396 3300046512 Bacteria 1805
390 Ga0495610_0072621 3300046512 Bacteria 1601
391 Ga0495610_0089118 3300046512 Bacteria 1401
392 Ga0495616_0000203 3300046513 Bacteria 49328
393 Ga0495616_0000259 3300046513 Bacteria 42870
394 Ga0495616_0000364 3300046513 Bacteria 35589
395 Ga0495616_0000506 3300046513 Bacteria 29552
396 Ga0495616_0001740 3300046513 Bacteria 14813
397 Ga0495616_0024638 3300046513 Bacteria 3225
398 Ga0495616_0037996 3300046513 Bacteria 2473
399 Ga0495616_0064079 3300046513 Bacteria 1794
400 Ga0495616_0133724 3300046513 Bacteria 1134
401 Ga0495620_0000126 3300046515 Bacteria 62048
402 Ga0495620_0001136 3300046515 Bacteria 16251
403 Ga0495620_0010342 3300046515 Bacteria 4925
404 Ga0495620_0011971 3300046515 Bacteria 4505
405 Ga0495620_0024159 3300046515 Bacteria 2894
406 Ga0495620_0035790 3300046515 Bacteria 2228
407 Ga0495620_0037449 3300046515 Bacteria 2160
408 Ga0495620_0100470 3300046515 Bacteria 1153
409 Ga0495620_0117126 3300046515 Bacteria 1052
410 Ga0495628_0068821 3300046516 Bacteria 2761
411 Ga0495630_0093697 3300046517 Bacteria 2270
412 Ga0495631_0000391 3300046518 Bacteria 30231
413 Ga0495631_0000554 3300046518 Bacteria 25074
414 Ga0495631_0018180 3300046518 Bacteria 3313
415 Ga0495631_0026550 3300046518 Bacteria 2658
416 Ga0495631_0047885 3300046518 Bacteria 1875
417 Ga0495631_0065988 3300046518 Bacteria 1566
418 Ga0495631_0090974 3300046518 Bacteria 1314
419 Ga0495632_0000229 3300046519 Bacteria 56776
420 Ga0495632_0001123 3300046519 Bacteria 22908
421 Ga0495632_0001858 3300046519 Bacteria 16984
422 Ga0495632_0003181 3300046519 Bacteria 11833
423 Ga0495632_0010196 3300046519 Bacteria 5583
424 Ga0495632_0015470 3300046519 Bacteria 4276
425 Ga0495632_0026437 3300046519 Bacteria 3055
426 Ga0495632_0029092 3300046519 Bacteria 2879
427 Ga0495632_0100915 3300046519 Bacteria 1360
428 Ga0495637_0000275 3300046520 Bacteria 40472
429 Ga0495637_0001100 3300046520 Bacteria 16650
430 Ga0495637_0003034 3300046520 Bacteria 8975
431 Ga0495637_0003254 3300046520 Bacteria 8653
432 Ga0495637_0004009 3300046520 Bacteria 7682
433 Ga0495637_0005301 3300046520 Bacteria 6592
434 Ga0495637_0006180 3300046520 Bacteria 6026
435 Ga0495637_0007420 3300046520 Bacteria 5431
436 Ga0495637_0016390 3300046520 Bacteria 3464
437 Ga0495637_0019589 3300046520 Bacteria 3126
438 Ga0495643_0000783 3300046522 Bacteria 35376
439 Ga0495643_0000955 3300046522 Bacteria 29765
440 Ga0495643_0001640 3300046522 Bacteria 19740
441 Ga0495643_0015728 3300046522 Bacteria 4462
442 Ga0495643_0034520 3300046522 Bacteria 2790
443 Ga0495643_0040732 3300046522 Bacteria 2535
444 Ga0495643_0062671 3300046522 Bacteria 1968
445 Ga0495643_0085863 3300046522 Bacteria 1631
446 Ga0495643_0135047 3300046522 Bacteria 1235
447 Ga0495644_0000314 3300046523 Bacteria 22404
448 Ga0495644_0001197 3300046523 Bacteria 10629
449 Ga0495644_0005610 3300046523 Bacteria 4895
450 Ga0495644_0042296 3300046523 Bacteria 1715
451 Ga0495644_0093452 3300046523 Bacteria 1136
452 Ga0495648_0000205 3300046524 Bacteria 68843
453 Ga0495648_0000318 3300046524 Bacteria 53345
454 Ga0495648_0000512 3300046524 Bacteria 41742
455 Ga0495648_0001151 3300046524 Bacteria 26757
456 Ga0495648_0001477 3300046524 Bacteria 22992
457 Ga0495648_0003592 3300046524 Bacteria 13565
458 Ga0495648_0005836 3300046524 Bacteria 10140
459 Ga0495648_0006296 3300046524 Bacteria 9707
460 Ga0495648_0006413 3300046524 Bacteria 9605
461 Ga0495648_0007388 3300046524 Bacteria 8798
462 Ga0495648_0010135 3300046524 Bacteria 7213
463 Ga0495648_0011602 3300046524 Bacteria 6622
464 Ga0495648_0039523 3300046524 Bacteria 3001
465 Ga0495648_0041012 3300046524 Bacteria 2928
466 Ga0495648_0090205 3300046524 Bacteria 1718
467 Ga0495648_0196233 3300046524 Bacteria 1014
468 Ga0495666_0002777 3300046526 Bacteria 8747
469 Ga0495666_0028896 3300046526 Bacteria 2727
470 Ga0495642_0000018 3300046528 Bacteria 108992
471 Ga0495642_0000024 3300046528 Bacteria 92899
472 Ga0495654_0000182 3300046530 Bacteria 61568
473 Ga0495654_0001488 3300046530 Bacteria 16030
474 Ga0495654_0002030 3300046530 Bacteria 13311
475 Ga0495654_0014989 3300046530 Bacteria 4119
476 Ga0495654_0021010 3300046530 Bacteria 3399
477 Ga0495654_0024930 3300046530 Bacteria 3085
478 Ga0495654_0026923 3300046530 Bacteria 2952
479 Ga0495654_0032827 3300046530 Bacteria 2630
480 Ga0495654_0034465 3300046530 Bacteria 2553
481 Ga0495654_0040178 3300046530 Bacteria 2332
482 Ga0495654_0051082 3300046530 Bacteria 2018
483 Ga0495654_0074854 3300046530 Bacteria 1598
484 Ga0495654_0093055 3300046530 Bacteria 1396
485 Ga0495587_0018808 3300046536 Bacteria 4282
486 Ga0495609_0000438 3300046538 Bacteria 34462
487 Ga0495609_0001183 3300046538 Bacteria 17998
488 Ga0495609_0001998 3300046538 Bacteria 12880
489 Ga0495609_0003568 3300046538 Bacteria 8851
490 Ga0495609_0016062 3300046538 Bacteria 3493
491 Ga0495609_0057613 3300046538 Bacteria 1719
492 Ga0495597_0000464 3300046542 Bacteria 34458
493 Ga0495597_0003860 3300046542 Bacteria 8491
494 Ga0495597_0008420 3300046542 Bacteria 5170
495 Ga0495597_0011851 3300046542 Bacteria 4220
496 Ga0495645_0103432 3300046543 Bacteria 2023
497 Ga0495622_0000452 3300046557 Bacteria 26316
498 Ga0495622_0000621 3300046557 Bacteria 20566
499 Ga0495622_0007008 3300046557 Bacteria 5232
500 Ga0495622_0021453 3300046557 Bacteria 3006
501 Ga0495633_0000730 3300046558 Bacteria 29769
502 Ga0495633_0001528 3300046558 Bacteria 17781
503 Ga0495633_0029604 3300046558 Bacteria 2664
504 Ga0495656_0018140 3300046615 Bacteria 2697
505 Ga0495668_0002047 3300046616 Bacteria 17552
506 Ga0495668_0002223 3300046616 Bacteria 16481
507 Ga0495668_0026565 3300046616 Bacteria 3284
