F485790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 922 | 392 | 882 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10001132|Ga0075370_100011325 |
| Length | 232 |
| Sequence | MSEPTPTAVIVEDEPQIRRFVRGALEAQQWQVHEAGTVKDGLVEAGTRRPDLVILDLGLPDGDGVDFLRDLRAWSQVPVIVLSARSEEAHKIAALDAGADDYLTKPFGVGELMARVRVAMRRGQRVGAESASSVFTIGDVTVDLAARRVHRAGGVVHLTPIEYRLLGVLIANVGRVLTHRFLLREVWGPAHSERTHYLRIYMGHLRHKLEADAAQPRHIVTETGVGYRLVVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 5 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 6 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 7 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 8 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 9 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 10 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 11 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 12 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 13 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 14 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 15 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 16 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 17 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 18 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 19 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 20 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 21 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 22 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 23 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 24 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 25 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 26 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 27 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 28 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 29 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 30 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 31 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 32 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 33 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 34 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 35 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 36 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 37 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 38 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 39 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 42 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 43 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 50 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 51 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 52 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 54 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 77 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 249 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 252 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 367 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 376 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 381 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 385 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 389 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 392 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.23 |
| Metatranscriptomes | 0.33 |
| Isolates | 4.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.33 |
| Nodule | 0.43 |
| Rhizoplane | 3.9 |
| Rhizosphere | 66.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000751 | 3300001979 | Bacteria | 14171 |
| 2 | JGI25156J39149_1007376 | 3300002705 | Bacteria | 2897 |
| 3 | JGI25154J39366_1001351 | 3300002738 | Bacteria | 8979 |
| 4 | JGI25154J39366_1001772 | 3300002738 | Bacteria | 6885 |
| 5 | JGI25158J39367_1007351 | 3300002739 | Bacteria | 1557 |
| 6 | JGI25152J39213_1000097 | 3300002773 | Bacteria | 61941 |
| 7 | JGI25150J39212_1000896 | 3300002774 | Bacteria | 9772 |
| 8 | JGI25150J39212_1001900 | 3300002774 | Bacteria | 5487 |
| 9 | JGI25159J45721_1001812 | 3300002987 | Bacteria | 8567 |
| 10 | JGI25159J45721_1003419 | 3300002987 | Bacteria | 5617 |
| 11 | JGI25159J45721_1003520 | 3300002987 | Bacteria | 5518 |
| 12 | JGI25151J46595_10032397 | 3300003187 | Bacteria | 2026 |
| 13 | JGI25153J46596_10000998 | 3300003215 | Bacteria | 17178 |
| 14 | JGI25153J46596_10002956 | 3300003215 | Bacteria | 9623 |
| 15 | rootH2_10150607 | 3300003320 | Unclassified | 2752 |
| 16 | rootH2_10186710 | 3300003320 | Bacteria | 1083 |
| 17 | rootL2_10159772 | 3300003322 | Bacteria | 3182 |
| 18 | rootH1_10044440 | 3300003316 | Bacteria | 8548 |
| 19 | rootH1_10044440 | 3300003323 | Bacteria | 1318 |
| 20 | JGI25160J50197_1008378 | 3300003354 | Bacteria | 3945 |
| 21 | JGI25161J50226_1000939 | 3300003374 | Bacteria | 10419 |
| 22 | JGI25161J50226_1003119 | 3300003374 | Bacteria | 3944 |
| 23 | Ga0055539_1000194 | 3300003752 | Bacteria | 50008 |
| 24 | Ga0055533_1001762 | 3300003756 | Bacteria | 5492 |
| 25 | Ga0055533_1004958 | 3300003756 | Bacteria | 2260 |
| 26 | Ga0055532_1000139 | 3300003758 | Bacteria | 71879 |
| 27 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 28 | Ga0055535_1000161 | 3300003761 | Bacteria | 71879 |
| 29 | Ga0055542_1000456 | 3300003762 | Bacteria | 38610 |
| 30 | Ga0055529_1000292 | 3300003763 | Bacteria | 58403 |
| 31 | Ga0055529_1000327 | 3300003763 | Bacteria | 53426 |
| 32 | Ga0055526_1000033 | 3300003771 | Bacteria | 138249 |
| 33 | Ga0055526_1000059 | 3300003771 | Bacteria | 108161 |
| 34 | Ga0055526_1002157 | 3300003771 | Bacteria | 13486 |
| 35 | Ga0055526_1002208 | 3300003771 | Bacteria | 13340 |
| 36 | Ga0055526_1007908 | 3300003771 | Bacteria | 5416 |
| 37 | Ga0055526_1009674 | 3300003771 | Bacteria | 4598 |
| 38 | Ga0055526_1013407 | 3300003771 | Bacteria | 3471 |
| 39 | Ga0055537_1000269 | 3300003773 | Bacteria | 37710 |
| 40 | Ga0055537_1002292 | 3300003773 | Bacteria | 6551 |
| 41 | Ga0055524_1000027 | 3300003775 | Bacteria | 213655 |
| 42 | Ga0055524_1000436 | 3300003775 | Bacteria | 34952 |
| 43 | Ga0055524_1001269 | 3300003775 | Bacteria | 14790 |
| 44 | Ga0055524_1001897 | 3300003775 | Bacteria | 11345 |
| 45 | Ga0055524_1008891 | 3300003775 | Bacteria | 4135 |
| 46 | Ga0055524_1009206 | 3300003775 | Bacteria | 4038 |
| 47 | Ga0055524_1023459 | 3300003775 | Bacteria | 1985 |
| 48 | Ga0055536_1000102 | 3300003781 | Bacteria | 73767 |
| 49 | Ga0055534_1000130 | 3300003784 | Bacteria | 56637 |
| 50 | Ga0055534_1000295 | 3300003784 | Bacteria | 33396 |
| 51 | Ga0055534_1010144 | 3300003784 | Bacteria | 1995 |
| 52 | Ga0055534_1013802 | 3300003784 | Bacteria | 1537 |
| 53 | Ga0055528_1000043 | 3300003790 | Bacteria | 103664 |
| 54 | Ga0055528_1007637 | 3300003790 | Bacteria | 4750 |
| 55 | Ga0055530_10003718 | 3300003791 | Bacteria | 8478 |
| 56 | Ga0055531_10000931 | 3300003794 | Bacteria | 23665 |
| 57 | Ga0055541_1000494 | 3300003841 | Bacteria | 11105 |
| 58 | Ga0055541_1002864 | 3300003841 | Bacteria | 3338 |
| 59 | Ga0055543_1001257 | 3300004625 | Bacteria | 10457 |
| 60 | Ga0065165_1000187 | 3300005262 | Bacteria | 108694 |
| 61 | Ga0065165_1029482 | 3300005262 | Bacteria | 1757 |
| 62 | Ga0065165_1040669 | 3300005262 | Bacteria | 1384 |
| 63 | Ga0065715_10032259 | 3300005293 | Bacteria | 1657 |
| 64 | Ga0070658_10000986 | 3300005327 | Bacteria | 24454 |
| 65 | Ga0070658_10058384 | 3300005327 | Bacteria | 3140 |
| 66 | Ga0070683_100272987 | 3300005329 | Bacteria | 1608 |
| 67 | Ga0070670_100000714 | 3300005331 | Bacteria | 25798 |
| 68 | Ga0068869_100097122 | 3300005334 | Bacteria | 2224 |
| 69 | Ga0070666_10095115 | 3300005335 | Bacteria | 2050 |
| 70 | Ga0070682_100268943 | 3300005337 | Bacteria | 1237 |
| 71 | Ga0068868_100357659 | 3300005338 | Bacteria | 1252 |
| 72 | Ga0070660_100002378 | 3300005339 | Bacteria | 12923 |
| 73 | Ga0070660_100022884 | 3300005339 | Bacteria | 4627 |
| 74 | Ga0070660_100236137 | 3300005339 | Bacteria | 1488 |
| 75 | Ga0070661_100000302 | 3300005344 | Bacteria | 39886 |
| 76 | Ga0070661_100011637 | 3300005344 | Bacteria | 6134 |
| 77 | Ga0070661_100016547 | 3300005344 | Bacteria | 5216 |
| 78 | Ga0070661_100198603 | 3300005344 | Bacteria | 1532 |
| 79 | Ga0070675_100005300 | 3300005354 | Bacteria | 9848 |
| 80 | Ga0070673_100000557 | 3300005364 | Bacteria | 20099 |
| 81 | Ga0070659_100000200 | 3300005366 | Bacteria | 46333 |
| 82 | Ga0070659_100122185 | 3300005366 | Bacteria | 2110 |
| 83 | Ga0070659_100147883 | 3300005366 | Bacteria | 1915 |
| 84 | Ga0070659_100222196 | 3300005366 | Bacteria | 1559 |
| 85 | Ga0070667_100002040 | 3300005367 | Bacteria | 17907 |
| 86 | Ga0070667_100005411 | 3300005367 | Bacteria | 10665 |
| 87 | Ga0070667_100165375 | 3300005367 | Bacteria | 1951 |
| 88 | Ga0070711_100258523 | 3300005439 | Bacteria | 1369 |
| 89 | Ga0070663_100000026 | 3300005455 | Bacteria | 101463 |
| 90 | Ga0068867_100148691 | 3300005459 | Bacteria | 1838 |
| 91 | Ga0070684_100027798 | 3300005535 | Bacteria | 4778 |
| 92 | Ga0068853_100203935 | 3300005539 | Bacteria | 1800 |
| 93 | Ga0070672_100001308 | 3300005543 | Bacteria | 15362 |
| 94 | Ga0070693_100204218 | 3300005547 | Bacteria | 1285 |
| 95 | Ga0070665_100175145 | 3300005548 | Bacteria | 2146 |
| 96 | Ga0070665_100204690 | 3300005548 | Bacteria | 1974 |
| 97 | Ga0070665_100588938 | 3300005548 | Bacteria | 1125 |
| 98 | Ga0068855_100002749 | 3300005563 | Bacteria | 21659 |
| 99 | Ga0068855_100439695 | 3300005563 | Bacteria | 1425 |
| 100 | Ga0070664_100000014 | 3300005564 | Bacteria | 130113 |
| 101 | Ga0070664_100002979 | 3300005564 | Bacteria | 13704 |
| 102 | Ga0070664_100020752 | 3300005564 | Bacteria | 5411 |
| 103 | Ga0068857_100077900 | 3300005577 | Bacteria | 2958 |
| 104 | Ga0068857_100123803 | 3300005577 | Bacteria | 2329 |
| 105 | Ga0068857_100201451 | 3300005577 | Bacteria | 1814 |
| 106 | Ga0068854_100000029 | 3300005578 | Bacteria | 112855 |
| 107 | Ga0068856_100000457 | 3300005614 | Bacteria | 45000 |
| 108 | Ga0068856_100168159 | 3300005614 | Bacteria | 2204 |
| 109 | Ga0068852_100067996 | 3300005616 | Bacteria | 3116 |
| 110 | Ga0068852_100082273 | 3300005616 | Bacteria | 2861 |
| 111 | Ga0068864_100274391 | 3300005618 | Bacteria | 1572 |
| 112 | Ga0068861_100604300 | 3300005719 | Bacteria | 1007 |
| 113 | Ga0068851_10000887 | 3300005834 | Bacteria | 12923 |
| 114 | Ga0068870_10046662 | 3300005840 | Bacteria | 2273 |
| 115 | Ga0068863_100017665 | 3300005841 | Bacteria | 6831 |
| 116 | Ga0075364_10040905 | 3300006051 | Bacteria | 3007 |
| 117 | Ga0075432_10066154 | 3300006058 | Bacteria | 1293 |
| 118 | Ga0070712_100124882 | 3300006175 | Bacteria | 1942 |
| 119 | Ga0075362_10005052 | 3300006177 | Bacteria | 4792 |
| 120 | Ga0075362_10177505 | 3300006177 | Bacteria | 1031 |
| 121 | Ga0075367_10017487 | 3300006178 | Bacteria | 3936 |
| 122 | Ga0075369_10006743 | 3300006186 | Bacteria | 4354 |
| 123 | Ga0075369_10031725 | 3300006186 | Bacteria | 2232 |
| 124 | Ga0075366_10002145 | 3300006195 | Bacteria | 10046 |
| 125 | Ga0075366_10010210 | 3300006195 | Bacteria | 5268 |
| 126 | Ga0075366_10080806 | 3300006195 | Bacteria | 1941 |
| 127 | Ga0075366_10352122 | 3300006195 | Bacteria | 904 |
| 128 | Ga0097621_100918180 | 3300006237 | Bacteria | 816 |
| 129 | Ga0075370_10000508 | 3300006353 | Bacteria | 14806 |
| 130 | Ga0075370_10001132 | 3300006353 | Bacteria | 11187 |
| 131 | Ga0075370_10004227 | 3300006353 | Bacteria | 6939 |
| 132 | Ga0068871_100018962 | 3300006358 | Bacteria | 5243 |
| 133 | Ga0068871_100064780 | 3300006358 | Bacteria | 2992 |
| 134 | Ga0068871_100424211 | 3300006358 | Bacteria | 1188 |
| 135 | Ga0068865_100226170 | 3300006881 | Bacteria | 1465 |
| 136 | Ga0068865_100877767 | 3300006881 | Bacteria | 779 |
| 137 | Ga0105251_10009738 | 3300009011 | Bacteria | 5642 |
| 138 | Ga0105244_10009135 | 3300009036 | Bacteria | 6118 |
| 139 | Ga0105244_10041193 | 3300009036 | Bacteria | 2394 |
| 140 | Ga0105240_10047825 | 3300009093 | Bacteria | 5410 |
| 141 | Ga0105240_10112192 | 3300009093 | Bacteria | 3296 |
| 142 | Ga0105245_10099266 | 3300009098 | Bacteria | 2691 |
| 143 | Ga0105245_10164434 | 3300009098 | Bacteria | 2108 |
| 144 | Ga0105241_10049406 | 3300009174 | Bacteria | 3203 |
| 145 | Ga0105237_10007631 | 3300009545 | Bacteria | 11820 |
| 146 | Ga0105237_10228514 | 3300009545 | Bacteria | 1861 |
| 147 | Ga0105239_10019901 | 3300010375 | Bacteria | 7408 |
| 148 | Ga0105239_10754154 | 3300010375 | Bacteria | 1114 |
| 149 | Ga0157373_10005551 | 3300013100 | Bacteria | 9455 |
| 150 | Ga0157371_10000014 | 3300013102 | Bacteria | 347490 |
| 151 | Ga0157371_10000118 | 3300013102 | Bacteria | 120790 |
| 152 | Ga0157370_10000038 | 3300013104 | Bacteria | 135182 |
| 153 | Ga0157374_10003550 | 3300013296 | Bacteria | 13126 |
| 154 | Ga0157374_10639946 | 3300013296 | Bacteria | 1075 |
| 155 | Ga0157378_10107400 | 3300013297 | Bacteria | 2554 |
| 156 | Ga0163162_10126328 | 3300013306 | Bacteria | 2664 |
| 157 | Ga0157372_10476134 | 3300013307 | Bacteria | 1456 |
| 158 | Ga0157375_10000644 | 3300013308 | Bacteria | 30997 |
| 159 | Ga0157375_10012497 | 3300013308 | Bacteria | 7535 |
| 160 | Ga0182008_10000881 | 3300014497 | Bacteria | 20870 |
| 161 | Ga0157377_10106715 | 3300014745 | Bacteria | 1678 |
| 162 | Ga0157376_10002947 | 3300014969 | Bacteria | 11684 |
| 163 | Ga0157376_10371188 | 3300014969 | Bacteria | 1375 |
| 164 | Ga0182006_1000046 | 3300015261 | Bacteria | 189544 |
| 165 | Ga0182006_1000060 | 3300015261 | Bacteria | 161773 |
| 166 | Ga0182006_1002614 | 3300015261 | Bacteria | 9732 |
| 167 | Ga0182007_10000148 | 3300015262 | Bacteria | 47310 |
| 168 | Ga0182007_10008801 | 3300015262 | Bacteria | 4118 |
| 169 | Ga0182007_10020018 | 3300015262 | Bacteria | 2397 |
| 170 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 171 | Ga0182005_1000032 | 3300015265 | Bacteria | 188517 |
| 172 | Ga0206356_11913180 | 3300020070 | Bacteria | 1413 |
| 173 | Ga0206351_10147340 | 3300020077 | Bacteria | 8940 |
| 174 | Ga0213872_10000135 | 3300021361 | Bacteria | 67262 |
| 175 | Ga0213872_10000938 | 3300021361 | Bacteria | 20482 |
| 176 | Ga0213872_10002323 | 3300021361 | Bacteria | 11317 |
| 177 | Ga0209436_101072 | 3300025208 | Bacteria | 10292 |
| 178 | Ga0209436_105978 | 3300025208 | Bacteria | 2721 |
| 179 | Ga0209436_113673 | 3300025208 | Bacteria | 1317 |
| 180 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 181 | Ga0209784_100108 | 3300025224 | Bacteria | 94409 |
| 182 | Ga0209784_101294 | 3300025224 | Bacteria | 3602 |
| 183 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 184 | Ga0209566_100626 | 3300025225 | Bacteria | 21772 |
| 185 | Ga0209566_101652 | 3300025225 | Bacteria | 5713 |
| 186 | Ga0209674_100097 | 3300025226 | Bacteria | 167285 |
| 187 | Ga0209674_100168 | 3300025226 | Bacteria | 84107 |
| 188 | Ga0209672_100252 | 3300025228 | Bacteria | 39846 |
| 189 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 190 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 191 | Ga0209563_100136 | 3300025230 | Bacteria | 88047 |
| 192 | Ga0209563_102466 | 3300025230 | Bacteria | 4176 |
| 193 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 194 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 195 | Ga0207425_1000062 | 3300025245 | Bacteria | 136118 |
| 196 | Ga0207425_1002065 | 3300025245 | Bacteria | 7474 |
| 197 | Ga0207425_1007685 | 3300025245 | Bacteria | 2819 |
| 198 | Ga0209646_1000047 | 3300025246 | Bacteria | 323416 |
| 199 | Ga0209646_1000153 | 3300025246 | Bacteria | 96707 |
| 200 | Ga0209026_1001413 | 3300025250 | Bacteria | 10681 |
| 201 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 202 | Ga0209677_103251 | 3300025253 | Bacteria | 5410 |
