F485850

General Info

Members Datasets Scaffolds Average Seq Length
924 312 1848 111

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100217641|Ga0070696_1002176412
Length 129
Sequence MRVSDTVVSGPRCLTPVTIMANPSPELLHGTLDALVLKTLCGGHRHGYAIARAIEDATGGVVEIEEGSLYPALYRMDKKGWVEAEWGLSELGRRAKFYRLTPRGRRHLTAQTAEWARFATAVSRVLLTA

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.95
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 15.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100217641 3300005546 Bacteria 1432
2 JGI24752J21851_1020319 3300001976 Bacteria 867
3 JGI24751J29686_10103979 3300002459 Bacteria 593
4 Ga0065714_10263793 3300005288 Unclassified 752
5 Ga0065712_10003335 3300005290 Bacteria 4418
6 Ga0065712_10216442 3300005290 Bacteria 1053
7 Ga0065715_10123314 3300005293 Bacteria 2181
8 Ga0065715_10506276 3300005293 Bacteria 775
9 Ga0065715_10622356 3300005293 Bacteria 695
10 Ga0065715_10807060 3300005293 Bacteria 607
11 Ga0065707_11069781 3300005295 Unclassified 522
12 Ga0070658_10545867 3300005327 Bacteria 1003
13 Ga0070676_10004580 3300005328 Bacteria 7288
14 Ga0070676_10005881 3300005328 Bacteria 6547
15 Ga0070676_10063539 3300005328 Bacteria 2199
16 Ga0070676_10684833 3300005328 Bacteria 747
17 Ga0070676_11192708 3300005328 Unclassified 578
18 Ga0070676_11226040 3300005328 Bacteria 571
19 Ga0070683_100006743 3300005329 Bacteria 9642
20 Ga0070683_100137723 3300005329 Bacteria 2312
21 Ga0070683_100651275 3300005329 Bacteria 1008
22 Ga0070690_100005897 3300005330 Bacteria 6911
23 Ga0070690_100166369 3300005330 Unclassified 1515
24 Ga0070690_100193997 3300005330 Bacteria 1410
25 Ga0070690_100205785 3300005330 Bacteria 1371
26 Ga0070690_100371626 3300005330 Bacteria 1043
27 Ga0070670_100001521 3300005331 Bacteria 18659
28 Ga0070670_100011997 3300005331 Bacteria 7412
29 Ga0070670_100042067 3300005331 Bacteria 3927
30 Ga0070670_100077225 3300005331 Bacteria 2861
31 Ga0070670_100086093 3300005331 Bacteria 2700
32 Ga0070670_100379250 3300005331 Bacteria 1246
33 Ga0070670_100380184 3300005331 Bacteria 1244
34 Ga0070677_10570850 3300005333 Bacteria 623
35 Ga0070677_10676715 3300005333 Bacteria 579
36 Ga0068869_100008493 3300005334 Bacteria 6625
37 Ga0068869_100020902 3300005334 Bacteria 4497
38 Ga0068869_100032093 3300005334 Bacteria 3699
39 Ga0068869_100735399 3300005334 Unclassified 844
40 Ga0068869_100768315 3300005334 Bacteria 826
41 Ga0068869_100780833 3300005334 Bacteria 820
42 Ga0068869_101128371 3300005334 Bacteria 687
43 Ga0070666_10051121 3300005335 Bacteria 2782
44 Ga0070666_10105889 3300005335 Bacteria 1943
45 Ga0070680_100123591 3300005336 Bacteria 2161
46 Ga0070682_100007167 3300005337 Bacteria 6281
47 Ga0068868_100200457 3300005338 Bacteria 1664
48 Ga0068868_100205766 3300005338 Bacteria 1643
49 Ga0068868_100875982 3300005338 Bacteria 814
50 Ga0070660_100257692 3300005339 Bacteria 1424
51 Ga0070660_100455165 3300005339 Bacteria 1062
52 Ga0070689_100044488 3300005340 Bacteria 3416
53 Ga0070689_100046883 3300005340 Bacteria 3331
54 Ga0070689_100080237 3300005340 Bacteria 2560
55 Ga0070689_100100596 3300005340 Bacteria 2287
56 Ga0070689_100136512 3300005340 Bacteria 1970
57 Ga0070689_100446691 3300005340 Unclassified 1100
58 Ga0070689_101273679 3300005340 Unclassified 661
59 Ga0070691_10005403 3300005341 Bacteria 5811
60 Ga0070691_10151919 3300005341 Bacteria 1188
61 Ga0070691_10156802 3300005341 Bacteria 1171
62 Ga0070687_100155603 3300005343 Bacteria 1346
63 Ga0070687_100314747 3300005343 Bacteria 998
64 Ga0070687_100481494 3300005343 Bacteria 832
65 Ga0070687_100697204 3300005343 Unclassified 709
66 Ga0070687_100749773 3300005343 Unclassified 687
67 Ga0070661_100073257 3300005344 Bacteria 2521
68 Ga0070661_100171746 3300005344 Bacteria 1646
69 Ga0070661_100464550 3300005344 Bacteria 1008
70 Ga0070692_10019836 3300005345 Bacteria 3250
71 Ga0070692_10098616 3300005345 Bacteria 1599
72 Ga0070692_10521067 3300005345 Bacteria 774
73 Ga0070692_11357502 3300005345 Unclassified 512
74 Ga0070692_11381790 3300005345 Unclassified 508
75 Ga0070668_100029740 3300005347 Bacteria 4150
76 Ga0070668_100049520 3300005347 Bacteria 3232
77 Ga0070669_100039405 3300005353 Bacteria 3434
78 Ga0070669_100072291 3300005353 Bacteria 2553
79 Ga0070669_100137950 3300005353 Bacteria 1877
80 Ga0070669_100138420 3300005353 Bacteria 1874
81 Ga0070669_100833950 3300005353 Bacteria 785
82 Ga0070669_101055541 3300005353 Bacteria 698
83 Ga0070669_101576240 3300005353 Bacteria 571
84 Ga0070675_100020417 3300005354 Bacteria 5287
85 Ga0070675_100031093 3300005354 Bacteria 4314
86 Ga0070675_100186409 3300005354 Bacteria 1796
87 Ga0070675_100191822 3300005354 Bacteria 1771
88 Ga0070671_100041100 3300005355 Bacteria 3842
89 Ga0070671_100042925 3300005355 Bacteria 3760
90 Ga0070671_100600275 3300005355 Bacteria 951
91 Ga0070674_100030441 3300005356 Bacteria 3566
92 Ga0070674_100142555 3300005356 Bacteria 1800
93 Ga0070674_100195722 3300005356 Bacteria 1558
94 Ga0070674_100199090 3300005356 Bacteria 1545
95 Ga0070674_100385979 3300005356 Bacteria 1140
96 Ga0070673_100018279 3300005364 Bacteria 5003
97 Ga0070673_100143662 3300005364 Bacteria 2015
98 Ga0070673_100776353 3300005364 Unclassified 884
99 Ga0070673_100783453 3300005364 Bacteria 879
100 Ga0070673_101748725 3300005364 Unclassified 589
101 Ga0070688_100008750 3300005365 Bacteria 5505
102 Ga0070688_100082892 3300005365 Unclassified 2080
103 Ga0070688_100238055 3300005365 Bacteria 1290
104 Ga0070688_100327009 3300005365 Bacteria 1116
105 Ga0070688_101348786 3300005365 Unclassified 577
106 Ga0070659_100002785 3300005366 Bacteria 12441
107 Ga0070659_100010028 3300005366 Bacteria 6972
108 Ga0070659_100088386 3300005366 Bacteria 2482
109 Ga0070667_100324601 3300005367 Bacteria 1389
110 Ga0070667_100926254 3300005367 Bacteria 812
111 Ga0070667_101744017 3300005367 Unclassified 586
112 Ga0070703_10136737 3300005406 Bacteria 906
113 Ga0070703_10184784 3300005406 Bacteria 808
114 Ga0070709_10014756 3300005434 Bacteria 4426
115 Ga0070709_10272945 3300005434 Bacteria 1226
116 Ga0070709_10473286 3300005434 Unclassified 947
117 Ga0070714_100057667 3300005435 Unclassified 3325
118 Ga0070713_100040613 3300005436 Bacteria 3783
119 Ga0070713_100280696 3300005436 Unclassified 1528
120 Ga0070713_100840699 3300005436 Bacteria 881
121 Ga0070701_10026970 3300005438 Bacteria 2809
122 Ga0070701_10065601 3300005438 Bacteria 1927
123 Ga0070701_10157561 3300005438 Bacteria 1313
124 Ga0070701_10641909 3300005438 Bacteria 708
125 Ga0070701_10930263 3300005438 Bacteria 602
126 Ga0070711_100433200 3300005439 Bacteria 1074
127 Ga0070705_100038713 3300005440 Bacteria 2700
128 Ga0070705_100062611 3300005440 Bacteria 2216
129 Ga0070705_100131050 3300005440 Bacteria 1636
130 Ga0070705_100333479 3300005440 Bacteria 1100
131 Ga0070705_100495516 3300005440 Bacteria 926
132 Ga0070700_100026204 3300005441 Bacteria 3440
133 Ga0070700_100095407 3300005441 Bacteria 1950
134 Ga0070700_100355278 3300005441 Bacteria 1088
135 Ga0070700_100979599 3300005441 Bacteria 694
136 Ga0070700_101375920 3300005441 Unclassified 596
137 Ga0070694_100163983 3300005444 Bacteria 1633
138 Ga0070694_100683096 3300005444 Bacteria 833
139 Ga0070694_101433656 3300005444 Unclassified 583
140 Ga0070708_100001261 3300005445 Bacteria 19463
141 Ga0070708_102089899 3300005445 Unclassified 524
142 Ga0070663_100228256 3300005455 Bacteria 1465
143 Ga0070663_100382490 3300005455 Bacteria 1147
144 Ga0070663_100535824 3300005455 Bacteria 977
145 Ga0070678_100256538 3300005456 Bacteria 1468
146 Ga0070678_100828648 3300005456 Bacteria 842
147 Ga0070678_102187175 3300005456 Bacteria 524
148 Ga0070662_100150442 3300005457 Unclassified 1812
149 Ga0070662_100184710 3300005457 Bacteria 1646
150 Ga0070662_100386039 3300005457 Bacteria 1153
151 Ga0070662_100455416 3300005457 Bacteria 1062
152 Ga0070662_100523508 3300005457 Unclassified 991
153 Ga0070662_100562075 3300005457 Bacteria 957
154 Ga0070662_101711318 3300005457 Unclassified 543
155 Ga0070681_10017232 3300005458 Bacteria 7222
156 Ga0070681_10045695 3300005458 Bacteria 4380
157 Ga0070681_10112607 3300005458 Bacteria 2661
158 Ga0070681_11023152 3300005458 Bacteria 746
159 Ga0068867_100058157 3300005459 Bacteria 2865
160 Ga0068867_100154968 3300005459 Bacteria 1802
161 Ga0070685_10170079 3300005466 Bacteria 1396
162 Ga0070685_10531432 3300005466 Bacteria 837
163 Ga0070706_100561243 3300005467 Bacteria 1062
164 Ga0070707_100427729 3300005468 Bacteria 1284
165 Ga0070707_101122875 3300005468 Unclassified 752
166 Ga0070707_102217356 3300005468 Unclassified 517
167 Ga0070698_100047263 3300005471 Bacteria 4400
168 Ga0070698_100214738 3300005471 Bacteria 1858