508 Ga0495668_0065278 3300046616 Bacteria 2003
509 Ga0495634_0021667 3300046642 Bacteria 4538
510 Ga0495634_0030308 3300046642 Bacteria 3737
511 Ga0495611_0000067 3300046648 Bacteria 72577
512 Ga0495611_0009821 3300046648 Bacteria 4047
513 Ga0495611_0030132 3300046648 Bacteria 2384
514 Ga0495625_0002094 3300046660 Bacteria 22301
515 Ga0495625_0002789 3300046660 Bacteria 18426
516 Ga0495625_0017344 3300046660 Bacteria 5639
517 Ga0495625_0019658 3300046660 Bacteria 5230
518 Ga0495625_0043774 3300046660 Bacteria 3244
519 Ga0495625_0089391 3300046660 Bacteria 2132
520 Ga0495625_0119818 3300046660 Bacteria 1792
521 Ga0495625_0150988 3300046660 Bacteria 1562
522 Ga0495625_0225907 3300046660 Bacteria 1224
523 Ga0495625_0249535 3300046660 Bacteria 1152
524 Ga0495625_0274841 3300046660 Bacteria 1086
525 Ga0495625_0307539 3300046660 Bacteria 1012
526 Ga0495635_0023331 3300046663 Bacteria 4312
527 Ga0495659_0006909 3300046664 Bacteria 3591
528 Ga0495661_0003518 3300046665 Bacteria 11544
529 Ga0495661_0003727 3300046665 Bacteria 11163
530 Ga0495661_0025453 3300046665 Bacteria 3821
531 Ga0495661_0089807 3300046665 Bacteria 1750
532 Ga0495661_0096708 3300046665 Bacteria 1669
533 Ga0495661_0150193 3300046665 Bacteria 1259
534 Ga0495661_0285187 3300046665 Bacteria 831
535 Ga0495588_0064117 3300046674 Bacteria 1906
536 Ga0495657_0050599 3300046675 Bacteria 2793
537 Ga0495623_0000754 3300046679 Bacteria 21717
538 Ga0495646_0001184 3300046680 Bacteria 15267
539 Ga0495646_0026401 3300046680 Bacteria 3647
540 Ga0495669_0021888 3300046684 Bacteria 2777
541 Ga0495613_0004522 3300046689 Bacteria 10425
542 Ga0495613_0062799 3300046689 Bacteria 2718
543 Ga0495624_0001661 3300046690 Bacteria 17058
544 Ga0495624_0052005 3300046690 Bacteria 2590
545 Ga0495670_0000061 3300046691 Bacteria 48947
546 Ga0495670_0000224 3300046691 Bacteria 25770
547 Ga0495670_0002054 3300046691 Bacteria 9919
548 Ga0495670_0021269 3300046691 Bacteria 3199
549 Ga0495670_0021997 3300046691 Bacteria 3148
550 Ga0495670_0191526 3300046691 Bacteria 1081
551 Ga0495671_0000061 3300046692 Bacteria 107050
552 Ga0495671_0002476 3300046692 Bacteria 11644
553 Ga0495671_0002950 3300046692 Bacteria 10577
554 Ga0495671_0006495 3300046692 Bacteria 6753
555 Ga0495671_0011563 3300046692 Bacteria 4849
556 Ga0495671_0012881 3300046692 Bacteria 4551
557 Ga0495671_0018211 3300046692 Bacteria 3729
558 Ga0495671_0026175 3300046692 Bacteria 3025
559 Ga0495671_0032009 3300046692 Bacteria 2686
560 Ga0495671_0036033 3300046692 Bacteria 2509
561 Ga0495671_0051629 3300046692 Bacteria 2045
562 Ga0495671_0056553 3300046692 Bacteria 1942
563 Ga0495649_0000664 3300046694 Bacteria 28100
564 Ga0495649_0001784 3300046694 Bacteria 15853
565 Ga0495649_0002386 3300046694 Bacteria 13285
566 Ga0495649_0002680 3300046694 Bacteria 12407
567 Ga0495649_0012756 3300046694 Bacteria 4873
568 Ga0495649_0014715 3300046694 Bacteria 4472
569 Ga0495649_0017692 3300046694 Bacteria 4020
570 Ga0495649_0033118 3300046694 Bacteria 2844
571 Ga0495649_0034525 3300046694 Bacteria 2782
572 Ga0495649_0034811 3300046694 Bacteria 2770
573 Ga0495649_0069044 3300046694 Bacteria 1895
574 Ga0495649_0092257 3300046694 Bacteria 1613
575 Ga0495649_0226833 3300046694 Bacteria 965
576 Ga0495589_0000011 3300046794 Bacteria 250370
577 Ga0495589_0000860 3300046794 Bacteria 19007
578 Ga0495589_0002486 3300046794 Bacteria 10314
579 Ga0495589_0015773 3300046794 Bacteria 3884
580 Ga0495589_0016848 3300046794 Bacteria 3752
581 Ga0495589_0020246 3300046794 Bacteria 3404
582 Ga0495589_0025358 3300046794 Bacteria 3009
583 Ga0495589_0104899 3300046794 Bacteria 1366
584 Ga0495589_0152881 3300046794 Bacteria 1101
585 Ga0495600_0001400 3300046809 Bacteria 13306
586 Ga0495660_0000616 3300046810 Bacteria 28012
587 Ga0495660_0000713 3300046810 Bacteria 25471
588 Ga0495660_0003337 3300046810 Bacteria 9957
589 Ga0495660_0005508 3300046810 Bacteria 7585
590 Ga0495660_0006801 3300046810 Bacteria 6742
591 Ga0495660_0010057 3300046810 Bacteria 5503
592 Ga0495660_0010753 3300046810 Bacteria 5316
593 Ga0495660_0011533 3300046810 Bacteria 5127
594 Ga0495660_0055457 3300046810 Bacteria 2145
595 Ga0495660_0123450 3300046810 Bacteria 1307
596 Ga0495660_0150309 3300046810 Bacteria 1150
597 Ga0495604_0002863 3300047317 Bacteria 13833
598 Ga0495604_0003062 3300047317 Bacteria 13360
599 Ga0495604_0025939 3300047317 Bacteria 4667
600 Ga0495674_0128364 3300047319 Bacteria 2137
601 Ga0495672_0000442 3300047320 Bacteria 49513
602 Ga0495672_0002423 3300047320 Bacteria 17192
603 Ga0495672_0004256 3300047320 Bacteria 11811
604 Ga0495672_0004720 3300047320 Bacteria 11016
605 Ga0495672_0008675 3300047320 Bacteria 7463
606 Ga0495672_0009995 3300047320 Bacteria 6805
607 Ga0495672_0010915 3300047320 Bacteria 6443
608 Ga0495672_0026045 3300047320 Bacteria 3735
609 Ga0495672_0038296 3300047320 Bacteria 2926
610 Ga0495672_0045808 3300047320 Bacteria 2614
611 Ga0495676_0000298 3300047321 Bacteria 40228
612 Ga0495676_0001880 3300047321 Bacteria 18431
613 Ga0495680_0016250 3300047322 Bacteria 6400
614 Ga0495680_0023125 3300047322 Bacteria 5170
615 Ga0495680_0463345 3300047322 Bacteria 866
616 Ga0495683_0000411 3300047323 Bacteria 34275
617 Ga0495683_0000633 3300047323 Bacteria 26201
618 Ga0495683_0002856 3300047323 Bacteria 10227
619 Ga0495683_0009092 3300047323 Bacteria 5293
620 Ga0495683_0035117 3300047323 Bacteria 2548
621 Ga0495683_0037916 3300047323 Bacteria 2441
622 Ga0495683_0057834 3300047323 Bacteria 1927
623 Ga0495683_0067799 3300047323 Bacteria 1756
624 Ga0495683_0144467 3300047323 Bacteria 1112
625 Ga0495687_001045 3300047443 Bacteria 27496
626 Ga0495687_008899 3300047443 Bacteria 5684