| 203 | Ga0209677_107158 | 3300025253 | Bacteria | 2441 |
| 204 | Ga0209148_1000286 | 3300025254 | Bacteria | 75823 |
| 205 | Ga0209148_1000466 | 3300025254 | Bacteria | 43177 |
| 206 | Ga0209759_1001494 | 3300025256 | Bacteria | 12966 |
| 207 | Ga0209759_1010307 | 3300025256 | Bacteria | 2747 |
| 208 | Ga0209759_1020001 | 3300025256 | Bacteria | 1568 |
| 209 | Ga0209129_1000009 | 3300025258 | Bacteria | 633100 |
| 210 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 211 | Ga0209565_1000106 | 3300025263 | Bacteria | 122574 |
| 212 | Ga0209565_1000622 | 3300025263 | Bacteria | 23367 |
| 213 | Ga0209565_1000784 | 3300025263 | Bacteria | 18444 |
| 214 | Ga0209565_1001080 | 3300025263 | Bacteria | 13621 |
| 215 | Ga0209565_1003819 | 3300025263 | Bacteria | 4753 |
| 216 | Ga0209565_1007158 | 3300025263 | Bacteria | 3038 |
| 217 | Ga0209455_1000051 | 3300025272 | Bacteria | 369818 |
| 218 | Ga0209455_1000107 | 3300025272 | Bacteria | 195136 |
| 219 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 220 | Ga0209673_1004605 | 3300025273 | Bacteria | 7310 |
| 221 | Ga0209130_1000191 | 3300025284 | Bacteria | 85239 |
| 222 | Ga0209130_1002139 | 3300025284 | Bacteria | 10471 |
| 223 | Ga0209130_1007249 | 3300025284 | Bacteria | 3455 |
| 224 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 225 | Ga0209675_1000241 | 3300025291 | Bacteria | 54674 |
| 226 | Ga0209675_1000280 | 3300025291 | Bacteria | 48644 |
| 227 | Ga0209675_1000441 | 3300025291 | Bacteria | 32836 |
| 228 | Ga0209675_1002100 | 3300025291 | Bacteria | 10558 |
| 229 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 230 | Ga0209025_1000770 | 3300025294 | Bacteria | 53136 |
| 231 | Ga0209025_1001252 | 3300025294 | Bacteria | 35173 |
| 232 | Ga0209025_1001261 | 3300025294 | Bacteria | 35022 |
| 233 | Ga0209025_1001612 | 3300025294 | Bacteria | 28231 |
| 234 | Ga0209025_1007179 | 3300025294 | Bacteria | 8408 |
| 235 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 236 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 237 | Ga0209564_1000085 | 3300025295 | Bacteria | 251509 |
| 238 | Ga0209564_1000146 | 3300025295 | Bacteria | 174811 |
| 239 | Ga0209564_1000693 | 3300025295 | Bacteria | 49337 |
| 240 | Ga0209564_1000736 | 3300025295 | Bacteria | 46496 |
| 241 | Ga0209564_1001080 | 3300025295 | Bacteria | 32728 |
| 242 | Ga0209564_1001087 | 3300025295 | Bacteria | 32500 |
| 243 | Ga0209564_1022490 | 3300025295 | Bacteria | 2227 |
| 244 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 245 | Ga0209758_1000280 | 3300025297 | Bacteria | 101103 |
| 246 | Ga0209758_1000456 | 3300025297 | Bacteria | 68269 |
| 247 | Ga0209758_1005826 | 3300025297 | Bacteria | 9207 |
| 248 | Ga0209050_1000064 | 3300025298 | Bacteria | 314803 |
| 249 | Ga0209050_1000171 | 3300025298 | Bacteria | 150524 |
| 250 | Ga0209050_1001144 | 3300025298 | Bacteria | 31864 |
| 251 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 252 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 253 | Ga0209256_1000220 | 3300025299 | Bacteria | 106021 |
| 254 | Ga0209256_1000376 | 3300025299 | Bacteria | 71561 |
| 255 | Ga0209256_1000507 | 3300025299 | Bacteria | 57359 |
| 256 | Ga0209256_1000978 | 3300025299 | Bacteria | 34333 |
| 257 | Ga0209256_1001972 | 3300025299 | Bacteria | 18495 |
| 258 | Ga0209256_1002523 | 3300025299 | Bacteria | 14707 |
| 259 | Ga0207426_1001027 | 3300025302 | Bacteria | 26714 |
| 260 | Ga0209051_1011529 | 3300025303 | Bacteria | 4356 |
| 261 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 262 | Ga0209257_1003990 | 3300025304 | Bacteria | 11915 |
| 263 | Ga0207656_10013763 | 3300025321 | Bacteria | 3100 |
| 264 | Ga0207655_1009587 | 3300025728 | Bacteria | 5997 |
| 265 | Ga0207655_1026527 | 3300025728 | Bacteria | 2781 |
| 266 | Ga0207713_1052683 | 3300025735 | Bacteria | 1608 |
| 267 | Ga0207705_10001052 | 3300025909 | Bacteria | 22439 |
| 268 | Ga0207705_10063952 | 3300025909 | Bacteria | 2659 |
| 269 | Ga0207707_10650418 | 3300025912 | Bacteria | 888 |
| 270 | Ga0207695_10002200 | 3300025913 | Bacteria | 29366 |
| 271 | Ga0207663_10135396 | 3300025916 | Bacteria | 1709 |
| 272 | Ga0207657_10012835 | 3300025919 | Bacteria | 8243 |
| 273 | Ga0207657_10031906 | 3300025919 | Bacteria | 4765 |
| 274 | Ga0207657_10114786 | 3300025919 | Bacteria | 2220 |
| 275 | Ga0207657_10177904 | 3300025919 | Bacteria | 1721 |
| 276 | Ga0207649_10000357 | 3300025920 | Bacteria | 34223 |
| 277 | Ga0207652_10768192 | 3300025921 | Bacteria | 857 |
| 278 | Ga0207650_10012314 | 3300025925 | Bacteria | 5903 |
| 279 | Ga0207659_10003223 | 3300025926 | Bacteria | 9759 |
| 280 | Ga0207687_10053028 | 3300025927 | Bacteria | 2832 |
| 281 | Ga0207687_10063400 | 3300025927 | Bacteria | 2616 |
| 282 | Ga0207700_10370810 | 3300025928 | Bacteria | 1250 |
| 283 | Ga0207644_10013773 | 3300025931 | Bacteria | 5401 |
| 284 | Ga0207690_10000489 | 3300025932 | Bacteria | 25578 |
| 285 | Ga0207690_10140150 | 3300025932 | Bacteria | 1781 |
| 286 | Ga0207706_10017201 | 3300025933 | Bacteria | 6517 |
| 287 | Ga0207706_10188538 | 3300025933 | Bacteria | 1810 |
| 288 | Ga0207686_10015922 | 3300025934 | Bacteria | 4213 |
| 289 | Ga0207709_10170044 | 3300025935 | Bacteria | 1528 |
| 290 | Ga0207704_10303190 | 3300025938 | Bacteria | 1225 |
| 291 | Ga0207665_10453497 | 3300025939 | Bacteria | 984 |
| 292 | Ga0207691_10001019 | 3300025940 | Bacteria | 27733 |
| 293 | Ga0207711_10058137 | 3300025941 | Bacteria | 3326 |
| 294 | Ga0207689_10194051 | 3300025942 | Bacteria | 1676 |
| 295 | Ga0207661_10009771 | 3300025944 | Bacteria | 6891 |
| 296 | Ga0207679_10000173 | 3300025945 | Bacteria | 53176 |
| 297 | Ga0207679_10012374 | 3300025945 | Bacteria | 5563 |
| 298 | Ga0207679_10019132 | 3300025945 | Bacteria | 4596 |
| 299 | Ga0207667_10025116 | 3300025949 | Bacteria | 6529 |
| 300 | Ga0207651_10115534 | 3300025960 | Bacteria | 2024 |
| 301 | Ga0207640_10000029 | 3300025981 | Bacteria | 130583 |
| 302 | Ga0207640_10269515 | 3300025981 | Bacteria | 1331 |
| 303 | Ga0207658_10001969 | 3300025986 | Bacteria | 15316 |
| 304 | Ga0207658_10161281 | 3300025986 | Bacteria | 1838 |
| 305 | Ga0207677_10011464 | 3300026023 | Bacteria | 5059 |
| 306 | Ga0207677_10137376 | 3300026023 | Bacteria | 1866 |
| 307 | Ga0207678_10000031 | 3300026067 | Bacteria | 112136 |
| 308 | Ga0207678_10108738 | 3300026067 | Bacteria | 2365 |
| 309 | Ga0207678_10498059 | 3300026067 | Bacteria | 1062 |
| 310 | Ga0207702_10000083 | 3300026078 | Bacteria | 106990 |
| 311 | Ga0207702_10125190 | 3300026078 | Bacteria | 2306 |
| 312 | Ga0207641_10161872 | 3300026088 | Bacteria | 2035 |
| 313 | Ga0207648_10174204 | 3300026089 | Bacteria | 1902 |
| 314 | Ga0207676_10036277 | 3300026095 | Bacteria | 3749 |
| 315 | Ga0207674_10021101 | 3300026116 | Bacteria | 7023 |
| 316 | Ga0207674_10082533 | 3300026116 | Bacteria | 3215 |
| 317 | Ga0207674_10232563 | 3300026116 | Bacteria | 1791 |
| 318 | Ga0207683_10026471 | 3300026121 | Bacteria | 5005 |
| 319 | Ga0207698_10001056 | 3300026142 | Bacteria | 16016 |
| 320 | Ga0207698_10100587 | 3300026142 | Bacteria | 2395 |
| 321 | Ga0209282_1000059 | 3300027666 | Bacteria | 97821 |
| 322 | Ga0207428_10279179 | 3300027907 | Bacteria | 1240 |
| 323 | Ga0265356_1001667 | 3300028017 | Bacteria | 3186 |
| 324 | Ga0268266_10166382 | 3300028379 | Bacteria | 1998 |
| 325 | Ga0268266_10190363 | 3300028379 | Bacteria | 1873 |
| 326 | Ga0268266_10659661 | 3300028379 | Bacteria | 1007 |
| 327 | Ga0307517_10051238 | 3300028786 | Bacteria | 4172 |
| 328 | Ga0307517_10232579 | 3300028786 | Bacteria | 1104 |
| 329 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 330 | Ga0307515_10014672 | 3300028794 | Bacteria | 14505 |
| 331 | Ga0307515_10059177 | 3300028794 | Bacteria | 5497 |
| 332 | Ga0307512_10068471 | 3300030522 | Bacteria | 2663 |
| 333 | Ga0316181_1070490 | 3300030744 | Bacteria | 2104 |
| 334 | Ga0265330_10013712 | 3300031235 | Bacteria | 3771 |
| 335 | Ga0265332_10001968 | 3300031238 | Bacteria | 10818 |
| 336 | Ga0265328_10034896 | 3300031239 | Bacteria | 1861 |
| 337 | Ga0265325_10084942 | 3300031241 | Bacteria | 1568 |
| 338 | Ga0265329_10006342 | 3300031242 | Bacteria | 4698 |
| 339 | Ga0265339_10201510 | 3300031249 | Bacteria | 981 |
| 340 | Ga0265331_10002869 | 3300031250 | Bacteria | 11395 |
| 341 | Ga0265327_10010274 | 3300031251 | Bacteria | 6600 |
| 342 | Ga0265316_10112748 | 3300031344 | Bacteria | 2058 |
| 343 | Ga0307513_10252728 | 3300031456 | Bacteria | 1558 |
| 344 | Ga0307513_10300184 | 3300031456 | Bacteria | 1373 |
| 345 | Ga0307509_10001946 | 3300031507 | Bacteria | 34096 |
| 346 | Ga0307509_10008897 | 3300031507 | Bacteria | 12664 |
| 347 | Ga0307509_10380395 | 3300031507 | Bacteria | 1125 |
| 348 | Ga0307408_100000971 | 3300031548 | Bacteria | 22238 |
| 349 | Ga0307408_100001592 | 3300031548 | Bacteria | 16755 |
| 350 | Ga0307408_100002803 | 3300031548 | Bacteria | 12100 |
| 351 | Ga0307408_100015171 | 3300031548 | Bacteria | 5127 |
| 352 | Ga0307408_100018923 | 3300031548 | Bacteria | 4630 |
| 353 | Ga0307508_10000078 | 3300031616 | Bacteria | 113416 |
| 354 | Ga0307514_10047105 | 3300031649 | Bacteria | 3367 |
| 355 | Ga0307514_10060389 | 3300031649 | Bacteria | 2892 |
| 356 | Ga0265314_10009491 | 3300031711 | Bacteria | 8207 |
| 357 | Ga0265314_10042534 | 3300031711 | Bacteria | 3239 |
| 358 | Ga0307516_10002337 | 3300031730 | Bacteria | 25506 |
| 359 | Ga0307516_10097916 | 3300031730 | Bacteria | 2752 |
| 360 | Ga0307411_10399946 | 3300032005 | Bacteria | 1135 |
| 361 | Ga0307510_10045598 | 3300033180 | Bacteria | 4728 |
| 362 | Ga0307510_10045790 | 3300033180 | Bacteria | 4714 |
| 363 | Ga0307510_10062421 | 3300033180 | Bacteria | 3808 |
| 364 | Ga0316214_1025106 | 3300033545 | Bacteria | 839 |
| 365 | Ga0373932_0019508 | 3300035112 | Bacteria | 1768 |
| 366 | Ga0373939_0020997 | 3300035114 | Bacteria | 1782 |
| 367 | Ga0373931_0005484 | 3300035691 | Bacteria | 5872 |
| 368 | Ga0373947_0084799 | 3300035725 | Bacteria | 1967 |
| 369 | Ga0373925_0014858 | 3300037068 | Bacteria | 5628 |
| 370 | Ga0373925_0053989 | 3300037068 | Bacteria | 3005 |
| 371 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 372 | Ga0395899_0001637 | 3300037312 | Bacteria | 18687 |
| 373 | Ga0395899_0002583 | 3300037312 | Bacteria | 14605 |
| 374 | Ga0395899_0035864 | 3300037312 | Bacteria | 3721 |
| 375 | Ga0395899_0076822 | 3300037312 | Bacteria | 2437 |
| 376 | Ga0395899_0139160 | 3300037312 | Bacteria | 1728 |
| 377 | Ga0395899_0307763 | 3300037312 | Bacteria | 1070 |
| 378 | Ga0395899_0384818 | 3300037312 | Bacteria | 931 |
| 379 | Ga0395900_0000295 | 3300037418 | Bacteria | 75130 |
| 380 | Ga0395900_0000513 | 3300037418 | Bacteria | 54785 |
| 381 | Ga0395900_0010183 | 3300037418 | Bacteria | 9617 |
| 382 | Ga0395900_0015250 | 3300037418 | Bacteria | 7836 |
| 383 | Ga0395900_0045265 | 3300037418 | Bacteria | 4533 |
| 384 | Ga0395900_0113603 | 3300037418 | Bacteria | 2779 |
| 385 | Ga0395900_0194331 | 3300037418 | Bacteria | 2056 |
| 386 | Ga0395900_0208472 | 3300037418 | Bacteria | 1974 |
| 387 | Ga0395900_0684185 | 3300037418 | Bacteria | 960 |
| 388 | Ga0395900_0737208 | 3300037418 | Bacteria | 916 |
| 389 | Ga0395898_0038131 | 3300037466 | Bacteria | 4765 |
| 390 | Ga0395898_0049928 | 3300037466 | Bacteria | 4097 |
| 391 | Ga0395898_0372790 | 3300037466 | Bacteria | 1361 |
| 392 | Ga0395905_0000236 | 3300037471 | Bacteria | 83344 |
| 393 | Ga0395905_0002685 | 3300037471 | Bacteria | 19502 |
| 394 | Ga0395905_0073482 | 3300037471 | Bacteria | 3205 |
| 395 | Ga0395905_0384556 | 3300037471 | Bacteria | 1297 |
| 396 | Ga0395901_0000019 | 3300038443 | Bacteria | 317063 |
| 397 | Ga0395901_0074228 | 3300038443 | Bacteria | 3548 |
| 398 | Ga0395901_0085620 | 3300038443 | Bacteria | 3295 |
| 399 | Ga0395901_0262199 | 3300038443 | Bacteria | 1798 |
| 400 | Ga0395901_0418460 | 3300038443 | Bacteria | 1374 |
| 401 | Ga0395901_0530895 | 3300038443 | Bacteria | 1194 |
| 402 | Ga0395901_0533925 | 3300038443 | Bacteria | 1190 |
| 403 | Ga0436361_0106962 | 3300039447 | Bacteria | 4608 |
| 404 | Ga0436361_0285442 | 3300039447 | Bacteria | 14396 |
| 405 | Ga0436361_0285806 | 3300039447 | Bacteria | 16514 |
| 406 | Ga0436361_0985114 | 3300039447 | Bacteria | 16998 |
| 407 | Ga0451789_0499112 | 3300041443 | Bacteria | 1106 |
| 408 | Ga0451853_2925066 | 3300041512 | Bacteria | 1421 |
| 409 | Ga0450920_014501 | 3300042122 | Bacteria | 1492 |
| 410 | Ga0466986_0181258 | 3300044650 | Bacteria | 1398 |
| 411 | Ga0466972_0000037 | 3300044658 | Bacteria | 137184 |
| 412 | Ga0466972_0014046 | 3300044658 | Bacteria | 4014 |
| 413 | Ga0466972_0028431 | 3300044658 | Bacteria | 2758 |
| 414 | Ga0466972_0036303 | 3300044658 | Bacteria | 2412 |
| 415 | Ga0466972_0096830 | 3300044658 | Bacteria | 1398 |
| 416 | Ga0466972_0130264 | 3300044658 | Bacteria | 1185 |
| 417 | Ga0466981_0197292 | 3300044669 | Bacteria | 1344 |
| 418 | Ga0466982_0093989 | 3300044672 | Bacteria | 1858 |
| 419 | Ga0466965_0001361 | 3300044683 | Bacteria | 9809 |
| 420 | Ga0466965_0008881 | 3300044683 | Bacteria | 4658 |
| 421 | Ga0466965_0015945 | 3300044683 | Bacteria | 3570 |
| 422 | Ga0466965_0066438 | 3300044683 | Bacteria | 1808 |
| 423 | Ga0466965_0099439 | 3300044683 | Bacteria | 1486 |
| 424 | Ga0466965_0241738 | 3300044683 | Bacteria | 966 |
| 425 | Ga0466966_0008213 | 3300044684 | Bacteria | 6918 |
| 426 | Ga0466966_0025260 | 3300044684 | Bacteria | 3881 |
| 427 | Ga0466966_0078495 | 3300044684 | Bacteria | 2058 |
| 428 | Ga0466966_0137726 | 3300044684 | Bacteria | 1492 |
| 429 | Ga0466961_0107241 | 3300044693 | Bacteria | 1758 |
| 430 | Ga0466964_0004791 | 3300044706 | Bacteria | 5002 |
| 431 | Ga0466964_0046672 | 3300044706 | Bacteria | 1766 |
| 432 | Ga0466964_0067477 | 3300044706 | Bacteria | 1504 |
| 433 | Ga0466968_0062849 | 3300044735 | Bacteria | 1604 |
| 434 | Ga0466968_0065870 | 3300044735 | Bacteria | 1568 |
| 435 | Ga0466968_0084459 | 3300044735 | Bacteria | 1399 |
| 436 | Ga0466970_0063247 | 3300044765 | Bacteria | 1984 |
| 437 | Ga0466957_0199927 | 3300044842 | Bacteria | 1312 |
| 438 | Ga0466959_0007582 | 3300045049 | Bacteria | 7627 |
| 439 | Ga0466959_0022000 | 3300045049 | Bacteria | 4709 |
| 440 | Ga0466959_0087283 | 3300045049 | Bacteria | 2244 |
| 441 | Ga0466959_0134579 | 3300045049 | Bacteria | 1750 |
| 442 | Ga0466958_0281456 | 3300045836 | Bacteria | 1066 |
| 443 | Ga0466967_0023588 | 3300045976 | Bacteria | 5045 |
| 444 | Ga0495617_000056 | 3300046452 | Bacteria | 100802 |
| 445 | Ga0495617_000958 | 3300046452 | Bacteria | 13415 |
| 446 | Ga0495617_002021 | 3300046452 | Bacteria | 8449 |
| 447 | Ga0495617_009619 | 3300046452 | Bacteria | 3316 |
| 448 | Ga0495627_000066 | 3300046453 | Bacteria | 130363 |
| 449 | Ga0495627_003668 | 3300046453 | Bacteria | 6665 |
| 450 | Ga0495592_0006645 | 3300046454 | Bacteria | 8621 |
| 451 | Ga0495590_0000036 | 3300046457 | Bacteria | 129241 |
| 452 | Ga0495590_0001695 | 3300046457 | Bacteria | 9365 |
| 453 | Ga0495590_0003847 | 3300046457 | Bacteria | 6109 |
| 454 | Ga0495590_0016394 | 3300046457 | Bacteria | 2676 |
| 455 | Ga0495590_0036444 | 3300046457 | Bacteria | 1716 |
| 456 | Ga0495591_016106 | 3300046458 | Bacteria | 2617 |
| 457 | Ga0495629_0000138 | 3300046459 | Bacteria | 63867 |
| 458 | Ga0495638_0000114 | 3300046460 | Bacteria | 129141 |
| 459 | Ga0495638_0004088 | 3300046460 | Bacteria | 11175 |
| 460 | Ga0495638_0007780 | 3300046460 | Bacteria | 7652 |
| 461 | Ga0495638_0022649 | 3300046460 | Bacteria | 4122 |
| 462 | Ga0495638_0044277 | 3300046460 | Bacteria | 2804 |
| 463 | Ga0495638_0069591 | 3300046460 | Bacteria | 2156 |
| 464 | Ga0495638_0092638 | 3300046460 | Bacteria | 1819 |