169 Ga0070698_101014164 3300005471 Unclassified 777
170 Ga0070698_101120320 3300005471 Bacteria 736
171 Ga0070699_100013218 3300005518 Bacteria 7118
172 Ga0070699_101829197 3300005518 Bacteria 556
173 Ga0070679_100048530 3300005530 Bacteria 4229
174 Ga0070679_100049947 3300005530 Bacteria 4166
175 Ga0070679_100122710 3300005530 Bacteria 2582
176 Ga0070679_100638034 3300005530 Bacteria 1008
177 Ga0070684_100057392 3300005535 Bacteria 3399
178 Ga0070684_100123192 3300005535 Bacteria 2333
179 Ga0070684_100263187 3300005535 Bacteria 1578
180 Ga0070684_100573015 3300005535 Bacteria 1048
181 Ga0070684_100632734 3300005535 Bacteria 995
182 Ga0070697_100117170 3300005536 Bacteria 2225
183 Ga0070697_100165851 3300005536 Unclassified 1868
184 Ga0070697_100235314 3300005536 Bacteria 1563
185 Ga0070697_100769723 3300005536 Unclassified 851
186 Ga0068853_100059145 3300005539 Unclassified 3311
187 Ga0068853_100523673 3300005539 Unclassified 1121
188 Ga0070672_100011128 3300005543 Bacteria 6266
189 Ga0070672_100025005 3300005543 Bacteria 4422
190 Ga0070672_100206872 3300005543 Bacteria 1642
191 Ga0070672_100691807 3300005543 Bacteria 892
192 Ga0070672_100705218 3300005543 Bacteria 884
193 Ga0070672_100749814 3300005543 Bacteria 857
194 Ga0070686_100061754 3300005544 Bacteria 2422
195 Ga0070686_100430899 3300005544 Bacteria 1009
196 Ga0070686_101293886 3300005544 Bacteria 609
197 Ga0070686_101774253 3300005544 Bacteria 525
198 Ga0070695_100012450 3300005545 Bacteria 5106
199 Ga0070695_100102387 3300005545 Bacteria 1931
200 Ga0070695_100858951 3300005545 Bacteria 731
201 Ga0070695_101371726 3300005545 Bacteria 586
202 Ga0070695_101878388 3300005545 Unclassified 503
203 Ga0070696_100013911 3300005546 Bacteria 5401
204 Ga0070696_100108623 3300005546 Bacteria 1996
205 Ga0070696_100381912 3300005546 Bacteria 1098
206 Ga0070696_100451956 3300005546 Bacteria 1014
207 Ga0070696_101272461 3300005546 Bacteria 624
208 Ga0070693_100007268 3300005547 Bacteria 5408
209 Ga0070693_100076460 3300005547 Bacteria 1984
210 Ga0070693_101154051 3300005547 Bacteria 593
211 Ga0070693_101514371 3300005547 Bacteria 524
212 Ga0070665_100006608 3300005548 Bacteria 11785
213 Ga0070665_101052080 3300005548 Bacteria 826
214 Ga0070665_102355839 3300005548 Bacteria 535
215 Ga0070704_100010437 3300005549 Bacteria 5652
216 Ga0070704_100032489 3300005549 Bacteria 3521
217 Ga0070704_101013175 3300005549 Bacteria 751
218 Ga0070704_101413237 3300005549 Bacteria 638
219 Ga0068855_100007091 3300005563 Bacteria 13596
220 Ga0068855_100247320 3300005563 Bacteria 1990
221 Ga0068855_100576495 3300005563 Bacteria 1216
222 Ga0070664_100032851 3300005564 Bacteria 4342
223 Ga0070664_100055110 3300005564 Bacteria 3374
224 Ga0070664_100133860 3300005564 Bacteria 2178
225 Ga0070664_100312200 3300005564 Bacteria 1423
226 Ga0068857_100035907 3300005577 Bacteria 4391
227 Ga0068857_100269255 3300005577 Bacteria 1565
228 Ga0068857_100939616 3300005577 Bacteria 830
229 Ga0068854_100021253 3300005578 Bacteria 4402
230 Ga0068854_100053063 3300005578 Bacteria 2910
231 Ga0068854_100803933 3300005578 Unclassified 820
232 Ga0068854_101253034 3300005578 Bacteria 666
233 Ga0068856_100115211 3300005614 Bacteria 2687
234 Ga0068856_100129019 3300005614 Bacteria 2533
235 Ga0068856_100200540 3300005614 Bacteria 2010
236 Ga0068856_101451498 3300005614 Bacteria 700
237 Ga0070702_100006906 3300005615 Bacteria 5405
238 Ga0070702_100009298 3300005615 Bacteria 4806
239 Ga0070702_100027803 3300005615 Bacteria 3056
240 Ga0070702_100047412 3300005615 Bacteria 2440
241 Ga0070702_100131377 3300005615 Bacteria 1582
242 Ga0070702_100489444 3300005615 Bacteria 901
243 Ga0068852_100023128 3300005616 Bacteria 4996
244 Ga0068852_100049609 3300005616 Bacteria 3592
245 Ga0068859_100060662 3300005617 Bacteria 3811
246 Ga0068859_100160363 3300005617 Bacteria 2328
247 Ga0068859_100228093 3300005617 Bacteria 1950
248 Ga0068859_100482105 3300005617 Bacteria 1336
249 Ga0068859_100519311 3300005617 Bacteria 1286
250 Ga0068859_101036487 3300005617 Unclassified 901
251 Ga0068859_101914928 3300005617 Unclassified 655
252 Ga0068859_102448737 3300005617 Bacteria 575
253 Ga0068859_102856889 3300005617 Bacteria 529
254 Ga0068864_100044832 3300005618 Bacteria 3792
255 Ga0068864_100050821 3300005618 Bacteria 3569
256 Ga0068864_100161476 3300005618 Bacteria 2037
257 Ga0068864_101639407 3300005618 Bacteria 647
258 Ga0068866_10003016 3300005718 Bacteria 6954
259 Ga0068866_10684540 3300005718 Bacteria 702
260 Ga0068861_100028370 3300005719 Bacteria 4083
261 Ga0068861_100042721 3300005719 Bacteria 3398
262 Ga0068861_100261622 3300005719 Unclassified 1481
263 Ga0068861_100864380 3300005719 Bacteria 854
264 Ga0068861_101186288 3300005719 Bacteria 738
265 Ga0068861_101959858 3300005719 Unclassified 584
266 Ga0068851_10017014 3300005834 Bacteria 3486
267 Ga0068851_10293581 3300005834 Bacteria 933
268 Ga0068851_10356572 3300005834 Bacteria 852
269 Ga0068870_10040657 3300005840 Bacteria 2412
270 Ga0068870_10894577 3300005840 Unclassified 627
271 Ga0068870_11250966 3300005840 Bacteria 539
272 Ga0068870_11302954 3300005840 Bacteria 529
273 Ga0068863_100005592 3300005841 Bacteria 12352
274 Ga0068863_100096188 3300005841 Bacteria 2811
275 Ga0068863_100197594 3300005841 Bacteria 1933
276 Ga0068863_101427204 3300005841 Bacteria 700
277 Ga0068863_101792697 3300005841 Bacteria 623
278 Ga0068863_102027036 3300005841 Bacteria 585
279 Ga0068858_100036783 3300005842 Bacteria 4539
280 Ga0068858_100207763 3300005842 Bacteria 1852
281 Ga0068858_100227922 3300005842 Bacteria 1766
282 Ga0068858_100347920 3300005842 Bacteria 1419
283 Ga0068858_100735847 3300005842 Bacteria 960
284 Ga0068858_102553730 3300005842 Bacteria 504
285 Ga0068860_100046442 3300005843 Bacteria 4140
286 Ga0068860_100063378 3300005843 Bacteria 3512
287 Ga0068860_100200347 3300005843 Bacteria 1934
288 Ga0068860_100230090 3300005843 Bacteria 1801
289 Ga0068860_100280855 3300005843 Bacteria 1627
290 Ga0068860_100657924 3300005843 Bacteria 1056
291 Ga0068860_101808783 3300005843 Bacteria 633
292 Ga0068860_102255252 3300005843 Bacteria 565
293 Ga0068862_100002047 3300005844 Bacteria 18232
294 Ga0068862_100035044 3300005844 Unclassified 4248
295 Ga0068862_100051977 3300005844 Bacteria 3505
296 Ga0068862_100065700 3300005844 Bacteria 3125
297 Ga0068862_100265745 3300005844 Unclassified 1567
298 Ga0068862_100399090 3300005844 Bacteria 1286
299 Ga0068862_101114375 3300005844 Bacteria 785
300 Ga0081455_10056470 3300005937 Bacteria 3333
301 Ga0081539_10011333 3300005985 Bacteria 7071
302 Ga0070717_10774191 3300006028 Unclassified 873
303 Ga0075432_10022594 3300006058 Bacteria 2152
304 Ga0075432_10054515 3300006058 Bacteria 1416
305 Ga0075432_10132898 3300006058 Bacteria 944
306 Ga0070712_100048673 3300006175 Bacteria 2940
307 Ga0070712_100521947 3300006175 Bacteria 998
308 Ga0075366_10125574 3300006195 Unclassified 1547
309 Ga0097621_100020042 3300006237 Bacteria 5148
310 Ga0068871_100005579 3300006358 Bacteria 8819
311 Ga0068871_100201904 3300006358 Bacteria 1717
312 Ga0075428_100115076 3300006844 Bacteria 2929
313 Ga0075428_100140848 3300006844 Bacteria 2623
314 Ga0075428_101371015 3300006844 Unclassified 743
315 Ga0075430_101254603 3300006846 Bacteria 610
316 Ga0075431_100448838 3300006847 Bacteria 1285
317 Ga0075433_10100264 3300006852 Bacteria 2564
318 Ga0075433_10639480 3300006852 Bacteria 933
319 Ga0075434_100000060 3300006871 Bacteria 55280
320 Ga0075434_100180062 3300006871 Bacteria 2133
321 Ga0075434_100307143 3300006871 Unclassified 1606
322 Ga0075434_100663031 3300006871 Bacteria 1061
323 Ga0075434_100687437 3300006871 Bacteria 1041
324 Ga0075429_100080230 3300006880 Bacteria 2844
325 Ga0075429_100092131 3300006880 Bacteria 2644
326 Ga0075429_100530440 3300006880 Bacteria 1032
327 Ga0075429_100536194 3300006880 Unclassified 1026
328 Ga0075429_101414392 3300006880 Bacteria 606
329 Ga0068865_100289608 3300006881 Bacteria 1307
330 Ga0068865_100580819 3300006881 Bacteria 945
331 Ga0068865_101052253 3300006881 Bacteria 715
332 Ga0075436_100001937 3300006914 Bacteria 14237
333 Ga0075436_100032365 3300006914 Bacteria 3604
334 Ga0075436_100077574 3300006914 Bacteria 2301
335 Ga0075436_100106877 3300006914 Bacteria 1952
336 Ga0075436_100717977 3300006914 Bacteria 741
337 Ga0097620_100060660 3300006931 Bacteria 3811
338 Ga0097620_100160359 3300006931 Bacteria 2328
339 Ga0097620_100228101 3300006931 Bacteria 1950
340 Ga0097620_100482056 3300006931 Bacteria 1336
341 Ga0097620_100519270 3300006931 Bacteria 1286
342 Ga0097620_101036539 3300006931 Unclassified 901
343 Ga0097620_101914941 3300006931 Unclassified 655
344 Ga0097620_102449474 3300006931 Bacteria 575