627 Ga0495687_013415 3300047443 Bacteria 4279
628 Ga0495675_0070869 3300047444 Bacteria 2200
629 Ga0495675_0088634 3300047444 Bacteria 1943
630 Ga0495679_000488 3300047446 Bacteria 28248
631 Ga0495679_000988 3300047446 Bacteria 17554
632 Ga0495679_001583 3300047446 Bacteria 12832
633 Ga0495679_008671 3300047446 Bacteria 4116
634 Ga0495679_097659 3300047446 Bacteria 818
635 Ga0495673_0000609 3300047469 Bacteria 35569
636 Ga0495673_0000960 3300047469 Bacteria 26055
637 Ga0495673_0001372 3300047469 Bacteria 19678
638 Ga0495673_0001588 3300047469 Bacteria 17725
639 Ga0495673_0002536 3300047469 Bacteria 12748
640 Ga0495673_0003195 3300047469 Bacteria 10940
641 Ga0495673_0003591 3300047469 Bacteria 10176
642 Ga0495673_0003696 3300047469 Bacteria 9962
643 Ga0495673_0003979 3300047469 Bacteria 9444
644 Ga0495673_0007359 3300047469 Bacteria 6343
645 Ga0495673_0011897 3300047469 Bacteria 4647
646 Ga0495673_0030040 3300047469 Bacteria 2558
647 Ga0495673_0030955 3300047469 Bacteria 2508
648 Ga0495673_0042025 3300047469 Bacteria 2055
649 Ga0495673_0043980 3300047469 Bacteria 1994
650 Ga0495673_0063198 3300047469 Bacteria 1578
651 Ga0495681_0000109 3300047470 Bacteria 71558
652 Ga0495681_0000240 3300047470 Bacteria 45463
653 Ga0495681_0000262 3300047470 Bacteria 42740
654 Ga0495681_0000359 3300047470 Bacteria 35569
655 Ga0495681_0001811 3300047470 Bacteria 15712
656 Ga0495681_0004800 3300047470 Bacteria 9162
657 Ga0495681_0007477 3300047470 Bacteria 6968
658 Ga0495681_0010199 3300047470 Bacteria 5705
659 Ga0495681_0028886 3300047470 Bacteria 2846
660 Ga0495681_0071666 3300047470 Bacteria 1568
661 Ga0495681_0104576 3300047470 Bacteria 1233
662 Ga0495684_0004741 3300047471 Bacteria 10624
663 Ga0495684_0482645 3300047471 Bacteria 855
664 Ga0495686_0000475 3300047472 Bacteria 59699
665 Ga0495686_0000789 3300047472 Bacteria 41293
666 Ga0495686_0002037 3300047472 Bacteria 19919
667 Ga0495686_0006130 3300047472 Bacteria 9307
668 Ga0495593_0000492 3300047673 Bacteria 22255
669 Ga0495593_0013565 3300047673 Bacteria 4645
670 Ga0495602_0001929 3300048088 Bacteria 20798
671 Ga0495626_0000079 3300048091 Bacteria 129922
672 Ga0495626_0000531 3300048091 Bacteria 37903
673 Ga0495626_0001273 3300048091 Bacteria 20609
674 Ga0495626_0001545 3300048091 Bacteria 18082
675 Ga0495626_0001554 3300048091 Bacteria 18009
676 Ga0495626_0001956 3300048091 Bacteria 15313
677 Ga0495626_0002203 3300048091 Bacteria 13981
678 Ga0495626_0002339 3300048091 Bacteria 13365
679 Ga0495626_0002426 3300048091 Bacteria 12944
680 Ga0495626_0002513 3300048091 Bacteria 12641
681 Ga0495626_0002919 3300048091 Bacteria 11391
682 Ga0495626_0003719 3300048091 Bacteria 9636
683 Ga0495626_0042589 3300048091 Bacteria 2132
684 Ga0495626_0134652 3300048091 Bacteria 1052
685 Ga0496102_0000038 3300048905 Bacteria 198844
686 Ga0496103_0016327 3300048906 Bacteria 4430
687 Ga0496106_0088469 3300048909 Bacteria 2388
688 Ga0496110_0053219 3300048913 Bacteria 3558
689 Ga0496110_0090258 3300048913 Bacteria 2740
690 Ga0496110_0144277 3300048913 Bacteria 2153
691 Ga0496110_0198415 3300048913 Bacteria 1823
692 Ga0496114_0011127 3300048917 Bacteria 7182
693 Ga0496114_0018718 3300048917 Bacteria 5604
694 Ga0496116_0000646 3300048919 Bacteria 45529
695 Ga0496116_0000654 3300048919 Bacteria 45317
696 Ga0496116_0001222 3300048919 Bacteria 29907
697 Ga0496116_0001414 3300048919 Bacteria 26960
698 Ga0496117_0000807 3300048920 Bacteria 48627
699 Ga0496117_0003142 3300048920 Bacteria 19693
700 Ga0496117_0005846 3300048920 Bacteria 12734
701 Ga0496117_0005882 3300048920 Bacteria 12677
702 Ga0496117_0008470 3300048920 Bacteria 9763
703 Ga0496117_0009338 3300048920 Bacteria 9142
704 Ga0496117_0019693 3300048920 Bacteria 5531
705 Ga0496117_0056614 3300048920 Bacteria 2729
706 Ga0496117_0169114 3300048920 Bacteria 1271
707 Ga0496118_0000586 3300048921 Bacteria 60209
708 Ga0496118_0003405 3300048921 Bacteria 20100
709 Ga0496118_0006298 3300048921 Bacteria 13118
710 Ga0496118_0006329 3300048921 Bacteria 13075
711 Ga0496118_0025537 3300048921 Bacteria 5061
712 Ga0496118_0027521 3300048921 Bacteria 4809
713 Ga0496118_0031204 3300048921 Bacteria 4424
714 Ga0496118_0051089 3300048921 Bacteria 3166
715 Ga0496118_0053261 3300048921 Bacteria 3078
716 Ga0496119_0000100 3300048922 Bacteria 125646
717 Ga0496119_0022842 3300048922 Bacteria 4459
718 Ga0496119_0028592 3300048922 Bacteria 3799
719 Ga0496120_0004864 3300048923 Bacteria 10978
720 Ga0496120_0006699 3300048923 Bacteria 8771
721 Ga0496121_0001858 3300048924 Bacteria 33891
722 Ga0496121_0021629 3300048924 Bacteria 6290
723 Ga0496121_0049686 3300048924 Bacteria 3552
724 Ga0496121_0177094 3300048924 Bacteria 1543
725 Ga0496122_0002635 3300048925 Bacteria 25075
726 Ga0496122_0024279 3300048925 Bacteria 5308
727 Ga0496122_0034587 3300048925 Bacteria 4132
728 Ga0496122_0058976 3300048925 Bacteria 2837
729 Ga0496122_0064953 3300048925 Bacteria 2650
730 Ga0496123_0001171 3300048926 Bacteria 38747
731 Ga0496123_0001474 3300048926 Bacteria 32628
732 Ga0496123_0035534 3300048926 Bacteria 3548
733 Ga0496123_0057422 3300048926 Bacteria 2533
734 Ga0496124_0002151 3300048927 Bacteria 26454
735 Ga0496124_0011066 3300048927 Bacteria 9057
736 Ga0496124_0017641 3300048927 Bacteria 6721
737 Ga0496124_0021195 3300048927 Bacteria 5991
738 Ga0496124_0027721 3300048927 Bacteria 5076
739 Ga0496124_0035372 3300048927 Bacteria 4370
740 Ga0496124_0037319 3300048927 Bacteria 4227
741 Ga0496124_0128818 3300048927 Bacteria 2013
742 Ga0496124_0269621 3300048927 Bacteria 1247
743 Ga0496124_0392352 3300048927 Bacteria 966
744 Ga0496125_0001820 3300048928 Bacteria 29445
745 Ga0496125_0009413 3300048928 Bacteria 10043