| 465 | Ga0495653_0000007 | 3300046463 | Bacteria | 314281 |
| 466 | Ga0495653_0000446 | 3300046463 | Bacteria | 32368 |
| 467 | Ga0495650_0000105 | 3300046471 | Bacteria | 205855 |
| 468 | Ga0495650_0000200 | 3300046471 | Bacteria | 130223 |
| 469 | Ga0495650_0000232 | 3300046471 | Bacteria | 113636 |
| 470 | Ga0495650_0000798 | 3300046471 | Bacteria | 38487 |
| 471 | Ga0495650_0000884 | 3300046471 | Bacteria | 35361 |
| 472 | Ga0495650_0004754 | 3300046471 | Bacteria | 9130 |
| 473 | Ga0495650_0014209 | 3300046471 | Bacteria | 4158 |
| 474 | Ga0495650_0051735 | 3300046471 | Bacteria | 1690 |
| 475 | Ga0495580_0199173 | 3300046472 | Bacteria | 1380 |
| 476 | Ga0495605_0000015 | 3300046474 | Bacteria | 300227 |
| 477 | Ga0495605_0001878 | 3300046474 | Bacteria | 13431 |
| 478 | Ga0495605_0014320 | 3300046474 | Bacteria | 4346 |
| 479 | Ga0495605_0021135 | 3300046474 | Bacteria | 3451 |
| 480 | Ga0495605_0076232 | 3300046474 | Bacteria | 1575 |
| 481 | Ga0495639_0040181 | 3300046475 | Bacteria | 2104 |
| 482 | Ga0495584_0000091 | 3300046491 | Bacteria | 62543 |
| 483 | Ga0495584_0000096 | 3300046491 | Bacteria | 59703 |
| 484 | Ga0495584_0000671 | 3300046491 | Bacteria | 22725 |
| 485 | Ga0495584_0001943 | 3300046491 | Bacteria | 11890 |
| 486 | Ga0495584_0004221 | 3300046491 | Bacteria | 7749 |
| 487 | Ga0495584_0011694 | 3300046491 | Bacteria | 4489 |
| 488 | Ga0495584_0032085 | 3300046491 | Bacteria | 2659 |
| 489 | Ga0495585_0000013 | 3300046492 | Bacteria | 195993 |
| 490 | Ga0495585_0000020 | 3300046492 | Bacteria | 156639 |
| 491 | Ga0495585_0009049 | 3300046492 | Bacteria | 5998 |
| 492 | Ga0495585_0010267 | 3300046492 | Bacteria | 5583 |
| 493 | Ga0495585_0010579 | 3300046492 | Bacteria | 5486 |
| 494 | Ga0495585_0014219 | 3300046492 | Bacteria | 4642 |
| 495 | Ga0495585_0027868 | 3300046492 | Bacteria | 3223 |
| 496 | Ga0495585_0050992 | 3300046492 | Bacteria | 2294 |
| 497 | Ga0495594_0002295 | 3300046499 | Bacteria | 9957 |
| 498 | Ga0495596_0000057 | 3300046500 | Bacteria | 81281 |
| 499 | Ga0495596_0003852 | 3300046500 | Bacteria | 7454 |
| 500 | Ga0495596_0003958 | 3300046500 | Bacteria | 7323 |
| 501 | Ga0495596_0042333 | 3300046500 | Bacteria | 1794 |
| 502 | Ga0495607_0006744 | 3300046501 | Bacteria | 8028 |
| 503 | Ga0495607_0018435 | 3300046501 | Bacteria | 4450 |
| 504 | Ga0495607_0023429 | 3300046501 | Bacteria | 3865 |
| 505 | Ga0495607_0030736 | 3300046501 | Bacteria | 3294 |
| 506 | Ga0495607_0032154 | 3300046501 | Bacteria | 3205 |
| 507 | Ga0495607_0033517 | 3300046501 | Bacteria | 3124 |
| 508 | Ga0495607_0040386 | 3300046501 | Bacteria | 2778 |
| 509 | Ga0495607_0141054 | 3300046501 | Bacteria | 1243 |
| 510 | Ga0495607_0145278 | 3300046501 | Bacteria | 1219 |
| 511 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 512 | Ga0495583_0000259 | 3300046506 | Bacteria | 87422 |
| 513 | Ga0495583_0001378 | 3300046506 | Bacteria | 24908 |
| 514 | Ga0495583_0003588 | 3300046506 | Bacteria | 11655 |
| 515 | Ga0495583_0011994 | 3300046506 | Bacteria | 4937 |
| 516 | Ga0495583_0032703 | 3300046506 | Bacteria | 2508 |
| 517 | Ga0495583_0081953 | 3300046506 | Bacteria | 1401 |
| 518 | Ga0495606_0000007 | 3300046507 | Bacteria | 323713 |
| 519 | Ga0495606_0000744 | 3300046507 | Bacteria | 50355 |
| 520 | Ga0495606_0003167 | 3300046507 | Bacteria | 17804 |
| 521 | Ga0495606_0003736 | 3300046507 | Bacteria | 15860 |
| 522 | Ga0495606_0004504 | 3300046507 | Bacteria | 13881 |
| 523 | Ga0495606_0005781 | 3300046507 | Bacteria | 11693 |
| 524 | Ga0495606_0006801 | 3300046507 | Bacteria | 10442 |
| 525 | Ga0495606_0007748 | 3300046507 | Bacteria | 9508 |
| 526 | Ga0495606_0007764 | 3300046507 | Bacteria | 9493 |
| 527 | Ga0495606_0020403 | 3300046507 | Bacteria | 4886 |
| 528 | Ga0495606_0045426 | 3300046507 | Bacteria | 2911 |
| 529 | Ga0495606_0079658 | 3300046507 | Bacteria | 2040 |
| 530 | Ga0495606_0094656 | 3300046507 | Bacteria | 1830 |
| 531 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 532 | Ga0495610_0000543 | 3300046512 | Bacteria | 37709 |
| 533 | Ga0495610_0002192 | 3300046512 | Bacteria | 16557 |
| 534 | Ga0495610_0014075 | 3300046512 | Bacteria | 4720 |
| 535 | Ga0495610_0044397 | 3300046512 | Bacteria | 2206 |
| 536 | Ga0495610_0196324 | 3300046512 | Bacteria | 829 |
| 537 | Ga0495616_0000571 | 3300046513 | Bacteria | 27838 |
| 538 | Ga0495616_0000699 | 3300046513 | Bacteria | 24846 |
| 539 | Ga0495616_0001847 | 3300046513 | Bacteria | 14335 |
| 540 | Ga0495616_0008520 | 3300046513 | Bacteria | 6064 |
| 541 | Ga0495616_0011013 | 3300046513 | Bacteria | 5201 |
| 542 | Ga0495616_0023733 | 3300046513 | Bacteria | 3296 |
| 543 | Ga0495616_0025739 | 3300046513 | Bacteria | 3139 |
| 544 | Ga0495616_0047339 | 3300046513 | Bacteria | 2166 |
| 545 | Ga0495616_0062431 | 3300046513 | Bacteria | 1824 |
| 546 | Ga0495620_0004488 | 3300046515 | Bacteria | 7854 |
| 547 | Ga0495620_0009360 | 3300046515 | Bacteria | 5214 |
| 548 | Ga0495630_0606405 | 3300046517 | Bacteria | 839 |
| 549 | Ga0495631_0000238 | 3300046518 | Bacteria | 37846 |
| 550 | Ga0495631_0012808 | 3300046518 | Bacteria | 4085 |
| 551 | Ga0495632_0006221 | 3300046519 | Bacteria | 7723 |
| 552 | Ga0495632_0008284 | 3300046519 | Bacteria | 6402 |
| 553 | Ga0495632_0013807 | 3300046519 | Bacteria | 4593 |
| 554 | Ga0495632_0123356 | 3300046519 | Bacteria | 1209 |
| 555 | Ga0495637_0000477 | 3300046520 | Bacteria | 29259 |
| 556 | Ga0495637_0010316 | 3300046520 | Bacteria | 4525 |
| 557 | Ga0495637_0094218 | 3300046520 | Bacteria | 1177 |
| 558 | Ga0495643_0000646 | 3300046522 | Bacteria | 41289 |
| 559 | Ga0495643_0001182 | 3300046522 | Bacteria | 25428 |
| 560 | Ga0495643_0008789 | 3300046522 | Bacteria | 6363 |
| 561 | Ga0495643_0013735 | 3300046522 | Bacteria | 4836 |
| 562 | Ga0495643_0036323 | 3300046522 | Bacteria | 2708 |
| 563 | Ga0495643_0163721 | 3300046522 | Bacteria | 1093 |
| 564 | Ga0495644_0003059 | 3300046523 | Bacteria | 6614 |
| 565 | Ga0495644_0003196 | 3300046523 | Bacteria | 6472 |
| 566 | Ga0495644_0018051 | 3300046523 | Bacteria | 2693 |
| 567 | Ga0495644_0025504 | 3300046523 | Bacteria | 2243 |
| 568 | Ga0495644_0025956 | 3300046523 | Bacteria | 2223 |
| 569 | Ga0495644_0046666 | 3300046523 | Bacteria | 1628 |
| 570 | Ga0495648_0000031 | 3300046524 | Bacteria | 213136 |
| 571 | Ga0495648_0000035 | 3300046524 | Bacteria | 196251 |
| 572 | Ga0495648_0000434 | 3300046524 | Bacteria | 45425 |
| 573 | Ga0495648_0018580 | 3300046524 | Bacteria | 4916 |
| 574 | Ga0495648_0020845 | 3300046524 | Bacteria | 4558 |
| 575 | Ga0495648_0021533 | 3300046524 | Bacteria | 4461 |
| 576 | Ga0495648_0036963 | 3300046524 | Bacteria | 3143 |
| 577 | Ga0495648_0054963 | 3300046524 | Bacteria | 2402 |
| 578 | Ga0495648_0175286 | 3300046524 | Bacteria | 1095 |
| 579 | Ga0495663_0004448 | 3300046525 | Bacteria | 3941 |
| 580 | Ga0495642_0001544 | 3300046528 | Bacteria | 10193 |
| 581 | Ga0495642_0009514 | 3300046528 | Bacteria | 3719 |
| 582 | Ga0495642_0040458 | 3300046528 | Bacteria | 1893 |
| 583 | Ga0495642_0046606 | 3300046528 | Bacteria | 1773 |
| 584 | Ga0495642_0065205 | 3300046528 | Bacteria | 1516 |
| 585 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 586 | Ga0495654_0008398 | 3300046530 | Bacteria | 5708 |
| 587 | Ga0495654_0076798 | 3300046530 | Bacteria | 1573 |
| 588 | Ga0495609_0000236 | 3300046538 | Bacteria | 52539 |
| 589 | Ga0495609_0000299 | 3300046538 | Bacteria | 45808 |
| 590 | Ga0495609_0000998 | 3300046538 | Bacteria | 20132 |
| 591 | Ga0495609_0004322 | 3300046538 | Bacteria | 7808 |
| 592 | Ga0495609_0006936 | 3300046538 | Bacteria | 5719 |
| 593 | Ga0495609_0013126 | 3300046538 | Bacteria | 3917 |
| 594 | Ga0495609_0052451 | 3300046538 | Bacteria | 1815 |
| 595 | Ga0495597_0001219 | 3300046542 | Bacteria | 19132 |
| 596 | Ga0495597_0001367 | 3300046542 | Bacteria | 17636 |
| 597 | Ga0495597_0029769 | 3300046542 | Bacteria | 2491 |
| 598 | Ga0495597_0045879 | 3300046542 | Bacteria | 1937 |
| 599 | Ga0495597_0050712 | 3300046542 | Bacteria | 1831 |
| 600 | Ga0495622_0000032 | 3300046557 | Bacteria | 125538 |
| 601 | Ga0495622_0001975 | 3300046557 | Bacteria | 10052 |
| 602 | Ga0495622_0026110 | 3300046557 | Bacteria | 2728 |
| 603 | Ga0495622_0079648 | 3300046557 | Bacteria | 1507 |
| 604 | Ga0495633_0000318 | 3300046558 | Bacteria | 54641 |
| 605 | Ga0495633_0000452 | 3300046558 | Bacteria | 42120 |
| 606 | Ga0495633_0000601 | 3300046558 | Bacteria | 34582 |
| 607 | Ga0495633_0000768 | 3300046558 | Bacteria | 28783 |
| 608 | Ga0495633_0001211 | 3300046558 | Bacteria | 20771 |
| 609 | Ga0495633_0002021 | 3300046558 | Bacteria | 14655 |
| 610 | Ga0495633_0002132 | 3300046558 | Bacteria | 14171 |
| 611 | Ga0495633_0008930 | 3300046558 | Bacteria | 5585 |
| 612 | Ga0495633_0044765 | 3300046558 | Bacteria | 2097 |
| 613 | Ga0495633_0081811 | 3300046558 | Bacteria | 1503 |
| 614 | Ga0495633_0240725 | 3300046558 | Bacteria | 826 |
| 615 | Ga0495656_0004844 | 3300046615 | Bacteria | 4630 |
| 616 | Ga0495656_0008855 | 3300046615 | Bacteria | 3611 |
| 617 | Ga0495656_0036424 | 3300046615 | Bacteria | 2027 |
| 618 | Ga0495656_0172465 | 3300046615 | Bacteria | 1058 |
| 619 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 620 | Ga0495668_0001868 | 3300046616 | Bacteria | 18872 |
| 621 | Ga0495668_0002205 | 3300046616 | Bacteria | 16584 |
| 622 | Ga0495668_0002372 | 3300046616 | Bacteria | 15661 |
| 623 | Ga0495668_0002805 | 3300046616 | Bacteria | 13872 |
| 624 | Ga0495668_0006970 | 3300046616 | Bacteria | 7307 |
| 625 | Ga0495668_0013235 | 3300046616 | Bacteria | 4875 |
| 626 | Ga0495668_0060311 | 3300046616 | Bacteria | 2093 |
| 627 | Ga0495611_0000062 | 3300046648 | Bacteria | 75510 |
| 628 | Ga0495611_0000788 | 3300046648 | Bacteria | 17620 |
| 629 | Ga0495611_0002071 | 3300046648 | Bacteria | 9437 |
| 630 | Ga0495611_0002306 | 3300046648 | Bacteria | 8825 |
| 631 | Ga0495611_0011202 | 3300046648 | Bacteria | 3801 |
| 632 | Ga0495611_0020241 | 3300046648 | Bacteria | 2863 |
| 633 | Ga0495611_0021111 | 3300046648 | Bacteria | 2810 |
| 634 | Ga0495611_0084138 | 3300046648 | Bacteria | 1466 |
| 635 | Ga0495611_0144756 | 3300046648 | Bacteria | 1109 |
| 636 | Ga0495625_0000273 | 3300046660 | Bacteria | 80579 |
| 637 | Ga0495625_0002365 | 3300046660 | Bacteria | 20532 |
| 638 | Ga0495625_0003587 | 3300046660 | Bacteria | 15281 |
| 639 | Ga0495625_0005618 | 3300046660 | Bacteria | 11370 |
| 640 | Ga0495625_0009465 | 3300046660 | Bacteria | 8151 |
| 641 | Ga0495625_0010111 | 3300046660 | Bacteria | 7838 |
| 642 | Ga0495625_0016045 | 3300046660 | Bacteria | 5905 |
| 643 | Ga0495625_0019878 | 3300046660 | Bacteria | 5197 |
| 644 | Ga0495625_0048917 | 3300046660 | Bacteria | 3041 |
| 645 | Ga0495625_0123795 | 3300046660 | Bacteria | 1757 |
| 646 | Ga0495625_0203490 | 3300046660 | Bacteria | 1305 |
| 647 | Ga0495659_0000443 | 3300046664 | Bacteria | 15555 |
| 648 | Ga0495659_0002617 | 3300046664 | Bacteria | 5805 |
| 649 | Ga0495659_0002930 | 3300046664 | Bacteria | 5477 |
| 650 | Ga0495659_0060676 | 3300046664 | Bacteria | 1396 |
| 651 | Ga0495659_0159404 | 3300046664 | Bacteria | 910 |
| 652 | Ga0495661_0008592 | 3300046665 | Bacteria | 7058 |
| 653 | Ga0495661_0013327 | 3300046665 | Bacteria | 5527 |
| 654 | Ga0495661_0016689 | 3300046665 | Bacteria | 4860 |
| 655 | Ga0495661_0018871 | 3300046665 | Bacteria | 4527 |
| 656 | Ga0495661_0032406 | 3300046665 | Bacteria | 3303 |
| 657 | Ga0495661_0033199 | 3300046665 | Bacteria | 3256 |
| 658 | Ga0495661_0043179 | 3300046665 | Bacteria | 2773 |
| 659 | Ga0495661_0043573 | 3300046665 | Bacteria | 2757 |
| 660 | Ga0495661_0084498 | 3300046665 | Bacteria | 1821 |
| 661 | Ga0495588_0000139 | 3300046674 | Bacteria | 109955 |
| 662 | Ga0495588_0002696 | 3300046674 | Bacteria | 7607 |
| 663 | Ga0495588_0073564 | 3300046674 | Bacteria | 1779 |
| 664 | Ga0495588_0109061 | 3300046674 | Bacteria | 1457 |
| 665 | Ga0495658_0217309 | 3300046683 | Bacteria | 1196 |
| 666 | Ga0495669_0001777 | 3300046684 | Bacteria | 8807 |
| 667 | Ga0495669_0125437 | 3300046684 | Bacteria | 1206 |
| 668 | Ga0495613_0059416 | 3300046689 | Bacteria | 2803 |
| 669 | Ga0495613_0060045 | 3300046689 | Bacteria | 2786 |
| 670 | Ga0495624_0109666 | 3300046690 | Bacteria | 1697 |
| 671 | Ga0495670_0003710 | 3300046691 | Bacteria | 7507 |
| 672 | Ga0495670_0004214 | 3300046691 | Bacteria | 7048 |
| 673 | Ga0495670_0045816 | 3300046691 | Bacteria | 2183 |
| 674 | Ga0495670_0052415 | 3300046691 | Bacteria | 2042 |
| 675 | Ga0495670_0053230 | 3300046691 | Bacteria | 2027 |
| 676 | Ga0495670_0092118 | 3300046691 | Bacteria | 1552 |
| 677 | Ga0495670_0114772 | 3300046691 | Bacteria | 1396 |
| 678 | Ga0495671_0000381 | 3300046692 | Bacteria | 36504 |
| 679 | Ga0495671_0000656 | 3300046692 | Bacteria | 25066 |
| 680 | Ga0495671_0007174 | 3300046692 | Bacteria | 6377 |
| 681 | Ga0495671_0010964 | 3300046692 | Bacteria | 5004 |
| 682 | Ga0495671_0033300 | 3300046692 | Bacteria | 2626 |
| 683 | Ga0495671_0159712 | 3300046692 | Bacteria | 1096 |
| 684 | Ga0495649_0000114 | 3300046694 | Bacteria | 71293 |
| 685 | Ga0495649_0000916 | 3300046694 | Bacteria | 23326 |
| 686 | Ga0495649_0001774 | 3300046694 | Bacteria | 15908 |
| 687 | Ga0495649_0053259 | 3300046694 | Bacteria | 2190 |
| 688 | Ga0495649_0095262 | 3300046694 | Bacteria | 1584 |
| 689 | Ga0495589_0049438 | 3300046794 | Bacteria | 2081 |
| 690 | Ga0495589_0059654 | 3300046794 | Bacteria | 1874 |
| 691 | Ga0495589_0065397 | 3300046794 | Bacteria | 1782 |
| 692 | Ga0495660_0002148 | 3300046810 | Bacteria | 12712 |
| 693 | Ga0495660_0003341 | 3300046810 | Bacteria | 9950 |
| 694 | Ga0495660_0009799 | 3300046810 | Bacteria | 5580 |
| 695 | Ga0495660_0014670 | 3300046810 | Bacteria | 4532 |
| 696 | Ga0495660_0014725 | 3300046810 | Bacteria | 4524 |
| 697 | Ga0495660_0014754 | 3300046810 | Bacteria | 4519 |
| 698 | Ga0495660_0021105 | 3300046810 | Bacteria | 3732 |
| 699 | Ga0495660_0034140 | 3300046810 | Bacteria | 2848 |
| 700 | Ga0495660_0037790 | 3300046810 | Bacteria | 2688 |
| 701 | Ga0495660_0087656 | 3300046810 | Bacteria | 1623 |
| 702 | Ga0495660_0112115 | 3300046810 | Bacteria | 1390 |
| 703 | Ga0495660_0134290 | 3300046810 | Bacteria | 1238 |
| 704 | Ga0495581_0481980 | 3300047315 | Bacteria | 721 |
| 705 | Ga0495604_0069571 | 3300047317 | Bacteria | 2667 |
| 706 | Ga0495636_0001586 | 3300047318 | Bacteria | 8650 |
| 707 | Ga0495636_0002072 | 3300047318 | Bacteria | 7698 |
| 708 | Ga0495636_0002753 | 3300047318 | Bacteria | 6780 |
| 709 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 710 | Ga0495672_0000427 | 3300047320 | Bacteria | 50460 |
| 711 | Ga0495672_0000447 | 3300047320 | Bacteria | 49038 |
| 712 | Ga0495672_0013232 | 3300047320 | Bacteria | 5700 |
| 713 | Ga0495672_0021836 | 3300047320 | Bacteria | 4169 |
| 714 | Ga0495672_0108165 | 3300047320 | Bacteria | 1496 |
| 715 | Ga0495676_0070130 | 3300047321 | Bacteria | 2701 |
| 716 | Ga0495676_0123768 | 3300047321 | Bacteria | 1877 |
| 717 | Ga0495680_0084055 | 3300047322 | Bacteria | 2399 |
| 718 | Ga0495683_0000005 | 3300047323 | Bacteria | 287871 |
| 719 | Ga0495683_0007123 | 3300047323 | Bacteria | 6068 |
| 720 | Ga0495683_0037245 | 3300047323 | Bacteria | 2466 |
| 721 | Ga0495687_000311 | 3300047443 | Bacteria | 63605 |
| 722 | Ga0495687_000685 | 3300047443 | Bacteria | 38430 |
| 723 | Ga0495687_000979 | 3300047443 | Bacteria | 28873 |
| 724 | Ga0495687_001575 | 3300047443 | Bacteria | 20711 |
| 725 | Ga0495687_007257 | 3300047443 | Bacteria | 6576 |
| 726 | Ga0495687_010128 | 3300047443 | Bacteria | 5193 |
| 727 | Ga0495687_017162 | 3300047443 | Bacteria | 3620 |
| 728 | Ga0495687_076515 | 3300047443 | Bacteria | 1324 |