345 Ga0097620_102856822 3300006931 Bacteria 529
346 Ga0075435_100000048 3300007076 Bacteria 60778
347 Ga0075435_100003365 3300007076 Bacteria 10842
348 Ga0075435_100027249 3300007076 Bacteria 4467
349 Ga0075435_100089770 3300007076 Bacteria 2534
350 Ga0075435_100144078 3300007076 Unclassified 2000
351 Ga0075435_100318294 3300007076 Bacteria 1331
352 Ga0075435_100404468 3300007076 Bacteria 1174
353 Ga0075435_100705844 3300007076 Bacteria 877
354 Ga0075435_101605489 3300007076 Unclassified 571
355 Ga0105240_10059446 3300009093 Bacteria 4770
356 Ga0105240_10342550 3300009093 Bacteria 1698
357 Ga0111539_10015558 3300009094 Bacteria 9458
358 Ga0111539_10111075 3300009094 Bacteria 3216
359 Ga0111539_10142399 3300009094 Bacteria 2807
360 Ga0111539_10168159 3300009094 Bacteria 2562
361 Ga0111539_10247314 3300009094 Unclassified 2076
362 Ga0111539_10253537 3300009094 Unclassified 2049
363 Ga0111539_10532694 3300009094 Unclassified 1368
364 Ga0105245_10018968 3300009098 Bacteria 6022
365 Ga0105245_10090746 3300009098 Bacteria 2811
366 Ga0105245_10109470 3300009098 Bacteria 2567
367 Ga0105245_10192976 3300009098 Bacteria 1952
368 Ga0105245_11102900 3300009098 Bacteria 840
369 Ga0105245_11210080 3300009098 Bacteria 803
370 Ga0105245_11425572 3300009098 Bacteria 743
371 Ga0105245_11659615 3300009098 Bacteria 691
372 Ga0105245_13042020 3300009098 Bacteria 520
373 Ga0105247_10471074 3300009101 Bacteria 909
374 Ga0105247_10607572 3300009101 Unclassified 812
375 Ga0114129_10037949 3300009147 Bacteria 6797
376 Ga0114129_10147697 3300009147 Unclassified 3219
377 Ga0114129_10183517 3300009147 Bacteria 2845
378 Ga0114129_10333844 3300009147 Bacteria 2012
379 Ga0114129_10360348 3300009147 Bacteria 1924
380 Ga0114129_10711009 3300009147 Bacteria 1290
381 Ga0105243_10033355 3300009148 Bacteria 3981
382 Ga0105243_10042115 3300009148 Bacteria 3573
383 Ga0105243_10050117 3300009148 Bacteria 3297
384 Ga0105243_11224803 3300009148 Unclassified 765
385 Ga0105243_12697705 3300009148 Unclassified 537
386 Ga0105241_10071443 3300009174 Bacteria 2694
387 Ga0105241_10163040 3300009174 Bacteria 1834
388 Ga0105241_11231257 3300009174 Unclassified 710
389 Ga0105241_12647912 3300009174 Bacteria 504
390 Ga0105242_10019925 3300009176 Bacteria 5254
391 Ga0105242_10253403 3300009176 Bacteria 1587
392 Ga0105242_11374624 3300009176 Bacteria 732
393 Ga0105242_11475255 3300009176 Unclassified 710
394 Ga0105242_11635541 3300009176 Bacteria 678
395 Ga0105242_11679817 3300009176 Unclassified 671
396 Ga0105248_10040545 3300009177 Bacteria 5220
397 Ga0105248_10070650 3300009177 Bacteria 3920
398 Ga0105248_10082025 3300009177 Bacteria 3625
399 Ga0105248_10148896 3300009177 Bacteria 2641
400 Ga0105248_10210743 3300009177 Bacteria 2189
401 Ga0105248_10320963 3300009177 Bacteria 1744
402 Ga0105248_10549086 3300009177 Bacteria 1303
403 Ga0105248_10792454 3300009177 Bacteria 1069
404 Ga0105248_11123353 3300009177 Bacteria 888
405 Ga0105248_11167086 3300009177 Bacteria 870
406 Ga0105248_11998006 3300009177 Unclassified 659
407 Ga0105237_10149986 3300009545 Bacteria 2328
408 Ga0105237_10162845 3300009545 Bacteria 2229
409 Ga0105237_10931818 3300009545 Bacteria 876
410 Ga0105237_12035343 3300009545 Bacteria 583
411 Ga0105237_12044639 3300009545 Bacteria 582
412 Ga0105238_10317029 3300009551 Bacteria 1545
413 Ga0105238_10602494 3300009551 Bacteria 1107
414 Ga0105238_10977039 3300009551 Bacteria 867
415 Ga0105249_10248586 3300009553 Unclassified 1762
416 Ga0105249_10344572 3300009553 Bacteria 1508
417 Ga0105249_10712638 3300009553 Bacteria 1064
418 Ga0105249_10763665 3300009553 Bacteria 1029
419 Ga0105249_10776247 3300009553 Bacteria 1021
420 Ga0105249_10833183 3300009553 Bacteria 987
421 Ga0105239_10299680 3300010375 Bacteria 1810
422 Ga0105239_10310951 3300010375 Bacteria 1776
423 Ga0105239_11072676 3300010375 Bacteria 927
424 Ga0105246_10002307 3300011119 Bacteria 11520
425 Ga0105246_10251859 3300011119 Bacteria 1402
426 Ga0157316_1018435 3300012510 Bacteria 738
427 Ga0157327_1038468 3300012512 Unclassified 632
428 Ga0157373_10017851 3300013100 Bacteria 5168
429 Ga0157371_10022828 3300013102 Bacteria 4578
430 Ga0157371_10555852 3300013102 Bacteria 851
431 Ga0157369_10371462 3300013105 Bacteria 1484
432 Ga0157369_10552637 3300013105 Bacteria 1190
433 Ga0157369_10869023 3300013105 Bacteria 925
434 Ga0157369_11018348 3300013105 Bacteria 848
435 Ga0157374_10182720 3300013296 Bacteria 2049
436 Ga0157374_10465605 3300013296 Bacteria 1266
437 Ga0157374_11230699 3300013296 Bacteria 770
438 Ga0157374_11527189 3300013296 Unclassified 691
439 Ga0157378_10245800 3300013297 Bacteria 1711
440 Ga0163162_10015068 3300013306 Bacteria 7552
441 Ga0163162_10018287 3300013306 Bacteria 6865
442 Ga0163162_10183980 3300013306 Bacteria 2216
443 Ga0163162_10207607 3300013306 Bacteria 2088
444 Ga0157372_10027006 3300013307 Bacteria 6249
445 Ga0157372_10075238 3300013307 Bacteria 3810
446 Ga0157372_10195260 3300013307 Bacteria 2345
447 Ga0157372_10459101 3300013307 Bacteria 1485
448 Ga0157372_10583374 3300013307 Bacteria 1303
449 Ga0157375_10212388 3300013308 Bacteria 2093
450 Ga0157375_10298145 3300013308 Bacteria 1776
451 Ga0157375_10479354 3300013308 Bacteria 1409
452 Ga0157375_10614615 3300013308 Bacteria 1245
453 Ga0157375_10654487 3300013308 Bacteria 1207
454 Ga0157375_11156967 3300013308 Bacteria 907
455 Ga0157375_11310724 3300013308 Bacteria 851
456 Ga0163163_10002082 3300014325 Bacteria 16891
457 Ga0163163_10057655 3300014325 Bacteria 3840
458 Ga0163163_10123984 3300014325 Bacteria 2620
459 Ga0163163_10246803 3300014325 Bacteria 1835
460 Ga0163163_10334277 3300014325 Bacteria 1570
461 Ga0163163_10409139 3300014325 Unclassified 1415
462 Ga0163163_11887337 3300014325 Bacteria 657
463 Ga0157380_10128582 3300014326 Bacteria 2158
464 Ga0157380_10236223 3300014326 Bacteria 1645
465 Ga0157380_10364680 3300014326 Unclassified 1357
466 Ga0157380_10507340 3300014326 Bacteria 1173
467 Ga0157380_12064458 3300014326 Bacteria 632
468 Ga0157377_10110305 3300014745 Bacteria 1653
469 Ga0157377_10545425 3300014745 Bacteria 818
470 Ga0157377_10595415 3300014745 Bacteria 788
471 Ga0157379_10065641 3300014968 Bacteria 3244
472 Ga0157379_10224504 3300014968 Bacteria 1702
473 Ga0157379_11371220 3300014968 Bacteria 684
474 Ga0157379_12302954 3300014968 Bacteria 536
475 Ga0157376_10026012 3300014969 Bacteria 4618
476 Ga0157376_10549070 3300014969 Bacteria 1143
477 Ga0157376_11134793 3300014969 Unclassified 808
478 Ga0157376_13064311 3300014969 Bacteria 506
479 Ga0182007_10144904 3300015262 Bacteria 805
480 Ga0182005_1134832 3300015265 Bacteria 710
481 Ga0163161_10023966 3300017792 Bacteria 4308
482 Ga0163161_10186437 3300017792 Bacteria 1593
483 Ga0163161_10317624 3300017792 Unclassified 1230
484 Ga0163161_11323195 3300017792 Bacteria 627
485 Ga0207673_1031016 3300025290 Unclassified 740
486 Ga0207697_10021020 3300025315 Bacteria 2672
487 Ga0207697_10094388 3300025315 Bacteria 1270
488 Ga0207656_10031079 3300025321 Bacteria 2210
489 Ga0207656_10069292 3300025321 Bacteria 1564
490 Ga0207656_10647908 3300025321 Bacteria 540
491 Ga0207656_10683898 3300025321 Bacteria 525
492 Ga0207653_10123154 3300025885 Bacteria 935
493 Ga0207653_10206712 3300025885 Bacteria 742
494 Ga0207642_10296445 3300025899 Bacteria 936
495 Ga0207642_10585007 3300025899 Bacteria 693
496 Ga0207642_10770377 3300025899 Bacteria 610
497 Ga0207688_10024925 3300025901 Bacteria 3282
498 Ga0207688_10047015 3300025901 Bacteria 2410
499 Ga0207688_10341289 3300025901 Bacteria 922
500 Ga0207680_10049057 3300025903 Bacteria 2511
501 Ga0207680_10234386 3300025903 Bacteria 1262
502 Ga0207680_10477349 3300025903 Bacteria 887
503 Ga0207680_11174558 3300025903 Bacteria 548
504 Ga0207647_10167954 3300025904 Bacteria 1278
505 Ga0207647_10252317 3300025904 Bacteria 1011
506 Ga0207699_10022936 3300025906 Bacteria 3390
507 Ga0207699_10063667 3300025906 Bacteria 2229
508 Ga0207645_10001855 3300025907 Bacteria 17040
509 Ga0207645_10003188 3300025907 Bacteria 12553
510 Ga0207645_10025973 3300025907 Bacteria 3788
511 Ga0207645_10108921 3300025907 Bacteria 1792
512 Ga0207645_10111288 3300025907 Bacteria 1773
513 Ga0207645_10817763 3300025907 Bacteria 633
514 Ga0207643_10009815 3300025908 Bacteria 5141
515 Ga0207643_10231805 3300025908 Bacteria 1133
516 Ga0207643_10256941 3300025908 Bacteria 1078
517 Ga0207643_10561926 3300025908 Unclassified 733
518 Ga0207684_10582650 3300025910 Bacteria 956
519 Ga0207654_10138737 3300025911 Bacteria 1548
520 Ga0207654_10933526 3300025911 Bacteria 630
521 Ga0207654_11208089 3300025911 Unclassified 551
522 Ga0207707_10029700 3300025912 Bacteria 4781
523 Ga0207707_10032512 3300025912 Bacteria 4566