746 Ga0496125_0044947 3300048928 Bacteria 3725
747 Ga0496125_0054125 3300048928 Bacteria 3282
748 Ga0496125_0091243 3300048928 Bacteria 2283
749 Ga0496126_0042562 3300048929 Bacteria 4194
750 Ga0495678_000343 3300049459 Bacteria 48316
751 Ga0495678_001740 3300049459 Bacteria 16194
752 Ga0495678_002705 3300049459 Bacteria 11693
753 Ga0495678_002927 3300049459 Bacteria 10926
754 Ga0495678_003829 3300049459 Bacteria 9058
755 Ga0495678_004984 3300049459 Bacteria 7481
756 Ga0495678_005137 3300049459 Bacteria 7339
757 Ga0495678_007138 3300049459 Bacteria 5834
758 Ga0495678_016017 3300049459 Bacteria 3440
759 Ga0495678_016247 3300049459 Bacteria 3407
760 Ga0495678_022524 3300049459 Bacteria 2752
761 Ga0495678_026515 3300049459 Bacteria 2472
762 Ga0495682_0001622 3300049460 Bacteria 11597
763 Ga0495682_0004985 3300049460 Bacteria 5583
764 Ga0495682_0011464 3300049460 Bacteria 3411
765 Ga0495682_0054832 3300049460 Bacteria 1446
766 Ga0495682_0071091 3300049460 Bacteria 1252
767 Ga0501031_0141605 3300049568 Bacteria 1572
768 Ga0501034_0000557 3300049571 Bacteria 58990
769 Ga0501034_0197845 3300049571 Bacteria 1969
770 Ga0501222_000977 3300049662 Bacteria 4096
771 Ga0501241_002385 3300049758 Bacteria 3634
772 Ga0501269_001312 3300049766 Bacteria 3313
773 Ga0501269_005519 3300049766 Bacteria 1520
774 Ga0501226_000006 3300049853 Bacteria 259153
775 Ga0501226_004954 3300049853 Bacteria 1528
776 nmdc:mga00v17_244067_c1 3300050491 Bacteria 1165
777 nmdc:mga08x19_96998_c1 3300050514 Bacteria 1951
778 Ga0500572_000048 3300053111 Bacteria 36871
779 Ga0500621_073227 3300053126 Bacteria 1379
780 Ga0500586_033267 3300053145 Bacteria 1712
781 2511253201 2511231004 Bacteria 6669789
782 2511271181 2511231007 Bacteria 6306603
783 2511281041 2511231008 Bacteria 6624100
784 2511290300 2511231010 Bacteria 6373152
785 2511298497 2511231011 Bacteria 6149768
786 2511303517 2511231012 Bacteria 6738011
787 2511314086 2511231014 Bacteria 6462302
788 2511321086 2511231015 Bacteria 6598026
789 2511327614 2511231016 Bacteria 6704427
790 2511335342 2511231017 Bacteria 6503007
791 2511348596 2511231020 Bacteria 6115223
792 2511360207 2511231021 Bacteria 7302637
793 2511364078 2511231022 Bacteria 6719296
794 2511368608 2511231023 Bacteria 6808468
795 2511375024 2511231024 Bacteria 5835885
796 2511415906 2511231031 Bacteria 6558529
797 2511825811 2511231156 Bacteria 6845832
798 2554813999 2554235132 Bacteria 6772433
799 2555245472 2554235231 Bacteria 5215788
800 2599330885 2599185155 Bacteria 5827168
801 2599500805 2599185188 Bacteria 6164180
802 2599615359 2599185212 Bacteria 6765997
803 2599768843 2599185248 Bacteria 6696816
804 2599884627 2599185289 Bacteria 6778765
805 2599896194 2599185291 Bacteria 6775623
806 2599932471 2599185300 Bacteria 6062622
807 2599958080 2599185305 Bacteria 6748700
808 2599963927 2599185306 Bacteria 6637356
809 2599976650 2599185308 Bacteria 6621546
810 2599992792 2599185311 Bacteria 6354990
811 2600003840 2599185313 Bacteria 6658188
812 2600010819 2599185314 Bacteria 6621749
813 2600015803 2599185315 Bacteria 6771107
814 2600023014 2599185316 Bacteria 6320029
815 2600028185 2599185317 Bacteria 6435722
816 2600034112 2599185318 Bacteria 6961590
817 2600040377 2599185319 Bacteria 6637840
818 2600051009 2599185321 Bacteria 6764560
819 2600056906 2599185322 Bacteria 6763055
820 2600063384 2599185323 Bacteria 6688755
821 2600069080 2599185324 Bacteria 6590677
822 2600076762 2599185325 Bacteria 6324919
823 2600357366 2600254930 Bacteria 6431253
824 2600442840 2600254954 Bacteria 5100516
825 2601799448 2600255318 Bacteria 6383414
826 2602010260 2600255389 Bacteria 5275336
827 2606078318 2603880185 Bacteria 6379190
828 2606130426 2603880199 Bacteria 6377649
829 2608384705 2606217733 Bacteria 6360972
830 2624480419 2623620443 Bacteria 6427864
831 2624492897 2623620446 Bacteria 6500345
832 2643842161 2643221565 Bacteria 6216018
833 2643956738 2643221589 Bacteria 6250934
834 2644021961 2643221602 Bacteria 6249926
835 2644188452 2643221633 Bacteria 6733554
836 2644281119 2643221650 Bacteria 7029547
837 2671088887 2667528170 Bacteria 6786960
838 2671124859 2667528176 Bacteria 6724917
839 2678263846 2675903515 Bacteria 6580491
840 2715753772 2713897148 Bacteria 5883533
841 2715759328 2713897149 Bacteria 6506249
842 2718634381 2718217725 Bacteria 5758958
843 2729147235 2728369097 Bacteria 4333476
844 2739197816 2738543004 Bacteria 6381073
845 2739260806 2738543015 Bacteria 6750701
846 2739312068 2738543025 Bacteria 6600348
847 2745004299 2744054620 Bacteria 6551379
848 2765582042 2765235841 Bacteria 6137024
849 2774118957 2773857670 Bacteria 6407454
850 2774138111 2773857673 Bacteria 6513460
851 2784264814 2784132063 Bacteria 6262788
852 2784312596 2784132072 Bacteria 6596533
853 2794597303 2791355520 Bacteria 5948615
854 2807410071 2806310737 Bacteria 5751088
855 2807458418 2806310745 Bacteria 5742165
856 2808907496 2808606373 Bacteria 4423627
857 2808933160 2808606377 Bacteria 6646337
858 2808939392 2808606379 Bacteria 5022697
859 2808955333 2808606381 Bacteria 6646461
860 2808960091 2808606382 Bacteria 6841132
861 2812366778 2811994881 Bacteria 6298475
862 2819654782 2818991456 Bacteria 6123676
863 2823422785 2823421272 Bacteria 5372474
864 2825652219 2825651385 Bacteria 6715909
865 2826586398 2826581358 Bacteria 5963467
866 2842818408 2842815866 Bacteria 5947510
867 2842837812 2842832357 Bacteria 5959113
868 2842843888 2842843487 Bacteria 6004777
869 2842853745 2842849001 Bacteria 5924277
870 2842858238 2842854478 Bacteria 6143501
871 2852662283 2852657418 Bacteria 6472974
872 2860345581 2860339153 Bacteria 6846989
873 2878032353 2878029506 Bacteria 6418441