| 729 | Ga0495675_0056493 | 3300047444 | Bacteria | 2488 |
| 730 | Ga0495677_0000360 | 3300047445 | Bacteria | 19708 |
| 731 | Ga0495677_0004571 | 3300047445 | Bacteria | 5293 |
| 732 | Ga0495677_0005565 | 3300047445 | Bacteria | 4773 |
| 733 | Ga0495677_0010118 | 3300047445 | Bacteria | 3469 |
| 734 | Ga0495677_0025204 | 3300047445 | Bacteria | 2157 |
| 735 | Ga0495677_0097059 | 3300047445 | Bacteria | 1113 |
| 736 | Ga0495679_092076 | 3300047446 | Bacteria | 849 |
| 737 | Ga0495685_000005 | 3300047447 | Bacteria | 112142 |
| 738 | Ga0495685_005353 | 3300047447 | Bacteria | 4187 |
| 739 | Ga0495685_014313 | 3300047447 | Bacteria | 2695 |
| 740 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 741 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 742 | Ga0495673_0000135 | 3300047469 | Bacteria | 135338 |
| 743 | Ga0495673_0002581 | 3300047469 | Bacteria | 12605 |
| 744 | Ga0495681_0003162 | 3300047470 | Bacteria | 11527 |
| 745 | Ga0495681_0004920 | 3300047470 | Bacteria | 9022 |
| 746 | Ga0495681_0022896 | 3300047470 | Bacteria | 3332 |
| 747 | Ga0495686_0001265 | 3300047472 | Bacteria | 28641 |
| 748 | Ga0495686_0005469 | 3300047472 | Bacteria | 10011 |
| 749 | Ga0495686_0009037 | 3300047472 | Bacteria | 7231 |
| 750 | Ga0495686_0015955 | 3300047472 | Bacteria | 5106 |
| 751 | Ga0495686_0018738 | 3300047472 | Bacteria | 4637 |
| 752 | Ga0495686_0046935 | 3300047472 | Bacteria | 2728 |
| 753 | Ga0495686_0157438 | 3300047472 | Bacteria | 1329 |
| 754 | Ga0495593_0060022 | 3300047673 | Bacteria | 1991 |
| 755 | Ga0495626_0002853 | 3300048091 | Bacteria | 11536 |
| 756 | Ga0495626_0012014 | 3300048091 | Bacteria | 4557 |
| 757 | Ga0495626_0017784 | 3300048091 | Bacteria | 3584 |
| 758 | Ga0495626_0103878 | 3300048091 | Bacteria | 1236 |
| 759 | Ga0496100_0007012 | 3300048903 | Bacteria | 6182 |
| 760 | Ga0496100_0083306 | 3300048903 | Bacteria | 2165 |
| 761 | Ga0496100_0254618 | 3300048903 | Bacteria | 1300 |
| 762 | Ga0496100_0290121 | 3300048903 | Bacteria | 1222 |
| 763 | Ga0496101_0014890 | 3300048904 | Bacteria | 5234 |
| 764 | Ga0496101_0089407 | 3300048904 | Bacteria | 2289 |
| 765 | Ga0496101_0091887 | 3300048904 | Bacteria | 2259 |
| 766 | Ga0496101_0171124 | 3300048904 | Bacteria | 1670 |
| 767 | Ga0496101_0183747 | 3300048904 | Bacteria | 1611 |
| 768 | Ga0496102_0000123 | 3300048905 | Bacteria | 110781 |
| 769 | Ga0496102_0300258 | 3300048905 | Bacteria | 1513 |
| 770 | Ga0496102_0376617 | 3300048905 | Bacteria | 1336 |
| 771 | Ga0496103_0007445 | 3300048906 | Bacteria | 6526 |
| 772 | Ga0496103_0090824 | 3300048906 | Bacteria | 1927 |
| 773 | Ga0496103_0208336 | 3300048906 | Bacteria | 1257 |
| 774 | Ga0496104_0078788 | 3300048907 | Bacteria | 3140 |
| 775 | Ga0496104_0130682 | 3300048907 | Bacteria | 2412 |
| 776 | Ga0496105_0254030 | 3300048908 | Bacteria | 1423 |
| 777 | Ga0496105_0428938 | 3300048908 | Bacteria | 1046 |
| 778 | Ga0496106_0001261 | 3300048909 | Bacteria | 18959 |
| 779 | Ga0496106_0180973 | 3300048909 | Bacteria | 1673 |
| 780 | Ga0496107_0041752 | 3300048910 | Bacteria | 3294 |
| 781 | Ga0496107_0155078 | 3300048910 | Bacteria | 1695 |
| 782 | Ga0496108_0001563 | 3300048911 | Bacteria | 18128 |
| 783 | Ga0496109_0005834 | 3300048912 | Bacteria | 10324 |
| 784 | Ga0496110_0005574 | 3300048913 | Bacteria | 9884 |
| 785 | Ga0496111_0027956 | 3300048914 | Bacteria | 3995 |
| 786 | Ga0496113_0000521 | 3300048916 | Bacteria | 18985 |
| 787 | Ga0496113_0041713 | 3300048916 | Bacteria | 3388 |
| 788 | Ga0496114_0053290 | 3300048917 | Bacteria | 3372 |
| 789 | Ga0496115_0007372 | 3300048918 | Bacteria | 8094 |
| 790 | Ga0496115_0032597 | 3300048918 | Bacteria | 4110 |
| 791 | Ga0496115_0546029 | 3300048918 | Bacteria | 927 |
| 792 | Ga0496116_0017091 | 3300048919 | Bacteria | 5649 |
| 793 | Ga0496116_0025790 | 3300048919 | Bacteria | 4313 |
| 794 | Ga0496116_0026002 | 3300048919 | Bacteria | 4290 |
| 795 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 796 | Ga0496117_0031375 | 3300048920 | Bacteria | 4058 |
| 797 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 798 | Ga0496118_0062519 | 3300048921 | Bacteria | 2747 |
| 799 | Ga0496121_0007116 | 3300048924 | Bacteria | 13578 |
| 800 | Ga0496121_0018751 | 3300048924 | Bacteria | 6955 |
| 801 | Ga0496121_0055083 | 3300048924 | Bacteria | 3316 |
| 802 | Ga0496121_0067541 | 3300048924 | Bacteria | 2897 |
| 803 | Ga0496121_0247420 | 3300048924 | Bacteria | 1238 |
| 804 | Ga0496122_0000823 | 3300048925 | Bacteria | 59308 |
| 805 | Ga0496122_0002002 | 3300048925 | Bacteria | 30328 |
| 806 | Ga0496122_0005039 | 3300048925 | Bacteria | 15971 |
| 807 | Ga0496122_0074559 | 3300048925 | Bacteria | 2400 |
| 808 | Ga0496122_0087568 | 3300048925 | Bacteria | 2139 |
| 809 | Ga0496122_0115020 | 3300048925 | Bacteria | 1754 |
| 810 | Ga0496123_0004103 | 3300048926 | Bacteria | 15624 |
| 811 | Ga0496123_0008198 | 3300048926 | Bacteria | 9635 |
| 812 | Ga0496123_0016418 | 3300048926 | Bacteria | 6015 |
| 813 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 814 | Ga0496124_0017030 | 3300048927 | Bacteria | 6875 |
| 815 | Ga0496124_0018696 | 3300048927 | Bacteria | 6482 |
| 816 | Ga0496124_0067639 | 3300048927 | Bacteria | 2972 |
| 817 | Ga0496124_0068134 | 3300048927 | Bacteria | 2959 |
| 818 | Ga0496124_0158209 | 3300048927 | Bacteria | 1769 |
| 819 | Ga0496124_0361666 | 3300048927 | Bacteria | 1022 |
| 820 | Ga0496125_0005107 | 3300048928 | Bacteria | 14774 |
| 821 | Ga0496125_0031820 | 3300048928 | Bacteria | 4694 |
| 822 | Ga0496125_0116450 | 3300048928 | Bacteria | 1919 |
| 823 | Ga0496126_0248364 | 3300048929 | Bacteria | 1483 |
| 824 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 825 | Ga0495678_000085 | 3300049459 | Bacteria | 117187 |
| 826 | Ga0495678_000803 | 3300049459 | Bacteria | 28133 |
| 827 | Ga0495678_002759 | 3300049459 | Bacteria | 11497 |
| 828 | Ga0495678_004468 | 3300049459 | Bacteria | 8077 |
| 829 | Ga0495678_004605 | 3300049459 | Bacteria | 7922 |
| 830 | Ga0495678_004946 | 3300049459 | Bacteria | 7515 |
| 831 | Ga0495678_005506 | 3300049459 | Bacteria | 6975 |
| 832 | Ga0495678_044473 | 3300049459 | Bacteria | 1756 |
| 833 | Ga0495678_048515 | 3300049459 | Bacteria | 1655 |
| 834 | Ga0495682_0000543 | 3300049460 | Bacteria | 26102 |
| 835 | Ga0495682_0000830 | 3300049460 | Bacteria | 19361 |
| 836 | Ga0495682_0002760 | 3300049460 | Bacteria | 8135 |
| 837 | Ga0495682_0025835 | 3300049460 | Bacteria | 2184 |
| 838 | Ga0495682_0039303 | 3300049460 | Bacteria | 1737 |
| 839 | Ga0501034_0000056 | 3300049571 | Bacteria | 202540 |
| 840 | Ga0501034_0055622 | 3300049571 | Bacteria | 3982 |
| 841 | Ga0501034_0135959 | 3300049571 | Bacteria | 2439 |
| 842 | Ga0501034_0408966 | 3300049571 | Bacteria | 1279 |
| 843 | Ga0501036_0008220 | 3300049572 | Bacteria | 8555 |
| 844 | Ga0501036_0093824 | 3300049572 | Bacteria | 2536 |
| 845 | Ga0501037_0184145 | 3300049573 | Bacteria | 1481 |
| 846 | Ga0501038_0006548 | 3300049574 | Bacteria | 10773 |
| 847 | Ga0501039_0236393 | 3300049575 | Bacteria | 1437 |
| 848 | Ga0501043_0010564 | 3300049579 | Bacteria | 7227 |
| 849 | Ga0501046_0123782 | 3300049580 | Bacteria | 1966 |
| 850 | Ga0501076_0116964 | 3300049592 | Bacteria | 2158 |
| 851 | Ga0501249_005608 | 3300049679 | Bacteria | 2565 |
| 852 | Ga0501269_000068 | 3300049766 | Bacteria | 32230 |
| 853 | Ga0501035_0033249 | 3300049822 | Bacteria | 4690 |
| 854 | Ga0501035_0204822 | 3300049822 | Bacteria | 1690 |
| 855 | Ga0501044_0000248 | 3300049823 | Bacteria | 68598 |
| 856 | Ga0501044_0011860 | 3300049823 | Bacteria | 9442 |
| 857 | nmdc:mga03683_5005_c1 | 3300050489 | Bacteria | 4437 |
| 858 | nmdc:mga00v17_204328_c1 | 3300050491 | Bacteria | 1277 |
| 859 | nmdc:mga0k408_418881_c1 | 3300050493 | Bacteria | 796 |
| 860 | nmdc:mga0k408_66736_c1 | 3300050493 | Bacteria | 2096 |
| 861 | nmdc:mga0k408_83373_c1 | 3300050493 | Bacteria | 1874 |
| 862 | nmdc:mga07m45_15009_c1 | 3300050496 | Bacteria | 4136 |
| 863 | nmdc:mga07m45_5671_c1 | 3300050496 | Bacteria | 6241 |
| 864 | nmdc:mga07m45_9499_c1 | 3300050496 | Bacteria | 5048 |
| 865 | nmdc:mga0n895_581848_c1 | 3300050512 | Bacteria | 1123 |
| 866 | Ga0500578_0011969 | 3300053086 | Bacteria | 5603 |
| 867 | Ga0500644_0019026 | 3300053088 | Bacteria | 2021 |
| 868 | Ga0500651_0160576 | 3300053093 | Bacteria | 1344 |
| 869 | Ga0500594_0029915 | 3300053118 | Bacteria | 1427 |
| 870 | Ga0500594_0053295 | 3300053118 | Bacteria | 1145 |
| 871 | Ga0500618_000831 | 3300053125 | Bacteria | 16848 |
| 872 | Ga0500628_009031 | 3300053129 | Bacteria | 1747 |
| 873 | Ga0500652_095776 | 3300053131 | Bacteria | 1239 |
| 874 | Ga0500559_0000191 | 3300053136 | Bacteria | 49243 |
| 875 | Ga0500568_0046440 | 3300053139 | Bacteria | 1723 |
| 876 | Ga0500586_002231 | 3300053145 | Bacteria | 4309 |
| 877 | Ga0500604_0005271 | 3300053151 | Bacteria | 3419 |
| 878 | Ga0500622_0000080 | 3300053156 | Bacteria | 102519 |
| 879 | Ga0500645_018772 | 3300053730 | Bacteria | 2155 |
| 880 | Ga0500587_006140 | 3300053739 | Bacteria | 1603 |
| 881 | Ga0587072_002560 | 3300059643 | Bacteria | 2449 |
| 882 | Ga0501082_0363499 | 3300060353 | Bacteria | 1262 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025981 | Ga0207640_10269515 | Ga0207640_102695152 | 195 |
| 2 | 3300038443 | Ga0395901_0262199 | Ga0395901_0262199_1185_1787 | 199 |
| 3 | 3300046517 | Ga0495630_0606405 | Ga0495630_0606405_224_826 | 199 |
| 4 | 3300047315 | Ga0495581_0481980 | Ga0495581_0481980_103_705 | 199 |
| 5 | 3300046459 | Ga0495629_0000138 | Ga0495629_0000138_21116_21727 | 201 |
| 6 | 3300046460 | Ga0495638_0004088 | Ga0495638_0004088_9502_10113 | 201 |
| 7 | 3300046463 | Ga0495653_0000446 | Ga0495653_0000446_1162_1773 | 201 |
| 8 | 3300046506 | Ga0495583_0003588 | Ga0495583_0003588_543_1154 | 201 |
| 9 | 3300046515 | Ga0495620_0009360 | Ga0495620_0009360_1370_1981 | 201 |
| 10 | 3300046648 | Ga0495611_0020241 | Ga0495611_0020241_430_1041 | 201 |
| 11 | 3300046665 | Ga0495661_0016689 | Ga0495661_0016689_139_747 | 201 |
| 12 | 3300046689 | Ga0495613_0059416 | Ga0495613_0059416_1232_1843 | 201 |
| 13 | 3300046690 | Ga0495624_0109666 | Ga0495624_0109666_1069_1680 | 201 |
| 14 | 3300047673 | Ga0495593_0060022 | Ga0495593_0060022_994_1605 | 201 |
| 15 | 3300048920 | Ga0496117_0031375 | Ga0496117_0031375_1091_1702 | 201 |
| 16 | 3300048921 | Ga0496118_0062519 | Ga0496118_0062519_58_669 | 201 |
| 17 | 3300048905 | Ga0496102_0300258 | Ga0496102_0300258_594_1220 | 207 |
| 18 | 3300037418 | Ga0395900_0684185 | Ga0395900_0684185_10_645 | 208 |
| 19 | 3300049822 | Ga0501035_0033249 | Ga0501035_0033249_1705_2340 | 208 |
| 20 | 3300013297 | Ga0157378_10107400 | Ga0157378_101074002 | 209 |
| 21 | 3300006195 | Ga0075366_10352122 | Ga0075366_103521222 | 210 |
| 22 | 3300025921 | Ga0207652_10768192 | Ga0207652_107681922 | 210 |
| 23 | 3300050493 | nmdc:mga0k408_418881_c1 | nmdc:mga0k408_418881_c1_76_771 | 210 |
| 24 | 3300053118 | Ga0500594_0053295 | Ga0500594_0053295_10_645 | 210 |
| 25 | 3300046519 | Ga0495632_0006221 | Ga0495632_0006221_448_1143 | 211 |
| 26 | 3300031730 | Ga0307516_10002337 | Ga0307516_1000233710 | 213 |
| 27 | 3300006195 | Ga0075366_10002145 | Ga0075366_100021458 | 216 |
| 28 | 3300009174 | Ga0105241_10049406 | Ga0105241_100494062 | 216 |
| 29 | 3300041443 | Ga0451789_0499112 | Ga0451789_0499112_261_956 | 216 |
| 30 | 3300046460 | Ga0495638_0022649 | Ga0495638_0022649_935_1630 | 216 |
| 31 | 3300050493 | nmdc:mga0k408_83373_c1 | nmdc:mga0k408_83373_c1_196_891 | 216 |
| 32 | 3300053129 | Ga0500628_009031 | Ga0500628_009031_308_1003 | 216 |
| 33 | 3300053131 | Ga0500652_095776 | Ga0500652_095776_530_1225 | 216 |
| 34 | 3300053139 | Ga0500568_0046440 | Ga0500568_0046440_311_1006 | 216 |
| 35 | 3300053151 | Ga0500604_0005271 | Ga0500604_0005271_643_1338 | 216 |
| 36 | 3300053156 | Ga0500622_0000080 | Ga0500622_0000080_63675_64370 | 216 |
| 37 | 3300014969 | Ga0157376_10371188 | Ga0157376_103711881 | 220 |
| 38 | 3300046457 | Ga0495590_0036444 | Ga0495590_0036444_24_719 | 220 |
| 39 | 3300046519 | Ga0495632_0013807 | Ga0495632_0013807_3747_4442 | 220 |
| 40 | 3300046694 | Ga0495649_0001774 | Ga0495649_0001774_1683_2378 | 220 |
| 41 | 3300046810 | Ga0495660_0034140 | Ga0495660_0034140_1204_1899 | 220 |
| 42 | 3300047443 | Ga0495687_007257 | Ga0495687_007257_4149_4844 | 220 |
| 43 | 3300048904 | Ga0496101_0171124 | Ga0496101_0171124_258_935 | 220 |
| 44 | 3300049460 | Ga0495682_0025835 | Ga0495682_0025835_194_889 | 220 |
| 45 | 3300037312 | Ga0395899_0000012 | Ga0395899_0000012_84683_85375 | 221 |
| 46 | 3300047320 | Ga0495672_0000014 | Ga0495672_0000014_488731_489402 | 222 |
| 47 | 3300048918 | Ga0496115_0007372 | Ga0496115_0007372_741_1412 | 222 |
| 48 | 3300028786 | Ga0307517_10232579 | Ga0307517_102325791 | 223 |
| 49 | 3300046453 | Ga0495627_003668 | Ga0495627_003668_1711_2391 | 225 |
| 50 | 3300046492 | Ga0495585_0010579 | Ga0495585_0010579_3627_4307 | 225 |
| 51 | 3300046501 | Ga0495607_0141054 | Ga0495607_0141054_149_829 | 225 |
| 52 | 3300046523 | Ga0495644_0018051 | Ga0495644_0018051_61_741 | 225 |
| 53 | 3300046525 | Ga0495663_0004448 | Ga0495663_0004448_967_1647 | 225 |
| 54 | 3300046542 | Ga0495597_0045879 | Ga0495597_0045879_233_913 | 225 |
| 55 | 3300046615 | Ga0495656_0004844 | Ga0495656_0004844_979_1659 | 225 |
| 56 | 3300046616 | Ga0495668_0002205 | Ga0495668_0002205_10237_10917 | 225 |
| 57 | 3300046648 | Ga0495611_0011202 | Ga0495611_0011202_1110_1790 | 225 |
| 58 | 3300046660 | Ga0495625_0123795 | Ga0495625_0123795_78_758 | 225 |
| 59 | 3300046684 | Ga0495669_0125437 | Ga0495669_0125437_383_1063 | 225 |
| 60 | 3300046691 | Ga0495670_0052415 | Ga0495670_0052415_905_1585 | 225 |
| 61 | 3300046692 | Ga0495671_0033300 | Ga0495671_0033300_1106_1786 | 225 |
| 62 | 3300046794 | Ga0495589_0059654 | Ga0495589_0059654_247_927 | 225 |
| 63 | 3300047445 | Ga0495677_0005565 | Ga0495677_0005565_661_1341 | 225 |
| 64 | 3300047470 | Ga0495681_0003162 | Ga0495681_0003162_3084_3764 | 225 |
| 65 | 3300006177 | Ga0075362_10005052 | Ga0075362_100050527 | 226 |
| 66 | 3300006178 | Ga0075367_10017487 | Ga0075367_100174877 | 226 |
| 67 | 3300006186 | Ga0075369_10006743 | Ga0075369_100067433 | 226 |
| 68 | 3300006195 | Ga0075366_10080806 | Ga0075366_100808062 | 226 |
| 69 | 3300006353 | Ga0075370_10004227 | Ga0075370_100042272 | 226 |
| 70 | 3300046528 | Ga0495642_0040458 | Ga0495642_0040458_1031_1714 | 226 |
| 71 | 3300049572 | Ga0501036_0008220 | Ga0501036_0008220_4748_5437 | 226 |
| 72 | 3300049574 | Ga0501038_0006548 | Ga0501038_0006548_3147_3836 | 226 |
| 73 | 3300049579 | Ga0501043_0010564 | Ga0501043_0010564_3958_4647 | 226 |
| 74 | 3300049822 | Ga0501035_0204822 | Ga0501035_0204822_666_1355 | 226 |
| 75 | 3300049823 | Ga0501044_0000248 | Ga0501044_0000248_26272_26961 | 226 |
| 76 | iso_pu_bacteria | 2585428057 | 2587726655 | 226 |
| 77 | iso_pu_bacteria | 2588253510 | 2588290883 | 226 |
| 78 | iso_pu_bacteria | 2600255292 | 2601670497 | 226 |
| 79 | iso_pu_bacteria | 2643221556 | 2643801534 | 226 |
| 80 | iso_pu_bacteria | 2643221684 | 2644471404 | 226 |
| 81 | iso_pu_bacteria | 2738541297 | 2738825572 | 226 |
| 82 | iso_pu_bacteria | 2738541357 | 2739149369 | 226 |
| 83 | iso_pu_bacteria | 2738543003 | 2739191288 | 226 |
| 84 | iso_pu_bacteria | 2738543026 | 2739317765 | 226 |
| 85 | iso_pu_bacteria | 2738543029 | 2739336006 | 226 |
| 86 | iso_pu_bacteria | 2739367655 | 2739612516 | 226 |
| 87 | iso_pu_bacteria | 2857542790 | 2857546176 | 226 |
| 88 | iso_pu_bacteria | 2857547612 | 2857548160 | 226 |
| 89 | iso_pu_bacteria | 2857564685 | 2857565988 | 226 |
| 90 | iso_pu_bacteria | 2885080285 | 2885082727 | 226 |