524 Ga0207707_10120495 3300025912 Bacteria 2294
525 Ga0207707_10162159 3300025912 Unclassified 1954
526 Ga0207707_10934907 3300025912 Bacteria 715
527 Ga0207695_10879440 3300025913 Bacteria 776
528 Ga0207671_11071062 3300025914 Bacteria 634
529 Ga0207693_10424680 3300025915 Bacteria 1039
530 Ga0207663_10153390 3300025916 Bacteria 1618
531 Ga0207660_10104879 3300025917 Bacteria 2117
532 Ga0207660_10298559 3300025917 Bacteria 1282
533 Ga0207662_10009156 3300025918 Bacteria 5442
534 Ga0207662_10029838 3300025918 Bacteria 3162
535 Ga0207662_10030401 3300025918 Bacteria 3134
536 Ga0207662_10279192 3300025918 Unclassified 1105
537 Ga0207662_10435273 3300025918 Bacteria 895
538 Ga0207662_10537511 3300025918 Bacteria 808
539 Ga0207657_10205720 3300025919 Bacteria 1581
540 Ga0207657_10283738 3300025919 Bacteria 1314
541 Ga0207657_10469756 3300025919 Bacteria 987
542 Ga0207657_11375165 3300025919 Unclassified 531
543 Ga0207649_10016295 3300025920 Bacteria 4187
544 Ga0207649_10158034 3300025920 Bacteria 1568
545 Ga0207649_10363014 3300025920 Bacteria 1075
546 Ga0207649_10417899 3300025920 Bacteria 1006
547 Ga0207652_10026336 3300025921 Bacteria 4842
548 Ga0207652_10148584 3300025921 Bacteria 2098
549 Ga0207652_10174208 3300025921 Bacteria 1931
550 Ga0207652_10337766 3300025921 Bacteria 1360
551 Ga0207646_10434495 3300025922 Bacteria 1185
552 Ga0207681_10102242 3300025923 Unclassified 2069
553 Ga0207681_10113121 3300025923 Bacteria 1978
554 Ga0207681_10215213 3300025923 Bacteria 1483
555 Ga0207681_10282394 3300025923 Unclassified 1307
556 Ga0207681_10516175 3300025923 Bacteria 980
557 Ga0207681_11479737 3300025923 Bacteria 569
558 Ga0207681_11752524 3300025923 Bacteria 518
559 Ga0207650_10056872 3300025925 Bacteria 2908
560 Ga0207650_10077990 3300025925 Bacteria 2505
561 Ga0207650_10141457 3300025925 Bacteria 1892
562 Ga0207650_10421647 3300025925 Bacteria 1107
563 Ga0207650_10626960 3300025925 Bacteria 905
564 Ga0207659_10011737 3300025926 Bacteria 5545
565 Ga0207659_10013259 3300025926 Bacteria 5272
566 Ga0207659_10094454 3300025926 Unclassified 2241
567 Ga0207659_10379892 3300025926 Bacteria 1178
568 Ga0207659_10561225 3300025926 Bacteria 971
569 Ga0207659_10637011 3300025926 Bacteria 910
570 Ga0207687_10076619 3300025927 Bacteria 2403
571 Ga0207687_10218190 3300025927 Bacteria 1500
572 Ga0207687_10580637 3300025927 Bacteria 943
573 Ga0207687_11150290 3300025927 Bacteria 667
574 Ga0207687_11766012 3300025927 Bacteria 530
575 Ga0207664_10063375 3300025929 Unclassified 2954
576 Ga0207644_10390872 3300025931 Bacteria 1135
577 Ga0207644_11277574 3300025931 Bacteria 617
578 Ga0207690_10198644 3300025932 Bacteria 1521
579 Ga0207690_10816318 3300025932 Bacteria 771
580 Ga0207706_10003203 3300025933 Bacteria 15707
581 Ga0207706_10007767 3300025933 Bacteria 9902
582 Ga0207706_10179172 3300025933 Bacteria 1861
583 Ga0207706_10488266 3300025933 Unclassified 1064
584 Ga0207706_11515471 3300025933 Unclassified 546
585 Ga0207686_10065498 3300025934 Bacteria 2317
586 Ga0207686_10181516 3300025934 Unclassified 1493
587 Ga0207686_10409078 3300025934 Unclassified 1035
588 Ga0207686_10532792 3300025934 Bacteria 916
589 Ga0207686_11211384 3300025934 Bacteria 618
590 Ga0207709_10026290 3300025935 Bacteria 3342
591 Ga0207709_10207800 3300025935 Bacteria 1403
592 Ga0207709_10213737 3300025935 Bacteria 1386
593 Ga0207670_10034981 3300025936 Bacteria 3253
594 Ga0207670_10098250 3300025936 Bacteria 2086
595 Ga0207670_10277374 3300025936 Bacteria 1305
596 Ga0207670_10387150 3300025936 Bacteria 1115
597 Ga0207670_10406764 3300025936 Unclassified 1089
598 Ga0207670_10509538 3300025936 Bacteria 978
599 Ga0207670_10536998 3300025936 Bacteria 954
600 Ga0207670_11033676 3300025936 Unclassified 692
601 Ga0207670_11137794 3300025936 Unclassified 660
602 Ga0207669_10158702 3300025937 Unclassified 1594
603 Ga0207669_10196875 3300025937 Bacteria 1459
604 Ga0207669_10303212 3300025937 Unclassified 1215
605 Ga0207669_10416666 3300025937 Bacteria 1056
606 Ga0207669_11419297 3300025937 Bacteria 591
607 Ga0207704_10042955 3300025938 Bacteria 2665
608 Ga0207704_10254005 3300025938 Bacteria 1321
609 Ga0207665_10101572 3300025939 Bacteria 2008
610 Ga0207691_10003520 3300025940 Bacteria 15234
611 Ga0207691_10005588 3300025940 Bacteria 12149
612 Ga0207691_10015213 3300025940 Bacteria 7320
613 Ga0207691_10059116 3300025940 Bacteria 3486
614 Ga0207691_10166861 3300025940 Bacteria 1929
615 Ga0207691_11252668 3300025940 Bacteria 614
616 Ga0207711_10002753 3300025941 Bacteria 15495
617 Ga0207711_10005503 3300025941 Bacteria 10709
618 Ga0207711_10187394 3300025941 Bacteria 1884
619 Ga0207711_10269699 3300025941 Bacteria 1566
620 Ga0207711_10279104 3300025941 Bacteria 1538
621 Ga0207711_10288901 3300025941 Bacteria 1511
622 Ga0207689_10010456 3300025942 Bacteria 7990
623 Ga0207689_10014676 3300025942 Bacteria 6652
624 Ga0207689_10037984 3300025942 Bacteria 3990
625 Ga0207689_10139292 3300025942 Bacteria 1998
626 Ga0207689_10787467 3300025942 Bacteria 803
627 Ga0207661_10001853 3300025944 Bacteria 14467
628 Ga0207661_10634605 3300025944 Bacteria 981
629 Ga0207661_11229095 3300025944 Bacteria 689
630 Ga0207679_10001341 3300025945 Bacteria 15577
631 Ga0207679_10027065 3300025945 Bacteria 3961
632 Ga0207679_10035872 3300025945 Bacteria 3512
633 Ga0207679_10983427 3300025945 Bacteria 773
634 Ga0207679_11074683 3300025945 Bacteria 738
635 Ga0207667_10023780 3300025949 Bacteria 6743
636 Ga0207667_10398526 3300025949 Bacteria 1401
637 Ga0207667_10504668 3300025949 Bacteria 1227
638 Ga0207651_10053328 3300025960 Bacteria 2763
639 Ga0207651_10055456 3300025960 Bacteria 2722
640 Ga0207651_10546455 3300025960 Unclassified 1007
641 Ga0207651_10597642 3300025960 Bacteria 964
642 Ga0207651_10948972 3300025960 Unclassified 767
643 Ga0207651_11266345 3300025960 Unclassified 663
644 Ga0207712_10030670 3300025961 Bacteria 3617
645 Ga0207712_10035034 3300025961 Bacteria 3406
646 Ga0207712_10157178 3300025961 Unclassified 1762
647 Ga0207712_11476222 3300025961 Unclassified 609
648 Ga0207712_12006089 3300025961 Bacteria 518
649 Ga0207668_10089573 3300025972 Bacteria 2256
650 Ga0207668_10331399 3300025972 Bacteria 1266
651 Ga0207668_10896041 3300025972 Unclassified 789
652 Ga0207668_11035052 3300025972 Bacteria 735
653 Ga0207668_11460542 3300025972 Bacteria 617
654 Ga0207640_10011238 3300025981 Bacteria 5064
655 Ga0207640_10160640 3300025981 Bacteria 1662
656 Ga0207640_10977656 3300025981 Bacteria 743
657 Ga0207640_11198694 3300025981 Bacteria 675
658 Ga0207658_10059362 3300025986 Bacteria 2850
659 Ga0207658_10256081 3300025986 Bacteria 1489
660 Ga0207658_11109225 3300025986 Bacteria 723
661 Ga0207658_11732957 3300025986 Bacteria 570
662 Ga0207677_10165277 3300026023 Bacteria 1724
663 Ga0207677_10170559 3300026023 Bacteria 1701
664 Ga0207677_10225746 3300026023 Bacteria 1505
665 Ga0207677_10232187 3300026023 Bacteria 1487
666 Ga0207677_12283278 3300026023 Unclassified 503
667 Ga0207703_10031616 3300026035 Bacteria 4186
668 Ga0207703_10081715 3300026035 Bacteria 2694
669 Ga0207703_10315460 3300026035 Bacteria 1430
670 Ga0207703_10810594 3300026035 Bacteria 894
671 Ga0207703_11041244 3300026035 Unclassified 786
672 Ga0207703_11259183 3300026035 Bacteria 711
673 Ga0207639_10038116 3300026041 Bacteria 3574
674 Ga0207639_10088786 3300026041 Bacteria 2468
675 Ga0207639_11642835 3300026041 Bacteria 602
676 Ga0207678_10146176 3300026067 Bacteria 2018
677 Ga0207678_10212058 3300026067 Bacteria 1657
678 Ga0207678_10246382 3300026067 Bacteria 1530
679 Ga0207708_10014133 3300026075 Bacteria 5968
680 Ga0207708_10034424 3300026075 Bacteria 3853
681 Ga0207708_10041959 3300026075 Bacteria 3488
682 Ga0207708_10085700 3300026075 Bacteria 2424
683 Ga0207708_10526774 3300026075 Bacteria 994
684 Ga0207702_10033658 3300026078 Bacteria 4281
685 Ga0207702_10202019 3300026078 Bacteria 1843
686 Ga0207702_10208338 3300026078 Bacteria 1816
687 Ga0207702_11199737 3300026078 Bacteria 753
688 Ga0207641_10002320 3300026088 Bacteria 17656
689 Ga0207641_10261216 3300026088 Bacteria 1621
690 Ga0207641_10466304 3300026088 Bacteria 1222
691 Ga0207641_11749759 3300026088 Bacteria 623
692 Ga0207648_10062565 3300026089 Bacteria 3244
693 Ga0207648_10073351 3300026089 Bacteria 2983
694 Ga0207648_10869255 3300026089 Bacteria 841
695 Ga0207676_10109648 3300026095 Bacteria 2307
696 Ga0207676_10252937 3300026095 Bacteria 1587
697 Ga0207676_10265993 3300026095 Bacteria 1550
698 Ga0207676_10414121 3300026095 Bacteria 1262
699 Ga0207676_11089335 3300026095 Bacteria 789
700 Ga0207674_10002910 3300026116 Bacteria 21258
701 Ga0207674_10012583 3300026116 Bacteria 9456