874 2880233151 2880230671 Bacteria 6140320
875 2904521970 2904518522 Bacteria 6068986
876 2904552103 2904550169 Bacteria 6221258
877 2912964650 2912963787 Bacteria 5646108
878 2913040271 2913036834 Bacteria 6704877
879 2919065289 2919063839 Bacteria 6302690
880 2919157842 2919155634 Bacteria 4860545
881 2919387266 2919385768 Bacteria 5897293
882 2919483308 2919481497 Bacteria 6907839
883 2919492974 2919487758 Bacteria 5929766
884 2919504808 2919501602 Bacteria 5286340
885 2919703547 2919697872 Bacteria 6553725
886 2923520812 2923519811 Bacteria 6298479
887 2923588195 2923586266 Bacteria 6565975
888 2926066485 2926063275 Bacteria 5285848
889 2929147832 2929144301 Bacteria 6622272
890 2931374928 2931369376 Bacteria 6847892
891 2931402745 2931396565 Bacteria 7251677
892 2939640035 2939636861 Bacteria 6297853
893 2939652157 2939651529 Bacteria 5895393
894 2969307247 2969304461 Bacteria 6601805
895 2974290652 2974289157 Bacteria 6080362
896 2990200390 2990196909 Bacteria 4054280
897 2998143179 2998139840 Bacteria 6073514
898 3007256408 3007252601 Bacteria 4559114
899 3007319370 3007315729 Bacteria 5076637
900 3007514999 3007511990 Bacteria 6481491
901 3007615066 3007614139 Bacteria 6053559
902 3007721929 3007718800 Bacteria 5971527
903 3007807401 3007803356 Bacteria 5931491
904 3007857148 3007855910 Bacteria 5637581
905 3007862263 3007861166 Bacteria 6045338
906 3007869227 3007866637 Bacteria 5899198
907 3007875960 3007872151 Bacteria 5268868
908 640488924 640427133 Bacteria 4567418
909 651177014 651053060 Bacteria 4689946
910 8011356500 8011350971 Bacteria 6158957
911 8019782192 8019775933 Bacteria 6858656
912 8029997625 8029995093 Bacteria 5990776
913 8034966072 8034962539 Bacteria 4884839
914 8052499108 8052494512 Bacteria 5765634
915 8054934331 8054929484 Bacteria 5599761
916 8056120463 8056115690 Bacteria 5527654
917 8056125072 8056120720 Bacteria 5758328
918 8056129518 8056125926 Bacteria 6228218
919 8056142085 8056137416 Bacteria 6147080
920 8056146120 8056143049 Bacteria 6307666
921 8056157416 8056155041 Bacteria 6486948
922 8056168022 8056166840 Bacteria 5820959
923 8056173984 8056172158 Bacteria 6133900
924 8056178734 8056177738 Bacteria 6748268
925 8056574126 8056569372 Bacteria 5997322
926 Ga0070704_100187673
927 MRS2a_Contig_18
928 MRS2a_Contig_8998
929 MRS2a_Contig_9449
930 SwRhRL2b_contig_3354362
931 Ga0055536_1000326
932 Ga0055530_10000123
933 Ga0055530_10000264
934 Ga0055530_10023133
935 Ga0055540_1000008
936 Ga0055540_1000159
937 Ga0055531_10000182
938 Ga0065714_10000094
939 Ga0065714_10002654
940 Ga0065714_10004889
941 Ga0065714_10011480
942 Ga0065714_10011782
943 Ga0065714_10093893
944 Ga0065704_10002237
945 Ga0065704_10002354
946 Ga0065704_10072581
947 Ga0065712_10068177
948 Ga0065715_10137665
949 Ga0070668_100689372
950 Ga0070674_100512194
951 Ga0070697_100135876
952 Ga0070665_100074472
953 Ga0075432_10000899
954 Ga0075432_10004800
955 Ga0075432_10048725
956 Ga0075432_10081281
957 Ga0075362_10059773
958 Ga0075436_100067419
959 Ga0099823_1000053
960 Ga0099823_1032365
961 Ga0079104_1000142
962 Ga0079104_1006789
963 Ga0079104_1062563
964 Ga0105251_10004550
965 Ga0105251_10011318
966 Ga0105251_10013120
967 Ga0105251_10040028
968 Ga0105251_10058019
969 Ga0105251_10152306
970 Ga0105244_10001121
971 Ga0105244_10001639
972 Ga0105244_10004838
973 Ga0105244_10006107
974 Ga0105244_10015579
975 Ga0105244_10017468
976 Ga0105244_10029717
977 Ga0105244_10030400
978 Ga0105244_10043792
979 Ga0105244_10056700
980 Ga0105244_10075351
981 Ga0105250_10000155
982 Ga0105250_10003962
983 Ga0105250_10010355
984 Ga0105243_10000060
985 Ga0105243_10004215
986 Ga0105243_10010557
987 Ga0105243_10329813
988 Ga0105246_10002304
989 Ga0105246_10026464
990 Ga0157345_1000033
991 Ga0157373_10000374
992 Ga0157373_10009374
993 Ga0157373_10090453
994 Ga0157371_10000535
995 Ga0157371_10003129
996 Ga0157371_10154263
997 Ga0157370_10006679
998 Ga0157370_10033641
999 Ga0157370_10091334
1000 Ga0157370_10349023
1001 Ga0157369_10001093
1002 Ga0157369_10105343
1003 Ga0157369_10206559
1004 Ga0163162_10000137
1005 Ga0157372_10004578
1006 Ga0157372_10075658
1007 Ga0157375_10123671
1008 Ga0157375_10299898
1009 Ga0182008_10002912
1010 Ga0182008_10010555
1011 Ga0182008_10060072
1012 Ga0182008_10097186
1013 Ga0182008_10120832
1014 Ga0182006_1000701
1015 Ga0182006_1001574
1016 Ga0182006_1002883
1017 Ga0182006_1003069
1018 Ga0182006_1003138
1019 Ga0182006_1009054
1020 Ga0182006_1079368
1021 Ga0182007_10002465
1022 Ga0182005_1001174
1023 Ga0182005_1005064
1024 Ga0182005_1006236
1025 Ga0182005_1006585
1026 Ga0182005_1036085
1027 Ga0182005_1058587
1028 Ga0163161_10000054
1029 Ga0163161_10008562
1030 Ga0163161_10037541
1031 Ga0163161_10165085
1032 Ga0209563_100549
1033 Ga0209676_1000002
1034 Ga0209676_1000050
1035 Ga0209676_1000306
1036 Ga0209676_1001444
1037 Ga0209676_1002014
1038 Ga0209050_1000006
1039 Ga0209050_1000013
1040 Ga0209050_1000973
1041 Ga0209050_1008518
1042 Ga0209051_1000001
1043 Ga0209051_1000007
1044 Ga0209051_1001630
1045 Ga0209257_1000029
1046 Ga0207696_1000120
1047 Ga0207696_1000223
1048 Ga0207696_1003244
1049 Ga0207696_1006777
1050 Ga0207655_1000076
1051 Ga0207655_1000917
1052 Ga0207655_1000950
1053 Ga0207655_1003134
1054 Ga0207655_1003660
1055 Ga0207655_1004390
1056 Ga0207655_1006716
1057 Ga0207655_1010927
1058 Ga0207655_1037001
1059 Ga0207655_1044751
1060 Ga0207655_1070120
1061 Ga0207713_1000271
1062 Ga0207713_1000924
1063 Ga0207713_1004288
1064 Ga0207713_1004346
1065 Ga0207713_1007615
1066 Ga0207713_1010844
1067 Ga0207713_1016140
1068 Ga0207713_1028298
1069 Ga0207713_1040769
1070 Ga0207713_1061643
1071 Ga0207707_10028584
1072 Ga0207646_10287715