| 91 | iso_pu_bacteria | 2932410948 | 2932412753 | 226 |
| 92 | iso_pu_bacteria | 2932416698 | 2932420268 | 226 |
| 93 | 3300048905 | Ga0496102_0376617 | Ga0496102_0376617_141_830 | 227 |
| 94 | iso_pu_bacteria | 2513237150 | 2513953091 | 227 |
| 95 | iso_pu_bacteria | 2596583598 | 2597032059 | 227 |
| 96 | iso_pu_bacteria | 2599185178 | 2599448351 | 227 |
| 97 | iso_pu_bacteria | 2643221554 | 2643788737 | 227 |
| 98 | iso_pu_bacteria | 2643221638 | 2644211410 | 227 |
| 99 | iso_pu_bacteria | 2821131069 | 2821134175 | 227 |
| 100 | iso_pu_bacteria | 2834641062 | 2834641158 | 227 |
| 101 | iso_pu_bacteria | 2842711865 | 2842711998 | 227 |
| 102 | iso_pu_bacteria | 2857553236 | 2857554766 | 227 |
| 103 | iso_pu_bacteria | 2857558681 | 2857559510 | 227 |
| 104 | iso_pu_bacteria | 2885266251 | 2885269310 | 227 |
| 105 | iso_pu_bacteria | 2900577576 | 2900578749 | 227 |
| 106 | iso_pu_bacteria | 2901300506 | 2901305644 | 227 |
| 107 | iso_pu_bacteria | 2904424332 | 2904429012 | 227 |
| 108 | iso_pu_bacteria | 2919476304 | 2919479153 | 227 |
| 109 | iso_pu_bacteria | 2928058823 | 2928060418 | 227 |
| 110 | iso_pu_bacteria | 644736347 | 644747294 | 227 |
| 111 | iso_pu_bacteria | 8003400568 | 8003403267 | 227 |
| 112 | 3300005614 | Ga0068856_100168159 | Ga0068856_1001681593 | 228 |
| 113 | 3300005616 | Ga0068852_100067996 | Ga0068852_1000679962 | 228 |
| 114 | 3300005834 | Ga0068851_10000887 | Ga0068851_100008872 | 228 |
| 115 | 3300006358 | Ga0068871_100018962 | Ga0068871_1000189624 | 228 |
| 116 | 3300013296 | Ga0157374_10639946 | Ga0157374_106399462 | 228 |
| 117 | 3300025939 | Ga0207665_10453497 | Ga0207665_104534972 | 228 |
| 118 | 3300026078 | Ga0207702_10125190 | Ga0207702_101251902 | 228 |
| 119 | 3300026142 | Ga0207698_10100587 | Ga0207698_101005872 | 228 |
| 120 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006125 | 228 |
| 121 | 3300031507 | Ga0307509_10380395 | Ga0307509_103803951 | 228 |
| 122 | 3300035725 | Ga0373947_0084799 | Ga0373947_0084799_87_773 | 228 |
| 123 | 3300037068 | Ga0373925_0053989 | Ga0373925_0053989_1347_2033 | 228 |
| 124 | 3300046471 | Ga0495650_0014209 | Ga0495650_0014209_1264_1968 | 228 |
| 125 | 3300046512 | Ga0495610_0044397 | Ga0495610_0044397_355_1044 | 228 |
| 126 | 3300048907 | Ga0496104_0130682 | Ga0496104_0130682_317_1003 | 228 |
| 127 | 3300048908 | Ga0496105_0254030 | Ga0496105_0254030_173_859 | 228 |
| 128 | 3300005719 | Ga0068861_100604300 | Ga0068861_1006043001 | 229 |
| 129 | 3300013102 | Ga0157371_10000014 | Ga0157371_10000014274 | 229 |
| 130 | 3300015262 | Ga0182007_10020018 | Ga0182007_100200182 | 229 |
| 131 | 3300025208 | Ga0209436_101072 | Ga0209436_1010722 | 229 |
| 132 | 3300025284 | Ga0209130_1002139 | Ga0209130_10021392 | 229 |
| 133 | 3300025295 | Ga0209564_1022490 | Ga0209564_10224902 | 229 |
| 134 | 3300028017 | Ga0265356_1001667 | Ga0265356_10016674 | 229 |
| 135 | 3300031548 | Ga0307408_100018923 | Ga0307408_1000189232 | 229 |
| 136 | 3300048927 | Ga0496124_0018696 | Ga0496124_0018696_3604_4296 | 229 |
| 137 | 3300049575 | Ga0501039_0236393 | Ga0501039_0236393_496_1191 | 229 |
| 138 | 3300049592 | Ga0501076_0116964 | Ga0501076_0116964_396_1091 | 229 |
| 139 | 3300060353 | Ga0501082_0363499 | Ga0501082_0363499_166_861 | 229 |
| 140 | 3300002987 | JGI25159J45721_1003520 | JGI25159J45721_10035202 | 230 |
| 141 | 3300003215 | JGI25153J46596_10002956 | JGI25153J46596_100029561 | 230 |
| 142 | 3300003320 | rootH2_10150607 | rootH2_101506073 | 230 |
| 143 | 3300003759 | Ga0055525_1000006 | Ga0055525_1000006507 | 230 |
| 144 | 3300003771 | Ga0055526_1000059 | Ga0055526_100005988 | 230 |
| 145 | 3300005262 | Ga0065165_1000187 | Ga0065165_100018791 | 230 |
| 146 | 3300005293 | Ga0065715_10032259 | Ga0065715_100322592 | 230 |
| 147 | 3300005327 | Ga0070658_10000986 | Ga0070658_100009865 | 230 |
| 148 | 3300005327 | Ga0070658_10058384 | Ga0070658_100583842 | 230 |
| 149 | 3300005329 | Ga0070683_100272987 | Ga0070683_1002729872 | 230 |
| 150 | 3300005331 | Ga0070670_100000714 | Ga0070670_10000071426 | 230 |
| 151 | 3300005334 | Ga0068869_100097122 | Ga0068869_1000971221 | 230 |
| 152 | 3300005335 | Ga0070666_10095115 | Ga0070666_100951152 | 230 |
| 153 | 3300005338 | Ga0068868_100357659 | Ga0068868_1003576592 | 230 |
| 154 | 3300005339 | Ga0070660_100002378 | Ga0070660_1000023784 | 230 |
| 155 | 3300005339 | Ga0070660_100022884 | Ga0070660_1000228842 | 230 |
| 156 | 3300005344 | Ga0070661_100011637 | Ga0070661_1000116376 | 230 |
| 157 | 3300005344 | Ga0070661_100016547 | Ga0070661_1000165473 | 230 |
| 158 | 3300005344 | Ga0070661_100198603 | Ga0070661_1001986032 | 230 |
| 159 | 3300005354 | Ga0070675_100005300 | Ga0070675_10000530010 | 230 |
| 160 | 3300005364 | Ga0070673_100000557 | Ga0070673_10000055710 | 230 |
| 161 | 3300005366 | Ga0070659_100122185 | Ga0070659_1001221852 | 230 |
| 162 | 3300005366 | Ga0070659_100147883 | Ga0070659_1001478832 | 230 |
| 163 | 3300005366 | Ga0070659_100222196 | Ga0070659_1002221961 | 230 |
| 164 | 3300005367 | Ga0070667_100002040 | Ga0070667_10000204012 | 230 |
| 165 | 3300005367 | Ga0070667_100005411 | Ga0070667_10000541112 | 230 |
| 166 | 3300005367 | Ga0070667_100165375 | Ga0070667_1001653751 | 230 |
| 167 | 3300005439 | Ga0070711_100258523 | Ga0070711_1002585231 | 230 |
| 168 | 3300005459 | Ga0068867_100148691 | Ga0068867_1001486912 | 230 |
| 169 | 3300005535 | Ga0070684_100027798 | Ga0070684_1000277985 | 230 |
| 170 | 3300005539 | Ga0068853_100203935 | Ga0068853_1002039351 | 230 |
| 171 | 3300005543 | Ga0070672_100001308 | Ga0070672_1000013082 | 230 |
| 172 | 3300005547 | Ga0070693_100204218 | Ga0070693_1002042182 | 230 |
| 173 | 3300005548 | Ga0070665_100175145 | Ga0070665_1001751452 | 230 |
| 174 | 3300005548 | Ga0070665_100204690 | Ga0070665_1002046904 | 230 |
| 175 | 3300005548 | Ga0070665_100588938 | Ga0070665_1005889382 | 230 |
| 176 | 3300005563 | Ga0068855_100002749 | Ga0068855_10000274922 | 230 |
| 177 | 3300005563 | Ga0068855_100439695 | Ga0068855_1004396952 | 230 |
| 178 | 3300005564 | Ga0070664_100002979 | Ga0070664_1000029792 | 230 |
| 179 | 3300005564 | Ga0070664_100020752 | Ga0070664_1000207522 | 230 |
| 180 | 3300005577 | Ga0068857_100123803 | Ga0068857_1001238035 | 230 |
| 181 | 3300005577 | Ga0068857_100201451 | Ga0068857_1002014513 | 230 |
| 182 | 3300005616 | Ga0068852_100082273 | Ga0068852_1000822732 | 230 |
| 183 | 3300005618 | Ga0068864_100274391 | Ga0068864_1002743912 | 230 |
| 184 | 3300005840 | Ga0068870_10046662 | Ga0068870_100466622 | 230 |
| 185 | 3300005841 | Ga0068863_100017665 | Ga0068863_1000176658 | 230 |
| 186 | 3300006051 | Ga0075364_10040905 | Ga0075364_100409055 | 230 |
| 187 | 3300006058 | Ga0075432_10066154 | Ga0075432_100661542 | 230 |
| 188 | 3300006175 | Ga0070712_100124882 | Ga0070712_1001248822 | 230 |
| 189 | 3300006186 | Ga0075369_10031725 | Ga0075369_100317252 | 230 |
| 190 | 3300006195 | Ga0075366_10010210 | Ga0075366_100102107 | 230 |
| 191 | 3300006237 | Ga0097621_100918180 | Ga0097621_1009181802 | 230 |
| 192 | 3300006353 | Ga0075370_10000508 | Ga0075370_100005085 | 230 |
| 193 | 3300006353 | Ga0075370_10001132 | Ga0075370_100011325 | 230 |
| 194 | 3300006358 | Ga0068871_100064780 | Ga0068871_1000647802 | 230 |
| 195 | 3300006358 | Ga0068871_100424211 | Ga0068871_1004242111 | 230 |
| 196 | 3300006881 | Ga0068865_100226170 | Ga0068865_1002261702 | 230 |
| 197 | 3300006881 | Ga0068865_100877767 | Ga0068865_1008777671 | 230 |
| 198 | 3300009036 | Ga0105244_10041193 | Ga0105244_100411932 | 230 |
| 199 | 3300009093 | Ga0105240_10047825 | Ga0105240_100478256 | 230 |
| 200 | 3300009098 | Ga0105245_10099266 | Ga0105245_100992661 | 230 |
| 201 | 3300009098 | Ga0105245_10164434 | Ga0105245_101644342 | 230 |
| 202 | 3300009545 | Ga0105237_10007631 | Ga0105237_100076314 | 230 |
| 203 | 3300009545 | Ga0105237_10228514 | Ga0105237_102285142 | 230 |
| 204 | 3300010375 | Ga0105239_10019901 | Ga0105239_100199012 | 230 |
| 205 | 3300010375 | Ga0105239_10754154 | Ga0105239_107541542 | 230 |
| 206 | 3300013296 | Ga0157374_10003550 | Ga0157374_1000355014 | 230 |
| 207 | 3300013306 | Ga0163162_10126328 | Ga0163162_101263282 | 230 |
| 208 | 3300013307 | Ga0157372_10476134 | Ga0157372_104761342 | 230 |
| 209 | 3300013308 | Ga0157375_10000644 | Ga0157375_100006442 | 230 |
| 210 | 3300013308 | Ga0157375_10012497 | Ga0157375_100124977 | 230 |
| 211 | 3300014497 | Ga0182008_10000881 | Ga0182008_1000088114 | 230 |
| 212 | 3300014745 | Ga0157377_10106715 | Ga0157377_101067152 | 230 |
| 213 | 3300014969 | Ga0157376_10002947 | Ga0157376_100029472 | 230 |
| 214 | 3300015261 | Ga0182006_1000046 | Ga0182006_1000046134 | 230 |
| 215 | 3300015262 | Ga0182007_10000148 | Ga0182007_1000014832 | 230 |
| 216 | 3300015265 | Ga0182005_1000032 | Ga0182005_1000032134 | 230 |
| 217 | 3300021361 | Ga0213872_10000135 | Ga0213872_1000013553 | 230 |
| 218 | 3300021361 | Ga0213872_10000938 | Ga0213872_1000093810 | 230 |
| 219 | 3300025208 | Ga0209436_113673 | Ga0209436_1136732 | 230 |
| 220 | 3300025230 | Ga0209563_100022 | Ga0209563_100022504 | 230 |
| 221 | 3300025245 | Ga0207425_1002065 | Ga0207425_10020654 | 230 |
| 222 | 3300025250 | Ga0209026_1001413 | Ga0209026_10014134 | 230 |
| 223 | 3300025253 | Ga0209677_107158 | Ga0209677_1071582 | 230 |
| 224 | 3300025254 | Ga0209148_1000466 | Ga0209148_10004665 | 230 |
| 225 | 3300025284 | Ga0209130_1000191 | Ga0209130_100019159 | 230 |
| 226 | 3300025294 | Ga0209025_1007179 | Ga0209025_10071792 | 230 |
| 227 | 3300025295 | Ga0209564_1000026 | Ga0209564_100002624 | 230 |
| 228 | 3300025297 | Ga0209758_1000280 | Ga0209758_100028066 | 230 |
| 229 | 3300025297 | Ga0209758_1000456 | Ga0209758_100045616 | 230 |
| 230 | 3300025321 | Ga0207656_10013763 | Ga0207656_100137632 | 230 |
| 231 | 3300025728 | Ga0207655_1026527 | Ga0207655_10265272 | 230 |
| 232 | 3300025909 | Ga0207705_10001052 | Ga0207705_1000105221 | 230 |
| 233 | 3300025909 | Ga0207705_10063952 | Ga0207705_100639522 | 230 |
| 234 | 3300025912 | Ga0207707_10650418 | Ga0207707_106504181 | 230 |
| 235 | 3300025916 | Ga0207663_10135396 | Ga0207663_101353962 | 230 |
| 236 | 3300025919 | Ga0207657_10012835 | Ga0207657_100128352 | 230 |
| 237 | 3300025919 | Ga0207657_10031906 | Ga0207657_100319063 | 230 |
| 238 | 3300025919 | Ga0207657_10114786 | Ga0207657_101147862 | 230 |
| 239 | 3300025925 | Ga0207650_10012314 | Ga0207650_100123142 | 230 |
| 240 | 3300025926 | Ga0207659_10003223 | Ga0207659_1000322310 | 230 |
| 241 | 3300025927 | Ga0207687_10053028 | Ga0207687_100530284 | 230 |
| 242 | 3300025927 | Ga0207687_10063400 | Ga0207687_100634002 | 230 |
| 243 | 3300025928 | Ga0207700_10370810 | Ga0207700_103708102 | 230 |
| 244 | 3300025931 | Ga0207644_10013773 | Ga0207644_100137735 | 230 |
| 245 | 3300025932 | Ga0207690_10140150 | Ga0207690_101401502 | 230 |
| 246 | 3300025933 | Ga0207706_10017201 | Ga0207706_100172012 | 230 |
| 247 | 3300025933 | Ga0207706_10188538 | Ga0207706_101885382 | 230 |
| 248 | 3300025934 | Ga0207686_10015922 | Ga0207686_100159222 | 230 |
| 249 | 3300025935 | Ga0207709_10170044 | Ga0207709_101700441 | 230 |
| 250 | 3300025938 | Ga0207704_10303190 | Ga0207704_103031902 | 230 |
| 251 | 3300025940 | Ga0207691_10001019 | Ga0207691_1000101918 | 230 |
| 252 | 3300025941 | Ga0207711_10058137 | Ga0207711_100581373 | 230 |
| 253 | 3300025942 | Ga0207689_10194051 | Ga0207689_101940512 | 230 |
| 254 | 3300025944 | Ga0207661_10009771 | Ga0207661_100097712 | 230 |
| 255 | 3300025945 | Ga0207679_10012374 | Ga0207679_100123743 | 230 |
| 256 | 3300025945 | Ga0207679_10019132 | Ga0207679_100191321 | 230 |
| 257 | 3300025949 | Ga0207667_10025116 | Ga0207667_100251163 | 230 |
| 258 | 3300025960 | Ga0207651_10115534 | Ga0207651_101155342 | 230 |
| 259 | 3300025986 | Ga0207658_10001969 | Ga0207658_100019695 | 230 |
| 260 | 3300025986 | Ga0207658_10161281 | Ga0207658_101612811 | 230 |
| 261 | 3300026023 | Ga0207677_10011464 | Ga0207677_100114642 | 230 |
| 262 | 3300026023 | Ga0207677_10137376 | Ga0207677_101373763 | 230 |
| 263 | 3300026067 | Ga0207678_10108738 | Ga0207678_101087381 | 230 |
| 264 | 3300026067 | Ga0207678_10498059 | Ga0207678_104980592 | 230 |
| 265 | 3300026088 | Ga0207641_10161872 | Ga0207641_101618722 | 230 |
| 266 | 3300026089 | Ga0207648_10174204 | Ga0207648_101742042 | 230 |
| 267 | 3300026095 | Ga0207676_10036277 | Ga0207676_100362773 | 230 |
| 268 | 3300026116 | Ga0207674_10082533 | Ga0207674_100825334 | 230 |
| 269 | 3300026116 | Ga0207674_10232563 | Ga0207674_102325631 | 230 |
| 270 | 3300026121 | Ga0207683_10026471 | Ga0207683_100264714 | 230 |
| 271 | 3300026142 | Ga0207698_10001056 | Ga0207698_100010567 | 230 |
| 272 | 3300027907 | Ga0207428_10279179 | Ga0207428_102791791 | 230 |
| 273 | 3300028379 | Ga0268266_10166382 | Ga0268266_101663822 | 230 |
| 274 | 3300028379 | Ga0268266_10190363 | Ga0268266_101903632 | 230 |
| 275 | 3300028379 | Ga0268266_10659661 | Ga0268266_106596611 | 230 |
| 276 | 3300028786 | Ga0307517_10051238 | Ga0307517_100512382 | 230 |
| 277 | 3300028794 | Ga0307515_10014672 | Ga0307515_100146724 | 230 |
| 278 | 3300030522 | Ga0307512_10068471 | Ga0307512_100684712 | 230 |
| 279 | 3300031235 | Ga0265330_10013712 | Ga0265330_100137122 | 230 |
| 280 | 3300031238 | Ga0265332_10001968 | Ga0265332_100019682 | 230 |
| 281 | 3300031239 | Ga0265328_10034896 | Ga0265328_100348961 | 230 |
| 282 | 3300031241 | Ga0265325_10084942 | Ga0265325_100849422 | 230 |
| 283 | 3300031242 | Ga0265329_10006342 | Ga0265329_100063422 | 230 |
| 284 | 3300031249 | Ga0265339_10201510 | Ga0265339_102015101 | 230 |
| 285 | 3300031250 | Ga0265331_10002869 | Ga0265331_100028694 | 230 |
| 286 | 3300031251 | Ga0265327_10010274 | Ga0265327_100102744 | 230 |
| 287 | 3300031344 | Ga0265316_10112748 | Ga0265316_101127482 | 230 |
| 288 | 3300031456 | Ga0307513_10252728 | Ga0307513_102527282 | 230 |
| 289 | 3300031456 | Ga0307513_10300184 | Ga0307513_103001842 | 230 |
| 290 | 3300031507 | Ga0307509_10001946 | Ga0307509_1000194619 | 230 |
| 291 | 3300031507 | Ga0307509_10008897 | Ga0307509_100088974 | 230 |
| 292 | 3300031616 | Ga0307508_10000078 | Ga0307508_1000007833 | 230 |
| 293 | 3300031649 | Ga0307514_10047105 | Ga0307514_100471052 | 230 |
| 294 | 3300031649 | Ga0307514_10060389 | Ga0307514_100603892 | 230 |
| 295 | 3300031711 | Ga0265314_10009491 | Ga0265314_100094912 | 230 |
| 296 | 3300031711 | Ga0265314_10042534 | Ga0265314_100425342 | 230 |
| 297 | 3300031730 | Ga0307516_10097916 | Ga0307516_100979162 | 230 |
| 298 | 3300033180 | Ga0307510_10045598 | Ga0307510_100455984 | 230 |
| 299 | 3300033180 | Ga0307510_10045790 | Ga0307510_100457902 | 230 |
| 300 | 3300033180 | Ga0307510_10062421 | Ga0307510_100624212 | 230 |
| 301 | 3300035112 | Ga0373932_0019508 | Ga0373932_0019508_1000_1695 | 230 |
| 302 | 3300035114 | Ga0373939_0020997 | Ga0373939_0020997_1069_1764 | 230 |
| 303 | 3300035691 | Ga0373931_0005484 | Ga0373931_0005484_2136_2831 | 230 |
| 304 | 3300037068 | Ga0373925_0014858 | Ga0373925_0014858_3681_4376 | 230 |
| 305 | 3300037312 | Ga0395899_0001637 | Ga0395899_0001637_5307_6008 | 230 |
| 306 | 3300037312 | Ga0395899_0002583 | Ga0395899_0002583_6974_7675 | 230 |
| 307 | 3300037312 | Ga0395899_0035864 | Ga0395899_0035864_2195_2890 | 230 |
| 308 | 3300037312 | Ga0395899_0076822 | Ga0395899_0076822_1475_2170 | 230 |
| 309 | 3300037312 | Ga0395899_0139160 | Ga0395899_0139160_390_1085 | 230 |
| 310 | 3300037312 | Ga0395899_0307763 | Ga0395899_0307763_19_714 | 230 |
| 311 | 3300037312 | Ga0395899_0384818 | Ga0395899_0384818_159_872 | 230 |
| 312 | 3300037418 | Ga0395900_0000295 | Ga0395900_0000295_74423_75118 | 230 |
| 313 | 3300037418 | Ga0395900_0000513 | Ga0395900_0000513_21421_22116 | 230 |
| 314 | 3300037418 | Ga0395900_0010183 | Ga0395900_0010183_8888_9589 | 230 |