702 Ga0207674_10018614 3300026116 Bacteria 7544
703 Ga0207674_10701328 3300026116 Bacteria 977
704 Ga0207675_100034037 3300026118 Bacteria 4748
705 Ga0207675_100057894 3300026118 Unclassified 3617
706 Ga0207675_100094318 3300026118 Bacteria 2815
707 Ga0207675_100302024 3300026118 Bacteria 1559
708 Ga0207675_100313956 3300026118 Bacteria 1529
709 Ga0207675_100328237 3300026118 Bacteria 1495
710 Ga0207675_100496241 3300026118 Bacteria 1215
711 Ga0207675_102020703 3300026118 Bacteria 594
712 Ga0207683_10502915 3300026121 Unclassified 1119
713 Ga0207683_11804012 3300026121 Unclassified 561
714 Ga0207698_10477782 3300026142 Unclassified 1208
715 Ga0207698_11191344 3300026142 Bacteria 775
716 Ga0207698_11954244 3300026142 Unclassified 601
717 Ga0209813_10345296 3300027866 Bacteria 588
718 Ga0207428_10013805 3300027907 Bacteria 7039
719 Ga0207428_10049069 3300027907 Unclassified 3384
720 Ga0207428_10121792 3300027907 Unclassified 2000
721 Ga0207428_10190586 3300027907 Unclassified 1546
722 Ga0207428_10217034 3300027907 Bacteria 1435
723 Ga0268266_10010488 3300028379 Bacteria 8098
724 Ga0268266_10353306 3300028379 Bacteria 1382
725 Ga0268266_11223167 3300028379 Bacteria 726
726 Ga0268265_10026487 3300028380 Bacteria 4126
727 Ga0268265_10073258 3300028380 Unclassified 2674
728 Ga0268265_10286461 3300028380 Bacteria 1476
729 Ga0268265_10341270 3300028380 Bacteria 1364
730 Ga0268265_10371628 3300028380 Bacteria 1312
731 Ga0268265_10752642 3300028380 Bacteria 946
732 Ga0268265_11013799 3300028380 Bacteria 820
733 Ga0268265_12215961 3300028380 Bacteria 556
734 Ga0268265_12694124 3300028380 Bacteria 502
735 Ga0268264_10027041 3300028381 Bacteria 4686
736 Ga0268264_10246244 3300028381 Bacteria 1658
737 Ga0268264_10250373 3300028381 Bacteria 1645
738 Ga0268264_10306612 3300028381 Bacteria 1496
739 Ga0268264_11057658 3300028381 Bacteria 819
740 Ga0268264_11318836 3300028381 Bacteria 732
741 Ga0268264_11563380 3300028381 Bacteria 670
742 Ga0307408_100032165 3300031548 Bacteria 3657
743 Ga0307408_100037317 3300031548 Bacteria 3422
744 Ga0307408_102057656 3300031548 Unclassified 550
745 Ga0316576_10153386 3300031727 Bacteria 1736
746 Ga0307413_10140755 3300031824 Bacteria 1667
747 Ga0307413_10419120 3300031824 Bacteria 1054
748 Ga0307410_10627860 3300031852 Unclassified 899
749 Ga0307406_10835918 3300031901 Unclassified 779
750 Ga0307407_11045773 3300031903 Unclassified 633
751 Ga0307412_10942840 3300031911 Unclassified 759
752 Ga0307409_100411928 3300031995 Unclassified 1294
753 Ga0307416_100141660 3300032002 Bacteria 2187
754 Ga0307416_100259370 3300032002 Bacteria 1698
755 Ga0307416_100498712 3300032002 Bacteria 1281
756 Ga0307414_10853275 3300032004 Bacteria 833
757 Ga0307411_11795197 3300032005 Unclassified 569
758 Ga0307415_101676912 3300032126 Unclassified 612
759 Ga0316580_10036967 3300032139 Bacteria 1511
760 Ga0373958_0150084 3300034819 Bacteria 583
761 Ga0373938_0152127 3300034957 Bacteria 616
762 Ga0373928_0134747 3300035084 Bacteria 672
763 Ga0373929_0127971 3300035085 Bacteria 663
764 Ga0373929_0199767 3300035085 Unclassified 560
765 Ga0373934_0019181 3300035086 Unclassified 2623
766 Ga0373951_0058648 3300035091 Bacteria 960
767 Ga0373939_0074386 3300035114 Bacteria 1114
768 Ga0373941_0362736 3300035115 Bacteria 592
769 Ga0373953_0193322 3300035117 Unclassified 879
770 Ga0373957_0012219 3300035120 Unclassified 2886
771 Ga0373960_0027568 3300035121 Unclassified 1561
772 Ga0373943_0037263 3300035170 Bacteria 2334
773 Ga0373955_0132445 3300035172 Archaea 1456
774 Ga0373942_0139809 3300035207 Bacteria 770
775 Ga0373961_0088183 3300035241 Bacteria 987
776 Ga0373961_0317464 3300035241 Unclassified 580
777 Ga0373962_0117333 3300035242 Bacteria 845
778 Ga0373935_0239186 3300035692 Bacteria 1267
779 Ga0373935_0374486 3300035692 Unclassified 1019
780 Ga0373927_0446565 3300035695 Bacteria 854
781 Ga0373933_0034538 3300035724 Bacteria 2947
782 Ga0373933_0053768 3300035724 Bacteria 2412
783 Ga0373937_0005939 3300036401 Bacteria 10508
784 Ga0373937_0008872 3300036401 Bacteria 8728
785 Ga0373925_0011758 3300037068 Bacteria 6333
786 Ga0373925_0379349 3300037068 Bacteria 1151
787 Ga0436365_0306411 3300039437 Bacteria 2525
788 Ga0436365_0600493 3300039437 Bacteria 2507
789 Ga0439431_0013058 3300041997 Bacteria 1914
790 Ga0439449_0362573 3300042007 Bacteria 549
791 Ga0439444_0179634 3300042437 Unclassified 525
792 Ga0451577_1730358 3300042876 Bacteria 550
793 Ga0451576_0018884 3300045051 Bacteria 7537
794 Ga0451576_1037018 3300045051 Bacteria 859
795 Ga0466967_0333536 3300045976 Bacteria 1465
796 Ga0466967_0574840 3300045976 Bacteria 1111
797 Ga0495592_0458370 3300046454 Unclassified 798
798 Ga0495629_0236515 3300046459 Bacteria 1258
799 Ga0495651_0024141 3300046462 Bacteria 4730
800 Ga0495580_0142836 3300046472 Bacteria 1659
801 Ga0495639_0025433 3300046475 Bacteria 2611
802 Ga0495639_0495428 3300046475 Bacteria 623
803 Ga0495662_0152511 3300046476 Bacteria 1138
804 Ga0495610_0379451 3300046512 Unclassified 526
805 Ga0495628_0360665 3300046516 Archaea 1067
806 Ga0495630_1276220 3300046517 Bacteria 554
807 Ga0495666_0253858 3300046526 Bacteria 801
808 Ga0495652_0056328 3300046529 Bacteria 3339
809 Ga0495652_0868541 3300046529 Unclassified 597
810 Ga0495665_0045690 3300046531 Bacteria 2326
811 Ga0495586_0003713 3300046535 Bacteria 8187
812 Ga0495586_0029250 3300046535 Bacteria 2948
813 Ga0495587_0003735 3300046536 Bacteria 10101
814 Ga0495621_0167395 3300046539 Bacteria 872
815 Ga0495645_0005663 3300046543 Bacteria 8603
816 Ga0495667_0019363 3300046559 Bacteria 4593
817 Ga0495634_0657428 3300046642 Bacteria 605
818 Ga0495635_0184157 3300046663 Bacteria 1419
819 Ga0495588_0301065 3300046674 Bacteria 844
820 Ga0495599_0025916 3300046678 Bacteria 3673
821 Ga0495647_0468708 3300046681 Bacteria 584
822 Ga0495658_0775386 3300046683 Bacteria 614
823 Ga0495669_0083293 3300046684 Bacteria 1470
824 Ga0495613_0091592 3300046689 Bacteria 2202
825 Ga0495600_0041107 3300046809 Bacteria 3013
826 Ga0495581_0126327 3300047315 Bacteria 1489
827 Ga0495604_0589617 3300047317 Unclassified 714
828 Ga0495674_0118735 3300047319 Bacteria 2236
829 Ga0495674_1156732 3300047319 Bacteria 587
830 Ga0495675_0004148 3300047444 Bacteria 8773
831 Ga0495684_0197293 3300047471 Bacteria 1485
832 Ga0495684_0603131 3300047471 Bacteria 740
833 Ga0495593_0072422 3300047673 Bacteria 1789
834 Ga0495593_0685055 3300047673 Unclassified 515
835 Ga0496101_1063946 3300048904 Bacteria 636
836 Ga0496102_0385028 3300048905 Bacteria 1320
837 Ga0496102_0393231 3300048905 Bacteria 1304
838 Ga0496104_1625665 3300048907 Bacteria 549
839 Ga0496107_0409939 3300048910 Bacteria 1008
840 Ga0496107_0743397 3300048910 Bacteria 720
841 Ga0496108_0189445 3300048911 Bacteria 1783
842 Ga0496109_1569141 3300048912 Bacteria 593
843 Ga0496109_2053642 3300048912 Bacteria 503
844 Ga0496110_0290561 3300048913 Bacteria 1489
845 Ga0496111_1343319 3300048914 Unclassified 502
846 Ga0496112_0067669 3300048915 Bacteria 3525
847 Ga0496112_0135933 3300048915 Bacteria 2429
848 Ga0496112_0255434 3300048915 Bacteria 1703
849 Ga0496112_0811641 3300048915 Bacteria 860
850 Ga0496113_0311337 3300048916 Bacteria 1261
851 Ga0496113_0440505 3300048916 Bacteria 1047
852 Ga0496113_0474781 3300048916 Bacteria 1005
853 Ga0501036_0237633 3300049572 Unclassified 1528
854 Ga0501040_0720086 3300049576 Bacteria 722
855 Ga0501041_0663413 3300049577 Bacteria 667
856 Ga0501071_0579061 3300049587 Bacteria 863
857 Ga0501072_0150873 3300049588 Bacteria 1853
858 Ga0501074_0231732 3300049590 Bacteria 1315
859 Ga0501075_0053248 3300049591 Bacteria 3044
860 Ga0501075_0089020 3300049591 Bacteria 2341
861 Ga0501075_0890409 3300049591 Bacteria 677
862 Ga0501076_0006384 3300049592 Bacteria 8551
863 Ga0501206_060626 3300049653 Unclassified 621
864 Ga0501079_0145036 3300049741 Bacteria 1850
865 Ga0501081_0010573 3300049743 Bacteria 6027
866 Ga0501045_1321501 3300049824 Bacteria 524
867 nmdc:mga03683_553044_c1 3300050489 Unclassified 560
868 nmdc:mga0k408_313800_c1 3300050493 Unclassified 936
869 nmdc:mga04h51_380561_c1 3300050495 Bacteria 588
870 nmdc:mga07m45_366919_c1 3300050496 Bacteria 836
871 nmdc:mga05p37_127627_c1 3300050507 Bacteria 3122
872 nmdc:mga05p37_1853023_c1 3300050507 Bacteria 579
873 nmdc:mga05p37_18814_c1 3300050507 Bacteria 8347
874 nmdc:mga05p37_2249_c1 3300050507 Bacteria 22479
875 nmdc:mga05p37_56251_c1 3300050507 Bacteria 4843
876 nmdc:mga05p37_830807_c1 3300050507 Bacteria 1006
877 nmdc:mga05p37_8658_c1 3300050507 Bacteria 12027
878 nmdc:mga09592_388904_c1 3300050508 Bacteria 1206
879 nmdc:mga09592_408692_c1 3300050508 Unclassified 1173
880 nmdc:mga09592_466034_c1 3300050508 Bacteria 1089