1073 Ga0207709_10000004
1074 Ga0207709_10002110
1075 Ga0207709_10032131
1076 Ga0209281_1000262
1077 Ga0209389_1000058
1078 Ga0209371_1000422
1079 Ga0209371_1000474
1080 Ga0209981_1003924
1081 Ga0209996_1004065
1082 Ga0209968_1001905
1083 Ga0209983_1008384
1084 Ga0207428_10017734
1085 Ga0207428_10021135
1086 Ga0207428_10028742
1087 Ga0207428_10118283
1088 Ga0268266_10046510
1089 Ga0268256_1000348
1090 Ga0268256_1000401
1091 Ga0314311_1064093
1092 Ga0316178_1161168
1093 Ga0316183_1060334
1094 Ga0307408_100000047
1095 Ga0307408_100000145
1096 Ga0307408_100012110
1097 Ga0307408_100137637
1098 Ga0307405_10000105
1099 Ga0307413_10013538
1100 Ga0307413_10159575
1101 Ga0307406_10004668
1102 Ga0307406_10062570
1103 Ga0307412_10000316
1104 Ga0307412_10000393
1105 Ga0307412_10420155
1106 Ga0307409_100153959
1107 Ga0307416_100110681
1108 Ga0307416_100372618
1109 Ga0307414_10011515
1110 Ga0307414_10031191
1111 Ga0307414_10036272
1112 Ga0307414_10211772
1113 Ga0307414_10215522
1114 Ga0307411_10006919
1115 Ga0307510_10002563
1116 Ga0237819_01250
1117 Ga0439438_000082
1118 Ga0439438_000084
1119 Ga0439438_000129
1120 Ga0439438_000142
1121 Ga0439438_000381
1122 Ga0439438_000587
1123 Ga0439438_001301
1124 Ga0439438_006911
1125 Ga0439438_012069
1126 Ga0439438_028491
1127 Ga0439447_000016
1128 Ga0439447_000944
1129 Ga0439447_004202
1130 Ga0439447_007618
1131 Ga0439447_012008
1132 Ga0439447_016519
1133 Ga0439447_017394
1134 Ga0439447_032972
1135 Ga0439447_038248
1136 Ga0439466_0003255
1137 Ga0439466_0006422
1138 Ga0439466_0012649
1139 Ga0439466_0014866
1140 Ga0439466_0022528
1141 Ga0439466_0022734
1142 Ga0439466_0028195
1143 Ga0439466_0086446
1144 Ga0439431_0014914
1145 Ga0439437_000265
1146 Ga0439445_0041075
1147 Ga0439432_000256
1148 Ga0439432_003928
1149 Ga0439432_006190
1150 Ga0439432_019451
1151 Ga0439432_022984
1152 Ga0439432_106663
1153 Ga0439451_004218
1154 Ga0439452_000045
1155 Ga0439452_000077
1156 Ga0439452_000093
1157 Ga0439452_000986
1158 Ga0439452_034871
1159 Ga0439455_0012960
1160 Ga0439456_000138
1161 Ga0439456_015871
1162 Ga0439456_017372
1163 Ga0439456_025626
1164 Ga0450911_000007
1165 Ga0450911_000095
1166 Ga0450911_001049
1167 Ga0450920_009359
1168 Ga0450922_000353
1169 Ga0450923_010659
1170 Ga0450900_000727
1171 Ga0450900_007245
1172 Ga0450900_009735
1173 Ga0450902_000218
1174 Ga0450902_003090
1175 Ga0450902_004520
1176 Ga0450903_011456
1177 Ga0450903_018574
1178 Ga0450904_000052
1179 Ga0450905_000698
1180 Ga0450905_000982
1181 Ga0450905_004594
1182 Ga0450905_005801
1183 Ga0450905_020448
1184 Ga0450906_000099
1185 Ga0450907_000001
1186 Ga0450907_006178
1187 Ga0439446_0000430
1188 Ga0439446_0011500
1189 Ga0450909_008840
1190 Ga0439434_0002321
1191 Ga0439459_0006033
1192 Ga0450893_0003380
1193 Ga0450893_0013005
1194 Ga0450901_000299
1195 Ga0451577_0033632
1196 Ga0495617_001175
1197 Ga0495617_001262
1198 Ga0495617_001894
1199 Ga0495617_002189
1200 Ga0495617_009618
1201 Ga0495617_018367
1202 Ga0495617_019752
1203 Ga0495627_000497
1204 Ga0495627_001769
1205 Ga0495627_003412
1206 Ga0495627_007118
1207 Ga0495627_007299
1208 Ga0495627_060990
1209 Ga0495592_0008121
1210 Ga0495603_0027901
1211 Ga0495590_0000153
1212 Ga0495590_0000173
1213 Ga0495590_0003010
1214 Ga0495590_0006207
1215 Ga0495590_0009621
1216 Ga0495591_000021
1217 Ga0495591_000197
1218 Ga0495591_000215
1219 Ga0495591_000263
1220 Ga0495591_000424
1221 Ga0495591_001323
1222 Ga0495591_001467
1223 Ga0495591_001651
1224 Ga0495591_005378
1225 Ga0495591_008864
1226 Ga0495591_013667
1227 Ga0495591_016643
1228 Ga0495638_0000417
1229 Ga0495638_0001489
1230 Ga0495638_0003874
1231 Ga0495638_0004178
1232 Ga0495638_0007715
1233 Ga0495638_0007972
1234 Ga0495638_0032197
1235 Ga0495638_0058356
1236 Ga0495638_0073273
1237 Ga0495638_0192605
1238 Ga0495638_0204759
1239 Ga0495638_0249273
1240 Ga0495653_0010448
1241 Ga0495653_0031584
1242 Ga0495650_0001410
1243 Ga0495650_0009288
1244 Ga0495650_0018577
1245 Ga0495650_0025036
1246 Ga0495650_0034670
1247 Ga0495650_0065037
1248 Ga0495605_0000631
1249 Ga0495605_0000642
1250 Ga0495605_0010341
1251 Ga0495605_0010825
1252 Ga0495605_0011230
1253 Ga0495605_0014049
1254 Ga0495605_0034965
1255 Ga0495605_0048502
1256 Ga0495605_0051715
1257 Ga0495605_0059902
1258 Ga0495605_0073641
1259 Ga0495639_0000976
1260 Ga0495584_0000038
1261 Ga0495584_0002610
1262 Ga0495584_0003775
1263 Ga0495584_0022319
1264 Ga0495584_0025026
1265 Ga0495584_0035860
1266 Ga0495584_0039421
1267 Ga0495584_0056071
1268 Ga0495584_0152872
1269 Ga0495584_0163000
1270 Ga0495585_0000030
1271 Ga0495585_0000978
1272 Ga0495585_0000991
1273 Ga0495585_0002454
1274 Ga0495585_0004028
1275 Ga0495585_0004818
1276 Ga0495585_0010922
1277 Ga0495585_0020734
1278 Ga0495585_0157892
1279 Ga0495585_0211342
1280 Ga0495594_0161312
1281 Ga0495596_0000128
1282 Ga0495596_0093589
1283 Ga0495596_0105197
1284 Ga0495607_0000259
1285 Ga0495607_0000271
1286 Ga0495607_0002455
1287 Ga0495607_0007174
1288 Ga0495607_0009311
1289 Ga0495607_0029413
1290 Ga0495607_0030262
1291 Ga0495607_0031242
1292 Ga0495607_0036326
1293 Ga0495607_0103287
1294 Ga0495607_0104726
1295 Ga0495607_0133962
1296 Ga0495583_0004024
1297 Ga0495583_0012601
1298 Ga0495583_0023322
1299 Ga0495606_0000682
1300 Ga0495606_0000706
1301 Ga0495606_0001735
1302 Ga0495606_0005536
1303 Ga0495606_0018967
1304 Ga0495606_0019110
1305 Ga0495606_0027951
1306 Ga0495606_0060228
1307 Ga0495610_0002828
1308 Ga0495610_0003987
1309 Ga0495610_0004167
1310 Ga0495610_0006782
1311 Ga0495610_0007526
1312 Ga0495610_0026697
1313 Ga0495610_0027204
1314 Ga0495610_0060396
1315 Ga0495610_0072621
1316 Ga0495610_0089118
1317 Ga0495616_0000203
1318 Ga0495616_0000259
1319 Ga0495616_0000364
1320 Ga0495616_0000506
1321 Ga0495616_0001740
1322 Ga0495616_0024638
1323 Ga0495616_0037996
1324 Ga0495616_0064079
1325 Ga0495616_0133724
1326 Ga0495620_0000126
1327 Ga0495620_0001136
1328 Ga0495620_0010342
1329 Ga0495620_0011971
1330 Ga0495620_0024159
1331 Ga0495620_0035790
1332 Ga0495620_0037449
1333 Ga0495620_0100470
1334 Ga0495620_0117126
1335 Ga0495628_0068821
1336 Ga0495630_0093697
1337 Ga0495631_0000391
1338 Ga0495631_0000554
1339 Ga0495631_0018180
1340 Ga0495631_0026550
1341 Ga0495631_0047885
1342 Ga0495631_0065988
1343 Ga0495631_0090974
1344 Ga0495632_0000229
1345 Ga0495632_0001123
1346 Ga0495632_0001858
1347 Ga0495632_0003181
1348 Ga0495632_0010196
1349 Ga0495632_0015470
1350 Ga0495632_0026437
1351 Ga0495632_0029092
1352 Ga0495632_0100915
1353 Ga0495637_0000275
1354 Ga0495637_0001100
1355 Ga0495637_0003034
1356 Ga0495637_0003254
1357 Ga0495637_0004009
1358 Ga0495637_0005301
1359 Ga0495637_0006180
1360 Ga0495637_0007420
1361 Ga0495637_0016390
1362 Ga0495637_0019589
1363 Ga0495643_0000783
1364 Ga0495643_0000955
1365 Ga0495643_0001640
1366 Ga0495643_0015728
1367 Ga0495643_0034520
1368 Ga0495643_0040732
1369 Ga0495643_0062671
1370 Ga0495643_0085863
1371 Ga0495643_0135047
1372 Ga0495644_0000314
1373 Ga0495644_0001197
1374 Ga0495644_0005610
1375 Ga0495644_0042296
1376 Ga0495644_0093452
1377 Ga0495648_0000205
1378 Ga0495648_0000318
1379 Ga0495648_0000512
1380 Ga0495648_0001151
1381 Ga0495648_0001477
1382 Ga0495648_0003592
1383 Ga0495648_0005836
1384 Ga0495648_0006296
1385 Ga0495648_0006413
1386 Ga0495648_0007388
1387 Ga0495648_0010135
1388 Ga0495648_0011602
1389 Ga0495648_0039523
1390 Ga0495648_0041012
1391 Ga0495648_0090205
1392 Ga0495648_0196233
1393 Ga0495666_0002777
1394 Ga0495666_0028896
1395 Ga0495642_0000018
1396 Ga0495642_0000024
1397 Ga0495654_0000182
1398 Ga0495654_0001488
1399 Ga0495654_0002030
1400 Ga0495654_0014989
1401 Ga0495654_0021010
1402 Ga0495654_0024930
1403 Ga0495654_0026923
1404 Ga0495654_0032827
1405 Ga0495654_0034465
1406 Ga0495654_0040178
1407 Ga0495654_0051082
1408 Ga0495654_0074854
1409 Ga0495654_0093055
1410 Ga0495587_0018808
1411 Ga0495609_0000438
1412 Ga0495609_0001183
1413 Ga0495609_0001998
1414 Ga0495609_0003568
1415 Ga0495609_0016062
1416 Ga0495609_0057613
1417 Ga0495597_0000464
1418 Ga0495597_0003860
1419 Ga0495597_0008420
1420 Ga0495597_0011851
1421 Ga0495645_0103432
1422 Ga0495622_0000452
1423 Ga0495622_0000621
1424 Ga0495622_0007008
1425 Ga0495622_0021453
1426 Ga0495633_0000730
1427 Ga0495633_0001528
1428 Ga0495633_0029604
1429 Ga0495656_0018140
1430 Ga0495668_0002047
1431 Ga0495668_0002223
1432 Ga0495668_0026565
1433 Ga0495668_0065278
1434 Ga0495634_0021667
1435 Ga0495634_0030308
1436 Ga0495611_0000067
1437 Ga0495611_0009821
1438 Ga0495611_0030132
1439 Ga0495625_0002094
1440 Ga0495625_0002789
1441 Ga0495625_0017344
1442 Ga0495625_0019658
1443 Ga0495625_0043774
1444 Ga0495625_0089391
1445 Ga0495625_0119818
1446 Ga0495625_0150988
1447 Ga0495625_0225907
1448 Ga0495625_0249535
1449 Ga0495625_0274841
1450 Ga0495625_0307539
1451 Ga0495635_0023331
1452 Ga0495659_0006909
1453 Ga0495661_0003518
1454 Ga0495661_0003727
1455 Ga0495661_0025453
1456 Ga0495661_0089807
1457 Ga0495661_0096708
1458 Ga0495661_0150193
1459 Ga0495661_0285187
1460 Ga0495588_0064117
1461 Ga0495657_0050599
1462 Ga0495623_0000754
1463 Ga0495646_0001184
1464 Ga0495646_0026401
1465 Ga0495669_0021888
1466 Ga0495613_0004522
1467 Ga0495613_0062799
1468 Ga0495624_0001661
1469 Ga0495624_0052005
1470 Ga0495670_0000061
1471 Ga0495670_0000224
1472 Ga0495670_0002054
1473 Ga0495670_0021269
1474 Ga0495670_0021997
1475 Ga0495670_0191526
1476 Ga0495671_0000061
1477 Ga0495671_0002476
1478 Ga0495671_0002950
1479 Ga0495671_0006495
1480 Ga0495671_0011563
1481 Ga0495671_0012881
1482 Ga0495671_0018211
1483 Ga0495671_0026175
1484 Ga0495671_0032009
1485 Ga0495671_0036033
1486 Ga0495671_0051629
1487 Ga0495671_0056553
1488 Ga0495649_0000664
1489 Ga0495649_0001784
1490 Ga0495649_0002386
1491 Ga0495649_0002680
1492 Ga0495649_0012756
1493 Ga0495649_0014715
1494 Ga0495649_0017692
1495 Ga0495649_0033118
1496 Ga0495649_0034525
1497 Ga0495649_0034811
1498 Ga0495649_0069044
1499 Ga0495649_0092257
1500 Ga0495649_0226833
1501 Ga0495589_0000011
1502 Ga0495589_0000860
1503 Ga0495589_0002486
1504 Ga0495589_0015773
1505 Ga0495589_0016848
1506 Ga0495589_0020246
1507 Ga0495589_0025358
1508 Ga0495589_0104899
1509 Ga0495589_0152881
1510 Ga0495600_0001400
1511 Ga0495660_0000616
1512 Ga0495660_0000713
1513 Ga0495660_0003337
1514 Ga0495660_0005508
1515 Ga0495660_0006801
1516 Ga0495660_0010057
1517 Ga0495660_0010753
1518 Ga0495660_0011533
1519 Ga0495660_0055457
1520 Ga0495660_0123450
1521 Ga0495660_0150309
1522 Ga0495604_0002863
1523 Ga0495604_0003062
1524 Ga0495604_0025939
1525 Ga0495674_0128364
1526 Ga0495672_0000442
1527 Ga0495672_0002423
1528 Ga0495672_0004256
1529 Ga0495672_0004720
1530 Ga0495672_0008675
1531 Ga0495672_0009995
1532 Ga0495672_0010915
1533 Ga0495672_0026045
1534 Ga0495672_0038296
1535 Ga0495672_0045808
1536 Ga0495676_0000298
1537 Ga0495676_0001880
1538 Ga0495680_0016250
1539 Ga0495680_0023125
1540 Ga0495680_0463345
1541 Ga0495683_0000411
1542 Ga0495683_0000633
1543 Ga0495683_0002856
1544 Ga0495683_0009092
1545 Ga0495683_0035117
1546 Ga0495683_0037916
1547 Ga0495683_0057834
1548 Ga0495683_0067799
1549 Ga0495683_0144467
1550 Ga0495687_001045
1551 Ga0495687_008899
1552 Ga0495687_013415
1553 Ga0495675_0070869
1554 Ga0495675_0088634
1555 Ga0495679_000488
1556 Ga0495679_000988
1557 Ga0495679_001583
1558 Ga0495679_008671
1559 Ga0495679_097659
1560 Ga0495673_0000609
1561 Ga0495673_0000960
1562 Ga0495673_0001372
1563 Ga0495673_0001588
1564 Ga0495673_0002536
1565 Ga0495673_0003195
1566 Ga0495673_0003591
1567 Ga0495673_0003696
1568 Ga0495673_0003979
1569 Ga0495673_0007359
1570 Ga0495673_0011897
1571 Ga0495673_0030040
1572 Ga0495673_0030955
1573 Ga0495673_0042025
1574 Ga0495673_0043980
1575 Ga0495673_0063198
1576 Ga0495681_0000109
1577 Ga0495681_0000240
1578 Ga0495681_0000262
1579 Ga0495681_0000359
1580 Ga0495681_0001811
1581 Ga0495681_0004800
1582 Ga0495681_0007477
1583 Ga0495681_0010199
1584 Ga0495681_0028886
1585 Ga0495681_0071666
1586 Ga0495681_0104576
1587 Ga0495684_0004741
1588 Ga0495684_0482645
1589 Ga0495686_0000475
1590 Ga0495686_0000789
1591 Ga0495686_0002037
1592 Ga0495686_0006130
1593 Ga0495593_0000492
1594 Ga0495593_0013565
1595 Ga0495602_0001929
1596 Ga0495626_0000079
1597 Ga0495626_0000531
1598 Ga0495626_0001273
1599 Ga0495626_0001545
1600 Ga0495626_0001554
1601 Ga0495626_0001956
1602 Ga0495626_0002203
1603 Ga0495626_0002339
1604 Ga0495626_0002426
1605 Ga0495626_0002513
1606 Ga0495626_0002919
1607 Ga0495626_0003719
1608 Ga0495626_0042589
1609 Ga0495626_0134652
1610 Ga0496102_0000038
1611 Ga0496103_0016327
1612 Ga0496106_0088469
1613 Ga0496110_0053219
1614 Ga0496110_0090258
1615 Ga0496110_0144277
1616 Ga0496110_0198415
1617 Ga0496114_0011127
1618 Ga0496114_0018718
1619 Ga0496116_0000646
1620 Ga0496116_0000654
1621 Ga0496116_0001222
1622 Ga0496116_0001414
1623 Ga0496117_0000807
1624 Ga0496117_0003142
1625 Ga0496117_0005846
1626 Ga0496117_0005882
1627 Ga0496117_0008470
1628 Ga0496117_0009338
1629 Ga0496117_0019693
1630 Ga0496117_0056614
1631 Ga0496117_0169114
1632 Ga0496118_0000586
1633 Ga0496118_0003405
1634 Ga0496118_0006298
1635 Ga0496118_0006329
1636 Ga0496118_0025537
1637 Ga0496118_0027521
1638 Ga0496118_0031204
1639 Ga0496118_0051089
1640 Ga0496118_0053261
1641 Ga0496119_0000100
1642 Ga0496119_0022842
1643 Ga0496119_0028592
1644 Ga0496120_0004864
1645 Ga0496120_0006699
1646 Ga0496121_0001858
1647 Ga0496121_0021629
1648 Ga0496121_0049686
1649 Ga0496121_0177094
1650 Ga0496122_0002635
1651 Ga0496122_0024279
1652 Ga0496122_0034587
1653 Ga0496122_0058976
1654 Ga0496122_0064953
1655 Ga0496123_0001171
1656 Ga0496123_0001474
1657 Ga0496123_0035534
1658 Ga0496123_0057422
1659 Ga0496124_0002151
1660 Ga0496124_0011066
1661 Ga0496124_0017641
1662 Ga0496124_0021195
1663 Ga0496124_0027721
1664 Ga0496124_0035372
1665 Ga0496124_0037319
1666 Ga0496124_0128818
1667 Ga0496124_0269621
1668 Ga0496124_0392352
1669 Ga0496125_0001820
1670 Ga0496125_0009413
1671 Ga0496125_0044947
1672 Ga0496125_0054125
1673 Ga0496125_0091243
1674 Ga0496126_0042562
1675 Ga0495678_000343
1676 Ga0495678_001740
1677 Ga0495678_002705
1678 Ga0495678_002927
1679 Ga0495678_003829
1680 Ga0495678_004984
1681 Ga0495678_005137
1682 Ga0495678_007138
1683 Ga0495678_016017
1684 Ga0495678_016247
1685 Ga0495678_022524
1686 Ga0495678_026515
1687 Ga0495682_0001622
1688 Ga0495682_0004985
1689 Ga0495682_0011464
1690 Ga0495682_0054832
1691 Ga0495682_0071091
1692 Ga0501031_0141605
1693 Ga0501034_0000557
1694 Ga0501034_0197845
1695 Ga0501222_000977
1696 Ga0501241_002385
1697 Ga0501269_001312
1698 Ga0501269_005519
1699 Ga0501226_000006
1700 Ga0501226_004954
1701 nmdc:mga00v17_244067_c1
1702 nmdc:mga08x19_96998_c1
1703 Ga0500572_000048
1704 Ga0500621_073227
1705 Ga0500586_033267
1706 2511253201
1707 2511271181
1708 2511281041
1709 2511290300
1710 2511298497
1711 2511303517
1712 2511314086
1713 2511321086
1714 2511327614
1715 2511335342
1716 2511348596
1717 2511360207
1718 2511364078
1719 2511368608
1720 2511375024
1721 2511415906
1722 2511825811
1723 2554813999
1724 2555245472
1725 2599330885
1726 2599500805
1727 2599615359
1728 2599768843
1729 2599884627
1730 2599896194
1731 2599932471
1732 2599958080
1733 2599963927
1734 2599976650
1735 2599992792
1736 2600003840
1737 2600010819
1738 2600015803
1739 2600023014
1740 2600028185
1741 2600034112
1742 2600040377
1743 2600051009
1744 2600056906
1745 2600063384
1746 2600069080
1747 2600076762
1748 2600357366
1749 2600442840
1750 2601799448
1751 2602010260
1752 2606078318
1753 2606130426
1754 2608384705
1755 2624480419
1756 2624492897
1757 2643842161
1758 2643956738
1759 2644021961
1760 2644188452
1761 2644281119
1762 2671088887
1763 2671124859
1764 2678263846
1765 2715753772
1766 2715759328
1767 2718634381
1768 2729147235
1769 2739197816
1770 2739260806
1771 2739312068
1772 2745004299
1773 2765582042
1774 2774118957
1775 2774138111
1776 2784264814
1777 2784312596
1778 2794597303
1779 2807410071
1780 2807458418
1781 2808907496
1782 2808933160
1783 2808939392
1784 2808955333
1785 2808960091
1786 2812366778
1787 2819654782
1788 2823422785
1789 2825652219
1790 2826586398
1791 2842818408
1792 2842837812
1793 2842843888
1794 2842853745
1795 2842858238
1796 2852662283
1797 2860345581
1798 2878032353
1799 2880233151
1800 2904521970
1801 2904552103
1802 2912964650
1803 2913040271
1804 2919065289
1805 2919157842
1806 2919387266
1807 2919483308
1808 2919492974
1809 2919504808
1810 2919703547
1811 2923520812
1812 2923588195
1813 2926066485
1814 2929147832
1815 2931374928
1816 2931402745
1817 2939640035
1818 2939652157
1819 2969307247
1820 2974290652
1821 2990200390
1822 2998143179
1823 3007256408
1824 3007319370
1825 3007514999
1826 3007615066
1827 3007721929
1828 3007807401
1829 3007857148
1830 3007862263
1831 3007869227
1832 3007875960
1833 640488924
1834 651177014
1835 8011356500
1836 8019782192
1837 8029997625
1838 8034966072
1839 8052499108
1840 8054934331
1841 8056120463
1842 8056125072
1843 8056129518
1844 8056142085
1845 8056146120
1846 8056157416
1847 8056168022
1848 8056173984
1849 8056178734
1850 8056574126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

51

243

0.92

Map