| 315 | 3300037418 | Ga0395900_0015250 | Ga0395900_0015250_1185_1892 | 230 |
| 316 | 3300037418 | Ga0395900_0045265 | Ga0395900_0045265_1908_2621 | 230 |
| 317 | 3300037418 | Ga0395900_0113603 | Ga0395900_0113603_332_1027 | 230 |
| 318 | 3300037418 | Ga0395900_0194331 | Ga0395900_0194331_1105_1800 | 230 |
| 319 | 3300037418 | Ga0395900_0737208 | Ga0395900_0737208_139_840 | 230 |
| 320 | 3300037466 | Ga0395898_0038131 | Ga0395898_0038131_2523_3218 | 230 |
| 321 | 3300037466 | Ga0395898_0049928 | Ga0395898_0049928_486_1181 | 230 |
| 322 | 3300037466 | Ga0395898_0372790 | Ga0395898_0372790_427_1122 | 230 |
| 323 | 3300037471 | Ga0395905_0000236 | Ga0395905_0000236_47596_48294 | 230 |
| 324 | 3300037471 | Ga0395905_0002685 | Ga0395905_0002685_3315_4013 | 230 |
| 325 | 3300037471 | Ga0395905_0073482 | Ga0395905_0073482_598_1305 | 230 |
| 326 | 3300037471 | Ga0395905_0384556 | Ga0395905_0384556_183_878 | 230 |
| 327 | 3300038443 | Ga0395901_0000019 | Ga0395901_0000019_179798_180493 | 230 |
| 328 | 3300038443 | Ga0395901_0074228 | Ga0395901_0074228_1058_1765 | 230 |
| 329 | 3300038443 | Ga0395901_0085620 | Ga0395901_0085620_2063_2767 | 230 |
| 330 | 3300038443 | Ga0395901_0418460 | Ga0395901_0418460_241_936 | 230 |
| 331 | 3300038443 | Ga0395901_0530895 | Ga0395901_0530895_303_998 | 230 |
| 332 | 3300038443 | Ga0395901_0533925 | Ga0395901_0533925_444_1145 | 230 |
| 333 | 3300039447 | Ga0436361_0106962 | Ga0436361_0106962_349_1047 | 230 |
| 334 | 3300039447 | Ga0436361_0285806 | Ga0436361_0285806_5692_6390 | 230 |
| 335 | 3300039447 | Ga0436361_0985114 | Ga0436361_0985114_11688_12386 | 230 |
| 336 | 3300041512 | Ga0451853_2925066 | Ga0451853_2925066_363_1055 | 230 |
| 337 | 3300044658 | Ga0466972_0000037 | Ga0466972_0000037_23438_24151 | 230 |
| 338 | 3300044658 | Ga0466972_0014046 | Ga0466972_0014046_1921_2619 | 230 |
| 339 | 3300044658 | Ga0466972_0028431 | Ga0466972_0028431_1918_2631 | 230 |
| 340 | 3300044658 | Ga0466972_0036303 | Ga0466972_0036303_181_894 | 230 |
| 341 | 3300044658 | Ga0466972_0096830 | Ga0466972_0096830_26_721 | 230 |
| 342 | 3300044658 | Ga0466972_0130264 | Ga0466972_0130264_445_1149 | 230 |
| 343 | 3300044683 | Ga0466965_0001361 | Ga0466965_0001361_5453_6151 | 230 |
| 344 | 3300044683 | Ga0466965_0015945 | Ga0466965_0015945_470_1183 | 230 |
| 345 | 3300044683 | Ga0466965_0066438 | Ga0466965_0066438_400_1104 | 230 |
| 346 | 3300044683 | Ga0466965_0099439 | Ga0466965_0099439_747_1442 | 230 |
| 347 | 3300044683 | Ga0466965_0241738 | Ga0466965_0241738_192_887 | 230 |
| 348 | 3300044684 | Ga0466966_0008213 | Ga0466966_0008213_1132_1836 | 230 |
| 349 | 3300044684 | Ga0466966_0025260 | Ga0466966_0025260_2312_3007 | 230 |
| 350 | 3300044684 | Ga0466966_0078495 | Ga0466966_0078495_794_1489 | 230 |
| 351 | 3300044684 | Ga0466966_0137726 | Ga0466966_0137726_187_882 | 230 |
| 352 | 3300044693 | Ga0466961_0107241 | Ga0466961_0107241_473_1168 | 230 |
| 353 | 3300044706 | Ga0466964_0004791 | Ga0466964_0004791_4048_4761 | 230 |
| 354 | 3300044706 | Ga0466964_0046672 | Ga0466964_0046672_535_1233 | 230 |
| 355 | 3300044706 | Ga0466964_0067477 | Ga0466964_0067477_734_1429 | 230 |
| 356 | 3300044735 | Ga0466968_0062849 | Ga0466968_0062849_63_776 | 230 |
| 357 | 3300044735 | Ga0466968_0065870 | Ga0466968_0065870_361_1059 | 230 |
| 358 | 3300044735 | Ga0466968_0084459 | Ga0466968_0084459_343_1056 | 230 |
| 359 | 3300044842 | Ga0466957_0199927 | Ga0466957_0199927_27_722 | 230 |
| 360 | 3300045049 | Ga0466959_0007582 | Ga0466959_0007582_3496_4191 | 230 |
| 361 | 3300045049 | Ga0466959_0022000 | Ga0466959_0022000_2441_3136 | 230 |
| 362 | 3300045049 | Ga0466959_0087283 | Ga0466959_0087283_633_1337 | 230 |
| 363 | 3300045049 | Ga0466959_0134579 | Ga0466959_0134579_735_1430 | 230 |
| 364 | 3300045836 | Ga0466958_0281456 | Ga0466958_0281456_187_882 | 230 |
| 365 | 3300045976 | Ga0466967_0023588 | Ga0466967_0023588_2303_2998 | 230 |
| 366 | 3300046452 | Ga0495617_000056 | Ga0495617_000056_65560_66255 | 230 |
| 367 | 3300046452 | Ga0495617_002021 | Ga0495617_002021_7683_8378 | 230 |
| 368 | 3300046454 | Ga0495592_0006645 | Ga0495592_0006645_1778_2473 | 230 |
| 369 | 3300046457 | Ga0495590_0001695 | Ga0495590_0001695_32_727 | 230 |
| 370 | 3300046460 | Ga0495638_0044277 | Ga0495638_0044277_2031_2726 | 230 |
| 371 | 3300046471 | Ga0495650_0000105 | Ga0495650_0000105_130315_131013 | 230 |
| 372 | 3300046471 | Ga0495650_0000200 | Ga0495650_0000200_47394_48092 | 230 |
| 373 | 3300046471 | Ga0495650_0000232 | Ga0495650_0000232_9839_10534 | 230 |
| 374 | 3300046471 | Ga0495650_0000798 | Ga0495650_0000798_11699_12394 | 230 |
| 375 | 3300046471 | Ga0495650_0000884 | Ga0495650_0000884_26283_26978 | 230 |
| 376 | 3300046471 | Ga0495650_0051735 | Ga0495650_0051735_299_994 | 230 |
| 377 | 3300046474 | Ga0495605_0000015 | Ga0495605_0000015_194777_195472 | 230 |
| 378 | 3300046474 | Ga0495605_0021135 | Ga0495605_0021135_1148_1843 | 230 |
| 379 | 3300046474 | Ga0495605_0076232 | Ga0495605_0076232_98_793 | 230 |
| 380 | 3300046491 | Ga0495584_0000096 | Ga0495584_0000096_13725_14420 | 230 |
| 381 | 3300046491 | Ga0495584_0001943 | Ga0495584_0001943_3019_3714 | 230 |
| 382 | 3300046491 | Ga0495584_0011694 | Ga0495584_0011694_3207_3902 | 230 |
| 383 | 3300046491 | Ga0495584_0032085 | Ga0495584_0032085_1906_2601 | 230 |
| 384 | 3300046492 | Ga0495585_0014219 | Ga0495585_0014219_2367_3062 | 230 |
| 385 | 3300046492 | Ga0495585_0027868 | Ga0495585_0027868_2018_2713 | 230 |
| 386 | 3300046499 | Ga0495594_0002295 | Ga0495594_0002295_9200_9895 | 230 |
| 387 | 3300046500 | Ga0495596_0003958 | Ga0495596_0003958_1324_2019 | 230 |
| 388 | 3300046500 | Ga0495596_0042333 | Ga0495596_0042333_329_1024 | 230 |
| 389 | 3300046501 | Ga0495607_0030736 | Ga0495607_0030736_280_975 | 230 |
| 390 | 3300046501 | Ga0495607_0145278 | Ga0495607_0145278_98_793 | 230 |
| 391 | 3300046506 | Ga0495583_0001378 | Ga0495583_0001378_20535_21230 | 230 |
| 392 | 3300046506 | Ga0495583_0011994 | Ga0495583_0011994_2498_3196 | 230 |
| 393 | 3300046506 | Ga0495583_0081953 | Ga0495583_0081953_10_705 | 230 |
| 394 | 3300046507 | Ga0495606_0000007 | Ga0495606_0000007_292380_293084 | 230 |
| 395 | 3300046507 | Ga0495606_0003167 | Ga0495606_0003167_3669_4367 | 230 |
| 396 | 3300046507 | Ga0495606_0003736 | Ga0495606_0003736_2295_2990 | 230 |
| 397 | 3300046507 | Ga0495606_0004504 | Ga0495606_0004504_1417_2112 | 230 |
| 398 | 3300046507 | Ga0495606_0007748 | Ga0495606_0007748_336_1031 | 230 |
| 399 | 3300046507 | Ga0495606_0094656 | Ga0495606_0094656_815_1510 | 230 |
| 400 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_862161_862856 | 230 |
| 401 | 3300046513 | Ga0495616_0008520 | Ga0495616_0008520_1997_2692 | 230 |
| 402 | 3300046513 | Ga0495616_0011013 | Ga0495616_0011013_2515_3210 | 230 |
| 403 | 3300046513 | Ga0495616_0047339 | Ga0495616_0047339_984_1679 | 230 |
| 404 | 3300046518 | Ga0495631_0000238 | Ga0495631_0000238_4013_4708 | 230 |
| 405 | 3300046518 | Ga0495631_0012808 | Ga0495631_0012808_275_970 | 230 |
| 406 | 3300046519 | Ga0495632_0123356 | Ga0495632_0123356_498_1193 | 230 |
| 407 | 3300046520 | Ga0495637_0000477 | Ga0495637_0000477_16354_17049 | 230 |
| 408 | 3300046520 | Ga0495637_0010316 | Ga0495637_0010316_1418_2113 | 230 |
| 409 | 3300046520 | Ga0495637_0094218 | Ga0495637_0094218_46_744 | 230 |
| 410 | 3300046522 | Ga0495643_0008789 | Ga0495643_0008789_1989_2684 | 230 |
| 411 | 3300046522 | Ga0495643_0013735 | Ga0495643_0013735_177_872 | 230 |
| 412 | 3300046522 | Ga0495643_0036323 | Ga0495643_0036323_1511_2206 | 230 |
| 413 | 3300046523 | Ga0495644_0025504 | Ga0495644_0025504_778_1473 | 230 |
| 414 | 3300046523 | Ga0495644_0025956 | Ga0495644_0025956_778_1473 | 230 |
| 415 | 3300046524 | Ga0495648_0018580 | Ga0495648_0018580_651_1346 | 230 |
| 416 | 3300046524 | Ga0495648_0020845 | Ga0495648_0020845_2486_3181 | 230 |
| 417 | 3300046524 | Ga0495648_0021533 | Ga0495648_0021533_972_1667 | 230 |
| 418 | 3300046524 | Ga0495648_0036963 | Ga0495648_0036963_2382_3077 | 230 |
| 419 | 3300046524 | Ga0495648_0054963 | Ga0495648_0054963_640_1335 | 230 |
| 420 | 3300046528 | Ga0495642_0001544 | Ga0495642_0001544_2033_2728 | 230 |
| 421 | 3300046528 | Ga0495642_0046606 | Ga0495642_0046606_187_882 | 230 |
| 422 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_425624_426319 | 230 |
| 423 | 3300046530 | Ga0495654_0008398 | Ga0495654_0008398_3395_4090 | 230 |
| 424 | 3300046530 | Ga0495654_0076798 | Ga0495654_0076798_599_1297 | 230 |
| 425 | 3300046538 | Ga0495609_0052451 | Ga0495609_0052451_10_705 | 230 |
| 426 | 3300046557 | Ga0495622_0000032 | Ga0495622_0000032_6470_7168 | 230 |
| 427 | 3300046557 | Ga0495622_0026110 | Ga0495622_0026110_985_1680 | 230 |
| 428 | 3300046558 | Ga0495633_0000601 | Ga0495633_0000601_24269_24964 | 230 |
| 429 | 3300046558 | Ga0495633_0001211 | Ga0495633_0001211_16207_16905 | 230 |
| 430 | 3300046558 | Ga0495633_0044765 | Ga0495633_0044765_1323_2018 | 230 |
| 431 | 3300046558 | Ga0495633_0081811 | Ga0495633_0081811_289_984 | 230 |
| 432 | 3300046615 | Ga0495656_0036424 | Ga0495656_0036424_1293_1988 | 230 |
| 433 | 3300046616 | Ga0495668_0002372 | Ga0495668_0002372_13405_14100 | 230 |
| 434 | 3300046616 | Ga0495668_0006970 | Ga0495668_0006970_4035_4730 | 230 |
| 435 | 3300046616 | Ga0495668_0013235 | Ga0495668_0013235_412_1107 | 230 |
| 436 | 3300046616 | Ga0495668_0060311 | Ga0495668_0060311_238_933 | 230 |
| 437 | 3300046648 | Ga0495611_0000062 | Ga0495611_0000062_33464_34159 | 230 |
| 438 | 3300046648 | Ga0495611_0000788 | Ga0495611_0000788_15337_16032 | 230 |
| 439 | 3300046648 | Ga0495611_0084138 | Ga0495611_0084138_559_1254 | 230 |
| 440 | 3300046648 | Ga0495611_0144756 | Ga0495611_0144756_10_705 | 230 |
| 441 | 3300046660 | Ga0495625_0016045 | Ga0495625_0016045_4722_5417 | 230 |
| 442 | 3300046660 | Ga0495625_0203490 | Ga0495625_0203490_144_839 | 230 |
| 443 | 3300046664 | Ga0495659_0060676 | Ga0495659_0060676_117_815 | 230 |
| 444 | 3300046664 | Ga0495659_0159404 | Ga0495659_0159404_33_731 | 230 |
| 445 | 3300046665 | Ga0495661_0008592 | Ga0495661_0008592_3425_4120 | 230 |
| 446 | 3300046665 | Ga0495661_0013327 | Ga0495661_0013327_2914_3609 | 230 |
| 447 | 3300046665 | Ga0495661_0032406 | Ga0495661_0032406_1245_1940 | 230 |
| 448 | 3300046665 | Ga0495661_0084498 | Ga0495661_0084498_186_881 | 230 |
| 449 | 3300046674 | Ga0495588_0000139 | Ga0495588_0000139_77201_77896 | 230 |
| 450 | 3300046674 | Ga0495588_0002696 | Ga0495588_0002696_2217_2912 | 230 |
| 451 | 3300046674 | Ga0495588_0073564 | Ga0495588_0073564_559_1266 | 230 |
| 452 | 3300046683 | Ga0495658_0217309 | Ga0495658_0217309_117_818 | 230 |
| 453 | 3300046691 | Ga0495670_0053230 | Ga0495670_0053230_729_1424 | 230 |
| 454 | 3300046692 | Ga0495671_0000381 | Ga0495671_0000381_29417_30112 | 230 |
| 455 | 3300046692 | Ga0495671_0159712 | Ga0495671_0159712_222_917 | 230 |
| 456 | 3300046694 | Ga0495649_0000114 | Ga0495649_0000114_23848_24543 | 230 |
| 457 | 3300046794 | Ga0495589_0049438 | Ga0495589_0049438_968_1663 | 230 |
| 458 | 3300046794 | Ga0495589_0065397 | Ga0495589_0065397_511_1206 | 230 |
| 459 | 3300046810 | Ga0495660_0014670 | Ga0495660_0014670_2449_3144 | 230 |
| 460 | 3300046810 | Ga0495660_0014754 | Ga0495660_0014754_2531_3226 | 230 |
| 461 | 3300046810 | Ga0495660_0037790 | Ga0495660_0037790_1569_2264 | 230 |
| 462 | 3300046810 | Ga0495660_0087656 | Ga0495660_0087656_59_757 | 230 |
| 463 | 3300046810 | Ga0495660_0112115 | Ga0495660_0112115_186_881 | 230 |
| 464 | 3300046810 | Ga0495660_0134290 | Ga0495660_0134290_345_1043 | 230 |
| 465 | 3300047318 | Ga0495636_0001586 | Ga0495636_0001586_5364_6062 | 230 |
| 466 | 3300047318 | Ga0495636_0002753 | Ga0495636_0002753_5526_6224 | 230 |
| 467 | 3300047320 | Ga0495672_0108165 | Ga0495672_0108165_620_1315 | 230 |
| 468 | 3300047321 | Ga0495676_0070130 | Ga0495676_0070130_1114_1812 | 230 |
| 469 | 3300047321 | Ga0495676_0123768 | Ga0495676_0123768_33_728 | 230 |
| 470 | 3300047322 | Ga0495680_0084055 | Ga0495680_0084055_237_932 | 230 |
| 471 | 3300047323 | Ga0495683_0037245 | Ga0495683_0037245_1513_2208 | 230 |
| 472 | 3300047443 | Ga0495687_000685 | Ga0495687_000685_11542_12237 | 230 |
| 473 | 3300047443 | Ga0495687_076515 | Ga0495687_076515_138_836 | 230 |
| 474 | 3300047445 | Ga0495677_0000360 | Ga0495677_0000360_3458_4153 | 230 |
| 475 | 3300047445 | Ga0495677_0010118 | Ga0495677_0010118_29_724 | 230 |
| 476 | 3300047446 | Ga0495679_092076 | Ga0495679_092076_45_740 | 230 |
| 477 | 3300047447 | Ga0495685_014313 | Ga0495685_014313_784_1479 | 230 |
| 478 | 3300047469 | Ga0495673_0000017 | Ga0495673_0000017_545937_546632 | 230 |
| 479 | 3300047469 | Ga0495673_0000135 | Ga0495673_0000135_104995_105690 | 230 |
| 480 | 3300047469 | Ga0495673_0002581 | Ga0495673_0002581_11389_12084 | 230 |
| 481 | 3300047472 | Ga0495686_0001265 | Ga0495686_0001265_3225_3923 | 230 |
| 482 | 3300047472 | Ga0495686_0005469 | Ga0495686_0005469_3576_4271 | 230 |
| 483 | 3300047472 | Ga0495686_0009037 | Ga0495686_0009037_4734_5429 | 230 |
| 484 | 3300047472 | Ga0495686_0157438 | Ga0495686_0157438_494_1216 | 230 |
| 485 | 3300048091 | Ga0495626_0002853 | Ga0495626_0002853_370_1065 | 230 |
| 486 | 3300048091 | Ga0495626_0012014 | Ga0495626_0012014_150_845 | 230 |
| 487 | 3300048091 | Ga0495626_0103878 | Ga0495626_0103878_405_1100 | 230 |
| 488 | 3300048903 | Ga0496100_0007012 | Ga0496100_0007012_285_980 | 230 |
| 489 | 3300048903 | Ga0496100_0083306 | Ga0496100_0083306_294_986 | 230 |
| 490 | 3300048903 | Ga0496100_0254618 | Ga0496100_0254618_224_919 | 230 |
| 491 | 3300048903 | Ga0496100_0290121 | Ga0496100_0290121_370_1068 | 230 |
| 492 | 3300048904 | Ga0496101_0014890 | Ga0496101_0014890_178_873 | 230 |
| 493 | 3300048904 | Ga0496101_0089407 | Ga0496101_0089407_1146_1841 | 230 |
| 494 | 3300048904 | Ga0496101_0091887 | Ga0496101_0091887_333_1031 | 230 |
| 495 | 3300048904 | Ga0496101_0183747 | Ga0496101_0183747_639_1331 | 230 |
| 496 | 3300048905 | Ga0496102_0000123 | Ga0496102_0000123_23000_23698 | 230 |
| 497 | 3300048906 | Ga0496103_0007445 | Ga0496103_0007445_1454_2152 | 230 |
| 498 | 3300048906 | Ga0496103_0090824 | Ga0496103_0090824_1073_1771 | 230 |
| 499 | 3300048906 | Ga0496103_0208336 | Ga0496103_0208336_244_939 | 230 |
| 500 | 3300048907 | Ga0496104_0078788 | Ga0496104_0078788_381_1097 | 230 |
| 501 | 3300048908 | Ga0496105_0428938 | Ga0496105_0428938_25_732 | 230 |
| 502 | 3300048909 | Ga0496106_0001261 | Ga0496106_0001261_4093_4788 | 230 |
| 503 | 3300048909 | Ga0496106_0180973 | Ga0496106_0180973_862_1584 | 230 |
| 504 | 3300048910 | Ga0496107_0041752 | Ga0496107_0041752_2317_3012 | 230 |
| 505 | 3300048910 | Ga0496107_0155078 | Ga0496107_0155078_352_1047 | 230 |
| 506 | 3300048911 | Ga0496108_0001563 | Ga0496108_0001563_9829_10521 | 230 |
| 507 | 3300048912 | Ga0496109_0005834 | Ga0496109_0005834_6119_6811 | 230 |
| 508 | 3300048913 | Ga0496110_0005574 | Ga0496110_0005574_8091_8783 | 230 |
| 509 | 3300048914 | Ga0496111_0027956 | Ga0496111_0027956_639_1331 | 230 |
| 510 | 3300048916 | Ga0496113_0000521 | Ga0496113_0000521_3476_4171 | 230 |
| 511 | 3300048916 | Ga0496113_0041713 | Ga0496113_0041713_1300_1995 | 230 |
| 512 | 3300048918 | Ga0496115_0032597 | Ga0496115_0032597_408_1112 | 230 |
| 513 | 3300048918 | Ga0496115_0546029 | Ga0496115_0546029_158_850 | 230 |
| 514 | 3300048919 | Ga0496116_0026002 | Ga0496116_0026002_2646_3344 | 230 |
| 515 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_141120_141818 | 230 |
| 516 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_470137_470835 | 230 |
| 517 | 3300048924 | Ga0496121_0007116 | Ga0496121_0007116_4894_5592 | 230 |
| 518 | 3300048924 | Ga0496121_0055083 | Ga0496121_0055083_1376_2074 | 230 |