881 nmdc:mga0qj67_497535_c1 3300050509 Bacteria 980
882 nmdc:mga06r32_104778_c1 3300050510 Bacteria 2778
883 nmdc:mga08y16_121864_c1 3300050511 Bacteria 2714
884 nmdc:mga08y16_2008187_c1 3300050511 Unclassified 527
885 nmdc:mga08y16_25031_c1 3300050511 Bacteria 6296
886 nmdc:mga08y16_318515_c1 3300050511 Bacteria 1601
887 nmdc:mga08y16_503701_c1 3300050511 Unclassified 1230
888 nmdc:mga08y16_50802_c1 3300050511 Bacteria 4339
889 nmdc:mga08y16_975976_c1 3300050511 Unclassified 829
890 nmdc:mga0n895_1363126_c1 3300050512 Unclassified 679
891 nmdc:mga0n895_14_c1 3300050512 Bacteria 102430
892 nmdc:mga0n895_197928_c1 3300050512 Bacteria 2041
893 nmdc:mga0n895_334327_c1 3300050512 Unclassified 1535
894 nmdc:mga0n895_627886_c1 3300050512 Bacteria 1075
895 nmdc:mga0n895_71966_c1 3300050512 Bacteria 3429
896 nmdc:mga0rr50_108369_c1 3300050513 Bacteria 2194
897 nmdc:mga0rr50_1556638_c1 3300050513 Bacteria 558
898 nmdc:mga0rr50_222104_c1 3300050513 Bacteria 1560
899 nmdc:mga0rr50_54452_c1 3300050513 Bacteria 2981
900 nmdc:mga0rr50_606673_c1 3300050513 Bacteria 933
901 nmdc:mga0rr50_617361_c1 3300050513 Bacteria 925
902 nmdc:mga0rr50_68_c1 3300050513 Bacteria 61320
903 nmdc:mga0rr50_833460_c1 3300050513 Unclassified 787
904 nmdc:mga08x19_356216_c1 3300050514 Bacteria 1022
905 nmdc:mga08x19_481967_c1 3300050514 Bacteria 875
906 nmdc:mga08x19_514980_c1 3300050514 Bacteria 845
907 nmdc:mga08x19_862_c1 3300050514 Bacteria 19241
908 nmdc:mga08x19_897483_c1 3300050514 Bacteria 630
909 nmdc:mga08x19_91271_c1 3300050514 Unclassified 2011
910 nmdc:mga0a205_100134_c2 3300050515 Unclassified 1778
911 nmdc:mga0a205_199671_c1 3300050515 Bacteria 1890
912 nmdc:mga0a205_287673_c1 3300050515 Bacteria 1518
913 nmdc:mga0a205_482077_c1 3300050515 Bacteria 1098
914 nmdc:mga0a205_54411_c1 3300050515 Bacteria 3864
915 nmdc:mga0a205_556596_c1 3300050515 Bacteria 1002
916 Ga0495601_0889292 3300053077 Unclassified 563
917 Ga0495612_0443302 3300053078 Bacteria 593
918 Ga0495595_0045661 3300053084 Bacteria 2016
919 Ga0495619_0238228 3300053085 Archaea 1261
920 Ga0500592_035842 3300053116 Bacteria 801
921 Ga0501084_0058573 3300054114 Bacteria 3223
922 Ga0501084_1574344 3300054114 Unclassified 550
923 Ga0501082_0366661 3300060353 Bacteria 1256
924 Ga0501082_0535782 3300060353 Bacteria 1024
925 Ga0070696_100217641
926 JGI24752J21851_1020319
927 JGI24751J29686_10103979
928 Ga0065714_10263793
929 Ga0065712_10003335
930 Ga0065712_10216442
931 Ga0065715_10123314
932 Ga0065715_10506276
933 Ga0065715_10622356
934 Ga0065715_10807060
935 Ga0065707_11069781
936 Ga0070658_10545867
937 Ga0070676_10004580
938 Ga0070676_10005881
939 Ga0070676_10063539
940 Ga0070676_10684833
941 Ga0070676_11192708
942 Ga0070676_11226040
943 Ga0070683_100006743
944 Ga0070683_100137723
945 Ga0070683_100651275
946 Ga0070690_100005897
947 Ga0070690_100166369
948 Ga0070690_100193997
949 Ga0070690_100205785
950 Ga0070690_100371626
951 Ga0070670_100001521
952 Ga0070670_100011997
953 Ga0070670_100042067
954 Ga0070670_100077225
955 Ga0070670_100086093
956 Ga0070670_100379250
957 Ga0070670_100380184
958 Ga0070677_10570850
959 Ga0070677_10676715
960 Ga0068869_100008493
961 Ga0068869_100020902
962 Ga0068869_100032093
963 Ga0068869_100735399
964 Ga0068869_100768315
965 Ga0068869_100780833
966 Ga0068869_101128371
967 Ga0070666_10051121
968 Ga0070666_10105889
969 Ga0070680_100123591
970 Ga0070682_100007167
971 Ga0068868_100200457
972 Ga0068868_100205766
973 Ga0068868_100875982
974 Ga0070660_100257692
975 Ga0070660_100455165
976 Ga0070689_100044488
977 Ga0070689_100046883
978 Ga0070689_100080237
979 Ga0070689_100100596
980 Ga0070689_100136512
981 Ga0070689_100446691
982 Ga0070689_101273679
983 Ga0070691_10005403
984 Ga0070691_10151919
985 Ga0070691_10156802
986 Ga0070687_100155603
987 Ga0070687_100314747
988 Ga0070687_100481494
989 Ga0070687_100697204
990 Ga0070687_100749773
991 Ga0070661_100073257
992 Ga0070661_100171746
993 Ga0070661_100464550
994 Ga0070692_10019836
995 Ga0070692_10098616
996 Ga0070692_10521067
997 Ga0070692_11357502
998 Ga0070692_11381790
999 Ga0070668_100029740
1000 Ga0070668_100049520
1001 Ga0070669_100039405
1002 Ga0070669_100072291
1003 Ga0070669_100137950
1004 Ga0070669_100138420
1005 Ga0070669_100833950
1006 Ga0070669_101055541
1007 Ga0070669_101576240
1008 Ga0070675_100020417
1009 Ga0070675_100031093
1010 Ga0070675_100186409
1011 Ga0070675_100191822
1012 Ga0070671_100041100
1013 Ga0070671_100042925
1014 Ga0070671_100600275
1015 Ga0070674_100030441
1016 Ga0070674_100142555
1017 Ga0070674_100195722
1018 Ga0070674_100199090
1019 Ga0070674_100385979
1020 Ga0070673_100018279
1021 Ga0070673_100143662
1022 Ga0070673_100776353
1023 Ga0070673_100783453
1024 Ga0070673_101748725
1025 Ga0070688_100008750
1026 Ga0070688_100082892
1027 Ga0070688_100238055
1028 Ga0070688_100327009
1029 Ga0070688_101348786
1030 Ga0070659_100002785
1031 Ga0070659_100010028
1032 Ga0070659_100088386
1033 Ga0070667_100324601
1034 Ga0070667_100926254
1035 Ga0070667_101744017
1036 Ga0070703_10136737
1037 Ga0070703_10184784
1038 Ga0070709_10014756
1039 Ga0070709_10272945
1040 Ga0070709_10473286
1041 Ga0070714_100057667
1042 Ga0070713_100040613
1043 Ga0070713_100280696
1044 Ga0070713_100840699
1045 Ga0070701_10026970
1046 Ga0070701_10065601
1047 Ga0070701_10157561
1048 Ga0070701_10641909
1049 Ga0070701_10930263
1050 Ga0070711_100433200
1051 Ga0070705_100038713
1052 Ga0070705_100062611
1053 Ga0070705_100131050
1054 Ga0070705_100333479
1055 Ga0070705_100495516
1056 Ga0070700_100026204
1057 Ga0070700_100095407
1058 Ga0070700_100355278
1059 Ga0070700_100979599
1060 Ga0070700_101375920
1061 Ga0070694_100163983
1062 Ga0070694_100683096
1063 Ga0070694_101433656
1064 Ga0070708_100001261
1065 Ga0070708_102089899
1066 Ga0070663_100228256
1067 Ga0070663_100382490
1068 Ga0070663_100535824
1069 Ga0070678_100256538
1070 Ga0070678_100828648
1071 Ga0070678_102187175
1072 Ga0070662_100150442
1073 Ga0070662_100184710
1074 Ga0070662_100386039
1075 Ga0070662_100455416
1076 Ga0070662_100523508
1077 Ga0070662_100562075
1078 Ga0070662_101711318
1079 Ga0070681_10017232
1080 Ga0070681_10045695
1081 Ga0070681_10112607
1082 Ga0070681_11023152
1083 Ga0068867_100058157
1084 Ga0068867_100154968
1085 Ga0070685_10170079
1086 Ga0070685_10531432
1087 Ga0070706_100561243
1088 Ga0070707_100427729
1089 Ga0070707_101122875
1090 Ga0070707_102217356
1091 Ga0070698_100047263
1092 Ga0070698_100214738
1093 Ga0070698_101014164
1094 Ga0070698_101120320
1095 Ga0070699_100013218
1096 Ga0070699_101829197
1097 Ga0070679_100048530
1098 Ga0070679_100049947
1099 Ga0070679_100122710
1100 Ga0070679_100638034
1101 Ga0070684_100057392
1102 Ga0070684_100123192
1103 Ga0070684_100263187
1104 Ga0070684_100573015
1105 Ga0070684_100632734
1106 Ga0070697_100117170
1107 Ga0070697_100165851
1108 Ga0070697_100235314
1109 Ga0070697_100769723
1110 Ga0068853_100059145
1111 Ga0068853_100523673
1112 Ga0070672_100011128
1113 Ga0070672_100025005
1114 Ga0070672_100206872
1115 Ga0070672_100691807
1116 Ga0070672_100705218
1117 Ga0070672_100749814
1118 Ga0070686_100061754
1119 Ga0070686_100430899
1120 Ga0070686_101293886
1121 Ga0070686_101774253
1122 Ga0070695_100012450
1123 Ga0070695_100102387
1124 Ga0070695_100858951
1125 Ga0070695_101371726
1126 Ga0070695_101878388
1127 Ga0070696_100013911
1128 Ga0070696_100108623
1129 Ga0070696_100381912
1130 Ga0070696_100451956
1131 Ga0070696_101272461
1132 Ga0070693_100007268
1133 Ga0070693_100076460
1134 Ga0070693_101154051
1135 Ga0070693_101514371
1136 Ga0070665_100006608
1137 Ga0070665_101052080
1138 Ga0070665_102355839
1139 Ga0070704_100010437
1140 Ga0070704_100032489
1141 Ga0070704_101013175
1142 Ga0070704_101413237
1143 Ga0068855_100007091
1144 Ga0068855_100247320
1145 Ga0068855_100576495
1146 Ga0070664_100032851
1147 Ga0070664_100055110
1148 Ga0070664_100133860
1149 Ga0070664_100312200
1150 Ga0068857_100035907
1151 Ga0068857_100269255
1152 Ga0068857_100939616
1153 Ga0068854_100021253
1154 Ga0068854_100053063
1155 Ga0068854_100803933
1156 Ga0068854_101253034
1157 Ga0068856_100115211
1158 Ga0068856_100129019
1159 Ga0068856_100200540
1160 Ga0068856_101451498
1161 Ga0070702_100006906
1162 Ga0070702_100009298
1163 Ga0070702_100027803
1164 Ga0070702_100047412
1165 Ga0070702_100131377
1166 Ga0070702_100489444
1167 Ga0068852_100023128
1168 Ga0068852_100049609
1169 Ga0068859_100060662
1170 Ga0068859_100160363
1171 Ga0068859_100228093
1172 Ga0068859_100482105
1173 Ga0068859_100519311
1174 Ga0068859_101036487
1175 Ga0068859_101914928
1176 Ga0068859_102448737
1177 Ga0068859_102856889
1178 Ga0068864_100044832
1179 Ga0068864_100050821
1180 Ga0068864_100161476
1181 Ga0068864_101639407
1182 Ga0068866_10003016
1183 Ga0068866_10684540
1184 Ga0068861_100028370
1185 Ga0068861_100042721
1186 Ga0068861_100261622
1187 Ga0068861_100864380
1188 Ga0068861_101186288
1189 Ga0068861_101959858
1190 Ga0068851_10017014
1191 Ga0068851_10293581
1192 Ga0068851_10356572
1193 Ga0068870_10040657
1194 Ga0068870_10894577
1195 Ga0068870_11250966
1196 Ga0068870_11302954
1197 Ga0068863_100005592
1198 Ga0068863_100096188
1199 Ga0068863_100197594
1200 Ga0068863_101427204
1201 Ga0068863_101792697
1202 Ga0068863_102027036
1203 Ga0068858_100036783
1204 Ga0068858_100207763
1205 Ga0068858_100227922
1206 Ga0068858_100347920
1207 Ga0068858_100735847
1208 Ga0068858_102553730
1209 Ga0068860_100046442
1210 Ga0068860_100063378
1211 Ga0068860_100200347
1212 Ga0068860_100230090
1213 Ga0068860_100280855
1214 Ga0068860_100657924
1215 Ga0068860_101808783
1216 Ga0068860_102255252
1217 Ga0068862_100002047
1218 Ga0068862_100035044
1219 Ga0068862_100051977
1220 Ga0068862_100065700
1221 Ga0068862_100265745
1222 Ga0068862_100399090
1223 Ga0068862_101114375
1224 Ga0081455_10056470
1225 Ga0081539_10011333
1226 Ga0070717_10774191
1227 Ga0075432_10022594
1228 Ga0075432_10054515
1229 Ga0075432_10132898
1230 Ga0070712_100048673
1231 Ga0070712_100521947
1232 Ga0075366_10125574
1233 Ga0097621_100020042
1234 Ga0068871_100005579
1235 Ga0068871_100201904
1236 Ga0075428_100115076
1237 Ga0075428_100140848
1238 Ga0075428_101371015
1239 Ga0075430_101254603
1240 Ga0075431_100448838
1241 Ga0075433_10100264
1242 Ga0075433_10639480
1243 Ga0075434_100000060
1244 Ga0075434_100180062
1245 Ga0075434_100307143
1246 Ga0075434_100663031
1247 Ga0075434_100687437
1248 Ga0075429_100080230
1249 Ga0075429_100092131
1250 Ga0075429_100530440
1251 Ga0075429_100536194
1252 Ga0075429_101414392
1253 Ga0068865_100289608
1254 Ga0068865_100580819
1255 Ga0068865_101052253
1256 Ga0075436_100001937
1257 Ga0075436_100032365
1258 Ga0075436_100077574
1259 Ga0075436_100106877
1260 Ga0075436_100717977
1261 Ga0097620_100060660
1262 Ga0097620_100160359
1263 Ga0097620_100228101
1264 Ga0097620_100482056
1265 Ga0097620_100519270
1266 Ga0097620_101036539
1267 Ga0097620_101914941
1268 Ga0097620_102449474
1269 Ga0097620_102856822
1270 Ga0075435_100000048
1271 Ga0075435_100003365
1272 Ga0075435_100027249
1273 Ga0075435_100089770
1274 Ga0075435_100144078
1275 Ga0075435_100318294
1276 Ga0075435_100404468
1277 Ga0075435_100705844
1278 Ga0075435_101605489
1279 Ga0105240_10059446
1280 Ga0105240_10342550
1281 Ga0111539_10015558
1282 Ga0111539_10111075
1283 Ga0111539_10142399
1284 Ga0111539_10168159
1285 Ga0111539_10247314
1286 Ga0111539_10253537
1287 Ga0111539_10532694
1288 Ga0105245_10018968
1289 Ga0105245_10090746
1290 Ga0105245_10109470
1291 Ga0105245_10192976
1292 Ga0105245_11102900
1293 Ga0105245_11210080
1294 Ga0105245_11425572
1295 Ga0105245_11659615
1296 Ga0105245_13042020
1297 Ga0105247_10471074
1298 Ga0105247_10607572
1299 Ga0114129_10037949
1300 Ga0114129_10147697
1301 Ga0114129_10183517
1302 Ga0114129_10333844
1303 Ga0114129_10360348
1304 Ga0114129_10711009
1305 Ga0105243_10033355
1306 Ga0105243_10042115
1307 Ga0105243_10050117
1308 Ga0105243_11224803
1309 Ga0105243_12697705
1310 Ga0105241_10071443
1311 Ga0105241_10163040
1312 Ga0105241_11231257
1313 Ga0105241_12647912
1314 Ga0105242_10019925
1315 Ga0105242_10253403
1316 Ga0105242_11374624
1317 Ga0105242_11475255
1318 Ga0105242_11635541
1319 Ga0105242_11679817
1320 Ga0105248_10040545
1321 Ga0105248_10070650
1322 Ga0105248_10082025
1323 Ga0105248_10148896
1324 Ga0105248_10210743
1325 Ga0105248_10320963
1326 Ga0105248_10549086
1327 Ga0105248_10792454
1328 Ga0105248_11123353
1329 Ga0105248_11167086
1330 Ga0105248_11998006
1331 Ga0105237_10149986
1332 Ga0105237_10162845
1333 Ga0105237_10931818
1334 Ga0105237_12035343
1335 Ga0105237_12044639
1336 Ga0105238_10317029
1337 Ga0105238_10602494
1338 Ga0105238_10977039
1339 Ga0105249_10248586
1340 Ga0105249_10344572
1341 Ga0105249_10712638
1342 Ga0105249_10763665
1343 Ga0105249_10776247
1344 Ga0105249_10833183
1345 Ga0105239_10299680
1346 Ga0105239_10310951
1347 Ga0105239_11072676
1348 Ga0105246_10002307
1349 Ga0105246_10251859
1350 Ga0157316_1018435
1351 Ga0157327_1038468
1352 Ga0157373_10017851
1353 Ga0157371_10022828
1354 Ga0157371_10555852
1355 Ga0157369_10371462
1356 Ga0157369_10552637
1357 Ga0157369_10869023
1358 Ga0157369_11018348
1359 Ga0157374_10182720
1360 Ga0157374_10465605
1361 Ga0157374_11230699
1362 Ga0157374_11527189
1363 Ga0157378_10245800
1364 Ga0163162_10015068
1365 Ga0163162_10018287
1366 Ga0163162_10183980
1367 Ga0163162_10207607
1368 Ga0157372_10027006
1369 Ga0157372_10075238
1370 Ga0157372_10195260
1371 Ga0157372_10459101
1372 Ga0157372_10583374
1373 Ga0157375_10212388
1374 Ga0157375_10298145
1375 Ga0157375_10479354
1376 Ga0157375_10614615
1377 Ga0157375_10654487
1378 Ga0157375_11156967
1379 Ga0157375_11310724
1380 Ga0163163_10002082
1381 Ga0163163_10057655
1382 Ga0163163_10123984
1383 Ga0163163_10246803
1384 Ga0163163_10334277
1385 Ga0163163_10409139
1386 Ga0163163_11887337
1387 Ga0157380_10128582
1388 Ga0157380_10236223
1389 Ga0157380_10364680
1390 Ga0157380_10507340
1391 Ga0157380_12064458
1392 Ga0157377_10110305
1393 Ga0157377_10545425
1394 Ga0157377_10595415
1395 Ga0157379_10065641
1396 Ga0157379_10224504
1397 Ga0157379_11371220
1398 Ga0157379_12302954
1399 Ga0157376_10026012
1400 Ga0157376_10549070
1401 Ga0157376_11134793
1402 Ga0157376_13064311
1403 Ga0182007_10144904
1404 Ga0182005_1134832
1405 Ga0163161_10023966
1406 Ga0163161_10186437
1407 Ga0163161_10317624
1408 Ga0163161_11323195
1409 Ga0207673_1031016
1410 Ga0207697_10021020
1411 Ga0207697_10094388
1412 Ga0207656_10031079
1413 Ga0207656_10069292
1414 Ga0207656_10647908
1415 Ga0207656_10683898
1416 Ga0207653_10123154
1417 Ga0207653_10206712
1418 Ga0207642_10296445
1419 Ga0207642_10585007
1420 Ga0207642_10770377
1421 Ga0207688_10024925
1422 Ga0207688_10047015
1423 Ga0207688_10341289
1424 Ga0207680_10049057
1425 Ga0207680_10234386
1426 Ga0207680_10477349
1427 Ga0207680_11174558
1428 Ga0207647_10167954
1429 Ga0207647_10252317
1430 Ga0207699_10022936
1431 Ga0207699_10063667
1432 Ga0207645_10001855
1433 Ga0207645_10003188
1434 Ga0207645_10025973
1435 Ga0207645_10108921
1436 Ga0207645_10111288
1437 Ga0207645_10817763
1438 Ga0207643_10009815
1439 Ga0207643_10231805
1440 Ga0207643_10256941
1441 Ga0207643_10561926
1442 Ga0207684_10582650
1443 Ga0207654_10138737
1444 Ga0207654_10933526
1445 Ga0207654_11208089
1446 Ga0207707_10029700
1447 Ga0207707_10032512
1448 Ga0207707_10120495
1449 Ga0207707_10162159
1450 Ga0207707_10934907
1451 Ga0207695_10879440
1452 Ga0207671_11071062
1453 Ga0207693_10424680
1454 Ga0207663_10153390
1455 Ga0207660_10104879
1456 Ga0207660_10298559
1457 Ga0207662_10009156
1458 Ga0207662_10029838
1459 Ga0207662_10030401
1460 Ga0207662_10279192
1461 Ga0207662_10435273
1462 Ga0207662_10537511
1463 Ga0207657_10205720
1464 Ga0207657_10283738
1465 Ga0207657_10469756
1466 Ga0207657_11375165
1467 Ga0207649_10016295
1468 Ga0207649_10158034
1469 Ga0207649_10363014
1470 Ga0207649_10417899
1471 Ga0207652_10026336
1472 Ga0207652_10148584
1473 Ga0207652_10174208
1474 Ga0207652_10337766
1475 Ga0207646_10434495
1476 Ga0207681_10102242
1477 Ga0207681_10113121
1478 Ga0207681_10215213
1479 Ga0207681_10282394
1480 Ga0207681_10516175
1481 Ga0207681_11479737
1482 Ga0207681_11752524
1483 Ga0207650_10056872
1484 Ga0207650_10077990
1485 Ga0207650_10141457
1486 Ga0207650_10421647
1487 Ga0207650_10626960
1488 Ga0207659_10011737
1489 Ga0207659_10013259
1490 Ga0207659_10094454
1491 Ga0207659_10379892
1492 Ga0207659_10561225
1493 Ga0207659_10637011
1494 Ga0207687_10076619
1495 Ga0207687_10218190
1496 Ga0207687_10580637
1497 Ga0207687_11150290
1498 Ga0207687_11766012
1499 Ga0207664_10063375
1500 Ga0207644_10390872
1501 Ga0207644_11277574
1502 Ga0207690_10198644
1503 Ga0207690_10816318
1504 Ga0207706_10003203
1505 Ga0207706_10007767
1506 Ga0207706_10179172
1507 Ga0207706_10488266
1508 Ga0207706_11515471
1509 Ga0207686_10065498
1510 Ga0207686_10181516
1511 Ga0207686_10409078
1512 Ga0207686_10532792
1513 Ga0207686_11211384
1514 Ga0207709_10026290
1515 Ga0207709_10207800
1516 Ga0207709_10213737
1517 Ga0207670_10034981
1518 Ga0207670_10098250
1519 Ga0207670_10277374
1520 Ga0207670_10387150
1521 Ga0207670_10406764
1522 Ga0207670_10509538
1523 Ga0207670_10536998
1524 Ga0207670_11033676
1525 Ga0207670_11137794
1526 Ga0207669_10158702
1527 Ga0207669_10196875
1528 Ga0207669_10303212
1529 Ga0207669_10416666
1530 Ga0207669_11419297
1531 Ga0207704_10042955
1532 Ga0207704_10254005
1533 Ga0207665_10101572
1534 Ga0207691_10003520
1535 Ga0207691_10005588
1536 Ga0207691_10015213
1537 Ga0207691_10059116
1538 Ga0207691_10166861
1539 Ga0207691_11252668
1540 Ga0207711_10002753
1541 Ga0207711_10005503
1542 Ga0207711_10187394
1543 Ga0207711_10269699
1544 Ga0207711_10279104
1545 Ga0207711_10288901
1546 Ga0207689_10010456
1547 Ga0207689_10014676
1548 Ga0207689_10037984
1549 Ga0207689_10139292
1550 Ga0207689_10787467
1551 Ga0207661_10001853
1552 Ga0207661_10634605
1553 Ga0207661_11229095
1554 Ga0207679_10001341
1555 Ga0207679_10027065
1556 Ga0207679_10035872
1557 Ga0207679_10983427
1558 Ga0207679_11074683
1559 Ga0207667_10023780
1560 Ga0207667_10398526
1561 Ga0207667_10504668
1562 Ga0207651_10053328
1563 Ga0207651_10055456
1564 Ga0207651_10546455
1565 Ga0207651_10597642
1566 Ga0207651_10948972
1567 Ga0207651_11266345
1568 Ga0207712_10030670
1569 Ga0207712_10035034
1570 Ga0207712_10157178
1571 Ga0207712_11476222
1572 Ga0207712_12006089
1573 Ga0207668_10089573
1574 Ga0207668_10331399
1575 Ga0207668_10896041
1576 Ga0207668_11035052
1577 Ga0207668_11460542
1578 Ga0207640_10011238
1579 Ga0207640_10160640
1580 Ga0207640_10977656
1581 Ga0207640_11198694
1582 Ga0207658_10059362
1583 Ga0207658_10256081
1584 Ga0207658_11109225
1585 Ga0207658_11732957
1586 Ga0207677_10165277
1587 Ga0207677_10170559
1588 Ga0207677_10225746
1589 Ga0207677_10232187
1590 Ga0207677_12283278
1591 Ga0207703_10031616
1592 Ga0207703_10081715
1593 Ga0207703_10315460
1594 Ga0207703_10810594
1595 Ga0207703_11041244
1596 Ga0207703_11259183
1597 Ga0207639_10038116
1598 Ga0207639_10088786
1599 Ga0207639_11642835
1600 Ga0207678_10146176
1601 Ga0207678_10212058
1602 Ga0207678_10246382
1603 Ga0207708_10014133
1604 Ga0207708_10034424
1605 Ga0207708_10041959
1606 Ga0207708_10085700
1607 Ga0207708_10526774
1608 Ga0207702_10033658
1609 Ga0207702_10202019
1610 Ga0207702_10208338
1611 Ga0207702_11199737
1612 Ga0207641_10002320
1613 Ga0207641_10261216
1614 Ga0207641_10466304
1615 Ga0207641_11749759
1616 Ga0207648_10062565
1617 Ga0207648_10073351
1618 Ga0207648_10869255
1619 Ga0207676_10109648
1620 Ga0207676_10252937
1621 Ga0207676_10265993
1622 Ga0207676_10414121
1623 Ga0207676_11089335
1624 Ga0207674_10002910
1625 Ga0207674_10012583
1626 Ga0207674_10018614
1627 Ga0207674_10701328
1628 Ga0207675_100034037
1629 Ga0207675_100057894
1630 Ga0207675_100094318
1631 Ga0207675_100302024
1632 Ga0207675_100313956
1633 Ga0207675_100328237
1634 Ga0207675_100496241
1635 Ga0207675_102020703
1636 Ga0207683_10502915
1637 Ga0207683_11804012
1638 Ga0207698_10477782
1639 Ga0207698_11191344
1640 Ga0207698_11954244
1641 Ga0209813_10345296
1642 Ga0207428_10013805
1643 Ga0207428_10049069
1644 Ga0207428_10121792
1645 Ga0207428_10190586
1646 Ga0207428_10217034
1647 Ga0268266_10010488
1648 Ga0268266_10353306
1649 Ga0268266_11223167
1650 Ga0268265_10026487
1651 Ga0268265_10073258
1652 Ga0268265_10286461
1653 Ga0268265_10341270
1654 Ga0268265_10371628
1655 Ga0268265_10752642
1656 Ga0268265_11013799
1657 Ga0268265_12215961
1658 Ga0268265_12694124
1659 Ga0268264_10027041
1660 Ga0268264_10246244
1661 Ga0268264_10250373
1662 Ga0268264_10306612
1663 Ga0268264_11057658
1664 Ga0268264_11318836
1665 Ga0268264_11563380
1666 Ga0307408_100032165
1667 Ga0307408_100037317
1668 Ga0307408_102057656
1669 Ga0316576_10153386
1670 Ga0307413_10140755
1671 Ga0307413_10419120
1672 Ga0307410_10627860
1673 Ga0307406_10835918
1674 Ga0307407_11045773
1675 Ga0307412_10942840
1676 Ga0307409_100411928
1677 Ga0307416_100141660
1678 Ga0307416_100259370
1679 Ga0307416_100498712
1680 Ga0307414_10853275
1681 Ga0307411_11795197
1682 Ga0307415_101676912
1683 Ga0316580_10036967
1684 Ga0373958_0150084
1685 Ga0373938_0152127
1686 Ga0373928_0134747
1687 Ga0373929_0127971
1688 Ga0373929_0199767
1689 Ga0373934_0019181
1690 Ga0373951_0058648
1691 Ga0373939_0074386
1692 Ga0373941_0362736
1693 Ga0373953_0193322
1694 Ga0373957_0012219
1695 Ga0373960_0027568
1696 Ga0373943_0037263
1697 Ga0373955_0132445
1698 Ga0373942_0139809
1699 Ga0373961_0088183
1700 Ga0373961_0317464
1701 Ga0373962_0117333
1702 Ga0373935_0239186
1703 Ga0373935_0374486
1704 Ga0373927_0446565
1705 Ga0373933_0034538
1706 Ga0373933_0053768
1707 Ga0373937_0005939
1708 Ga0373937_0008872
1709 Ga0373925_0011758
1710 Ga0373925_0379349
1711 Ga0436365_0306411
1712 Ga0436365_0600493
1713 Ga0439431_0013058
1714 Ga0439449_0362573
1715 Ga0439444_0179634
1716 Ga0451577_1730358
1717 Ga0451576_0018884
1718 Ga0451576_1037018
1719 Ga0466967_0333536
1720 Ga0466967_0574840
1721 Ga0495592_0458370
1722 Ga0495629_0236515
1723 Ga0495651_0024141
1724 Ga0495580_0142836
1725 Ga0495639_0025433
1726 Ga0495639_0495428
1727 Ga0495662_0152511
1728 Ga0495610_0379451
1729 Ga0495628_0360665
1730 Ga0495630_1276220
1731 Ga0495666_0253858
1732 Ga0495652_0056328
1733 Ga0495652_0868541
1734 Ga0495665_0045690
1735 Ga0495586_0003713
1736 Ga0495586_0029250
1737 Ga0495587_0003735
1738 Ga0495621_0167395
1739 Ga0495645_0005663
1740 Ga0495667_0019363
1741 Ga0495634_0657428
1742 Ga0495635_0184157
1743 Ga0495588_0301065
1744 Ga0495599_0025916
1745 Ga0495647_0468708
1746 Ga0495658_0775386
1747 Ga0495669_0083293
1748 Ga0495613_0091592
1749 Ga0495600_0041107
1750 Ga0495581_0126327
1751 Ga0495604_0589617
1752 Ga0495674_0118735
1753 Ga0495674_1156732
1754 Ga0495675_0004148
1755 Ga0495684_0197293
1756 Ga0495684_0603131
1757 Ga0495593_0072422
1758 Ga0495593_0685055
1759 Ga0496101_1063946
1760 Ga0496102_0385028
1761 Ga0496102_0393231
1762 Ga0496104_1625665
1763 Ga0496107_0409939
1764 Ga0496107_0743397
1765 Ga0496108_0189445
1766 Ga0496109_1569141
1767 Ga0496109_2053642
1768 Ga0496110_0290561
1769 Ga0496111_1343319
1770 Ga0496112_0067669
1771 Ga0496112_0135933
1772 Ga0496112_0255434
1773 Ga0496112_0811641
1774 Ga0496113_0311337
1775 Ga0496113_0440505
1776 Ga0496113_0474781
1777 Ga0501036_0237633
1778 Ga0501040_0720086
1779 Ga0501041_0663413
1780 Ga0501071_0579061
1781 Ga0501072_0150873
1782 Ga0501074_0231732
1783 Ga0501075_0053248
1784 Ga0501075_0089020
1785 Ga0501075_0890409
1786 Ga0501076_0006384
1787 Ga0501206_060626
1788 Ga0501079_0145036
1789 Ga0501081_0010573
1790 Ga0501045_1321501
1791 nmdc:mga03683_553044_c1
1792 nmdc:mga0k408_313800_c1
1793 nmdc:mga04h51_380561_c1
1794 nmdc:mga07m45_366919_c1
1795 nmdc:mga05p37_127627_c1
1796 nmdc:mga05p37_1853023_c1
1797 nmdc:mga05p37_18814_c1
1798 nmdc:mga05p37_2249_c1
1799 nmdc:mga05p37_56251_c1
1800 nmdc:mga05p37_830807_c1
1801 nmdc:mga05p37_8658_c1
1802 nmdc:mga09592_388904_c1
1803 nmdc:mga09592_408692_c1
1804 nmdc:mga09592_466034_c1
1805 nmdc:mga0qj67_497535_c1
1806 nmdc:mga06r32_104778_c1
1807 nmdc:mga08y16_121864_c1
1808 nmdc:mga08y16_2008187_c1
1809 nmdc:mga08y16_25031_c1
1810 nmdc:mga08y16_318515_c1
1811 nmdc:mga08y16_503701_c1
1812 nmdc:mga08y16_50802_c1
1813 nmdc:mga08y16_975976_c1
1814 nmdc:mga0n895_1363126_c1
1815 nmdc:mga0n895_14_c1
1816 nmdc:mga0n895_197928_c1
1817 nmdc:mga0n895_334327_c1
1818 nmdc:mga0n895_627886_c1
1819 nmdc:mga0n895_71966_c1
1820 nmdc:mga0rr50_108369_c1
1821 nmdc:mga0rr50_1556638_c1
1822 nmdc:mga0rr50_222104_c1
1823 nmdc:mga0rr50_54452_c1
1824 nmdc:mga0rr50_606673_c1
1825 nmdc:mga0rr50_617361_c1
1826 nmdc:mga0rr50_68_c1
1827 nmdc:mga0rr50_833460_c1
1828 nmdc:mga08x19_356216_c1
1829 nmdc:mga08x19_481967_c1
1830 nmdc:mga08x19_514980_c1
1831 nmdc:mga08x19_862_c1
1832 nmdc:mga08x19_897483_c1
1833 nmdc:mga08x19_91271_c1
1834 nmdc:mga0a205_100134_c2
1835 nmdc:mga0a205_199671_c1
1836 nmdc:mga0a205_287673_c1
1837 nmdc:mga0a205_482077_c1
1838 nmdc:mga0a205_54411_c1
1839 nmdc:mga0a205_556596_c1
1840 Ga0495601_0889292
1841 Ga0495612_0443302
1842 Ga0495595_0045661
1843 Ga0495619_0238228
1844 Ga0500592_035842
1845 Ga0501084_0058573
1846 Ga0501084_1574344
1847 Ga0501082_0366661
1848 Ga0501082_0535782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

36

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9208 8 108
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9114 11 110
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9081 5 107
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9069 5 107
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9043 15 110
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.937 10 109 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9208 8 108 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9005 5 112 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8988 14 95 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8946 8 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9977 11 108
AF-A0A1Q8A1R2-F1-model_v4 PadR family transcriptional regulator 0.9956 11 108
AF-A0A2E8E0J4-F1-model_v4 PadR family transcriptional regulator 0.9948 12 109
AF-A0A5B9EGF4-F1-model_v4 PadR family transcriptional regulator 0.9939 17 108
AF-A0A2V9ASX9-F1-model_v4 PadR family transcriptional regulator 0.9932 12 109

Map