| 519 | 3300048924 | Ga0496121_0067541 | Ga0496121_0067541_611_1309 | 230 |
| 520 | 3300048925 | Ga0496122_0000823 | Ga0496122_0000823_5877_6575 | 230 |
| 521 | 3300048925 | Ga0496122_0005039 | Ga0496122_0005039_3518_4213 | 230 |
| 522 | 3300048925 | Ga0496122_0087568 | Ga0496122_0087568_534_1229 | 230 |
| 523 | 3300048925 | Ga0496122_0115020 | Ga0496122_0115020_891_1586 | 230 |
| 524 | 3300048926 | Ga0496123_0008198 | Ga0496123_0008198_2962_3660 | 230 |
| 525 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_656084_656776 | 230 |
| 526 | 3300048927 | Ga0496124_0017030 | Ga0496124_0017030_161_856 | 230 |
| 527 | 3300048927 | Ga0496124_0067639 | Ga0496124_0067639_406_1101 | 230 |
| 528 | 3300048927 | Ga0496124_0068134 | Ga0496124_0068134_1656_2351 | 230 |
| 529 | 3300048927 | Ga0496124_0158209 | Ga0496124_0158209_978_1676 | 230 |
| 530 | 3300048927 | Ga0496124_0361666 | Ga0496124_0361666_255_953 | 230 |
| 531 | 3300048928 | Ga0496125_0005107 | Ga0496125_0005107_12846_13544 | 230 |
| 532 | 3300048928 | Ga0496125_0116450 | Ga0496125_0116450_27_725 | 230 |
| 533 | 3300049459 | Ga0495678_000085 | Ga0495678_000085_79205_79900 | 230 |
| 534 | 3300049459 | Ga0495678_004605 | Ga0495678_004605_1378_2076 | 230 |
| 535 | 3300049459 | Ga0495678_005506 | Ga0495678_005506_2476_3174 | 230 |
| 536 | 3300049460 | Ga0495682_0002760 | Ga0495682_0002760_3785_4483 | 230 |
| 537 | 3300049571 | Ga0501034_0135959 | Ga0501034_0135959_903_1601 | 230 |
| 538 | 3300049571 | Ga0501034_0408966 | Ga0501034_0408966_87_782 | 230 |
| 539 | 3300049572 | Ga0501036_0093824 | Ga0501036_0093824_793_1488 | 230 |
| 540 | 3300049573 | Ga0501037_0184145 | Ga0501037_0184145_389_1090 | 230 |
| 541 | 3300049580 | Ga0501046_0123782 | Ga0501046_0123782_403_1104 | 230 |
| 542 | 3300049823 | Ga0501044_0011860 | Ga0501044_0011860_7661_8362 | 230 |
| 543 | 3300050489 | nmdc:mga03683_5005_c1 | nmdc:mga03683_5005_c1_1214_1909 | 230 |
| 544 | 3300050491 | nmdc:mga00v17_204328_c1 | nmdc:mga00v17_204328_c1_15_710 | 230 |
| 545 | 3300050493 | nmdc:mga0k408_66736_c1 | nmdc:mga0k408_66736_c1_1253_1948 | 230 |
| 546 | 3300050496 | nmdc:mga07m45_15009_c1 | nmdc:mga07m45_15009_c1_2667_3362 | 230 |
| 547 | 3300050496 | nmdc:mga07m45_5671_c1 | nmdc:mga07m45_5671_c1_1283_1978 | 230 |
| 548 | 3300050496 | nmdc:mga07m45_9499_c1 | nmdc:mga07m45_9499_c1_3493_4188 | 230 |
| 549 | 3300050512 | nmdc:mga0n895_581848_c1 | nmdc:mga0n895_581848_c1_190_888 | 230 |
| 550 | 3300053086 | Ga0500578_0011969 | Ga0500578_0011969_336_1058 | 230 |
| 551 | 3300053088 | Ga0500644_0019026 | Ga0500644_0019026_516_1211 | 230 |
| 552 | 3300053093 | Ga0500651_0160576 | Ga0500651_0160576_592_1287 | 230 |
| 553 | 3300053118 | Ga0500594_0029915 | Ga0500594_0029915_258_950 | 230 |
| 554 | 3300053125 | Ga0500618_000831 | Ga0500618_000831_16109_16807 | 230 |
| 555 | 3300053136 | Ga0500559_0000191 | Ga0500559_0000191_46260_46955 | 230 |
| 556 | 3300053730 | Ga0500645_018772 | Ga0500645_018772_1284_2006 | 230 |
| 557 | 3300053739 | Ga0500587_006140 | Ga0500587_006140_688_1410 | 230 |
| 558 | 3300002705 | JGI25156J39149_1007376 | JGI25156J39149_10073762 | 231 |
| 559 | 3300002738 | JGI25154J39366_1001351 | JGI25154J39366_10013517 | 231 |
| 560 | 3300002738 | JGI25154J39366_1001772 | JGI25154J39366_10017722 | 231 |
| 561 | 3300002739 | JGI25158J39367_1007351 | JGI25158J39367_10073512 | 231 |
| 562 | 3300002773 | JGI25152J39213_1000097 | JGI25152J39213_100009728 | 231 |
| 563 | 3300002774 | JGI25150J39212_1000896 | JGI25150J39212_10008962 | 231 |
| 564 | 3300002774 | JGI25150J39212_1001900 | JGI25150J39212_10019002 | 231 |
| 565 | 3300002987 | JGI25159J45721_1001812 | JGI25159J45721_10018122 | 231 |
| 566 | 3300002987 | JGI25159J45721_1003419 | JGI25159J45721_10034192 | 231 |
| 567 | 3300003187 | JGI25151J46595_10032397 | JGI25151J46595_100323971 | 231 |
| 568 | 3300003215 | JGI25153J46596_10000998 | JGI25153J46596_100009987 | 231 |
| 569 | 3300003320 | rootH2_10186710 | rootH2_101867101 | 231 |
| 570 | 3300003322 | rootL2_10159772 | rootL2_101597723 | 231 |
| 571 | 3300003354 | JGI25160J50197_1008378 | JGI25160J50197_10083784 | 231 |
| 572 | 3300003374 | JGI25161J50226_1000939 | JGI25161J50226_10009397 | 231 |
| 573 | 3300003374 | JGI25161J50226_1003119 | JGI25161J50226_10031192 | 231 |
| 574 | 3300003752 | Ga0055539_1000194 | Ga0055539_10001943 | 231 |
| 575 | 3300003756 | Ga0055533_1001762 | Ga0055533_10017622 | 231 |
| 576 | 3300003758 | Ga0055532_1000139 | Ga0055532_100013934 | 231 |
| 577 | 3300003761 | Ga0055535_1000161 | Ga0055535_100016134 | 231 |
| 578 | 3300003762 | Ga0055542_1000456 | Ga0055542_100045627 | 231 |
| 579 | 3300003763 | Ga0055529_1000327 | Ga0055529_100032733 | 231 |
| 580 | 3300003771 | Ga0055526_1000033 | Ga0055526_10000339 | 231 |
| 581 | 3300003771 | Ga0055526_1002157 | Ga0055526_10021572 | 231 |
| 582 | 3300003771 | Ga0055526_1002208 | Ga0055526_10022088 | 231 |
| 583 | 3300003771 | Ga0055526_1007908 | Ga0055526_10079082 | 231 |
| 584 | 3300003771 | Ga0055526_1009674 | Ga0055526_10096742 | 231 |
| 585 | 3300003771 | Ga0055526_1013407 | Ga0055526_10134072 | 231 |
| 586 | 3300003773 | Ga0055537_1000269 | Ga0055537_10002692 | 231 |
| 587 | 3300003773 | Ga0055537_1002292 | Ga0055537_10022924 | 231 |
| 588 | 3300003775 | Ga0055524_1000027 | Ga0055524_1000027182 | 231 |
| 589 | 3300003775 | Ga0055524_1000436 | Ga0055524_100043616 | 231 |
| 590 | 3300003775 | Ga0055524_1001269 | Ga0055524_10012693 | 231 |
| 591 | 3300003775 | Ga0055524_1001897 | Ga0055524_10018972 | 231 |
| 592 | 3300003775 | Ga0055524_1008891 | Ga0055524_10088914 | 231 |
| 593 | 3300003775 | Ga0055524_1009206 | Ga0055524_10092062 | 231 |
| 594 | 3300003775 | Ga0055524_1023459 | Ga0055524_10234592 | 231 |
| 595 | 3300003781 | Ga0055536_1000102 | Ga0055536_100010250 | 231 |
| 596 | 3300003784 | Ga0055534_1000130 | Ga0055534_100013034 | 231 |
| 597 | 3300003784 | Ga0055534_1000295 | Ga0055534_100029516 | 231 |
| 598 | 3300003784 | Ga0055534_1010144 | Ga0055534_10101442 | 231 |
| 599 | 3300003784 | Ga0055534_1013802 | Ga0055534_10138022 | 231 |
| 600 | 3300003790 | Ga0055528_1000043 | Ga0055528_100004340 | 231 |
| 601 | 3300003790 | Ga0055528_1007637 | Ga0055528_10076372 | 231 |
| 602 | 3300003791 | Ga0055530_10003718 | Ga0055530_100037184 | 231 |
| 603 | 3300003794 | Ga0055531_10000931 | Ga0055531_100009312 | 231 |
| 604 | 3300003841 | Ga0055541_1000494 | Ga0055541_10004944 | 231 |
| 605 | 3300004625 | Ga0055543_1001257 | Ga0055543_10012572 | 231 |
| 606 | 3300005262 | Ga0065165_1029482 | Ga0065165_10294822 | 231 |
| 607 | 3300005262 | Ga0065165_1040669 | Ga0065165_10406693 | 231 |
| 608 | 3300005339 | Ga0070660_100236137 | Ga0070660_1002361372 | 231 |
| 609 | 3300005366 | Ga0070659_100000200 | Ga0070659_10000020013 | 231 |
| 610 | 3300005577 | Ga0068857_100077900 | Ga0068857_1000779002 | 231 |
| 611 | 3300005578 | Ga0068854_100000029 | Ga0068854_10000002987 | 231 |
| 612 | 3300009011 | Ga0105251_10009738 | Ga0105251_100097382 | 231 |
| 613 | 3300015261 | Ga0182006_1000060 | Ga0182006_1000060147 | 231 |
| 614 | 3300015265 | Ga0182005_1000003 | Ga0182005_1000003379 | 231 |
| 615 | 3300020077 | Ga0206351_10147340 | Ga0206351_101473404 | 231 |
| 616 | 3300025208 | Ga0209436_105978 | Ga0209436_1059783 | 231 |
| 617 | 3300025224 | Ga0209784_101294 | Ga0209784_1012942 | 231 |
| 618 | 3300025225 | Ga0209566_100626 | Ga0209566_10062622 | 231 |
| 619 | 3300025226 | Ga0209674_100168 | Ga0209674_10016826 | 231 |
| 620 | 3300025228 | Ga0209672_100252 | Ga0209672_10025211 | 231 |
| 621 | 3300025229 | Ga0209147_100018 | Ga0209147_100018434 | 231 |
| 622 | 3300025230 | Ga0209563_102466 | Ga0209563_1024663 | 231 |
| 623 | 3300025242 | Ga0209258_100028 | Ga0209258_100028434 | 231 |
| 624 | 3300025245 | Ga0207425_1000006 | Ga0207425_1000006274 | 231 |
| 625 | 3300025245 | Ga0207425_1000062 | Ga0207425_1000062125 | 231 |
| 626 | 3300025245 | Ga0207425_1007685 | Ga0207425_10076852 | 231 |
| 627 | 3300025246 | Ga0209646_1000047 | Ga0209646_1000047152 | 231 |
| 628 | 3300025246 | Ga0209646_1000153 | Ga0209646_100015393 | 231 |
| 629 | 3300025253 | Ga0209677_103251 | Ga0209677_1032512 | 231 |
| 630 | 3300025254 | Ga0209148_1000286 | Ga0209148_100028658 | 231 |
| 631 | 3300025256 | Ga0209759_1001494 | Ga0209759_10014948 | 231 |
| 632 | 3300025256 | Ga0209759_1010307 | Ga0209759_10103072 | 231 |
| 633 | 3300025258 | Ga0209129_1000009 | Ga0209129_1000009103 | 231 |
| 634 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006353 | 231 |
| 635 | 3300025263 | Ga0209565_1000106 | Ga0209565_100010617 | 231 |
| 636 | 3300025263 | Ga0209565_1000622 | Ga0209565_10006229 | 231 |
| 637 | 3300025263 | Ga0209565_1000784 | Ga0209565_10007847 | 231 |
| 638 | 3300025263 | Ga0209565_1001080 | Ga0209565_10010805 | 231 |
| 639 | 3300025263 | Ga0209565_1003819 | Ga0209565_10038192 | 231 |
| 640 | 3300025263 | Ga0209565_1007158 | Ga0209565_10071581 | 231 |
| 641 | 3300025272 | Ga0209455_1000051 | Ga0209455_100005190 | 231 |
| 642 | 3300025272 | Ga0209455_1000107 | Ga0209455_1000107134 | 231 |
| 643 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004476 | 231 |
| 644 | 3300025273 | Ga0209673_1004605 | Ga0209673_10046054 | 231 |
| 645 | 3300025284 | Ga0209130_1007249 | Ga0209130_10072494 | 231 |
| 646 | 3300025291 | Ga0209675_1000006 | Ga0209675_1000006352 | 231 |
| 647 | 3300025291 | Ga0209675_1000241 | Ga0209675_100024112 | 231 |
| 648 | 3300025291 | Ga0209675_1000280 | Ga0209675_100028028 | 231 |
| 649 | 3300025291 | Ga0209675_1000441 | Ga0209675_100044111 | 231 |
| 650 | 3300025291 | Ga0209675_1002100 | Ga0209675_10021009 | 231 |
| 651 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036154 | 231 |
| 652 | 3300025294 | Ga0209025_1000770 | Ga0209025_100077013 | 231 |
| 653 | 3300025294 | Ga0209025_1001252 | Ga0209025_100125217 | 231 |
| 654 | 3300025294 | Ga0209025_1001261 | Ga0209025_10012613 | 231 |
| 655 | 3300025294 | Ga0209025_1001612 | Ga0209025_100161225 | 231 |
| 656 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006535 | 231 |
| 657 | 3300025295 | Ga0209564_1000085 | Ga0209564_100008577 | 231 |
| 658 | 3300025295 | Ga0209564_1000146 | Ga0209564_1000146131 | 231 |
| 659 | 3300025295 | Ga0209564_1000693 | Ga0209564_100069312 | 231 |
| 660 | 3300025295 | Ga0209564_1000736 | Ga0209564_100073610 | 231 |
| 661 | 3300025295 | Ga0209564_1001080 | Ga0209564_100108013 | 231 |
| 662 | 3300025295 | Ga0209564_1001087 | Ga0209564_100108717 | 231 |
| 663 | 3300025297 | Ga0209758_1000047 | Ga0209758_100004766 | 231 |
| 664 | 3300025297 | Ga0209758_1005826 | Ga0209758_10058264 | 231 |
| 665 | 3300025298 | Ga0209050_1000064 | Ga0209050_1000064186 | 231 |
| 666 | 3300025298 | Ga0209050_1000171 | Ga0209050_1000171127 | 231 |
| 667 | 3300025298 | Ga0209050_1001144 | Ga0209050_10011445 | 231 |
| 668 | 3300025299 | Ga0209256_1000013 | Ga0209256_1000013231 | 231 |
| 669 | 3300025299 | Ga0209256_1000037 | Ga0209256_1000037320 | 231 |
| 670 | 3300025299 | Ga0209256_1000220 | Ga0209256_100022082 | 231 |
| 671 | 3300025299 | Ga0209256_1000376 | Ga0209256_100037670 | 231 |
| 672 | 3300025299 | Ga0209256_1000507 | Ga0209256_100050730 | 231 |
| 673 | 3300025299 | Ga0209256_1000978 | Ga0209256_10009784 | 231 |
| 674 | 3300025299 | Ga0209256_1001972 | Ga0209256_100197211 | 231 |
| 675 | 3300025299 | Ga0209256_1002523 | Ga0209256_10025238 | 231 |
| 676 | 3300025302 | Ga0207426_1001027 | Ga0207426_10010274 | 231 |
| 677 | 3300025303 | Ga0209051_1011529 | Ga0209051_10115294 | 231 |
| 678 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010546 | 231 |
| 679 | 3300025304 | Ga0209257_1003990 | Ga0209257_10039909 | 231 |
| 680 | 3300025735 | Ga0207713_1052683 | Ga0207713_10526831 | 231 |
| 681 | 3300025913 | Ga0207695_10002200 | Ga0207695_100022002 | 231 |
| 682 | 3300025919 | Ga0207657_10177904 | Ga0207657_101779042 | 231 |
| 683 | 3300025932 | Ga0207690_10000489 | Ga0207690_100004894 | 231 |
| 684 | 3300025981 | Ga0207640_10000029 | Ga0207640_10000029102 | 231 |
| 685 | 3300026116 | Ga0207674_10021101 | Ga0207674_100211013 | 231 |
| 686 | 3300027666 | Ga0209282_1000059 | Ga0209282_100005968 | 231 |
| 687 | 3300028794 | Ga0307515_10059177 | Ga0307515_100591776 | 231 |
| 688 | 3300031548 | Ga0307408_100000971 | Ga0307408_1000009718 | 231 |
| 689 | 3300031548 | Ga0307408_100001592 | Ga0307408_1000015925 | 231 |
| 690 | 3300031548 | Ga0307408_100002803 | Ga0307408_1000028039 | 231 |
| 691 | 3300031548 | Ga0307408_100015171 | Ga0307408_1000151714 | 231 |
| 692 | 3300032005 | Ga0307411_10399946 | Ga0307411_103999461 | 231 |
| 693 | 3300042122 | Ga0450920_014501 | Ga0450920_014501_335_1033 | 231 |
| 694 | 3300044669 | Ga0466981_0197292 | Ga0466981_0197292_83_787 | 231 |
| 695 | 3300044672 | Ga0466982_0093989 | Ga0466982_0093989_262_966 | 231 |
| 696 | 3300044683 | Ga0466965_0008881 | Ga0466965_0008881_2563_3267 | 231 |
| 697 | 3300044765 | Ga0466970_0063247 | Ga0466970_0063247_1217_1921 | 231 |
| 698 | 3300046452 | Ga0495617_000958 | Ga0495617_000958_650_1348 | 231 |
| 699 | 3300046452 | Ga0495617_009619 | Ga0495617_009619_914_1624 | 231 |
| 700 | 3300046453 | Ga0495627_000066 | Ga0495627_000066_26981_27694 | 231 |
| 701 | 3300046457 | Ga0495590_0000036 | Ga0495590_0000036_124575_125279 | 231 |
| 702 | 3300046457 | Ga0495590_0003847 | Ga0495590_0003847_2189_2899 | 231 |
| 703 | 3300046457 | Ga0495590_0016394 | Ga0495590_0016394_427_1137 | 231 |
| 704 | 3300046458 | Ga0495591_016106 | Ga0495591_016106_653_1348 | 231 |
| 705 | 3300046460 | Ga0495638_0000114 | Ga0495638_0000114_124536_125246 | 231 |
| 706 | 3300046460 | Ga0495638_0007780 | Ga0495638_0007780_3980_4690 | 231 |
| 707 | 3300046460 | Ga0495638_0069591 | Ga0495638_0069591_875_1585 | 231 |
| 708 | 3300046460 | Ga0495638_0092638 | Ga0495638_0092638_687_1385 | 231 |
| 709 | 3300046463 | Ga0495653_0000007 | Ga0495653_0000007_247399_248103 | 231 |
| 710 | 3300046471 | Ga0495650_0004754 | Ga0495650_0004754_3783_4490 | 231 |
| 711 | 3300046472 | Ga0495580_0199173 | Ga0495580_0199173_671_1366 | 231 |
| 712 | 3300046474 | Ga0495605_0001878 | Ga0495605_0001878_3701_4396 | 231 |
| 713 | 3300046474 | Ga0495605_0014320 | Ga0495605_0014320_1240_1950 | 231 |
| 714 | 3300046475 | Ga0495639_0040181 | Ga0495639_0040181_829_1536 | 231 |
| 715 | 3300046491 | Ga0495584_0000091 | Ga0495584_0000091_47767_48465 | 231 |
| 716 | 3300046491 | Ga0495584_0000671 | Ga0495584_0000671_18569_19279 | 231 |
| 717 | 3300046491 | Ga0495584_0004221 | Ga0495584_0004221_3073_3783 | 231 |
| 718 | 3300046492 | Ga0495585_0000013 | Ga0495585_0000013_78725_79423 | 231 |
| 719 | 3300046492 | Ga0495585_0000020 | Ga0495585_0000020_101751_102449 | 231 |
| 720 | 3300046492 | Ga0495585_0009049 | Ga0495585_0009049_39_749 | 231 |
| 721 | 3300046492 | Ga0495585_0010267 | Ga0495585_0010267_2010_2708 | 231 |
| 722 | 3300046492 | Ga0495585_0050992 | Ga0495585_0050992_249_959 | 231 |
| 723 | 3300046500 | Ga0495596_0000057 | Ga0495596_0000057_18638_19333 | 231 |
| 724 | 3300046500 | Ga0495596_0003852 | Ga0495596_0003852_3790_4488 | 231 |
| 725 | 3300046501 | Ga0495607_0006744 | Ga0495607_0006744_3799_4509 | 231 |
| 726 | 3300046501 | Ga0495607_0018435 | Ga0495607_0018435_1593_2303 | 231 |
| 727 | 3300046501 | Ga0495607_0023429 | Ga0495607_0023429_554_1264 | 231 |
| 728 | 3300046501 | Ga0495607_0032154 | Ga0495607_0032154_1301_2011 | 231 |
| 729 | 3300046501 | Ga0495607_0033517 | Ga0495607_0033517_2394_3098 | 231 |
| 730 | 3300046501 | Ga0495607_0040386 | Ga0495607_0040386_384_1094 | 231 |
| 731 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_173960_174670 | 231 |
| 732 | 3300046506 | Ga0495583_0000259 | Ga0495583_0000259_64877_65584 | 231 |
| 733 | 3300046506 | Ga0495583_0032703 | Ga0495583_0032703_1309_2019 | 231 |
| 734 | 3300046507 | Ga0495606_0005781 | Ga0495606_0005781_3835_4539 | 231 |
| 735 | 3300046507 | Ga0495606_0007764 | Ga0495606_0007764_5030_5731 | 231 |
| 736 | 3300046507 | Ga0495606_0020403 | Ga0495606_0020403_301_999 | 231 |
| 737 | 3300046507 | Ga0495606_0045426 | Ga0495606_0045426_1348_2058 | 231 |
| 738 | 3300046507 | Ga0495606_0079658 | Ga0495606_0079658_71_772 | 231 |
| 739 | 3300046512 | Ga0495610_0000543 | Ga0495610_0000543_33550_34245 | 231 |
| 740 | 3300046512 | Ga0495610_0002192 | Ga0495610_0002192_14763_15464 | 231 |
| 741 | 3300046513 | Ga0495616_0000571 | Ga0495616_0000571_16970_17665 | 231 |
| 742 | 3300046513 | Ga0495616_0000699 | Ga0495616_0000699_16400_17098 | 231 |
| 743 | 3300046513 | Ga0495616_0001847 | Ga0495616_0001847_7827_8525 | 231 |
| 744 | 3300046513 | Ga0495616_0023733 | Ga0495616_0023733_299_1009 | 231 |
| 745 | 3300046513 | Ga0495616_0025739 | Ga0495616_0025739_154_864 | 231 |
| 746 | 3300046513 | Ga0495616_0062431 | Ga0495616_0062431_689_1399 | 231 |
| 747 | 3300046515 | Ga0495620_0004488 | Ga0495620_0004488_3425_4123 | 231 |
| 748 | 3300046519 | Ga0495632_0008284 | Ga0495632_0008284_3978_4679 | 231 |
| 749 | 3300046522 | Ga0495643_0000646 | Ga0495643_0000646_7090_7791 | 231 |
| 750 | 3300046522 | Ga0495643_0001182 | Ga0495643_0001182_10358_11071 | 231 |
| 751 | 3300046522 | Ga0495643_0163721 | Ga0495643_0163721_383_1078 | 231 |
| 752 | 3300046523 | Ga0495644_0003059 | Ga0495644_0003059_1025_1735 | 231 |
| 753 | 3300046523 | Ga0495644_0003196 | Ga0495644_0003196_4738_5448 | 231 |
| 754 | 3300046523 | Ga0495644_0046666 | Ga0495644_0046666_904_1611 | 231 |
| 755 | 3300046524 | Ga0495648_0000031 | Ga0495648_0000031_134536_135234 | 231 |
| 756 | 3300046524 | Ga0495648_0000035 | Ga0495648_0000035_70427_71134 | 231 |
| 757 | 3300046524 | Ga0495648_0000434 | Ga0495648_0000434_32502_33212 | 231 |
| 758 | 3300046524 | Ga0495648_0175286 | Ga0495648_0175286_300_998 | 231 |
| 759 | 3300046528 | Ga0495642_0009514 | Ga0495642_0009514_53_751 | 231 |
| 760 | 3300046528 | Ga0495642_0065205 | Ga0495642_0065205_782_1492 | 231 |
| 761 | 3300046538 | Ga0495609_0000236 | Ga0495609_0000236_47828_48538 | 231 |
| 762 | 3300046538 | Ga0495609_0000299 | Ga0495609_0000299_942_1652 | 231 |
| 763 | 3300046538 | Ga0495609_0000998 | Ga0495609_0000998_9271_9966 | 231 |
| 764 | 3300046538 | Ga0495609_0004322 | Ga0495609_0004322_4072_4782 | 231 |
| 765 | 3300046538 | Ga0495609_0006936 | Ga0495609_0006936_60_767 | 231 |
| 766 | 3300046538 | Ga0495609_0013126 | Ga0495609_0013126_1509_2207 | 231 |
| 767 | 3300046542 | Ga0495597_0001219 | Ga0495597_0001219_5857_6561 | 231 |
| 768 | 3300046542 | Ga0495597_0001367 | Ga0495597_0001367_12538_13251 | 231 |
| 769 | 3300046542 | Ga0495597_0050712 | Ga0495597_0050712_1008_1709 | 231 |
| 770 | 3300046557 | Ga0495622_0001975 | Ga0495622_0001975_3919_4626 | 231 |
| 771 | 3300046558 | Ga0495633_0000318 | Ga0495633_0000318_51454_52152 | 231 |
| 772 | 3300046558 | Ga0495633_0000452 | Ga0495633_0000452_32695_33399 | 231 |
| 773 | 3300046558 | Ga0495633_0000768 | Ga0495633_0000768_11251_11961 | 231 |
| 774 | 3300046558 | Ga0495633_0002021 | Ga0495633_0002021_470_1180 | 231 |
| 775 | 3300046558 | Ga0495633_0002132 | Ga0495633_0002132_11277_11975 | 231 |
| 776 | 3300046558 | Ga0495633_0008930 | Ga0495633_0008930_1268_1969 | 231 |
| 777 | 3300046558 | Ga0495633_0240725 | Ga0495633_0240725_18_716 | 231 |
| 778 | 3300046615 | Ga0495656_0008855 | Ga0495656_0008855_1164_1859 | 231 |
| 779 | 3300046615 | Ga0495656_0172465 | Ga0495656_0172465_326_1036 | 231 |
| 780 | 3300046616 | Ga0495668_0000008 | Ga0495668_0000008_31809_32519 | 231 |
| 781 | 3300046616 | Ga0495668_0001868 | Ga0495668_0001868_4113_4826 | 231 |
| 782 | 3300046648 | Ga0495611_0002071 | Ga0495611_0002071_4261_4971 | 231 |
| 783 | 3300046648 | Ga0495611_0002306 | Ga0495611_0002306_3632_4342 | 231 |
| 784 | 3300046648 | Ga0495611_0021111 | Ga0495611_0021111_1091_1801 | 231 |
| 785 | 3300046660 | Ga0495625_0000273 | Ga0495625_0000273_30871_31578 | 231 |
| 786 | 3300046660 | Ga0495625_0003587 | Ga0495625_0003587_3199_3909 | 231 |
| 787 | 3300046660 | Ga0495625_0005618 | Ga0495625_0005618_9079_9780 | 231 |
| 788 | 3300046660 | Ga0495625_0009465 | Ga0495625_0009465_5626_6336 | 231 |
| 789 | 3300046660 | Ga0495625_0010111 | Ga0495625_0010111_2406_3107 | 231 |
| 790 | 3300046660 | Ga0495625_0048917 | Ga0495625_0048917_640_1350 | 231 |
| 791 | 3300046664 | Ga0495659_0002617 | Ga0495659_0002617_1703_2413 | 231 |
| 792 | 3300046664 | Ga0495659_0002930 | Ga0495659_0002930_1050_1760 | 231 |
| 793 | 3300046665 | Ga0495661_0018871 | Ga0495661_0018871_2555_3265 | 231 |
| 794 | 3300046665 | Ga0495661_0033199 | Ga0495661_0033199_414_1112 | 231 |
| 795 | 3300046665 | Ga0495661_0043179 | Ga0495661_0043179_1557_2267 | 231 |
| 796 | 3300046665 | Ga0495661_0043573 | Ga0495661_0043573_494_1204 | 231 |
| 797 | 3300046684 | Ga0495669_0001777 | Ga0495669_0001777_917_1627 | 231 |
| 798 | 3300046691 | Ga0495670_0003710 | Ga0495670_0003710_2920_3630 | 231 |
| 799 | 3300046691 | Ga0495670_0004214 | Ga0495670_0004214_3870_4580 | 231 |
| 800 | 3300046691 | Ga0495670_0092118 | Ga0495670_0092118_644_1342 | 231 |
| 801 | 3300046691 | Ga0495670_0114772 | Ga0495670_0114772_202_900 | 231 |
| 802 | 3300046692 | Ga0495671_0007174 | Ga0495671_0007174_5027_5722 | 231 |
| 803 | 3300046692 | Ga0495671_0010964 | Ga0495671_0010964_1240_1950 | 231 |
| 804 | 3300046694 | Ga0495649_0000916 | Ga0495649_0000916_19628_20329 | 231 |
| 805 | 3300046694 | Ga0495649_0053259 | Ga0495649_0053259_622_1332 | 231 |
| 806 | 3300046694 | Ga0495649_0095262 | Ga0495649_0095262_79_780 | 231 |
| 807 | 3300046810 | Ga0495660_0003341 | Ga0495660_0003341_9198_9905 | 231 |
| 808 | 3300046810 | Ga0495660_0009799 | Ga0495660_0009799_1543_2256 | 231 |
| 809 | 3300046810 | Ga0495660_0014725 | Ga0495660_0014725_3016_3717 | 231 |
| 810 | 3300046810 | Ga0495660_0021105 | Ga0495660_0021105_216_914 | 231 |
| 811 | 3300047317 | Ga0495604_0069571 | Ga0495604_0069571_753_1448 | 231 |
| 812 | 3300047318 | Ga0495636_0002072 | Ga0495636_0002072_4026_4736 | 231 |
| 813 | 3300047320 | Ga0495672_0000427 | Ga0495672_0000427_12671_13372 | 231 |
| 814 | 3300047320 | Ga0495672_0013232 | Ga0495672_0013232_1216_1926 | 231 |
| 815 | 3300047320 | Ga0495672_0021836 | Ga0495672_0021836_1307_2017 | 231 |
| 816 | 3300047323 | Ga0495683_0000005 | Ga0495683_0000005_228063_228761 | 231 |
| 817 | 3300047323 | Ga0495683_0007123 | Ga0495683_0007123_896_1606 | 231 |
| 818 | 3300047443 | Ga0495687_000311 | Ga0495687_000311_51358_52068 | 231 |
| 819 | 3300047443 | Ga0495687_000979 | Ga0495687_000979_12695_13408 | 231 |
| 820 | 3300047443 | Ga0495687_001575 | Ga0495687_001575_12669_13382 | 231 |
| 821 | 3300047443 | Ga0495687_010128 | Ga0495687_010128_4045_4746 | 231 |
| 822 | 3300047443 | Ga0495687_017162 | Ga0495687_017162_448_1149 | 231 |
| 823 | 3300047445 | Ga0495677_0004571 | Ga0495677_0004571_1193_1903 | 231 |
| 824 | 3300047445 | Ga0495677_0025204 | Ga0495677_0025204_191_901 | 231 |
| 825 | 3300047445 | Ga0495677_0097059 | Ga0495677_0097059_213_923 | 231 |
| 826 | 3300047447 | Ga0495685_000005 | Ga0495685_000005_43803_44513 | 231 |
| 827 | 3300047447 | Ga0495685_005353 | Ga0495685_005353_2287_2997 | 231 |
| 828 | 3300047469 | Ga0495673_0000027 | Ga0495673_0000027_365123_365824 | 231 |
| 829 | 3300047470 | Ga0495681_0004920 | Ga0495681_0004920_2515_3225 | 231 |
| 830 | 3300047472 | Ga0495686_0046935 | Ga0495686_0046935_1993_2703 | 231 |
| 831 | 3300048091 | Ga0495626_0017784 | Ga0495626_0017784_1279_1977 | 231 |
| 832 | 3300048917 | Ga0496114_0053290 | Ga0496114_0053290_1163_1867 | 231 |
| 833 | 3300048919 | Ga0496116_0017091 | Ga0496116_0017091_3659_4354 | 231 |
| 834 | 3300048924 | Ga0496121_0018751 | Ga0496121_0018751_4005_4700 | 231 |
| 835 | 3300048924 | Ga0496121_0247420 | Ga0496121_0247420_344_1048 | 231 |
| 836 | 3300048925 | Ga0496122_0002002 | Ga0496122_0002002_18958_19653 | 231 |
| 837 | 3300048925 | Ga0496122_0074559 | Ga0496122_0074559_817_1521 | 231 |
| 838 | 3300048926 | Ga0496123_0004103 | Ga0496123_0004103_4245_4940 | 231 |
| 839 | 3300048926 | Ga0496123_0016418 | Ga0496123_0016418_4046_4750 | 231 |
| 840 | 3300048929 | Ga0496126_0248364 | Ga0496126_0248364_39_737 | 231 |
| 841 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_762960_763673 | 231 |
| 842 | 3300049459 | Ga0495678_000803 | Ga0495678_000803_23459_24166 | 231 |
| 843 | 3300049459 | Ga0495678_002759 | Ga0495678_002759_6983_7684 | 231 |
| 844 | 3300049459 | Ga0495678_004468 | Ga0495678_004468_3582_4289 | 231 |
| 845 | 3300049459 | Ga0495678_004946 | Ga0495678_004946_4117_4827 | 231 |
| 846 | 3300049459 | Ga0495678_044473 | Ga0495678_044473_470_1171 | 231 |
| 847 | 3300049459 | Ga0495678_048515 | Ga0495678_048515_768_1478 | 231 |
| 848 | 3300049460 | Ga0495682_0000543 | Ga0495682_0000543_2064_2774 | 231 |
| 849 | 3300049460 | Ga0495682_0000830 | Ga0495682_0000830_11230_11940 | 231 |
| 850 | 3300049460 | Ga0495682_0039303 | Ga0495682_0039303_957_1655 | 231 |
| 851 | 3300049571 | Ga0501034_0000056 | Ga0501034_0000056_108965_109660 | 231 |
| 852 | 3300049571 | Ga0501034_0055622 | Ga0501034_0055622_1475_2170 | 231 |
| 853 | 3300053145 | Ga0500586_002231 | Ga0500586_002231_3587_4288 | 231 |
| 854 | 3300039447 | Ga0436361_0285442 | Ga0436361_0285442_9728_10432 | 232 |
| 855 | 3300046810 | Ga0495660_0002148 | Ga0495660_0002148_3464_4177 | 232 |
| 856 | 3300047472 | Ga0495686_0015955 | Ga0495686_0015955_1121_1834 | 232 |
| 857 | iso_pu_bacteria | 2643221645 | 2644249598 | 232 |
| 858 | iso_pu_bacteria | 2643221664 | 2644359708 | 232 |
| 859 | iso_pu_bacteria | 2738541280 | 2738739185 | 232 |
| 860 | iso_pu_bacteria | 2738541300 | 2738845329 | 232 |
| 861 | iso_pu_bacteria | 2738543018 | 2739274924 | 232 |
| 862 | iso_pu_bacteria | 2738543030 | 2739343968 | 232 |
| 863 | 3300046507 | Ga0495606_0000744 | Ga0495606_0000744_15523_16227 | 233 |
| 864 | 3300046512 | Ga0495610_0014075 | Ga0495610_0014075_3517_4227 | 233 |
| 865 | 3300046512 | Ga0495610_0196324 | Ga0495610_0196324_101_811 | 233 |
| 866 | 3300046616 | Ga0495668_0002805 | Ga0495668_0002805_2598_3302 | 233 |
| 867 | 3300047470 | Ga0495681_0022896 | Ga0495681_0022896_1892_2602 | 233 |
| 868 | 3300047472 | Ga0495686_0018738 | Ga0495686_0018738_3126_3830 | 233 |
| 869 | 3300048919 | Ga0496116_0025790 | Ga0496116_0025790_484_1188 | 233 |
| 870 | 3300003323 | rootH1_10044440 | rootH1_100444402 | 234 |
| 871 | 3300005564 | Ga0070664_100000014 | Ga0070664_10000001437 | 234 |
| 872 | 3300005614 | Ga0068856_100000457 | Ga0068856_1000004578 | 234 |
| 873 | 3300006177 | Ga0075362_10177505 | Ga0075362_101775052 | 234 |
| 874 | 3300009036 | Ga0105244_10009135 | Ga0105244_100091357 | 234 |
| 875 | 3300009093 | Ga0105240_10112192 | Ga0105240_101121922 | 234 |
| 876 | 3300013100 | Ga0157373_10005551 | Ga0157373_1000555110 | 234 |
| 877 | 3300013102 | Ga0157371_10000118 | Ga0157371_1000011886 | 234 |
| 878 | 3300013104 | Ga0157370_10000038 | Ga0157370_1000003894 | 234 |
| 879 | 3300015261 | Ga0182006_1002614 | Ga0182006_10026144 | 234 |
| 880 | 3300015262 | Ga0182007_10008801 | Ga0182007_100088013 | 234 |
| 881 | 3300020070 | Ga0206356_11913180 | Ga0206356_119131802 | 234 |
| 882 | 3300025224 | Ga0209784_100006 | Ga0209784_10000660 | 234 |
| 883 | 3300025224 | Ga0209784_100108 | Ga0209784_10010865 | 234 |
| 884 | 3300025225 | Ga0209566_100002 | Ga0209566_10000260 | 234 |
| 885 | 3300025225 | Ga0209566_101652 | Ga0209566_1016524 | 234 |
| 886 | 3300025226 | Ga0209674_100097 | Ga0209674_10009760 | 234 |
| 887 | 3300025230 | Ga0209563_100136 | Ga0209563_10013624 | 234 |
| 888 | 3300025253 | Ga0209677_100007 | Ga0209677_10000760 | 234 |
| 889 | 3300025256 | Ga0209759_1020001 | Ga0209759_10200011 | 234 |
| 890 | 3300025728 | Ga0207655_1009587 | Ga0207655_10095877 | 234 |
| 891 | 3300025920 | Ga0207649_10000357 | Ga0207649_1000035721 | 234 |
| 892 | 3300025945 | Ga0207679_10000173 | Ga0207679_1000017316 | 234 |
| 893 | 3300026067 | Ga0207678_10000031 | Ga0207678_1000003179 | 234 |
| 894 | 3300026078 | Ga0207702_10000083 | Ga0207702_1000008394 | 234 |
| 895 | 3300030744 | Ga0316181_1070490 | Ga0316181_10704902 | 234 |
| 896 | 3300037418 | Ga0395900_0208472 | Ga0395900_0208472_850_1554 | 234 |
| 897 | 3300044650 | Ga0466986_0181258 | Ga0466986_0181258_382_1086 | 234 |
| 898 | 3300046660 | Ga0495625_0019878 | Ga0495625_0019878_3692_4399 | 234 |
| 899 | 3300048928 | Ga0496125_0031820 | Ga0496125_0031820_2535_3239 | 234 |
| 900 | 3300049679 | Ga0501249_005608 | Ga0501249_005608_1162_1875 | 234 |
| 901 | 3300049766 | Ga0501269_000068 | Ga0501269_000068_14180_14893 | 234 |
| 902 | 3300059643 | Ga0587072_002560 | Ga0587072_002560_932_1636 | 234 |
| 903 | 3300046542 | Ga0495597_0029769 | Ga0495597_0029769_646_1371 | 236 |
| 904 | 3300046660 | Ga0495625_0002365 | Ga0495625_0002365_11409_12131 | 236 |
| 905 | 3300046664 | Ga0495659_0000443 | Ga0495659_0000443_2891_3616 | 236 |
| 906 | 3300046692 | Ga0495671_0000656 | Ga0495671_0000656_23148_23873 | 236 |
| 907 | 3300047320 | Ga0495672_0000447 | Ga0495672_0000447_41999_42724 | 236 |
| 908 | 3300033545 | Ga0316214_1025106 | Ga0316214_10251061 | 238 |
| 909 | 3300046557 | Ga0495622_0079648 | Ga0495622_0079648_762_1481 | 238 |
| 910 | 3300046674 | Ga0495588_0109061 | Ga0495588_0109061_526_1245 | 238 |
| 911 | 3300046689 | Ga0495613_0060045 | Ga0495613_0060045_847_1566 | 238 |
| 912 | 3300047444 | Ga0495675_0056493 | Ga0495675_0056493_1151_1870 | 238 |
| 913 | 3300021361 | Ga0213872_10002323 | Ga0213872_100023232 | 239 |
| 914 | 3300046507 | Ga0495606_0006801 | Ga0495606_0006801_1568_2290 | 239 |
| 915 | 3300046691 | Ga0495670_0045816 | Ga0495670_0045816_1436_2158 | 239 |
| 916 | 3300001979 | JGI24740J21852_10000751 | JGI24740J21852_100007513 | 240 |
| 917 | 3300003756 | Ga0055533_1004958 | Ga0055533_10049581 | 240 |
| 918 | 3300003763 | Ga0055529_1000292 | Ga0055529_100029234 | 240 |
| 919 | 3300003841 | Ga0055541_1002864 | Ga0055541_10028643 | 240 |
| 920 | 3300005337 | Ga0070682_100268943 | Ga0070682_1002689431 | 240 |
| 921 | 3300005344 | Ga0070661_100000302 | Ga0070661_10000030236 | 240 |
| 922 | 3300005455 | Ga0070663_100000026 | Ga0070663_10000002636 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9994 | 17 | 132 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9972 | 17 | 132 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9971 | 17 | 132 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9899 | 15 | 133 |
| 1zh4-assembly1.cif.gz_A | crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe | 0.986 | 15 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 1.003 | 15 | 94 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9944 | 17 | 94 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9903 | 15 | 94 | 3.40.50.2300 |
| 4kfcB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.99 | 143 | 240 | 1.10.10.10 |
| af_Q2FWH6_1_124_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.983 | 14 | 133 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354CML5-F1-model_v4 | DNA-binding response regulator | 0.993 | 16 | 125 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A847D0Q5-F1-model_v4 | Response regulator | 0.9902 | 17 | 126 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A535YC29-F1-model_v4 | Response regulator | 0.9874 | 61 | 129 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1V5JWS4-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9851 | 15 | 139 |
GO:0000155
GO:0005524 GO:0006355 |
| AF-A0A7X9Q292-F1-model_v4 | DNA-binding response regulator | 0.982 | 143 | 239 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar