F485790

General Info

Members Datasets Scaffolds Average Seq Length
922 392 882 231

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10001132|Ga0075370_100011325
Length 232
Sequence MSEPTPTAVIVEDEPQIRRFVRGALEAQQWQVHEAGTVKDGLVEAGTRRPDLVILDLGLPDGDGVDFLRDLRAWSQVPVIVLSARSEEAHKIAALDAGADDYLTKPFGVGELMARVRVAMRRGQRVGAESASSVFTIGDVTVDLAARRVHRAGGVVHLTPIEYRLLGVLIANVGRVLTHRFLLREVWGPAHSERTHYLRIYMGHLRHKLEADAAQPRHIVTETGVGYRLVVD

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221638 Duganella sp. Root336D2 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2643221684 Massilia sp. Root133 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541297 Duganella sp. GV083 Isolate Unclassified
15 2738541300 Massilia sp. GV016 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543018 Massilia sp. GV045 Isolate Unclassified
19 2738543026 Duganella sp. GV089 Isolate Unclassified
20 2738543029 Duganella sp. GV039 Isolate Unclassified
21 2738543030 Massilia sp. GV097 Isolate Unclassified
22 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
23 2821131069 Duganella sp. 1224 Isolate Unclassified
24 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
25 2842711865 Duganella sp. R-73148 Isolate Unclassified
26 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
27 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
28 2857553236 Duganella sp. R-74557 Isolate Unclassified
29 2857558681 Duganella sp. R-74565 Isolate Unclassified
30 2857564685 Duganella sp. R-74599 Isolate Unclassified
31 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
32 2885266251 Ralstonia sp. SET104 Isolate Nodule
33 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
34 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
35 2904424332 Duganella sp. 1411 Isolate Rhizosphere
36 2919476304 Duganella sp. 3397 Isolate Unclassified
37 2928058823 Ralstonia sp. 1138 Isolate Unclassified
38 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
39 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
249 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
252 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
325 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
326 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
327 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
367 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
376 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
381 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
385 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
389 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
392 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 0.33
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.33
Nodule 0.43
Rhizoplane 3.9
Rhizosphere 66.81
Stem 0
Stem Tuber 0
Unclassified 10.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000751 3300001979 Bacteria 14171
2 JGI25156J39149_1007376 3300002705 Bacteria 2897
3 JGI25154J39366_1001351 3300002738 Bacteria 8979
4 JGI25154J39366_1001772 3300002738 Bacteria 6885
5 JGI25158J39367_1007351 3300002739 Bacteria 1557
6 JGI25152J39213_1000097 3300002773 Bacteria 61941
7 JGI25150J39212_1000896 3300002774 Bacteria 9772
8 JGI25150J39212_1001900 3300002774 Bacteria 5487
9 JGI25159J45721_1001812 3300002987 Bacteria 8567
10 JGI25159J45721_1003419 3300002987 Bacteria 5617
11 JGI25159J45721_1003520 3300002987 Bacteria 5518
12 JGI25151J46595_10032397 3300003187 Bacteria 2026
13 JGI25153J46596_10000998 3300003215 Bacteria 17178
14 JGI25153J46596_10002956 3300003215 Bacteria 9623
15 rootH2_10150607 3300003320 Unclassified 2752
16 rootH2_10186710 3300003320 Bacteria 1083
17 rootL2_10159772 3300003322 Bacteria 3182
18 rootH1_10044440 3300003316 Bacteria 8548
19 rootH1_10044440 3300003323 Bacteria 1318
20 JGI25160J50197_1008378 3300003354 Bacteria 3945
21 JGI25161J50226_1000939 3300003374 Bacteria 10419
22 JGI25161J50226_1003119 3300003374 Bacteria 3944
23 Ga0055539_1000194 3300003752 Bacteria 50008
24 Ga0055533_1001762 3300003756 Bacteria 5492
25 Ga0055533_1004958 3300003756 Bacteria 2260
26 Ga0055532_1000139 3300003758 Bacteria 71879
27 Ga0055525_1000006 3300003759 Bacteria 642912
28 Ga0055535_1000161 3300003761 Bacteria 71879
29 Ga0055542_1000456 3300003762 Bacteria 38610
30 Ga0055529_1000292 3300003763 Bacteria 58403
31 Ga0055529_1000327 3300003763 Bacteria 53426
32 Ga0055526_1000033 3300003771 Bacteria 138249
33 Ga0055526_1000059 3300003771 Bacteria 108161
34 Ga0055526_1002157 3300003771 Bacteria 13486
35 Ga0055526_1002208 3300003771 Bacteria 13340
36 Ga0055526_1007908 3300003771 Bacteria 5416
37 Ga0055526_1009674 3300003771 Bacteria 4598
38 Ga0055526_1013407 3300003771 Bacteria 3471
39 Ga0055537_1000269 3300003773 Bacteria 37710
40 Ga0055537_1002292 3300003773 Bacteria 6551
41 Ga0055524_1000027 3300003775 Bacteria 213655
42 Ga0055524_1000436 3300003775 Bacteria 34952
43 Ga0055524_1001269 3300003775 Bacteria 14790
44 Ga0055524_1001897 3300003775 Bacteria 11345
45 Ga0055524_1008891 3300003775 Bacteria 4135
46 Ga0055524_1009206 3300003775 Bacteria 4038
47 Ga0055524_1023459 3300003775 Bacteria 1985
48 Ga0055536_1000102 3300003781 Bacteria 73767
49 Ga0055534_1000130 3300003784 Bacteria 56637
50 Ga0055534_1000295 3300003784 Bacteria 33396
51 Ga0055534_1010144 3300003784 Bacteria 1995
52 Ga0055534_1013802 3300003784 Bacteria 1537
53 Ga0055528_1000043 3300003790 Bacteria 103664
54 Ga0055528_1007637 3300003790 Bacteria 4750
55 Ga0055530_10003718 3300003791 Bacteria 8478
56 Ga0055531_10000931 3300003794 Bacteria 23665
57 Ga0055541_1000494 3300003841 Bacteria 11105
58 Ga0055541_1002864 3300003841 Bacteria 3338
59 Ga0055543_1001257 3300004625 Bacteria 10457
60 Ga0065165_1000187 3300005262 Bacteria 108694
61 Ga0065165_1029482 3300005262 Bacteria 1757
62 Ga0065165_1040669 3300005262 Bacteria 1384
63 Ga0065715_10032259 3300005293 Bacteria 1657
64 Ga0070658_10000986 3300005327 Bacteria 24454
65 Ga0070658_10058384 3300005327 Bacteria 3140
66 Ga0070683_100272987 3300005329 Bacteria 1608
67 Ga0070670_100000714 3300005331 Bacteria 25798
68 Ga0068869_100097122 3300005334 Bacteria 2224
69 Ga0070666_10095115 3300005335 Bacteria 2050
70 Ga0070682_100268943 3300005337 Bacteria 1237
71 Ga0068868_100357659 3300005338 Bacteria 1252
72 Ga0070660_100002378 3300005339 Bacteria 12923
73 Ga0070660_100022884 3300005339 Bacteria 4627
74 Ga0070660_100236137 3300005339 Bacteria 1488
75 Ga0070661_100000302 3300005344 Bacteria 39886
76 Ga0070661_100011637 3300005344 Bacteria 6134
77 Ga0070661_100016547 3300005344 Bacteria 5216
78 Ga0070661_100198603 3300005344 Bacteria 1532
79 Ga0070675_100005300 3300005354 Bacteria 9848
80 Ga0070673_100000557 3300005364 Bacteria 20099
81 Ga0070659_100000200 3300005366 Bacteria 46333
82 Ga0070659_100122185 3300005366 Bacteria 2110
83 Ga0070659_100147883 3300005366 Bacteria 1915
84 Ga0070659_100222196 3300005366 Bacteria 1559
85 Ga0070667_100002040 3300005367 Bacteria 17907
86 Ga0070667_100005411 3300005367 Bacteria 10665
87 Ga0070667_100165375 3300005367 Bacteria 1951
88 Ga0070711_100258523 3300005439 Bacteria 1369
89 Ga0070663_100000026 3300005455 Bacteria 101463
90 Ga0068867_100148691 3300005459 Bacteria 1838
91 Ga0070684_100027798 3300005535 Bacteria 4778
92 Ga0068853_100203935 3300005539 Bacteria 1800
93 Ga0070672_100001308 3300005543 Bacteria 15362
94 Ga0070693_100204218 3300005547 Bacteria 1285
95 Ga0070665_100175145 3300005548 Bacteria 2146
96 Ga0070665_100204690 3300005548 Bacteria 1974
97 Ga0070665_100588938 3300005548 Bacteria 1125
98 Ga0068855_100002749 3300005563 Bacteria 21659
99 Ga0068855_100439695 3300005563 Bacteria 1425
100 Ga0070664_100000014 3300005564 Bacteria 130113
101 Ga0070664_100002979 3300005564 Bacteria 13704
102 Ga0070664_100020752 3300005564 Bacteria 5411
103 Ga0068857_100077900 3300005577 Bacteria 2958
104 Ga0068857_100123803 3300005577 Bacteria 2329
105 Ga0068857_100201451 3300005577 Bacteria 1814
106 Ga0068854_100000029 3300005578 Bacteria 112855
107 Ga0068856_100000457 3300005614 Bacteria 45000
108 Ga0068856_100168159 3300005614 Bacteria 2204
109 Ga0068852_100067996 3300005616 Bacteria 3116
110 Ga0068852_100082273 3300005616 Bacteria 2861
111 Ga0068864_100274391 3300005618 Bacteria 1572
112 Ga0068861_100604300 3300005719 Bacteria 1007
113 Ga0068851_10000887 3300005834 Bacteria 12923
114 Ga0068870_10046662 3300005840 Bacteria 2273
115 Ga0068863_100017665 3300005841 Bacteria 6831
116 Ga0075364_10040905 3300006051 Bacteria 3007
117 Ga0075432_10066154 3300006058 Bacteria 1293
118 Ga0070712_100124882 3300006175 Bacteria 1942
119 Ga0075362_10005052 3300006177 Bacteria 4792
120 Ga0075362_10177505 3300006177 Bacteria 1031
121 Ga0075367_10017487 3300006178 Bacteria 3936
122 Ga0075369_10006743 3300006186 Bacteria 4354
123 Ga0075369_10031725 3300006186 Bacteria 2232
124 Ga0075366_10002145 3300006195 Bacteria 10046
125 Ga0075366_10010210 3300006195 Bacteria 5268
126 Ga0075366_10080806 3300006195 Bacteria 1941
127 Ga0075366_10352122 3300006195 Bacteria 904
128 Ga0097621_100918180 3300006237 Bacteria 816
129 Ga0075370_10000508 3300006353 Bacteria 14806
130 Ga0075370_10001132 3300006353 Bacteria 11187
131 Ga0075370_10004227 3300006353 Bacteria 6939
132 Ga0068871_100018962 3300006358 Bacteria 5243
133 Ga0068871_100064780 3300006358 Bacteria 2992
134 Ga0068871_100424211 3300006358 Bacteria 1188
135 Ga0068865_100226170 3300006881 Bacteria 1465
136 Ga0068865_100877767 3300006881 Bacteria 779
137 Ga0105251_10009738 3300009011 Bacteria 5642
138 Ga0105244_10009135 3300009036 Bacteria 6118
139 Ga0105244_10041193 3300009036 Bacteria 2394
140 Ga0105240_10047825 3300009093 Bacteria 5410
141 Ga0105240_10112192 3300009093 Bacteria 3296
142 Ga0105245_10099266 3300009098 Bacteria 2691
143 Ga0105245_10164434 3300009098 Bacteria 2108
144 Ga0105241_10049406 3300009174 Bacteria 3203
145 Ga0105237_10007631 3300009545 Bacteria 11820
146 Ga0105237_10228514 3300009545 Bacteria 1861
147 Ga0105239_10019901 3300010375 Bacteria 7408
148 Ga0105239_10754154 3300010375 Bacteria 1114
149 Ga0157373_10005551 3300013100 Bacteria 9455
150 Ga0157371_10000014 3300013102 Bacteria 347490
151 Ga0157371_10000118 3300013102 Bacteria 120790
152 Ga0157370_10000038 3300013104 Bacteria 135182
153 Ga0157374_10003550 3300013296 Bacteria 13126
154 Ga0157374_10639946 3300013296 Bacteria 1075
155 Ga0157378_10107400 3300013297 Bacteria 2554
156 Ga0163162_10126328 3300013306 Bacteria 2664
157 Ga0157372_10476134 3300013307 Bacteria 1456
158 Ga0157375_10000644 3300013308 Bacteria 30997
159 Ga0157375_10012497 3300013308 Bacteria 7535
160 Ga0182008_10000881 3300014497 Bacteria 20870
161 Ga0157377_10106715 3300014745 Bacteria 1678
162 Ga0157376_10002947 3300014969 Bacteria 11684
163 Ga0157376_10371188 3300014969 Bacteria 1375
164 Ga0182006_1000046 3300015261 Bacteria 189544
165 Ga0182006_1000060 3300015261 Bacteria 161773
166 Ga0182006_1002614 3300015261 Bacteria 9732
167 Ga0182007_10000148 3300015262 Bacteria 47310
168 Ga0182007_10008801 3300015262 Bacteria 4118
169 Ga0182007_10020018 3300015262 Bacteria 2397
170 Ga0182005_1000003 3300015265 Bacteria 683269
171 Ga0182005_1000032 3300015265 Bacteria 188517
172 Ga0206356_11913180 3300020070 Bacteria 1413
173 Ga0206351_10147340 3300020077 Bacteria 8940
174 Ga0213872_10000135 3300021361 Bacteria 67262
175 Ga0213872_10000938 3300021361 Bacteria 20482
176 Ga0213872_10002323 3300021361 Bacteria 11317
177 Ga0209436_101072 3300025208 Bacteria 10292
178 Ga0209436_105978 3300025208 Bacteria 2721
179 Ga0209436_113673 3300025208 Bacteria 1317
180 Ga0209784_100006 3300025224 Bacteria 930704
181 Ga0209784_100108 3300025224 Bacteria 94409
182 Ga0209784_101294 3300025224 Bacteria 3602
183 Ga0209566_100002 3300025225 Bacteria 2614868
184 Ga0209566_100626 3300025225 Bacteria 21772
185 Ga0209566_101652 3300025225 Bacteria 5713
186 Ga0209674_100097 3300025226 Bacteria 167285
187 Ga0209674_100168 3300025226 Bacteria 84107
188 Ga0209672_100252 3300025228 Bacteria 39846
189 Ga0209147_100018 3300025229 Bacteria 515719
190 Ga0209563_100022 3300025230 Bacteria 643318
191 Ga0209563_100136 3300025230 Bacteria 88047
192 Ga0209563_102466 3300025230 Bacteria 4176
193 Ga0209258_100028 3300025242 Bacteria 515719
194 Ga0207425_1000006 3300025245 Bacteria 808854
195 Ga0207425_1000062 3300025245 Bacteria 136118
196 Ga0207425_1002065 3300025245 Bacteria 7474
197 Ga0207425_1007685 3300025245 Bacteria 2819
198 Ga0209646_1000047 3300025246 Bacteria 323416
199 Ga0209646_1000153 3300025246 Bacteria 96707
200 Ga0209026_1001413 3300025250 Bacteria 10681
201 Ga0209677_100007 3300025253 Bacteria 1021332
202 Ga0209677_103251 3300025253 Bacteria 5410
203 Ga0209677_107158 3300025253 Bacteria 2441
204 Ga0209148_1000286 3300025254 Bacteria 75823
205 Ga0209148_1000466 3300025254 Bacteria 43177
206 Ga0209759_1001494 3300025256 Bacteria 12966
207 Ga0209759_1010307 3300025256 Bacteria 2747
208 Ga0209759_1020001 3300025256 Bacteria 1568
209 Ga0209129_1000009 3300025258 Bacteria 633100
210 Ga0209565_1000006 3300025263 Bacteria 897294
211 Ga0209565_1000106 3300025263 Bacteria 122574
212 Ga0209565_1000622 3300025263 Bacteria 23367
213 Ga0209565_1000784 3300025263 Bacteria 18444
214 Ga0209565_1001080 3300025263 Bacteria 13621
215 Ga0209565_1003819 3300025263 Bacteria 4753
216 Ga0209565_1007158 3300025263 Bacteria 3038
217 Ga0209455_1000051 3300025272 Bacteria 369818
218 Ga0209455_1000107 3300025272 Bacteria 195136
219 Ga0209673_1000004 3300025273 Bacteria 896155
220 Ga0209673_1004605 3300025273 Bacteria 7310
221 Ga0209130_1000191 3300025284 Bacteria 85239
222 Ga0209130_1002139 3300025284 Bacteria 10471
223 Ga0209130_1007249 3300025284 Bacteria 3455
224 Ga0209675_1000006 3300025291 Bacteria 732267
225 Ga0209675_1000241 3300025291 Bacteria 54674
226 Ga0209675_1000280 3300025291 Bacteria 48644
227 Ga0209675_1000441 3300025291 Bacteria 32836
228 Ga0209675_1002100 3300025291 Bacteria 10558
229 Ga0209676_1000036 3300025292 Bacteria 457623
230 Ga0209025_1000770 3300025294 Bacteria 53136
231 Ga0209025_1001252 3300025294 Bacteria 35173
232 Ga0209025_1001261 3300025294 Bacteria 35022
233 Ga0209025_1001612 3300025294 Bacteria 28231
234 Ga0209025_1007179 3300025294 Bacteria 8408
235 Ga0209564_1000006 3300025295 Bacteria 1100927
236 Ga0209564_1000026 3300025295 Bacteria 519154
237 Ga0209564_1000085 3300025295 Bacteria 251509
238 Ga0209564_1000146 3300025295 Bacteria 174811
239 Ga0209564_1000693 3300025295 Bacteria 49337
240 Ga0209564_1000736 3300025295 Bacteria 46496
241 Ga0209564_1001080 3300025295 Bacteria 32728
242 Ga0209564_1001087 3300025295 Bacteria 32500
243 Ga0209564_1022490 3300025295 Bacteria 2227
244 Ga0209758_1000047 3300025297 Bacteria 360971
245 Ga0209758_1000280 3300025297 Bacteria 101103
246 Ga0209758_1000456 3300025297 Bacteria 68269
247 Ga0209758_1005826 3300025297 Bacteria 9207
248 Ga0209050_1000064 3300025298 Bacteria 314803
249 Ga0209050_1000171 3300025298 Bacteria 150524
250 Ga0209050_1001144 3300025298 Bacteria 31864
251 Ga0209256_1000013 3300025299 Bacteria 689442
252 Ga0209256_1000037 3300025299 Bacteria 377661
253 Ga0209256_1000220 3300025299 Bacteria 106021
254 Ga0209256_1000376 3300025299 Bacteria 71561
255 Ga0209256_1000507 3300025299 Bacteria 57359
256 Ga0209256_1000978 3300025299 Bacteria 34333
257 Ga0209256_1001972 3300025299 Bacteria 18495
258 Ga0209256_1002523 3300025299 Bacteria 14707
259 Ga0207426_1001027 3300025302 Bacteria 26714
260 Ga0209051_1011529 3300025303 Bacteria 4356
261 Ga0209257_1000010 3300025304 Bacteria 1158682
262 Ga0209257_1003990 3300025304 Bacteria 11915
263 Ga0207656_10013763 3300025321 Bacteria 3100
264 Ga0207655_1009587 3300025728 Bacteria 5997
265 Ga0207655_1026527 3300025728 Bacteria 2781
266 Ga0207713_1052683 3300025735 Bacteria 1608
267 Ga0207705_10001052 3300025909 Bacteria 22439
268 Ga0207705_10063952 3300025909 Bacteria 2659
269 Ga0207707_10650418 3300025912 Bacteria 888
270 Ga0207695_10002200 3300025913 Bacteria 29366
271 Ga0207663_10135396 3300025916 Bacteria 1709
272 Ga0207657_10012835 3300025919 Bacteria 8243
273 Ga0207657_10031906 3300025919 Bacteria 4765
274 Ga0207657_10114786 3300025919 Bacteria 2220
275 Ga0207657_10177904 3300025919 Bacteria 1721
276 Ga0207649_10000357 3300025920 Bacteria 34223
277 Ga0207652_10768192 3300025921 Bacteria 857
278 Ga0207650_10012314 3300025925 Bacteria 5903
279 Ga0207659_10003223 3300025926 Bacteria 9759
280 Ga0207687_10053028 3300025927 Bacteria 2832
281 Ga0207687_10063400 3300025927 Bacteria 2616
282 Ga0207700_10370810 3300025928 Bacteria 1250
283 Ga0207644_10013773 3300025931 Bacteria 5401
284 Ga0207690_10000489 3300025932 Bacteria 25578
285 Ga0207690_10140150 3300025932 Bacteria 1781
286 Ga0207706_10017201 3300025933 Bacteria 6517
287 Ga0207706_10188538 3300025933 Bacteria 1810
288 Ga0207686_10015922 3300025934 Bacteria 4213
289 Ga0207709_10170044 3300025935 Bacteria 1528
290 Ga0207704_10303190 3300025938 Bacteria 1225
291 Ga0207665_10453497 3300025939 Bacteria 984
292 Ga0207691_10001019 3300025940 Bacteria 27733
293 Ga0207711_10058137 3300025941 Bacteria 3326
294 Ga0207689_10194051 3300025942 Bacteria 1676
295 Ga0207661_10009771 3300025944 Bacteria 6891
296 Ga0207679_10000173 3300025945 Bacteria 53176
297 Ga0207679_10012374 3300025945 Bacteria 5563
298 Ga0207679_10019132 3300025945 Bacteria 4596
299 Ga0207667_10025116 3300025949 Bacteria 6529
300 Ga0207651_10115534 3300025960 Bacteria 2024
301 Ga0207640_10000029 3300025981 Bacteria 130583
302 Ga0207640_10269515 3300025981 Bacteria 1331
303 Ga0207658_10001969 3300025986 Bacteria 15316
304 Ga0207658_10161281 3300025986 Bacteria 1838
305 Ga0207677_10011464 3300026023 Bacteria 5059
306 Ga0207677_10137376 3300026023 Bacteria 1866
307 Ga0207678_10000031 3300026067 Bacteria 112136
308 Ga0207678_10108738 3300026067 Bacteria 2365
309 Ga0207678_10498059 3300026067 Bacteria 1062
310 Ga0207702_10000083 3300026078 Bacteria 106990
311 Ga0207702_10125190 3300026078 Bacteria 2306
312 Ga0207641_10161872 3300026088 Bacteria 2035
313 Ga0207648_10174204 3300026089 Bacteria 1902
314 Ga0207676_10036277 3300026095 Bacteria 3749
315 Ga0207674_10021101 3300026116 Bacteria 7023
316 Ga0207674_10082533 3300026116 Bacteria 3215
317 Ga0207674_10232563 3300026116 Bacteria 1791
318 Ga0207683_10026471 3300026121 Bacteria 5005
319 Ga0207698_10001056 3300026142 Bacteria 16016
320 Ga0207698_10100587 3300026142 Bacteria 2395
321 Ga0209282_1000059 3300027666 Bacteria 97821
322 Ga0207428_10279179 3300027907 Bacteria 1240
323 Ga0265356_1001667 3300028017 Bacteria 3186
324 Ga0268266_10166382 3300028379 Bacteria 1998
325 Ga0268266_10190363 3300028379 Bacteria 1873
326 Ga0268266_10659661 3300028379 Bacteria 1007
327 Ga0307517_10051238 3300028786 Bacteria 4172
328 Ga0307517_10232579 3300028786 Bacteria 1104
329 Ga0307515_10000006 3300028794 Bacteria 725810
330 Ga0307515_10014672 3300028794 Bacteria 14505
331 Ga0307515_10059177 3300028794 Bacteria 5497
332 Ga0307512_10068471 3300030522 Bacteria 2663
333 Ga0316181_1070490 3300030744 Bacteria 2104
334 Ga0265330_10013712 3300031235 Bacteria 3771
335 Ga0265332_10001968 3300031238 Bacteria 10818
336 Ga0265328_10034896 3300031239 Bacteria 1861
337 Ga0265325_10084942 3300031241 Bacteria 1568
338 Ga0265329_10006342 3300031242 Bacteria 4698
339 Ga0265339_10201510 3300031249 Bacteria 981
340 Ga0265331_10002869 3300031250 Bacteria 11395
341 Ga0265327_10010274 3300031251 Bacteria 6600
342 Ga0265316_10112748 3300031344 Bacteria 2058
343 Ga0307513_10252728 3300031456 Bacteria 1558
344 Ga0307513_10300184 3300031456 Bacteria 1373
345 Ga0307509_10001946 3300031507 Bacteria 34096
346 Ga0307509_10008897 3300031507 Bacteria 12664
347 Ga0307509_10380395 3300031507 Bacteria 1125
348 Ga0307408_100000971 3300031548 Bacteria 22238
349 Ga0307408_100001592 3300031548 Bacteria 16755
350 Ga0307408_100002803 3300031548 Bacteria 12100
351 Ga0307408_100015171 3300031548 Bacteria 5127
352 Ga0307408_100018923 3300031548 Bacteria 4630
353 Ga0307508_10000078 3300031616 Bacteria 113416
354 Ga0307514_10047105 3300031649 Bacteria 3367
355 Ga0307514_10060389 3300031649 Bacteria 2892
356 Ga0265314_10009491 3300031711 Bacteria 8207
357 Ga0265314_10042534 3300031711 Bacteria 3239
358 Ga0307516_10002337 3300031730 Bacteria 25506
359 Ga0307516_10097916 3300031730 Bacteria 2752
360 Ga0307411_10399946 3300032005 Bacteria 1135
361 Ga0307510_10045598 3300033180 Bacteria 4728
362 Ga0307510_10045790 3300033180 Bacteria 4714
363 Ga0307510_10062421 3300033180 Bacteria 3808
364 Ga0316214_1025106 3300033545 Bacteria 839
365 Ga0373932_0019508 3300035112 Bacteria 1768
366 Ga0373939_0020997 3300035114 Bacteria 1782
367 Ga0373931_0005484 3300035691 Bacteria 5872
368 Ga0373947_0084799 3300035725 Bacteria 1967
369 Ga0373925_0014858 3300037068 Bacteria 5628
370 Ga0373925_0053989 3300037068 Bacteria 3005
371 Ga0395899_0000012 3300037312 Bacteria 517561
372 Ga0395899_0001637 3300037312 Bacteria 18687
373 Ga0395899_0002583 3300037312 Bacteria 14605
374 Ga0395899_0035864 3300037312 Bacteria 3721
375 Ga0395899_0076822 3300037312 Bacteria 2437
376 Ga0395899_0139160 3300037312 Bacteria 1728
377 Ga0395899_0307763 3300037312 Bacteria 1070
378 Ga0395899_0384818 3300037312 Bacteria 931
379 Ga0395900_0000295 3300037418 Bacteria 75130
380 Ga0395900_0000513 3300037418 Bacteria 54785
381 Ga0395900_0010183 3300037418 Bacteria 9617
382 Ga0395900_0015250 3300037418 Bacteria 7836
383 Ga0395900_0045265 3300037418 Bacteria 4533
384 Ga0395900_0113603 3300037418 Bacteria 2779
385 Ga0395900_0194331 3300037418 Bacteria 2056
386 Ga0395900_0208472 3300037418 Bacteria 1974
387 Ga0395900_0684185 3300037418 Bacteria 960
388 Ga0395900_0737208 3300037418 Bacteria 916
389 Ga0395898_0038131 3300037466 Bacteria 4765
390 Ga0395898_0049928 3300037466 Bacteria 4097
391 Ga0395898_0372790 3300037466 Bacteria 1361
392 Ga0395905_0000236 3300037471 Bacteria 83344
393 Ga0395905_0002685 3300037471 Bacteria 19502
394 Ga0395905_0073482 3300037471 Bacteria 3205
395 Ga0395905_0384556 3300037471 Bacteria 1297
396 Ga0395901_0000019 3300038443 Bacteria 317063
397 Ga0395901_0074228 3300038443 Bacteria 3548
398 Ga0395901_0085620 3300038443 Bacteria 3295
399 Ga0395901_0262199 3300038443 Bacteria 1798
400 Ga0395901_0418460 3300038443 Bacteria 1374
401 Ga0395901_0530895 3300038443 Bacteria 1194
402 Ga0395901_0533925 3300038443 Bacteria 1190
403 Ga0436361_0106962 3300039447 Bacteria 4608
404 Ga0436361_0285442 3300039447 Bacteria 14396
405 Ga0436361_0285806 3300039447 Bacteria 16514
406 Ga0436361_0985114 3300039447 Bacteria 16998
407 Ga0451789_0499112 3300041443 Bacteria 1106
408 Ga0451853_2925066 3300041512 Bacteria 1421
409 Ga0450920_014501 3300042122 Bacteria 1492
410 Ga0466986_0181258 3300044650 Bacteria 1398
411 Ga0466972_0000037 3300044658 Bacteria 137184
412 Ga0466972_0014046 3300044658 Bacteria 4014
413 Ga0466972_0028431 3300044658 Bacteria 2758
414 Ga0466972_0036303 3300044658 Bacteria 2412
415 Ga0466972_0096830 3300044658 Bacteria 1398
416 Ga0466972_0130264 3300044658 Bacteria 1185
417 Ga0466981_0197292 3300044669 Bacteria 1344
418 Ga0466982_0093989 3300044672 Bacteria 1858
419 Ga0466965_0001361 3300044683 Bacteria 9809
420 Ga0466965_0008881 3300044683 Bacteria 4658
421 Ga0466965_0015945 3300044683 Bacteria 3570
422 Ga0466965_0066438 3300044683 Bacteria 1808
423 Ga0466965_0099439 3300044683 Bacteria 1486
424 Ga0466965_0241738 3300044683 Bacteria 966
425 Ga0466966_0008213 3300044684 Bacteria 6918
426 Ga0466966_0025260 3300044684 Bacteria 3881
427 Ga0466966_0078495 3300044684 Bacteria 2058
428 Ga0466966_0137726 3300044684 Bacteria 1492
429 Ga0466961_0107241 3300044693 Bacteria 1758
430 Ga0466964_0004791 3300044706 Bacteria 5002
431 Ga0466964_0046672 3300044706 Bacteria 1766
432 Ga0466964_0067477 3300044706 Bacteria 1504
433 Ga0466968_0062849 3300044735 Bacteria 1604
434 Ga0466968_0065870 3300044735 Bacteria 1568
435 Ga0466968_0084459 3300044735 Bacteria 1399
436 Ga0466970_0063247 3300044765 Bacteria 1984
437 Ga0466957_0199927 3300044842 Bacteria 1312
438 Ga0466959_0007582 3300045049 Bacteria 7627
439 Ga0466959_0022000 3300045049 Bacteria 4709
440 Ga0466959_0087283 3300045049 Bacteria 2244
441 Ga0466959_0134579 3300045049 Bacteria 1750
442 Ga0466958_0281456 3300045836 Bacteria 1066
443 Ga0466967_0023588 3300045976 Bacteria 5045
444 Ga0495617_000056 3300046452 Bacteria 100802
445 Ga0495617_000958 3300046452 Bacteria 13415
446 Ga0495617_002021 3300046452 Bacteria 8449
447 Ga0495617_009619 3300046452 Bacteria 3316
448 Ga0495627_000066 3300046453 Bacteria 130363
449 Ga0495627_003668 3300046453 Bacteria 6665
450 Ga0495592_0006645 3300046454 Bacteria 8621
451 Ga0495590_0000036 3300046457 Bacteria 129241
452 Ga0495590_0001695 3300046457 Bacteria 9365
453 Ga0495590_0003847 3300046457 Bacteria 6109
454 Ga0495590_0016394 3300046457 Bacteria 2676
455 Ga0495590_0036444 3300046457 Bacteria 1716
456 Ga0495591_016106 3300046458 Bacteria 2617
457 Ga0495629_0000138 3300046459 Bacteria 63867
458 Ga0495638_0000114 3300046460 Bacteria 129141
459 Ga0495638_0004088 3300046460 Bacteria 11175
460 Ga0495638_0007780 3300046460 Bacteria 7652
461 Ga0495638_0022649 3300046460 Bacteria 4122
462 Ga0495638_0044277 3300046460 Bacteria 2804
463 Ga0495638_0069591 3300046460 Bacteria 2156
464 Ga0495638_0092638 3300046460 Bacteria 1819
465 Ga0495653_0000007 3300046463 Bacteria 314281
466 Ga0495653_0000446 3300046463 Bacteria 32368
467 Ga0495650_0000105 3300046471 Bacteria 205855
468 Ga0495650_0000200 3300046471 Bacteria 130223
469 Ga0495650_0000232 3300046471 Bacteria 113636
470 Ga0495650_0000798 3300046471 Bacteria 38487
471 Ga0495650_0000884 3300046471 Bacteria 35361
472 Ga0495650_0004754 3300046471 Bacteria 9130
473 Ga0495650_0014209 3300046471 Bacteria 4158
474 Ga0495650_0051735 3300046471 Bacteria 1690
475 Ga0495580_0199173 3300046472 Bacteria 1380
476 Ga0495605_0000015 3300046474 Bacteria 300227
477 Ga0495605_0001878 3300046474 Bacteria 13431
478 Ga0495605_0014320 3300046474 Bacteria 4346
479 Ga0495605_0021135 3300046474 Bacteria 3451
480 Ga0495605_0076232 3300046474 Bacteria 1575
481 Ga0495639_0040181 3300046475 Bacteria 2104
482 Ga0495584_0000091 3300046491 Bacteria 62543
483 Ga0495584_0000096 3300046491 Bacteria 59703
484 Ga0495584_0000671 3300046491 Bacteria 22725
485 Ga0495584_0001943 3300046491 Bacteria 11890
486 Ga0495584_0004221 3300046491 Bacteria 7749
487 Ga0495584_0011694 3300046491 Bacteria 4489
488 Ga0495584_0032085 3300046491 Bacteria 2659
489 Ga0495585_0000013 3300046492 Bacteria 195993
490 Ga0495585_0000020 3300046492 Bacteria 156639
491 Ga0495585_0009049 3300046492 Bacteria 5998
492 Ga0495585_0010267 3300046492 Bacteria 5583
493 Ga0495585_0010579 3300046492 Bacteria 5486
494 Ga0495585_0014219 3300046492 Bacteria 4642
495 Ga0495585_0027868 3300046492 Bacteria 3223
496 Ga0495585_0050992 3300046492 Bacteria 2294
497 Ga0495594_0002295 3300046499 Bacteria 9957
498 Ga0495596_0000057 3300046500 Bacteria 81281
499 Ga0495596_0003852 3300046500 Bacteria 7454
500 Ga0495596_0003958 3300046500 Bacteria 7323
501 Ga0495596_0042333 3300046500 Bacteria 1794
502 Ga0495607_0006744 3300046501 Bacteria 8028
503 Ga0495607_0018435 3300046501 Bacteria 4450
504 Ga0495607_0023429 3300046501 Bacteria 3865
505 Ga0495607_0030736 3300046501 Bacteria 3294
506 Ga0495607_0032154 3300046501 Bacteria 3205
507 Ga0495607_0033517 3300046501 Bacteria 3124
508 Ga0495607_0040386 3300046501 Bacteria 2778
509 Ga0495607_0141054 3300046501 Bacteria 1243
510 Ga0495607_0145278 3300046501 Bacteria 1219
511 Ga0495583_0000004 3300046506 Bacteria 655287
512 Ga0495583_0000259 3300046506 Bacteria 87422
513 Ga0495583_0001378 3300046506 Bacteria 24908
514 Ga0495583_0003588 3300046506 Bacteria 11655
515 Ga0495583_0011994 3300046506 Bacteria 4937
516 Ga0495583_0032703 3300046506 Bacteria 2508
517 Ga0495583_0081953 3300046506 Bacteria 1401
518 Ga0495606_0000007 3300046507 Bacteria 323713
519 Ga0495606_0000744 3300046507 Bacteria 50355
520 Ga0495606_0003167 3300046507 Bacteria 17804
521 Ga0495606_0003736 3300046507 Bacteria 15860
522 Ga0495606_0004504 3300046507 Bacteria 13881
523 Ga0495606_0005781 3300046507 Bacteria 11693
524 Ga0495606_0006801 3300046507 Bacteria 10442
525 Ga0495606_0007748 3300046507 Bacteria 9508
526 Ga0495606_0007764 3300046507 Bacteria 9493
527 Ga0495606_0020403 3300046507 Bacteria 4886
528 Ga0495606_0045426 3300046507 Bacteria 2911
529 Ga0495606_0079658 3300046507 Bacteria 2040
530 Ga0495606_0094656 3300046507 Bacteria 1830
531 Ga0495610_0000004 3300046512 Bacteria 1006135
532 Ga0495610_0000543 3300046512 Bacteria 37709
533 Ga0495610_0002192 3300046512 Bacteria 16557
534 Ga0495610_0014075 3300046512 Bacteria 4720
535 Ga0495610_0044397 3300046512 Bacteria 2206
536 Ga0495610_0196324 3300046512 Bacteria 829
537 Ga0495616_0000571 3300046513 Bacteria 27838
538 Ga0495616_0000699 3300046513 Bacteria 24846
539 Ga0495616_0001847 3300046513 Bacteria 14335
540 Ga0495616_0008520 3300046513 Bacteria 6064
541 Ga0495616_0011013 3300046513 Bacteria 5201
542 Ga0495616_0023733 3300046513 Bacteria 3296
543 Ga0495616_0025739 3300046513 Bacteria 3139
544 Ga0495616_0047339 3300046513 Bacteria 2166
545 Ga0495616_0062431 3300046513 Bacteria 1824
546 Ga0495620_0004488 3300046515 Bacteria 7854
547 Ga0495620_0009360 3300046515 Bacteria 5214
548 Ga0495630_0606405 3300046517 Bacteria 839
549 Ga0495631_0000238 3300046518 Bacteria 37846
550 Ga0495631_0012808 3300046518 Bacteria 4085
551 Ga0495632_0006221 3300046519 Bacteria 7723
552 Ga0495632_0008284 3300046519 Bacteria 6402
553 Ga0495632_0013807 3300046519 Bacteria 4593
554 Ga0495632_0123356 3300046519 Bacteria 1209
555 Ga0495637_0000477 3300046520 Bacteria 29259
556 Ga0495637_0010316 3300046520 Bacteria 4525
557 Ga0495637_0094218 3300046520 Bacteria 1177
558 Ga0495643_0000646 3300046522 Bacteria 41289
559 Ga0495643_0001182 3300046522 Bacteria 25428
560 Ga0495643_0008789 3300046522 Bacteria 6363
561 Ga0495643_0013735 3300046522 Bacteria 4836
562 Ga0495643_0036323 3300046522 Bacteria 2708
563 Ga0495643_0163721 3300046522 Bacteria 1093
564 Ga0495644_0003059 3300046523 Bacteria 6614
565 Ga0495644_0003196 3300046523 Bacteria 6472
566 Ga0495644_0018051 3300046523 Bacteria 2693
567 Ga0495644_0025504 3300046523 Bacteria 2243
568 Ga0495644_0025956 3300046523 Bacteria 2223
569 Ga0495644_0046666 3300046523 Bacteria 1628
570 Ga0495648_0000031 3300046524 Bacteria 213136
571 Ga0495648_0000035 3300046524 Bacteria 196251
572 Ga0495648_0000434 3300046524 Bacteria 45425
573 Ga0495648_0018580 3300046524 Bacteria 4916
574 Ga0495648_0020845 3300046524 Bacteria 4558
575 Ga0495648_0021533 3300046524 Bacteria 4461
576 Ga0495648_0036963 3300046524 Bacteria 3143
577 Ga0495648_0054963 3300046524 Bacteria 2402
578 Ga0495648_0175286 3300046524 Bacteria 1095
579 Ga0495663_0004448 3300046525 Bacteria 3941
580 Ga0495642_0001544 3300046528 Bacteria 10193
581 Ga0495642_0009514 3300046528 Bacteria 3719
582 Ga0495642_0040458 3300046528 Bacteria 1893
583 Ga0495642_0046606 3300046528 Bacteria 1773
584 Ga0495642_0065205 3300046528 Bacteria 1516
585 Ga0495654_0000005 3300046530 Bacteria 491381
586 Ga0495654_0008398 3300046530 Bacteria 5708
587 Ga0495654_0076798 3300046530 Bacteria 1573
588 Ga0495609_0000236 3300046538 Bacteria 52539
589 Ga0495609_0000299 3300046538 Bacteria 45808
590 Ga0495609_0000998 3300046538 Bacteria 20132
591 Ga0495609_0004322 3300046538 Bacteria 7808
592 Ga0495609_0006936 3300046538 Bacteria 5719
593 Ga0495609_0013126 3300046538 Bacteria 3917
594 Ga0495609_0052451 3300046538 Bacteria 1815
595 Ga0495597_0001219 3300046542 Bacteria 19132
596 Ga0495597_0001367 3300046542 Bacteria 17636
597 Ga0495597_0029769 3300046542 Bacteria 2491
598 Ga0495597_0045879 3300046542 Bacteria 1937
599 Ga0495597_0050712 3300046542 Bacteria 1831
600 Ga0495622_0000032 3300046557 Bacteria 125538
601 Ga0495622_0001975 3300046557 Bacteria 10052
602 Ga0495622_0026110 3300046557 Bacteria 2728
603 Ga0495622_0079648 3300046557 Bacteria 1507
604 Ga0495633_0000318 3300046558 Bacteria 54641
605 Ga0495633_0000452 3300046558 Bacteria 42120
606 Ga0495633_0000601 3300046558 Bacteria 34582
607 Ga0495633_0000768 3300046558 Bacteria 28783
608 Ga0495633_0001211 3300046558 Bacteria 20771
609 Ga0495633_0002021 3300046558 Bacteria 14655
610 Ga0495633_0002132 3300046558 Bacteria 14171
611 Ga0495633_0008930 3300046558 Bacteria 5585
612 Ga0495633_0044765 3300046558 Bacteria 2097
613 Ga0495633_0081811 3300046558 Bacteria 1503
614 Ga0495633_0240725 3300046558 Bacteria 826
615 Ga0495656_0004844 3300046615 Bacteria 4630
616 Ga0495656_0008855 3300046615 Bacteria 3611
617 Ga0495656_0036424 3300046615 Bacteria 2027
618 Ga0495656_0172465 3300046615 Bacteria 1058
619 Ga0495668_0000008 3300046616 Bacteria 498364
620 Ga0495668_0001868 3300046616 Bacteria 18872
621 Ga0495668_0002205 3300046616 Bacteria 16584
622 Ga0495668_0002372 3300046616 Bacteria 15661
623 Ga0495668_0002805 3300046616 Bacteria 13872
624 Ga0495668_0006970 3300046616 Bacteria 7307
625 Ga0495668_0013235 3300046616 Bacteria 4875
626 Ga0495668_0060311 3300046616 Bacteria 2093
627 Ga0495611_0000062 3300046648 Bacteria 75510
628 Ga0495611_0000788 3300046648 Bacteria 17620
629 Ga0495611_0002071 3300046648 Bacteria 9437
630 Ga0495611_0002306 3300046648 Bacteria 8825
631 Ga0495611_0011202 3300046648 Bacteria 3801
632 Ga0495611_0020241 3300046648 Bacteria 2863
633 Ga0495611_0021111 3300046648 Bacteria 2810
634 Ga0495611_0084138 3300046648 Bacteria 1466
635 Ga0495611_0144756 3300046648 Bacteria 1109
636 Ga0495625_0000273 3300046660 Bacteria 80579
637 Ga0495625_0002365 3300046660 Bacteria 20532
638 Ga0495625_0003587 3300046660 Bacteria 15281
639 Ga0495625_0005618 3300046660 Bacteria 11370
640 Ga0495625_0009465 3300046660 Bacteria 8151
641 Ga0495625_0010111 3300046660 Bacteria 7838
642 Ga0495625_0016045 3300046660 Bacteria 5905
643 Ga0495625_0019878 3300046660 Bacteria 5197
644 Ga0495625_0048917 3300046660 Bacteria 3041
645 Ga0495625_0123795 3300046660 Bacteria 1757
646 Ga0495625_0203490 3300046660 Bacteria 1305
647 Ga0495659_0000443 3300046664 Bacteria 15555
648 Ga0495659_0002617 3300046664 Bacteria 5805
649 Ga0495659_0002930 3300046664 Bacteria 5477
650 Ga0495659_0060676 3300046664 Bacteria 1396
651 Ga0495659_0159404 3300046664 Bacteria 910
652 Ga0495661_0008592 3300046665 Bacteria 7058
653 Ga0495661_0013327 3300046665 Bacteria 5527
654 Ga0495661_0016689 3300046665 Bacteria 4860
655 Ga0495661_0018871 3300046665 Bacteria 4527
656 Ga0495661_0032406 3300046665 Bacteria 3303
657 Ga0495661_0033199 3300046665 Bacteria 3256
658 Ga0495661_0043179 3300046665 Bacteria 2773
659 Ga0495661_0043573 3300046665 Bacteria 2757
660 Ga0495661_0084498 3300046665 Bacteria 1821
661 Ga0495588_0000139 3300046674 Bacteria 109955
662 Ga0495588_0002696 3300046674 Bacteria 7607
663 Ga0495588_0073564 3300046674 Bacteria 1779
664 Ga0495588_0109061 3300046674 Bacteria 1457
665 Ga0495658_0217309 3300046683 Bacteria 1196
666 Ga0495669_0001777 3300046684 Bacteria 8807
667 Ga0495669_0125437 3300046684 Bacteria 1206
668 Ga0495613_0059416 3300046689 Bacteria 2803
669 Ga0495613_0060045 3300046689 Bacteria 2786
670 Ga0495624_0109666 3300046690 Bacteria 1697
671 Ga0495670_0003710 3300046691 Bacteria 7507
672 Ga0495670_0004214 3300046691 Bacteria 7048
673 Ga0495670_0045816 3300046691 Bacteria 2183
674 Ga0495670_0052415 3300046691 Bacteria 2042
675 Ga0495670_0053230 3300046691 Bacteria 2027
676 Ga0495670_0092118 3300046691 Bacteria 1552
677 Ga0495670_0114772 3300046691 Bacteria 1396
678 Ga0495671_0000381 3300046692 Bacteria 36504
679 Ga0495671_0000656 3300046692 Bacteria 25066
680 Ga0495671_0007174 3300046692 Bacteria 6377
681 Ga0495671_0010964 3300046692 Bacteria 5004
682 Ga0495671_0033300 3300046692 Bacteria 2626
683 Ga0495671_0159712 3300046692 Bacteria 1096
684 Ga0495649_0000114 3300046694 Bacteria 71293
685 Ga0495649_0000916 3300046694 Bacteria 23326
686 Ga0495649_0001774 3300046694 Bacteria 15908
687 Ga0495649_0053259 3300046694 Bacteria 2190
688 Ga0495649_0095262 3300046694 Bacteria 1584
689 Ga0495589_0049438 3300046794 Bacteria 2081
690 Ga0495589_0059654 3300046794 Bacteria 1874
691 Ga0495589_0065397 3300046794 Bacteria 1782
692 Ga0495660_0002148 3300046810 Bacteria 12712
693 Ga0495660_0003341 3300046810 Bacteria 9950
694 Ga0495660_0009799 3300046810 Bacteria 5580
695 Ga0495660_0014670 3300046810 Bacteria 4532
696 Ga0495660_0014725 3300046810 Bacteria 4524
697 Ga0495660_0014754 3300046810 Bacteria 4519
698 Ga0495660_0021105 3300046810 Bacteria 3732
699 Ga0495660_0034140 3300046810 Bacteria 2848
700 Ga0495660_0037790 3300046810 Bacteria 2688
701 Ga0495660_0087656 3300046810 Bacteria 1623
702 Ga0495660_0112115 3300046810 Bacteria 1390
703 Ga0495660_0134290 3300046810 Bacteria 1238
704 Ga0495581_0481980 3300047315 Bacteria 721
705 Ga0495604_0069571 3300047317 Bacteria 2667
706 Ga0495636_0001586 3300047318 Bacteria 8650
707 Ga0495636_0002072 3300047318 Bacteria 7698
708 Ga0495636_0002753 3300047318 Bacteria 6780
709 Ga0495672_0000014 3300047320 Bacteria 505636
710 Ga0495672_0000427 3300047320 Bacteria 50460
711 Ga0495672_0000447 3300047320 Bacteria 49038
712 Ga0495672_0013232 3300047320 Bacteria 5700
713 Ga0495672_0021836 3300047320 Bacteria 4169
714 Ga0495672_0108165 3300047320 Bacteria 1496
715 Ga0495676_0070130 3300047321 Bacteria 2701
716 Ga0495676_0123768 3300047321 Bacteria 1877
717 Ga0495680_0084055 3300047322 Bacteria 2399
718 Ga0495683_0000005 3300047323 Bacteria 287871
719 Ga0495683_0007123 3300047323 Bacteria 6068
720 Ga0495683_0037245 3300047323 Bacteria 2466
721 Ga0495687_000311 3300047443 Bacteria 63605
722 Ga0495687_000685 3300047443 Bacteria 38430
723 Ga0495687_000979 3300047443 Bacteria 28873
724 Ga0495687_001575 3300047443 Bacteria 20711
725 Ga0495687_007257 3300047443 Bacteria 6576
726 Ga0495687_010128 3300047443 Bacteria 5193
727 Ga0495687_017162 3300047443 Bacteria 3620
728 Ga0495687_076515 3300047443 Bacteria 1324
729 Ga0495675_0056493 3300047444 Bacteria 2488
730 Ga0495677_0000360 3300047445 Bacteria 19708
731 Ga0495677_0004571 3300047445 Bacteria 5293
732 Ga0495677_0005565 3300047445 Bacteria 4773
733 Ga0495677_0010118 3300047445 Bacteria 3469
734 Ga0495677_0025204 3300047445 Bacteria 2157
735 Ga0495677_0097059 3300047445 Bacteria 1113
736 Ga0495679_092076 3300047446 Bacteria 849
737 Ga0495685_000005 3300047447 Bacteria 112142
738 Ga0495685_005353 3300047447 Bacteria 4187
739 Ga0495685_014313 3300047447 Bacteria 2695
740 Ga0495673_0000017 3300047469 Bacteria 574970
741 Ga0495673_0000027 3300047469 Bacteria 475440
742 Ga0495673_0000135 3300047469 Bacteria 135338
743 Ga0495673_0002581 3300047469 Bacteria 12605
744 Ga0495681_0003162 3300047470 Bacteria 11527
745 Ga0495681_0004920 3300047470 Bacteria 9022
746 Ga0495681_0022896 3300047470 Bacteria 3332
747 Ga0495686_0001265 3300047472 Bacteria 28641
748 Ga0495686_0005469 3300047472 Bacteria 10011
749 Ga0495686_0009037 3300047472 Bacteria 7231
750 Ga0495686_0015955 3300047472 Bacteria 5106
751 Ga0495686_0018738 3300047472 Bacteria 4637
752 Ga0495686_0046935 3300047472 Bacteria 2728
753 Ga0495686_0157438 3300047472 Bacteria 1329
754 Ga0495593_0060022 3300047673 Bacteria 1991
755 Ga0495626_0002853 3300048091 Bacteria 11536
756 Ga0495626_0012014 3300048091 Bacteria 4557
757 Ga0495626_0017784 3300048091 Bacteria 3584
758 Ga0495626_0103878 3300048091 Bacteria 1236
759 Ga0496100_0007012 3300048903 Bacteria 6182
760 Ga0496100_0083306 3300048903 Bacteria 2165
761 Ga0496100_0254618 3300048903 Bacteria 1300
762 Ga0496100_0290121 3300048903 Bacteria 1222
763 Ga0496101_0014890 3300048904 Bacteria 5234
764 Ga0496101_0089407 3300048904 Bacteria 2289
765 Ga0496101_0091887 3300048904 Bacteria 2259
766 Ga0496101_0171124 3300048904 Bacteria 1670
767 Ga0496101_0183747 3300048904 Bacteria 1611
768 Ga0496102_0000123 3300048905 Bacteria 110781
769 Ga0496102_0300258 3300048905 Bacteria 1513
770 Ga0496102_0376617 3300048905 Bacteria 1336
771 Ga0496103_0007445 3300048906 Bacteria 6526
772 Ga0496103_0090824 3300048906 Bacteria 1927
773 Ga0496103_0208336 3300048906 Bacteria 1257
774 Ga0496104_0078788 3300048907 Bacteria 3140
775 Ga0496104_0130682 3300048907 Bacteria 2412
776 Ga0496105_0254030 3300048908 Bacteria 1423
777 Ga0496105_0428938 3300048908 Bacteria 1046
778 Ga0496106_0001261 3300048909 Bacteria 18959
779 Ga0496106_0180973 3300048909 Bacteria 1673
780 Ga0496107_0041752 3300048910 Bacteria 3294
781 Ga0496107_0155078 3300048910 Bacteria 1695
782 Ga0496108_0001563 3300048911 Bacteria 18128
783 Ga0496109_0005834 3300048912 Bacteria 10324
784 Ga0496110_0005574 3300048913 Bacteria 9884
785 Ga0496111_0027956 3300048914 Bacteria 3995
786 Ga0496113_0000521 3300048916 Bacteria 18985
787 Ga0496113_0041713 3300048916 Bacteria 3388
788 Ga0496114_0053290 3300048917 Bacteria 3372
789 Ga0496115_0007372 3300048918 Bacteria 8094
790 Ga0496115_0032597 3300048918 Bacteria 4110
791 Ga0496115_0546029 3300048918 Bacteria 927
792 Ga0496116_0017091 3300048919 Bacteria 5649
793 Ga0496116_0025790 3300048919 Bacteria 4313
794 Ga0496116_0026002 3300048919 Bacteria 4290
795 Ga0496117_0000010 3300048920 Bacteria 611954
796 Ga0496117_0031375 3300048920 Bacteria 4058
797 Ga0496118_0000009 3300048921 Bacteria 611954
798 Ga0496118_0062519 3300048921 Bacteria 2747
799 Ga0496121_0007116 3300048924 Bacteria 13578
800 Ga0496121_0018751 3300048924 Bacteria 6955
801 Ga0496121_0055083 3300048924 Bacteria 3316
802 Ga0496121_0067541 3300048924 Bacteria 2897
803 Ga0496121_0247420 3300048924 Bacteria 1238
804 Ga0496122_0000823 3300048925 Bacteria 59308
805 Ga0496122_0002002 3300048925 Bacteria 30328
806 Ga0496122_0005039 3300048925 Bacteria 15971
807 Ga0496122_0074559 3300048925 Bacteria 2400
808 Ga0496122_0087568 3300048925 Bacteria 2139
809 Ga0496122_0115020 3300048925 Bacteria 1754
810 Ga0496123_0004103 3300048926 Bacteria 15624
811 Ga0496123_0008198 3300048926 Bacteria 9635
812 Ga0496123_0016418 3300048926 Bacteria 6015
813 Ga0496124_0000004 3300048927 Bacteria 976131
814 Ga0496124_0017030 3300048927 Bacteria 6875
815 Ga0496124_0018696 3300048927 Bacteria 6482
816 Ga0496124_0067639 3300048927 Bacteria 2972
817 Ga0496124_0068134 3300048927 Bacteria 2959
818 Ga0496124_0158209 3300048927 Bacteria 1769
819 Ga0496124_0361666 3300048927 Bacteria 1022
820 Ga0496125_0005107 3300048928 Bacteria 14774
821 Ga0496125_0031820 3300048928 Bacteria 4694
822 Ga0496125_0116450 3300048928 Bacteria 1919
823 Ga0496126_0248364 3300048929 Bacteria 1483
824 Ga0495678_000001 3300049459 Bacteria 1060340
825 Ga0495678_000085 3300049459 Bacteria 117187
826 Ga0495678_000803 3300049459 Bacteria 28133
827 Ga0495678_002759 3300049459 Bacteria 11497
828 Ga0495678_004468 3300049459 Bacteria 8077
829 Ga0495678_004605 3300049459 Bacteria 7922
830 Ga0495678_004946 3300049459 Bacteria 7515
831 Ga0495678_005506 3300049459 Bacteria 6975
832 Ga0495678_044473 3300049459 Bacteria 1756
833 Ga0495678_048515 3300049459 Bacteria 1655
834 Ga0495682_0000543 3300049460 Bacteria 26102
835 Ga0495682_0000830 3300049460 Bacteria 19361
836 Ga0495682_0002760 3300049460 Bacteria 8135
837 Ga0495682_0025835 3300049460 Bacteria 2184
838 Ga0495682_0039303 3300049460 Bacteria 1737
839 Ga0501034_0000056 3300049571 Bacteria 202540
840 Ga0501034_0055622 3300049571 Bacteria 3982
841 Ga0501034_0135959 3300049571 Bacteria 2439
842 Ga0501034_0408966 3300049571 Bacteria 1279
843 Ga0501036_0008220 3300049572 Bacteria 8555
844 Ga0501036_0093824 3300049572 Bacteria 2536
845 Ga0501037_0184145 3300049573 Bacteria 1481
846 Ga0501038_0006548 3300049574 Bacteria 10773
847 Ga0501039_0236393 3300049575 Bacteria 1437
848 Ga0501043_0010564 3300049579 Bacteria 7227
849 Ga0501046_0123782 3300049580 Bacteria 1966
850 Ga0501076_0116964 3300049592 Bacteria 2158
851 Ga0501249_005608 3300049679 Bacteria 2565
852 Ga0501269_000068 3300049766 Bacteria 32230
853 Ga0501035_0033249 3300049822 Bacteria 4690
854 Ga0501035_0204822 3300049822 Bacteria 1690
855 Ga0501044_0000248 3300049823 Bacteria 68598
856 Ga0501044_0011860 3300049823 Bacteria 9442
857 nmdc:mga03683_5005_c1 3300050489 Bacteria 4437
858 nmdc:mga00v17_204328_c1 3300050491 Bacteria 1277
859 nmdc:mga0k408_418881_c1 3300050493 Bacteria 796
860 nmdc:mga0k408_66736_c1 3300050493 Bacteria 2096
861 nmdc:mga0k408_83373_c1 3300050493 Bacteria 1874
862 nmdc:mga07m45_15009_c1 3300050496 Bacteria 4136
863 nmdc:mga07m45_5671_c1 3300050496 Bacteria 6241
864 nmdc:mga07m45_9499_c1 3300050496 Bacteria 5048
865 nmdc:mga0n895_581848_c1 3300050512 Bacteria 1123
866 Ga0500578_0011969 3300053086 Bacteria 5603
867 Ga0500644_0019026 3300053088 Bacteria 2021
868 Ga0500651_0160576 3300053093 Bacteria 1344
869 Ga0500594_0029915 3300053118 Bacteria 1427
870 Ga0500594_0053295 3300053118 Bacteria 1145
871 Ga0500618_000831 3300053125 Bacteria 16848
872 Ga0500628_009031 3300053129 Bacteria 1747
873 Ga0500652_095776 3300053131 Bacteria 1239
874 Ga0500559_0000191 3300053136 Bacteria 49243
875 Ga0500568_0046440 3300053139 Bacteria 1723
876 Ga0500586_002231 3300053145 Bacteria 4309
877 Ga0500604_0005271 3300053151 Bacteria 3419
878 Ga0500622_0000080 3300053156 Bacteria 102519
879 Ga0500645_018772 3300053730 Bacteria 2155
880 Ga0500587_006140 3300053739 Bacteria 1603
881 Ga0587072_002560 3300059643 Bacteria 2449
882 Ga0501082_0363499 3300060353 Bacteria 1262

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025981 Ga0207640_10269515 Ga0207640_102695152 195
2 3300038443 Ga0395901_0262199 Ga0395901_0262199_1185_1787 199
3 3300046517 Ga0495630_0606405 Ga0495630_0606405_224_826 199
4 3300047315 Ga0495581_0481980 Ga0495581_0481980_103_705 199
5 3300046459 Ga0495629_0000138 Ga0495629_0000138_21116_21727 201
6 3300046460 Ga0495638_0004088 Ga0495638_0004088_9502_10113 201
7 3300046463 Ga0495653_0000446 Ga0495653_0000446_1162_1773 201
8 3300046506 Ga0495583_0003588 Ga0495583_0003588_543_1154 201
9 3300046515 Ga0495620_0009360 Ga0495620_0009360_1370_1981 201
10 3300046648 Ga0495611_0020241 Ga0495611_0020241_430_1041 201
11 3300046665 Ga0495661_0016689 Ga0495661_0016689_139_747 201
12 3300046689 Ga0495613_0059416 Ga0495613_0059416_1232_1843 201
13 3300046690 Ga0495624_0109666 Ga0495624_0109666_1069_1680 201
14 3300047673 Ga0495593_0060022 Ga0495593_0060022_994_1605 201
15 3300048920 Ga0496117_0031375 Ga0496117_0031375_1091_1702 201
16 3300048921 Ga0496118_0062519 Ga0496118_0062519_58_669 201
17 3300048905 Ga0496102_0300258 Ga0496102_0300258_594_1220 207
18 3300037418 Ga0395900_0684185 Ga0395900_0684185_10_645 208
19 3300049822 Ga0501035_0033249 Ga0501035_0033249_1705_2340 208
20 3300013297 Ga0157378_10107400 Ga0157378_101074002 209
21 3300006195 Ga0075366_10352122 Ga0075366_103521222 210
22 3300025921 Ga0207652_10768192 Ga0207652_107681922 210
23 3300050493 nmdc:mga0k408_418881_c1 nmdc:mga0k408_418881_c1_76_771 210
24 3300053118 Ga0500594_0053295 Ga0500594_0053295_10_645 210
25 3300046519 Ga0495632_0006221 Ga0495632_0006221_448_1143 211
26 3300031730 Ga0307516_10002337 Ga0307516_1000233710 213
27 3300006195 Ga0075366_10002145 Ga0075366_100021458 216
28 3300009174 Ga0105241_10049406 Ga0105241_100494062 216
29 3300041443 Ga0451789_0499112 Ga0451789_0499112_261_956 216
30 3300046460 Ga0495638_0022649 Ga0495638_0022649_935_1630 216
31 3300050493 nmdc:mga0k408_83373_c1 nmdc:mga0k408_83373_c1_196_891 216
32 3300053129 Ga0500628_009031 Ga0500628_009031_308_1003 216
33 3300053131 Ga0500652_095776 Ga0500652_095776_530_1225 216
34 3300053139 Ga0500568_0046440 Ga0500568_0046440_311_1006 216
35 3300053151 Ga0500604_0005271 Ga0500604_0005271_643_1338 216
36 3300053156 Ga0500622_0000080 Ga0500622_0000080_63675_64370 216
37 3300014969 Ga0157376_10371188 Ga0157376_103711881 220
38 3300046457 Ga0495590_0036444 Ga0495590_0036444_24_719 220
39 3300046519 Ga0495632_0013807 Ga0495632_0013807_3747_4442 220
40 3300046694 Ga0495649_0001774 Ga0495649_0001774_1683_2378 220
41 3300046810 Ga0495660_0034140 Ga0495660_0034140_1204_1899 220
42 3300047443 Ga0495687_007257 Ga0495687_007257_4149_4844 220
43 3300048904 Ga0496101_0171124 Ga0496101_0171124_258_935 220
44 3300049460 Ga0495682_0025835 Ga0495682_0025835_194_889 220
45 3300037312 Ga0395899_0000012 Ga0395899_0000012_84683_85375 221
46 3300047320 Ga0495672_0000014 Ga0495672_0000014_488731_489402 222
47 3300048918 Ga0496115_0007372 Ga0496115_0007372_741_1412 222
48 3300028786 Ga0307517_10232579 Ga0307517_102325791 223
49 3300046453 Ga0495627_003668 Ga0495627_003668_1711_2391 225
50 3300046492 Ga0495585_0010579 Ga0495585_0010579_3627_4307 225
51 3300046501 Ga0495607_0141054 Ga0495607_0141054_149_829 225
52 3300046523 Ga0495644_0018051 Ga0495644_0018051_61_741 225
53 3300046525 Ga0495663_0004448 Ga0495663_0004448_967_1647 225
54 3300046542 Ga0495597_0045879 Ga0495597_0045879_233_913 225
55 3300046615 Ga0495656_0004844 Ga0495656_0004844_979_1659 225
56 3300046616 Ga0495668_0002205 Ga0495668_0002205_10237_10917 225
57 3300046648 Ga0495611_0011202 Ga0495611_0011202_1110_1790 225
58 3300046660 Ga0495625_0123795 Ga0495625_0123795_78_758 225
59 3300046684 Ga0495669_0125437 Ga0495669_0125437_383_1063 225
60 3300046691 Ga0495670_0052415 Ga0495670_0052415_905_1585 225
61 3300046692 Ga0495671_0033300 Ga0495671_0033300_1106_1786 225
62 3300046794 Ga0495589_0059654 Ga0495589_0059654_247_927 225
63 3300047445 Ga0495677_0005565 Ga0495677_0005565_661_1341 225
64 3300047470 Ga0495681_0003162 Ga0495681_0003162_3084_3764 225
65 3300006177 Ga0075362_10005052 Ga0075362_100050527 226
66 3300006178 Ga0075367_10017487 Ga0075367_100174877 226
67 3300006186 Ga0075369_10006743 Ga0075369_100067433 226
68 3300006195 Ga0075366_10080806 Ga0075366_100808062 226
69 3300006353 Ga0075370_10004227 Ga0075370_100042272 226
70 3300046528 Ga0495642_0040458 Ga0495642_0040458_1031_1714 226
71 3300049572 Ga0501036_0008220 Ga0501036_0008220_4748_5437 226
72 3300049574 Ga0501038_0006548 Ga0501038_0006548_3147_3836 226
73 3300049579 Ga0501043_0010564 Ga0501043_0010564_3958_4647 226
74 3300049822 Ga0501035_0204822 Ga0501035_0204822_666_1355 226
75 3300049823 Ga0501044_0000248 Ga0501044_0000248_26272_26961 226
76 iso_pu_bacteria 2585428057 2587726655 226
77 iso_pu_bacteria 2588253510 2588290883 226
78 iso_pu_bacteria 2600255292 2601670497 226
79 iso_pu_bacteria 2643221556 2643801534 226
80 iso_pu_bacteria 2643221684 2644471404 226
81 iso_pu_bacteria 2738541297 2738825572 226
82 iso_pu_bacteria 2738541357 2739149369 226
83 iso_pu_bacteria 2738543003 2739191288 226
84 iso_pu_bacteria 2738543026 2739317765 226
85 iso_pu_bacteria 2738543029 2739336006 226
86 iso_pu_bacteria 2739367655 2739612516 226
87 iso_pu_bacteria 2857542790 2857546176 226
88 iso_pu_bacteria 2857547612 2857548160 226
89 iso_pu_bacteria 2857564685 2857565988 226
90 iso_pu_bacteria 2885080285 2885082727 226
91 iso_pu_bacteria 2932410948 2932412753 226
92 iso_pu_bacteria 2932416698 2932420268 226
93 3300048905 Ga0496102_0376617 Ga0496102_0376617_141_830 227
94 iso_pu_bacteria 2513237150 2513953091 227
95 iso_pu_bacteria 2596583598 2597032059 227
96 iso_pu_bacteria 2599185178 2599448351 227
97 iso_pu_bacteria 2643221554 2643788737 227
98 iso_pu_bacteria 2643221638 2644211410 227
99 iso_pu_bacteria 2821131069 2821134175 227
100 iso_pu_bacteria 2834641062 2834641158 227
101 iso_pu_bacteria 2842711865 2842711998 227
102 iso_pu_bacteria 2857553236 2857554766 227
103 iso_pu_bacteria 2857558681 2857559510 227
104 iso_pu_bacteria 2885266251 2885269310 227
105 iso_pu_bacteria 2900577576 2900578749 227
106 iso_pu_bacteria 2901300506 2901305644 227
107 iso_pu_bacteria 2904424332 2904429012 227
108 iso_pu_bacteria 2919476304 2919479153 227
109 iso_pu_bacteria 2928058823 2928060418 227
110 iso_pu_bacteria 644736347 644747294 227
111 iso_pu_bacteria 8003400568 8003403267 227
112 3300005614 Ga0068856_100168159 Ga0068856_1001681593 228
113 3300005616 Ga0068852_100067996 Ga0068852_1000679962 228
114 3300005834 Ga0068851_10000887 Ga0068851_100008872 228
115 3300006358 Ga0068871_100018962 Ga0068871_1000189624 228
116 3300013296 Ga0157374_10639946 Ga0157374_106399462 228
117 3300025939 Ga0207665_10453497 Ga0207665_104534972 228
118 3300026078 Ga0207702_10125190 Ga0207702_101251902 228
119 3300026142 Ga0207698_10100587 Ga0207698_101005872 228
120 3300028794 Ga0307515_10000006 Ga0307515_10000006125 228
121 3300031507 Ga0307509_10380395 Ga0307509_103803951 228
122 3300035725 Ga0373947_0084799 Ga0373947_0084799_87_773 228
123 3300037068 Ga0373925_0053989 Ga0373925_0053989_1347_2033 228
124 3300046471 Ga0495650_0014209 Ga0495650_0014209_1264_1968 228
125 3300046512 Ga0495610_0044397 Ga0495610_0044397_355_1044 228
126 3300048907 Ga0496104_0130682 Ga0496104_0130682_317_1003 228
127 3300048908 Ga0496105_0254030 Ga0496105_0254030_173_859 228
128 3300005719 Ga0068861_100604300 Ga0068861_1006043001 229
129 3300013102 Ga0157371_10000014 Ga0157371_10000014274 229
130 3300015262 Ga0182007_10020018 Ga0182007_100200182 229
131 3300025208 Ga0209436_101072 Ga0209436_1010722 229
132 3300025284 Ga0209130_1002139 Ga0209130_10021392 229
133 3300025295 Ga0209564_1022490 Ga0209564_10224902 229
134 3300028017 Ga0265356_1001667 Ga0265356_10016674 229
135 3300031548 Ga0307408_100018923 Ga0307408_1000189232 229
136 3300048927 Ga0496124_0018696 Ga0496124_0018696_3604_4296 229
137 3300049575 Ga0501039_0236393 Ga0501039_0236393_496_1191 229
138 3300049592 Ga0501076_0116964 Ga0501076_0116964_396_1091 229
139 3300060353 Ga0501082_0363499 Ga0501082_0363499_166_861 229
140 3300002987 JGI25159J45721_1003520 JGI25159J45721_10035202 230
141 3300003215 JGI25153J46596_10002956 JGI25153J46596_100029561 230
142 3300003320 rootH2_10150607 rootH2_101506073 230
143 3300003759 Ga0055525_1000006 Ga0055525_1000006507 230
144 3300003771 Ga0055526_1000059 Ga0055526_100005988 230
145 3300005262 Ga0065165_1000187 Ga0065165_100018791 230
146 3300005293 Ga0065715_10032259 Ga0065715_100322592 230
147 3300005327 Ga0070658_10000986 Ga0070658_100009865 230
148 3300005327 Ga0070658_10058384 Ga0070658_100583842 230
149 3300005329 Ga0070683_100272987 Ga0070683_1002729872 230
150 3300005331 Ga0070670_100000714 Ga0070670_10000071426 230
151 3300005334 Ga0068869_100097122 Ga0068869_1000971221 230
152 3300005335 Ga0070666_10095115 Ga0070666_100951152 230
153 3300005338 Ga0068868_100357659 Ga0068868_1003576592 230
154 3300005339 Ga0070660_100002378 Ga0070660_1000023784 230
155 3300005339 Ga0070660_100022884 Ga0070660_1000228842 230
156 3300005344 Ga0070661_100011637 Ga0070661_1000116376 230
157 3300005344 Ga0070661_100016547 Ga0070661_1000165473 230
158 3300005344 Ga0070661_100198603 Ga0070661_1001986032 230
159 3300005354 Ga0070675_100005300 Ga0070675_10000530010 230
160 3300005364 Ga0070673_100000557 Ga0070673_10000055710 230
161 3300005366 Ga0070659_100122185 Ga0070659_1001221852 230
162 3300005366 Ga0070659_100147883 Ga0070659_1001478832 230
163 3300005366 Ga0070659_100222196 Ga0070659_1002221961 230
164 3300005367 Ga0070667_100002040 Ga0070667_10000204012 230
165 3300005367 Ga0070667_100005411 Ga0070667_10000541112 230
166 3300005367 Ga0070667_100165375 Ga0070667_1001653751 230
167 3300005439 Ga0070711_100258523 Ga0070711_1002585231 230
168 3300005459 Ga0068867_100148691 Ga0068867_1001486912 230
169 3300005535 Ga0070684_100027798 Ga0070684_1000277985 230
170 3300005539 Ga0068853_100203935 Ga0068853_1002039351 230
171 3300005543 Ga0070672_100001308 Ga0070672_1000013082 230
172 3300005547 Ga0070693_100204218 Ga0070693_1002042182 230
173 3300005548 Ga0070665_100175145 Ga0070665_1001751452 230
174 3300005548 Ga0070665_100204690 Ga0070665_1002046904 230
175 3300005548 Ga0070665_100588938 Ga0070665_1005889382 230
176 3300005563 Ga0068855_100002749 Ga0068855_10000274922 230
177 3300005563 Ga0068855_100439695 Ga0068855_1004396952 230
178 3300005564 Ga0070664_100002979 Ga0070664_1000029792 230
179 3300005564 Ga0070664_100020752 Ga0070664_1000207522 230
180 3300005577 Ga0068857_100123803 Ga0068857_1001238035 230
181 3300005577 Ga0068857_100201451 Ga0068857_1002014513 230
182 3300005616 Ga0068852_100082273 Ga0068852_1000822732 230
183 3300005618 Ga0068864_100274391 Ga0068864_1002743912 230
184 3300005840 Ga0068870_10046662 Ga0068870_100466622 230
185 3300005841 Ga0068863_100017665 Ga0068863_1000176658 230
186 3300006051 Ga0075364_10040905 Ga0075364_100409055 230
187 3300006058 Ga0075432_10066154 Ga0075432_100661542 230
188 3300006175 Ga0070712_100124882 Ga0070712_1001248822 230
189 3300006186 Ga0075369_10031725 Ga0075369_100317252 230
190 3300006195 Ga0075366_10010210 Ga0075366_100102107 230
191 3300006237 Ga0097621_100918180 Ga0097621_1009181802 230
192 3300006353 Ga0075370_10000508 Ga0075370_100005085 230
193 3300006353 Ga0075370_10001132 Ga0075370_100011325 230
194 3300006358 Ga0068871_100064780 Ga0068871_1000647802 230
195 3300006358 Ga0068871_100424211 Ga0068871_1004242111 230
196 3300006881 Ga0068865_100226170 Ga0068865_1002261702 230
197 3300006881 Ga0068865_100877767 Ga0068865_1008777671 230
198 3300009036 Ga0105244_10041193 Ga0105244_100411932 230
199 3300009093 Ga0105240_10047825 Ga0105240_100478256 230
200 3300009098 Ga0105245_10099266 Ga0105245_100992661 230
201 3300009098 Ga0105245_10164434 Ga0105245_101644342 230
202 3300009545 Ga0105237_10007631 Ga0105237_100076314 230
203 3300009545 Ga0105237_10228514 Ga0105237_102285142 230
204 3300010375 Ga0105239_10019901 Ga0105239_100199012 230
205 3300010375 Ga0105239_10754154 Ga0105239_107541542 230
206 3300013296 Ga0157374_10003550 Ga0157374_1000355014 230
207 3300013306 Ga0163162_10126328 Ga0163162_101263282 230
208 3300013307 Ga0157372_10476134 Ga0157372_104761342 230
209 3300013308 Ga0157375_10000644 Ga0157375_100006442 230
210 3300013308 Ga0157375_10012497 Ga0157375_100124977 230
211 3300014497 Ga0182008_10000881 Ga0182008_1000088114 230
212 3300014745 Ga0157377_10106715 Ga0157377_101067152 230
213 3300014969 Ga0157376_10002947 Ga0157376_100029472 230
214 3300015261 Ga0182006_1000046 Ga0182006_1000046134 230
215 3300015262 Ga0182007_10000148 Ga0182007_1000014832 230
216 3300015265 Ga0182005_1000032 Ga0182005_1000032134 230
217 3300021361 Ga0213872_10000135 Ga0213872_1000013553 230
218 3300021361 Ga0213872_10000938 Ga0213872_1000093810 230
219 3300025208 Ga0209436_113673 Ga0209436_1136732 230
220 3300025230 Ga0209563_100022 Ga0209563_100022504 230
221 3300025245 Ga0207425_1002065 Ga0207425_10020654 230
222 3300025250 Ga0209026_1001413 Ga0209026_10014134 230
223 3300025253 Ga0209677_107158 Ga0209677_1071582 230
224 3300025254 Ga0209148_1000466 Ga0209148_10004665 230
225 3300025284 Ga0209130_1000191 Ga0209130_100019159 230
226 3300025294 Ga0209025_1007179 Ga0209025_10071792 230
227 3300025295 Ga0209564_1000026 Ga0209564_100002624 230
228 3300025297 Ga0209758_1000280 Ga0209758_100028066 230
229 3300025297 Ga0209758_1000456 Ga0209758_100045616 230
230 3300025321 Ga0207656_10013763 Ga0207656_100137632 230
231 3300025728 Ga0207655_1026527 Ga0207655_10265272 230
232 3300025909 Ga0207705_10001052 Ga0207705_1000105221 230
233 3300025909 Ga0207705_10063952 Ga0207705_100639522 230
234 3300025912 Ga0207707_10650418 Ga0207707_106504181 230
235 3300025916 Ga0207663_10135396 Ga0207663_101353962 230
236 3300025919 Ga0207657_10012835 Ga0207657_100128352 230
237 3300025919 Ga0207657_10031906 Ga0207657_100319063 230
238 3300025919 Ga0207657_10114786 Ga0207657_101147862 230
239 3300025925 Ga0207650_10012314 Ga0207650_100123142 230
240 3300025926 Ga0207659_10003223 Ga0207659_1000322310 230
241 3300025927 Ga0207687_10053028 Ga0207687_100530284 230
242 3300025927 Ga0207687_10063400 Ga0207687_100634002 230
243 3300025928 Ga0207700_10370810 Ga0207700_103708102 230
244 3300025931 Ga0207644_10013773 Ga0207644_100137735 230
245 3300025932 Ga0207690_10140150 Ga0207690_101401502 230
246 3300025933 Ga0207706_10017201 Ga0207706_100172012 230
247 3300025933 Ga0207706_10188538 Ga0207706_101885382 230
248 3300025934 Ga0207686_10015922 Ga0207686_100159222 230
249 3300025935 Ga0207709_10170044 Ga0207709_101700441 230
250 3300025938 Ga0207704_10303190 Ga0207704_103031902 230
251 3300025940 Ga0207691_10001019 Ga0207691_1000101918 230
252 3300025941 Ga0207711_10058137 Ga0207711_100581373 230
253 3300025942 Ga0207689_10194051 Ga0207689_101940512 230
254 3300025944 Ga0207661_10009771 Ga0207661_100097712 230
255 3300025945 Ga0207679_10012374 Ga0207679_100123743 230
256 3300025945 Ga0207679_10019132 Ga0207679_100191321 230
257 3300025949 Ga0207667_10025116 Ga0207667_100251163 230
258 3300025960 Ga0207651_10115534 Ga0207651_101155342 230
259 3300025986 Ga0207658_10001969 Ga0207658_100019695 230
260 3300025986 Ga0207658_10161281 Ga0207658_101612811 230
261 3300026023 Ga0207677_10011464 Ga0207677_100114642 230
262 3300026023 Ga0207677_10137376 Ga0207677_101373763 230
263 3300026067 Ga0207678_10108738 Ga0207678_101087381 230
264 3300026067 Ga0207678_10498059 Ga0207678_104980592 230
265 3300026088 Ga0207641_10161872 Ga0207641_101618722 230
266 3300026089 Ga0207648_10174204 Ga0207648_101742042 230
267 3300026095 Ga0207676_10036277 Ga0207676_100362773 230
268 3300026116 Ga0207674_10082533 Ga0207674_100825334 230
269 3300026116 Ga0207674_10232563 Ga0207674_102325631 230
270 3300026121 Ga0207683_10026471 Ga0207683_100264714 230
271 3300026142 Ga0207698_10001056 Ga0207698_100010567 230
272 3300027907 Ga0207428_10279179 Ga0207428_102791791 230
273 3300028379 Ga0268266_10166382 Ga0268266_101663822 230
274 3300028379 Ga0268266_10190363 Ga0268266_101903632 230
275 3300028379 Ga0268266_10659661 Ga0268266_106596611 230
276 3300028786 Ga0307517_10051238 Ga0307517_100512382 230
277 3300028794 Ga0307515_10014672 Ga0307515_100146724 230
278 3300030522 Ga0307512_10068471 Ga0307512_100684712 230
279 3300031235 Ga0265330_10013712 Ga0265330_100137122 230
280 3300031238 Ga0265332_10001968 Ga0265332_100019682 230
281 3300031239 Ga0265328_10034896 Ga0265328_100348961 230
282 3300031241 Ga0265325_10084942 Ga0265325_100849422 230
283 3300031242 Ga0265329_10006342 Ga0265329_100063422 230
284 3300031249 Ga0265339_10201510 Ga0265339_102015101 230
285 3300031250 Ga0265331_10002869 Ga0265331_100028694 230
286 3300031251 Ga0265327_10010274 Ga0265327_100102744 230
287 3300031344 Ga0265316_10112748 Ga0265316_101127482 230
288 3300031456 Ga0307513_10252728 Ga0307513_102527282 230
289 3300031456 Ga0307513_10300184 Ga0307513_103001842 230
290 3300031507 Ga0307509_10001946 Ga0307509_1000194619 230
291 3300031507 Ga0307509_10008897 Ga0307509_100088974 230
292 3300031616 Ga0307508_10000078 Ga0307508_1000007833 230
293 3300031649 Ga0307514_10047105 Ga0307514_100471052 230
294 3300031649 Ga0307514_10060389 Ga0307514_100603892 230
295 3300031711 Ga0265314_10009491 Ga0265314_100094912 230
296 3300031711 Ga0265314_10042534 Ga0265314_100425342 230
297 3300031730 Ga0307516_10097916 Ga0307516_100979162 230
298 3300033180 Ga0307510_10045598 Ga0307510_100455984 230
299 3300033180 Ga0307510_10045790 Ga0307510_100457902 230
300 3300033180 Ga0307510_10062421 Ga0307510_100624212 230
301 3300035112 Ga0373932_0019508 Ga0373932_0019508_1000_1695 230
302 3300035114 Ga0373939_0020997 Ga0373939_0020997_1069_1764 230
303 3300035691 Ga0373931_0005484 Ga0373931_0005484_2136_2831 230
304 3300037068 Ga0373925_0014858 Ga0373925_0014858_3681_4376 230
305 3300037312 Ga0395899_0001637 Ga0395899_0001637_5307_6008 230
306 3300037312 Ga0395899_0002583 Ga0395899_0002583_6974_7675 230
307 3300037312 Ga0395899_0035864 Ga0395899_0035864_2195_2890 230
308 3300037312 Ga0395899_0076822 Ga0395899_0076822_1475_2170 230
309 3300037312 Ga0395899_0139160 Ga0395899_0139160_390_1085 230
310 3300037312 Ga0395899_0307763 Ga0395899_0307763_19_714 230
311 3300037312 Ga0395899_0384818 Ga0395899_0384818_159_872 230
312 3300037418 Ga0395900_0000295 Ga0395900_0000295_74423_75118 230
313 3300037418 Ga0395900_0000513 Ga0395900_0000513_21421_22116 230
314 3300037418 Ga0395900_0010183 Ga0395900_0010183_8888_9589 230
315 3300037418 Ga0395900_0015250 Ga0395900_0015250_1185_1892 230
316 3300037418 Ga0395900_0045265 Ga0395900_0045265_1908_2621 230
317 3300037418 Ga0395900_0113603 Ga0395900_0113603_332_1027 230
318 3300037418 Ga0395900_0194331 Ga0395900_0194331_1105_1800 230
319 3300037418 Ga0395900_0737208 Ga0395900_0737208_139_840 230
320 3300037466 Ga0395898_0038131 Ga0395898_0038131_2523_3218 230
321 3300037466 Ga0395898_0049928 Ga0395898_0049928_486_1181 230
322 3300037466 Ga0395898_0372790 Ga0395898_0372790_427_1122 230
323 3300037471 Ga0395905_0000236 Ga0395905_0000236_47596_48294 230
324 3300037471 Ga0395905_0002685 Ga0395905_0002685_3315_4013 230
325 3300037471 Ga0395905_0073482 Ga0395905_0073482_598_1305 230
326 3300037471 Ga0395905_0384556 Ga0395905_0384556_183_878 230
327 3300038443 Ga0395901_0000019 Ga0395901_0000019_179798_180493 230
328 3300038443 Ga0395901_0074228 Ga0395901_0074228_1058_1765 230
329 3300038443 Ga0395901_0085620 Ga0395901_0085620_2063_2767 230
330 3300038443 Ga0395901_0418460 Ga0395901_0418460_241_936 230
331 3300038443 Ga0395901_0530895 Ga0395901_0530895_303_998 230
332 3300038443 Ga0395901_0533925 Ga0395901_0533925_444_1145 230
333 3300039447 Ga0436361_0106962 Ga0436361_0106962_349_1047 230
334 3300039447 Ga0436361_0285806 Ga0436361_0285806_5692_6390 230
335 3300039447 Ga0436361_0985114 Ga0436361_0985114_11688_12386 230
336 3300041512 Ga0451853_2925066 Ga0451853_2925066_363_1055 230
337 3300044658 Ga0466972_0000037 Ga0466972_0000037_23438_24151 230
338 3300044658 Ga0466972_0014046 Ga0466972_0014046_1921_2619 230
339 3300044658 Ga0466972_0028431 Ga0466972_0028431_1918_2631 230
340 3300044658 Ga0466972_0036303 Ga0466972_0036303_181_894 230
341 3300044658 Ga0466972_0096830 Ga0466972_0096830_26_721 230
342 3300044658 Ga0466972_0130264 Ga0466972_0130264_445_1149 230
343 3300044683 Ga0466965_0001361 Ga0466965_0001361_5453_6151 230
344 3300044683 Ga0466965_0015945 Ga0466965_0015945_470_1183 230
345 3300044683 Ga0466965_0066438 Ga0466965_0066438_400_1104 230
346 3300044683 Ga0466965_0099439 Ga0466965_0099439_747_1442 230
347 3300044683 Ga0466965_0241738 Ga0466965_0241738_192_887 230
348 3300044684 Ga0466966_0008213 Ga0466966_0008213_1132_1836 230
349 3300044684 Ga0466966_0025260 Ga0466966_0025260_2312_3007 230
350 3300044684 Ga0466966_0078495 Ga0466966_0078495_794_1489 230
351 3300044684 Ga0466966_0137726 Ga0466966_0137726_187_882 230
352 3300044693 Ga0466961_0107241 Ga0466961_0107241_473_1168 230
353 3300044706 Ga0466964_0004791 Ga0466964_0004791_4048_4761 230
354 3300044706 Ga0466964_0046672 Ga0466964_0046672_535_1233 230
355 3300044706 Ga0466964_0067477 Ga0466964_0067477_734_1429 230
356 3300044735 Ga0466968_0062849 Ga0466968_0062849_63_776 230
357 3300044735 Ga0466968_0065870 Ga0466968_0065870_361_1059 230
358 3300044735 Ga0466968_0084459 Ga0466968_0084459_343_1056 230
359 3300044842 Ga0466957_0199927 Ga0466957_0199927_27_722 230
360 3300045049 Ga0466959_0007582 Ga0466959_0007582_3496_4191 230
361 3300045049 Ga0466959_0022000 Ga0466959_0022000_2441_3136 230
362 3300045049 Ga0466959_0087283 Ga0466959_0087283_633_1337 230
363 3300045049 Ga0466959_0134579 Ga0466959_0134579_735_1430 230
364 3300045836 Ga0466958_0281456 Ga0466958_0281456_187_882 230
365 3300045976 Ga0466967_0023588 Ga0466967_0023588_2303_2998 230
366 3300046452 Ga0495617_000056 Ga0495617_000056_65560_66255 230
367 3300046452 Ga0495617_002021 Ga0495617_002021_7683_8378 230
368 3300046454 Ga0495592_0006645 Ga0495592_0006645_1778_2473 230
369 3300046457 Ga0495590_0001695 Ga0495590_0001695_32_727 230
370 3300046460 Ga0495638_0044277 Ga0495638_0044277_2031_2726 230
371 3300046471 Ga0495650_0000105 Ga0495650_0000105_130315_131013 230
372 3300046471 Ga0495650_0000200 Ga0495650_0000200_47394_48092 230
373 3300046471 Ga0495650_0000232 Ga0495650_0000232_9839_10534 230
374 3300046471 Ga0495650_0000798 Ga0495650_0000798_11699_12394 230
375 3300046471 Ga0495650_0000884 Ga0495650_0000884_26283_26978 230
376 3300046471 Ga0495650_0051735 Ga0495650_0051735_299_994 230
377 3300046474 Ga0495605_0000015 Ga0495605_0000015_194777_195472 230
378 3300046474 Ga0495605_0021135 Ga0495605_0021135_1148_1843 230
379 3300046474 Ga0495605_0076232 Ga0495605_0076232_98_793 230
380 3300046491 Ga0495584_0000096 Ga0495584_0000096_13725_14420 230
381 3300046491 Ga0495584_0001943 Ga0495584_0001943_3019_3714 230
382 3300046491 Ga0495584_0011694 Ga0495584_0011694_3207_3902 230
383 3300046491 Ga0495584_0032085 Ga0495584_0032085_1906_2601 230
384 3300046492 Ga0495585_0014219 Ga0495585_0014219_2367_3062 230
385 3300046492 Ga0495585_0027868 Ga0495585_0027868_2018_2713 230
386 3300046499 Ga0495594_0002295 Ga0495594_0002295_9200_9895 230
387 3300046500 Ga0495596_0003958 Ga0495596_0003958_1324_2019 230
388 3300046500 Ga0495596_0042333 Ga0495596_0042333_329_1024 230
389 3300046501 Ga0495607_0030736 Ga0495607_0030736_280_975 230
390 3300046501 Ga0495607_0145278 Ga0495607_0145278_98_793 230
391 3300046506 Ga0495583_0001378 Ga0495583_0001378_20535_21230 230
392 3300046506 Ga0495583_0011994 Ga0495583_0011994_2498_3196 230
393 3300046506 Ga0495583_0081953 Ga0495583_0081953_10_705 230
394 3300046507 Ga0495606_0000007 Ga0495606_0000007_292380_293084 230
395 3300046507 Ga0495606_0003167 Ga0495606_0003167_3669_4367 230
396 3300046507 Ga0495606_0003736 Ga0495606_0003736_2295_2990 230
397 3300046507 Ga0495606_0004504 Ga0495606_0004504_1417_2112 230
398 3300046507 Ga0495606_0007748 Ga0495606_0007748_336_1031 230
399 3300046507 Ga0495606_0094656 Ga0495606_0094656_815_1510 230
400 3300046512 Ga0495610_0000004 Ga0495610_0000004_862161_862856 230
401 3300046513 Ga0495616_0008520 Ga0495616_0008520_1997_2692 230
402 3300046513 Ga0495616_0011013 Ga0495616_0011013_2515_3210 230
403 3300046513 Ga0495616_0047339 Ga0495616_0047339_984_1679 230
404 3300046518 Ga0495631_0000238 Ga0495631_0000238_4013_4708 230
405 3300046518 Ga0495631_0012808 Ga0495631_0012808_275_970 230
406 3300046519 Ga0495632_0123356 Ga0495632_0123356_498_1193 230
407 3300046520 Ga0495637_0000477 Ga0495637_0000477_16354_17049 230
408 3300046520 Ga0495637_0010316 Ga0495637_0010316_1418_2113 230
409 3300046520 Ga0495637_0094218 Ga0495637_0094218_46_744 230
410 3300046522 Ga0495643_0008789 Ga0495643_0008789_1989_2684 230
411 3300046522 Ga0495643_0013735 Ga0495643_0013735_177_872 230
412 3300046522 Ga0495643_0036323 Ga0495643_0036323_1511_2206 230
413 3300046523 Ga0495644_0025504 Ga0495644_0025504_778_1473 230
414 3300046523 Ga0495644_0025956 Ga0495644_0025956_778_1473 230
415 3300046524 Ga0495648_0018580 Ga0495648_0018580_651_1346 230
416 3300046524 Ga0495648_0020845 Ga0495648_0020845_2486_3181 230
417 3300046524 Ga0495648_0021533 Ga0495648_0021533_972_1667 230
418 3300046524 Ga0495648_0036963 Ga0495648_0036963_2382_3077 230
419 3300046524 Ga0495648_0054963 Ga0495648_0054963_640_1335 230
420 3300046528 Ga0495642_0001544 Ga0495642_0001544_2033_2728 230
421 3300046528 Ga0495642_0046606 Ga0495642_0046606_187_882 230
422 3300046530 Ga0495654_0000005 Ga0495654_0000005_425624_426319 230
423 3300046530 Ga0495654_0008398 Ga0495654_0008398_3395_4090 230
424 3300046530 Ga0495654_0076798 Ga0495654_0076798_599_1297 230
425 3300046538 Ga0495609_0052451 Ga0495609_0052451_10_705 230
426 3300046557 Ga0495622_0000032 Ga0495622_0000032_6470_7168 230
427 3300046557 Ga0495622_0026110 Ga0495622_0026110_985_1680 230
428 3300046558 Ga0495633_0000601 Ga0495633_0000601_24269_24964 230
429 3300046558 Ga0495633_0001211 Ga0495633_0001211_16207_16905 230
430 3300046558 Ga0495633_0044765 Ga0495633_0044765_1323_2018 230
431 3300046558 Ga0495633_0081811 Ga0495633_0081811_289_984 230
432 3300046615 Ga0495656_0036424 Ga0495656_0036424_1293_1988 230
433 3300046616 Ga0495668_0002372 Ga0495668_0002372_13405_14100 230
434 3300046616 Ga0495668_0006970 Ga0495668_0006970_4035_4730 230
435 3300046616 Ga0495668_0013235 Ga0495668_0013235_412_1107 230
436 3300046616 Ga0495668_0060311 Ga0495668_0060311_238_933 230
437 3300046648 Ga0495611_0000062 Ga0495611_0000062_33464_34159 230
438 3300046648 Ga0495611_0000788 Ga0495611_0000788_15337_16032 230
439 3300046648 Ga0495611_0084138 Ga0495611_0084138_559_1254 230
440 3300046648 Ga0495611_0144756 Ga0495611_0144756_10_705 230
441 3300046660 Ga0495625_0016045 Ga0495625_0016045_4722_5417 230
442 3300046660 Ga0495625_0203490 Ga0495625_0203490_144_839 230
443 3300046664 Ga0495659_0060676 Ga0495659_0060676_117_815 230
444 3300046664 Ga0495659_0159404 Ga0495659_0159404_33_731 230
445 3300046665 Ga0495661_0008592 Ga0495661_0008592_3425_4120 230
446 3300046665 Ga0495661_0013327 Ga0495661_0013327_2914_3609 230
447 3300046665 Ga0495661_0032406 Ga0495661_0032406_1245_1940 230
448 3300046665 Ga0495661_0084498 Ga0495661_0084498_186_881 230
449 3300046674 Ga0495588_0000139 Ga0495588_0000139_77201_77896 230
450 3300046674 Ga0495588_0002696 Ga0495588_0002696_2217_2912 230
451 3300046674 Ga0495588_0073564 Ga0495588_0073564_559_1266 230
452 3300046683 Ga0495658_0217309 Ga0495658_0217309_117_818 230
453 3300046691 Ga0495670_0053230 Ga0495670_0053230_729_1424 230
454 3300046692 Ga0495671_0000381 Ga0495671_0000381_29417_30112 230
455 3300046692 Ga0495671_0159712 Ga0495671_0159712_222_917 230
456 3300046694 Ga0495649_0000114 Ga0495649_0000114_23848_24543 230
457 3300046794 Ga0495589_0049438 Ga0495589_0049438_968_1663 230
458 3300046794 Ga0495589_0065397 Ga0495589_0065397_511_1206 230
459 3300046810 Ga0495660_0014670 Ga0495660_0014670_2449_3144 230
460 3300046810 Ga0495660_0014754 Ga0495660_0014754_2531_3226 230
461 3300046810 Ga0495660_0037790 Ga0495660_0037790_1569_2264 230
462 3300046810 Ga0495660_0087656 Ga0495660_0087656_59_757 230
463 3300046810 Ga0495660_0112115 Ga0495660_0112115_186_881 230
464 3300046810 Ga0495660_0134290 Ga0495660_0134290_345_1043 230
465 3300047318 Ga0495636_0001586 Ga0495636_0001586_5364_6062 230
466 3300047318 Ga0495636_0002753 Ga0495636_0002753_5526_6224 230
467 3300047320 Ga0495672_0108165 Ga0495672_0108165_620_1315 230
468 3300047321 Ga0495676_0070130 Ga0495676_0070130_1114_1812 230
469 3300047321 Ga0495676_0123768 Ga0495676_0123768_33_728 230
470 3300047322 Ga0495680_0084055 Ga0495680_0084055_237_932 230
471 3300047323 Ga0495683_0037245 Ga0495683_0037245_1513_2208 230
472 3300047443 Ga0495687_000685 Ga0495687_000685_11542_12237 230
473 3300047443 Ga0495687_076515 Ga0495687_076515_138_836 230
474 3300047445 Ga0495677_0000360 Ga0495677_0000360_3458_4153 230
475 3300047445 Ga0495677_0010118 Ga0495677_0010118_29_724 230
476 3300047446 Ga0495679_092076 Ga0495679_092076_45_740 230
477 3300047447 Ga0495685_014313 Ga0495685_014313_784_1479 230
478 3300047469 Ga0495673_0000017 Ga0495673_0000017_545937_546632 230
479 3300047469 Ga0495673_0000135 Ga0495673_0000135_104995_105690 230
480 3300047469 Ga0495673_0002581 Ga0495673_0002581_11389_12084 230
481 3300047472 Ga0495686_0001265 Ga0495686_0001265_3225_3923 230
482 3300047472 Ga0495686_0005469 Ga0495686_0005469_3576_4271 230
483 3300047472 Ga0495686_0009037 Ga0495686_0009037_4734_5429 230
484 3300047472 Ga0495686_0157438 Ga0495686_0157438_494_1216 230
485 3300048091 Ga0495626_0002853 Ga0495626_0002853_370_1065 230
486 3300048091 Ga0495626_0012014 Ga0495626_0012014_150_845 230
487 3300048091 Ga0495626_0103878 Ga0495626_0103878_405_1100 230
488 3300048903 Ga0496100_0007012 Ga0496100_0007012_285_980 230
489 3300048903 Ga0496100_0083306 Ga0496100_0083306_294_986 230
490 3300048903 Ga0496100_0254618 Ga0496100_0254618_224_919 230
491 3300048903 Ga0496100_0290121 Ga0496100_0290121_370_1068 230
492 3300048904 Ga0496101_0014890 Ga0496101_0014890_178_873 230
493 3300048904 Ga0496101_0089407 Ga0496101_0089407_1146_1841 230
494 3300048904 Ga0496101_0091887 Ga0496101_0091887_333_1031 230
495 3300048904 Ga0496101_0183747 Ga0496101_0183747_639_1331 230
496 3300048905 Ga0496102_0000123 Ga0496102_0000123_23000_23698 230
497 3300048906 Ga0496103_0007445 Ga0496103_0007445_1454_2152 230
498 3300048906 Ga0496103_0090824 Ga0496103_0090824_1073_1771 230
499 3300048906 Ga0496103_0208336 Ga0496103_0208336_244_939 230
500 3300048907 Ga0496104_0078788 Ga0496104_0078788_381_1097 230
501 3300048908 Ga0496105_0428938 Ga0496105_0428938_25_732 230
502 3300048909 Ga0496106_0001261 Ga0496106_0001261_4093_4788 230
503 3300048909 Ga0496106_0180973 Ga0496106_0180973_862_1584 230
504 3300048910 Ga0496107_0041752 Ga0496107_0041752_2317_3012 230
505 3300048910 Ga0496107_0155078 Ga0496107_0155078_352_1047 230
506 3300048911 Ga0496108_0001563 Ga0496108_0001563_9829_10521 230
507 3300048912 Ga0496109_0005834 Ga0496109_0005834_6119_6811 230
508 3300048913 Ga0496110_0005574 Ga0496110_0005574_8091_8783 230
509 3300048914 Ga0496111_0027956 Ga0496111_0027956_639_1331 230
510 3300048916 Ga0496113_0000521 Ga0496113_0000521_3476_4171 230
511 3300048916 Ga0496113_0041713 Ga0496113_0041713_1300_1995 230
512 3300048918 Ga0496115_0032597 Ga0496115_0032597_408_1112 230
513 3300048918 Ga0496115_0546029 Ga0496115_0546029_158_850 230
514 3300048919 Ga0496116_0026002 Ga0496116_0026002_2646_3344 230
515 3300048920 Ga0496117_0000010 Ga0496117_0000010_141120_141818 230
516 3300048921 Ga0496118_0000009 Ga0496118_0000009_470137_470835 230
517 3300048924 Ga0496121_0007116 Ga0496121_0007116_4894_5592 230
518 3300048924 Ga0496121_0055083 Ga0496121_0055083_1376_2074 230
519 3300048924 Ga0496121_0067541 Ga0496121_0067541_611_1309 230
520 3300048925 Ga0496122_0000823 Ga0496122_0000823_5877_6575 230
521 3300048925 Ga0496122_0005039 Ga0496122_0005039_3518_4213 230
522 3300048925 Ga0496122_0087568 Ga0496122_0087568_534_1229 230
523 3300048925 Ga0496122_0115020 Ga0496122_0115020_891_1586 230
524 3300048926 Ga0496123_0008198 Ga0496123_0008198_2962_3660 230
525 3300048927 Ga0496124_0000004 Ga0496124_0000004_656084_656776 230
526 3300048927 Ga0496124_0017030 Ga0496124_0017030_161_856 230
527 3300048927 Ga0496124_0067639 Ga0496124_0067639_406_1101 230
528 3300048927 Ga0496124_0068134 Ga0496124_0068134_1656_2351 230
529 3300048927 Ga0496124_0158209 Ga0496124_0158209_978_1676 230
530 3300048927 Ga0496124_0361666 Ga0496124_0361666_255_953 230
531 3300048928 Ga0496125_0005107 Ga0496125_0005107_12846_13544 230
532 3300048928 Ga0496125_0116450 Ga0496125_0116450_27_725 230
533 3300049459 Ga0495678_000085 Ga0495678_000085_79205_79900 230
534 3300049459 Ga0495678_004605 Ga0495678_004605_1378_2076 230
535 3300049459 Ga0495678_005506 Ga0495678_005506_2476_3174 230
536 3300049460 Ga0495682_0002760 Ga0495682_0002760_3785_4483 230
537 3300049571 Ga0501034_0135959 Ga0501034_0135959_903_1601 230
538 3300049571 Ga0501034_0408966 Ga0501034_0408966_87_782 230
539 3300049572 Ga0501036_0093824 Ga0501036_0093824_793_1488 230
540 3300049573 Ga0501037_0184145 Ga0501037_0184145_389_1090 230
541 3300049580 Ga0501046_0123782 Ga0501046_0123782_403_1104 230
542 3300049823 Ga0501044_0011860 Ga0501044_0011860_7661_8362 230
543 3300050489 nmdc:mga03683_5005_c1 nmdc:mga03683_5005_c1_1214_1909 230
544 3300050491 nmdc:mga00v17_204328_c1 nmdc:mga00v17_204328_c1_15_710 230
545 3300050493 nmdc:mga0k408_66736_c1 nmdc:mga0k408_66736_c1_1253_1948 230
546 3300050496 nmdc:mga07m45_15009_c1 nmdc:mga07m45_15009_c1_2667_3362 230
547 3300050496 nmdc:mga07m45_5671_c1 nmdc:mga07m45_5671_c1_1283_1978 230
548 3300050496 nmdc:mga07m45_9499_c1 nmdc:mga07m45_9499_c1_3493_4188 230
549 3300050512 nmdc:mga0n895_581848_c1 nmdc:mga0n895_581848_c1_190_888 230
550 3300053086 Ga0500578_0011969 Ga0500578_0011969_336_1058 230
551 3300053088 Ga0500644_0019026 Ga0500644_0019026_516_1211 230
552 3300053093 Ga0500651_0160576 Ga0500651_0160576_592_1287 230
553 3300053118 Ga0500594_0029915 Ga0500594_0029915_258_950 230
554 3300053125 Ga0500618_000831 Ga0500618_000831_16109_16807 230
555 3300053136 Ga0500559_0000191 Ga0500559_0000191_46260_46955 230
556 3300053730 Ga0500645_018772 Ga0500645_018772_1284_2006 230
557 3300053739 Ga0500587_006140 Ga0500587_006140_688_1410 230
558 3300002705 JGI25156J39149_1007376 JGI25156J39149_10073762 231
559 3300002738 JGI25154J39366_1001351 JGI25154J39366_10013517 231
560 3300002738 JGI25154J39366_1001772 JGI25154J39366_10017722 231
561 3300002739 JGI25158J39367_1007351 JGI25158J39367_10073512 231
562 3300002773 JGI25152J39213_1000097 JGI25152J39213_100009728 231
563 3300002774 JGI25150J39212_1000896 JGI25150J39212_10008962 231
564 3300002774 JGI25150J39212_1001900 JGI25150J39212_10019002 231
565 3300002987 JGI25159J45721_1001812 JGI25159J45721_10018122 231
566 3300002987 JGI25159J45721_1003419 JGI25159J45721_10034192 231
567 3300003187 JGI25151J46595_10032397 JGI25151J46595_100323971 231
568 3300003215 JGI25153J46596_10000998 JGI25153J46596_100009987 231
569 3300003320 rootH2_10186710 rootH2_101867101 231
570 3300003322 rootL2_10159772 rootL2_101597723 231
571 3300003354 JGI25160J50197_1008378 JGI25160J50197_10083784 231
572 3300003374 JGI25161J50226_1000939 JGI25161J50226_10009397 231
573 3300003374 JGI25161J50226_1003119 JGI25161J50226_10031192 231
574 3300003752 Ga0055539_1000194 Ga0055539_10001943 231
575 3300003756 Ga0055533_1001762 Ga0055533_10017622 231
576 3300003758 Ga0055532_1000139 Ga0055532_100013934 231
577 3300003761 Ga0055535_1000161 Ga0055535_100016134 231
578 3300003762 Ga0055542_1000456 Ga0055542_100045627 231
579 3300003763 Ga0055529_1000327 Ga0055529_100032733 231
580 3300003771 Ga0055526_1000033 Ga0055526_10000339 231
581 3300003771 Ga0055526_1002157 Ga0055526_10021572 231
582 3300003771 Ga0055526_1002208 Ga0055526_10022088 231
583 3300003771 Ga0055526_1007908 Ga0055526_10079082 231
584 3300003771 Ga0055526_1009674 Ga0055526_10096742 231
585 3300003771 Ga0055526_1013407 Ga0055526_10134072 231
586 3300003773 Ga0055537_1000269 Ga0055537_10002692 231
587 3300003773 Ga0055537_1002292 Ga0055537_10022924 231
588 3300003775 Ga0055524_1000027 Ga0055524_1000027182 231
589 3300003775 Ga0055524_1000436 Ga0055524_100043616 231
590 3300003775 Ga0055524_1001269 Ga0055524_10012693 231
591 3300003775 Ga0055524_1001897 Ga0055524_10018972 231
592 3300003775 Ga0055524_1008891 Ga0055524_10088914 231
593 3300003775 Ga0055524_1009206 Ga0055524_10092062 231
594 3300003775 Ga0055524_1023459 Ga0055524_10234592 231
595 3300003781 Ga0055536_1000102 Ga0055536_100010250 231
596 3300003784 Ga0055534_1000130 Ga0055534_100013034 231
597 3300003784 Ga0055534_1000295 Ga0055534_100029516 231
598 3300003784 Ga0055534_1010144 Ga0055534_10101442 231
599 3300003784 Ga0055534_1013802 Ga0055534_10138022 231
600 3300003790 Ga0055528_1000043 Ga0055528_100004340 231
601 3300003790 Ga0055528_1007637 Ga0055528_10076372 231
602 3300003791 Ga0055530_10003718 Ga0055530_100037184 231
603 3300003794 Ga0055531_10000931 Ga0055531_100009312 231
604 3300003841 Ga0055541_1000494 Ga0055541_10004944 231
605 3300004625 Ga0055543_1001257 Ga0055543_10012572 231
606 3300005262 Ga0065165_1029482 Ga0065165_10294822 231
607 3300005262 Ga0065165_1040669 Ga0065165_10406693 231
608 3300005339 Ga0070660_100236137 Ga0070660_1002361372 231
609 3300005366 Ga0070659_100000200 Ga0070659_10000020013 231
610 3300005577 Ga0068857_100077900 Ga0068857_1000779002 231
611 3300005578 Ga0068854_100000029 Ga0068854_10000002987 231
612 3300009011 Ga0105251_10009738 Ga0105251_100097382 231
613 3300015261 Ga0182006_1000060 Ga0182006_1000060147 231
614 3300015265 Ga0182005_1000003 Ga0182005_1000003379 231
615 3300020077 Ga0206351_10147340 Ga0206351_101473404 231
616 3300025208 Ga0209436_105978 Ga0209436_1059783 231
617 3300025224 Ga0209784_101294 Ga0209784_1012942 231
618 3300025225 Ga0209566_100626 Ga0209566_10062622 231
619 3300025226 Ga0209674_100168 Ga0209674_10016826 231
620 3300025228 Ga0209672_100252 Ga0209672_10025211 231
621 3300025229 Ga0209147_100018 Ga0209147_100018434 231
622 3300025230 Ga0209563_102466 Ga0209563_1024663 231
623 3300025242 Ga0209258_100028 Ga0209258_100028434 231
624 3300025245 Ga0207425_1000006 Ga0207425_1000006274 231
625 3300025245 Ga0207425_1000062 Ga0207425_1000062125 231
626 3300025245 Ga0207425_1007685 Ga0207425_10076852 231
627 3300025246 Ga0209646_1000047 Ga0209646_1000047152 231
628 3300025246 Ga0209646_1000153 Ga0209646_100015393 231
629 3300025253 Ga0209677_103251 Ga0209677_1032512 231
630 3300025254 Ga0209148_1000286 Ga0209148_100028658 231
631 3300025256 Ga0209759_1001494 Ga0209759_10014948 231
632 3300025256 Ga0209759_1010307 Ga0209759_10103072 231
633 3300025258 Ga0209129_1000009 Ga0209129_1000009103 231
634 3300025263 Ga0209565_1000006 Ga0209565_1000006353 231
635 3300025263 Ga0209565_1000106 Ga0209565_100010617 231
636 3300025263 Ga0209565_1000622 Ga0209565_10006229 231
637 3300025263 Ga0209565_1000784 Ga0209565_10007847 231
638 3300025263 Ga0209565_1001080 Ga0209565_10010805 231
639 3300025263 Ga0209565_1003819 Ga0209565_10038192 231
640 3300025263 Ga0209565_1007158 Ga0209565_10071581 231
641 3300025272 Ga0209455_1000051 Ga0209455_100005190 231
642 3300025272 Ga0209455_1000107 Ga0209455_1000107134 231
643 3300025273 Ga0209673_1000004 Ga0209673_1000004476 231
644 3300025273 Ga0209673_1004605 Ga0209673_10046054 231
645 3300025284 Ga0209130_1007249 Ga0209130_10072494 231
646 3300025291 Ga0209675_1000006 Ga0209675_1000006352 231
647 3300025291 Ga0209675_1000241 Ga0209675_100024112 231
648 3300025291 Ga0209675_1000280 Ga0209675_100028028 231
649 3300025291 Ga0209675_1000441 Ga0209675_100044111 231
650 3300025291 Ga0209675_1002100 Ga0209675_10021009 231
651 3300025292 Ga0209676_1000036 Ga0209676_1000036154 231
652 3300025294 Ga0209025_1000770 Ga0209025_100077013 231
653 3300025294 Ga0209025_1001252 Ga0209025_100125217 231
654 3300025294 Ga0209025_1001261 Ga0209025_10012613 231
655 3300025294 Ga0209025_1001612 Ga0209025_100161225 231
656 3300025295 Ga0209564_1000006 Ga0209564_1000006535 231
657 3300025295 Ga0209564_1000085 Ga0209564_100008577 231
658 3300025295 Ga0209564_1000146 Ga0209564_1000146131 231
659 3300025295 Ga0209564_1000693 Ga0209564_100069312 231
660 3300025295 Ga0209564_1000736 Ga0209564_100073610 231
661 3300025295 Ga0209564_1001080 Ga0209564_100108013 231
662 3300025295 Ga0209564_1001087 Ga0209564_100108717 231
663 3300025297 Ga0209758_1000047 Ga0209758_100004766 231
664 3300025297 Ga0209758_1005826 Ga0209758_10058264 231
665 3300025298 Ga0209050_1000064 Ga0209050_1000064186 231
666 3300025298 Ga0209050_1000171 Ga0209050_1000171127 231
667 3300025298 Ga0209050_1001144 Ga0209050_10011445 231
668 3300025299 Ga0209256_1000013 Ga0209256_1000013231 231
669 3300025299 Ga0209256_1000037 Ga0209256_1000037320 231
670 3300025299 Ga0209256_1000220 Ga0209256_100022082 231
671 3300025299 Ga0209256_1000376 Ga0209256_100037670 231
672 3300025299 Ga0209256_1000507 Ga0209256_100050730 231
673 3300025299 Ga0209256_1000978 Ga0209256_10009784 231
674 3300025299 Ga0209256_1001972 Ga0209256_100197211 231
675 3300025299 Ga0209256_1002523 Ga0209256_10025238 231
676 3300025302 Ga0207426_1001027 Ga0207426_10010274 231
677 3300025303 Ga0209051_1011529 Ga0209051_10115294 231
678 3300025304 Ga0209257_1000010 Ga0209257_1000010546 231
679 3300025304 Ga0209257_1003990 Ga0209257_10039909 231
680 3300025735 Ga0207713_1052683 Ga0207713_10526831 231
681 3300025913 Ga0207695_10002200 Ga0207695_100022002 231
682 3300025919 Ga0207657_10177904 Ga0207657_101779042 231
683 3300025932 Ga0207690_10000489 Ga0207690_100004894 231
684 3300025981 Ga0207640_10000029 Ga0207640_10000029102 231
685 3300026116 Ga0207674_10021101 Ga0207674_100211013 231
686 3300027666 Ga0209282_1000059 Ga0209282_100005968 231
687 3300028794 Ga0307515_10059177 Ga0307515_100591776 231
688 3300031548 Ga0307408_100000971 Ga0307408_1000009718 231
689 3300031548 Ga0307408_100001592 Ga0307408_1000015925 231
690 3300031548 Ga0307408_100002803 Ga0307408_1000028039 231
691 3300031548 Ga0307408_100015171 Ga0307408_1000151714 231
692 3300032005 Ga0307411_10399946 Ga0307411_103999461 231
693 3300042122 Ga0450920_014501 Ga0450920_014501_335_1033 231
694 3300044669 Ga0466981_0197292 Ga0466981_0197292_83_787 231
695 3300044672 Ga0466982_0093989 Ga0466982_0093989_262_966 231
696 3300044683 Ga0466965_0008881 Ga0466965_0008881_2563_3267 231
697 3300044765 Ga0466970_0063247 Ga0466970_0063247_1217_1921 231
698 3300046452 Ga0495617_000958 Ga0495617_000958_650_1348 231
699 3300046452 Ga0495617_009619 Ga0495617_009619_914_1624 231
700 3300046453 Ga0495627_000066 Ga0495627_000066_26981_27694 231
701 3300046457 Ga0495590_0000036 Ga0495590_0000036_124575_125279 231
702 3300046457 Ga0495590_0003847 Ga0495590_0003847_2189_2899 231
703 3300046457 Ga0495590_0016394 Ga0495590_0016394_427_1137 231
704 3300046458 Ga0495591_016106 Ga0495591_016106_653_1348 231
705 3300046460 Ga0495638_0000114 Ga0495638_0000114_124536_125246 231
706 3300046460 Ga0495638_0007780 Ga0495638_0007780_3980_4690 231
707 3300046460 Ga0495638_0069591 Ga0495638_0069591_875_1585 231
708 3300046460 Ga0495638_0092638 Ga0495638_0092638_687_1385 231
709 3300046463 Ga0495653_0000007 Ga0495653_0000007_247399_248103 231
710 3300046471 Ga0495650_0004754 Ga0495650_0004754_3783_4490 231
711 3300046472 Ga0495580_0199173 Ga0495580_0199173_671_1366 231
712 3300046474 Ga0495605_0001878 Ga0495605_0001878_3701_4396 231
713 3300046474 Ga0495605_0014320 Ga0495605_0014320_1240_1950 231
714 3300046475 Ga0495639_0040181 Ga0495639_0040181_829_1536 231
715 3300046491 Ga0495584_0000091 Ga0495584_0000091_47767_48465 231
716 3300046491 Ga0495584_0000671 Ga0495584_0000671_18569_19279 231
717 3300046491 Ga0495584_0004221 Ga0495584_0004221_3073_3783 231
718 3300046492 Ga0495585_0000013 Ga0495585_0000013_78725_79423 231
719 3300046492 Ga0495585_0000020 Ga0495585_0000020_101751_102449 231
720 3300046492 Ga0495585_0009049 Ga0495585_0009049_39_749 231
721 3300046492 Ga0495585_0010267 Ga0495585_0010267_2010_2708 231
722 3300046492 Ga0495585_0050992 Ga0495585_0050992_249_959 231
723 3300046500 Ga0495596_0000057 Ga0495596_0000057_18638_19333 231
724 3300046500 Ga0495596_0003852 Ga0495596_0003852_3790_4488 231
725 3300046501 Ga0495607_0006744 Ga0495607_0006744_3799_4509 231
726 3300046501 Ga0495607_0018435 Ga0495607_0018435_1593_2303 231
727 3300046501 Ga0495607_0023429 Ga0495607_0023429_554_1264 231
728 3300046501 Ga0495607_0032154 Ga0495607_0032154_1301_2011 231
729 3300046501 Ga0495607_0033517 Ga0495607_0033517_2394_3098 231
730 3300046501 Ga0495607_0040386 Ga0495607_0040386_384_1094 231
731 3300046506 Ga0495583_0000004 Ga0495583_0000004_173960_174670 231
732 3300046506 Ga0495583_0000259 Ga0495583_0000259_64877_65584 231
733 3300046506 Ga0495583_0032703 Ga0495583_0032703_1309_2019 231
734 3300046507 Ga0495606_0005781 Ga0495606_0005781_3835_4539 231
735 3300046507 Ga0495606_0007764 Ga0495606_0007764_5030_5731 231
736 3300046507 Ga0495606_0020403 Ga0495606_0020403_301_999 231
737 3300046507 Ga0495606_0045426 Ga0495606_0045426_1348_2058 231
738 3300046507 Ga0495606_0079658 Ga0495606_0079658_71_772 231
739 3300046512 Ga0495610_0000543 Ga0495610_0000543_33550_34245 231
740 3300046512 Ga0495610_0002192 Ga0495610_0002192_14763_15464 231
741 3300046513 Ga0495616_0000571 Ga0495616_0000571_16970_17665 231
742 3300046513 Ga0495616_0000699 Ga0495616_0000699_16400_17098 231
743 3300046513 Ga0495616_0001847 Ga0495616_0001847_7827_8525 231
744 3300046513 Ga0495616_0023733 Ga0495616_0023733_299_1009 231
745 3300046513 Ga0495616_0025739 Ga0495616_0025739_154_864 231
746 3300046513 Ga0495616_0062431 Ga0495616_0062431_689_1399 231
747 3300046515 Ga0495620_0004488 Ga0495620_0004488_3425_4123 231
748 3300046519 Ga0495632_0008284 Ga0495632_0008284_3978_4679 231
749 3300046522 Ga0495643_0000646 Ga0495643_0000646_7090_7791 231
750 3300046522 Ga0495643_0001182 Ga0495643_0001182_10358_11071 231
751 3300046522 Ga0495643_0163721 Ga0495643_0163721_383_1078 231
752 3300046523 Ga0495644_0003059 Ga0495644_0003059_1025_1735 231
753 3300046523 Ga0495644_0003196 Ga0495644_0003196_4738_5448 231
754 3300046523 Ga0495644_0046666 Ga0495644_0046666_904_1611 231
755 3300046524 Ga0495648_0000031 Ga0495648_0000031_134536_135234 231
756 3300046524 Ga0495648_0000035 Ga0495648_0000035_70427_71134 231
757 3300046524 Ga0495648_0000434 Ga0495648_0000434_32502_33212 231
758 3300046524 Ga0495648_0175286 Ga0495648_0175286_300_998 231
759 3300046528 Ga0495642_0009514 Ga0495642_0009514_53_751 231
760 3300046528 Ga0495642_0065205 Ga0495642_0065205_782_1492 231
761 3300046538 Ga0495609_0000236 Ga0495609_0000236_47828_48538 231
762 3300046538 Ga0495609_0000299 Ga0495609_0000299_942_1652 231
763 3300046538 Ga0495609_0000998 Ga0495609_0000998_9271_9966 231
764 3300046538 Ga0495609_0004322 Ga0495609_0004322_4072_4782 231
765 3300046538 Ga0495609_0006936 Ga0495609_0006936_60_767 231
766 3300046538 Ga0495609_0013126 Ga0495609_0013126_1509_2207 231
767 3300046542 Ga0495597_0001219 Ga0495597_0001219_5857_6561 231
768 3300046542 Ga0495597_0001367 Ga0495597_0001367_12538_13251 231
769 3300046542 Ga0495597_0050712 Ga0495597_0050712_1008_1709 231
770 3300046557 Ga0495622_0001975 Ga0495622_0001975_3919_4626 231
771 3300046558 Ga0495633_0000318 Ga0495633_0000318_51454_52152 231
772 3300046558 Ga0495633_0000452 Ga0495633_0000452_32695_33399 231
773 3300046558 Ga0495633_0000768 Ga0495633_0000768_11251_11961 231
774 3300046558 Ga0495633_0002021 Ga0495633_0002021_470_1180 231
775 3300046558 Ga0495633_0002132 Ga0495633_0002132_11277_11975 231
776 3300046558 Ga0495633_0008930 Ga0495633_0008930_1268_1969 231
777 3300046558 Ga0495633_0240725 Ga0495633_0240725_18_716 231
778 3300046615 Ga0495656_0008855 Ga0495656_0008855_1164_1859 231
779 3300046615 Ga0495656_0172465 Ga0495656_0172465_326_1036 231
780 3300046616 Ga0495668_0000008 Ga0495668_0000008_31809_32519 231
781 3300046616 Ga0495668_0001868 Ga0495668_0001868_4113_4826 231
782 3300046648 Ga0495611_0002071 Ga0495611_0002071_4261_4971 231
783 3300046648 Ga0495611_0002306 Ga0495611_0002306_3632_4342 231
784 3300046648 Ga0495611_0021111 Ga0495611_0021111_1091_1801 231
785 3300046660 Ga0495625_0000273 Ga0495625_0000273_30871_31578 231
786 3300046660 Ga0495625_0003587 Ga0495625_0003587_3199_3909 231
787 3300046660 Ga0495625_0005618 Ga0495625_0005618_9079_9780 231
788 3300046660 Ga0495625_0009465 Ga0495625_0009465_5626_6336 231
789 3300046660 Ga0495625_0010111 Ga0495625_0010111_2406_3107 231
790 3300046660 Ga0495625_0048917 Ga0495625_0048917_640_1350 231
791 3300046664 Ga0495659_0002617 Ga0495659_0002617_1703_2413 231
792 3300046664 Ga0495659_0002930 Ga0495659_0002930_1050_1760 231
793 3300046665 Ga0495661_0018871 Ga0495661_0018871_2555_3265 231
794 3300046665 Ga0495661_0033199 Ga0495661_0033199_414_1112 231
795 3300046665 Ga0495661_0043179 Ga0495661_0043179_1557_2267 231
796 3300046665 Ga0495661_0043573 Ga0495661_0043573_494_1204 231
797 3300046684 Ga0495669_0001777 Ga0495669_0001777_917_1627 231
798 3300046691 Ga0495670_0003710 Ga0495670_0003710_2920_3630 231
799 3300046691 Ga0495670_0004214 Ga0495670_0004214_3870_4580 231
800 3300046691 Ga0495670_0092118 Ga0495670_0092118_644_1342 231
801 3300046691 Ga0495670_0114772 Ga0495670_0114772_202_900 231
802 3300046692 Ga0495671_0007174 Ga0495671_0007174_5027_5722 231
803 3300046692 Ga0495671_0010964 Ga0495671_0010964_1240_1950 231
804 3300046694 Ga0495649_0000916 Ga0495649_0000916_19628_20329 231
805 3300046694 Ga0495649_0053259 Ga0495649_0053259_622_1332 231
806 3300046694 Ga0495649_0095262 Ga0495649_0095262_79_780 231
807 3300046810 Ga0495660_0003341 Ga0495660_0003341_9198_9905 231
808 3300046810 Ga0495660_0009799 Ga0495660_0009799_1543_2256 231
809 3300046810 Ga0495660_0014725 Ga0495660_0014725_3016_3717 231
810 3300046810 Ga0495660_0021105 Ga0495660_0021105_216_914 231
811 3300047317 Ga0495604_0069571 Ga0495604_0069571_753_1448 231
812 3300047318 Ga0495636_0002072 Ga0495636_0002072_4026_4736 231
813 3300047320 Ga0495672_0000427 Ga0495672_0000427_12671_13372 231
814 3300047320 Ga0495672_0013232 Ga0495672_0013232_1216_1926 231
815 3300047320 Ga0495672_0021836 Ga0495672_0021836_1307_2017 231
816 3300047323 Ga0495683_0000005 Ga0495683_0000005_228063_228761 231
817 3300047323 Ga0495683_0007123 Ga0495683_0007123_896_1606 231
818 3300047443 Ga0495687_000311 Ga0495687_000311_51358_52068 231
819 3300047443 Ga0495687_000979 Ga0495687_000979_12695_13408 231
820 3300047443 Ga0495687_001575 Ga0495687_001575_12669_13382 231
821 3300047443 Ga0495687_010128 Ga0495687_010128_4045_4746 231
822 3300047443 Ga0495687_017162 Ga0495687_017162_448_1149 231
823 3300047445 Ga0495677_0004571 Ga0495677_0004571_1193_1903 231
824 3300047445 Ga0495677_0025204 Ga0495677_0025204_191_901 231
825 3300047445 Ga0495677_0097059 Ga0495677_0097059_213_923 231
826 3300047447 Ga0495685_000005 Ga0495685_000005_43803_44513 231
827 3300047447 Ga0495685_005353 Ga0495685_005353_2287_2997 231
828 3300047469 Ga0495673_0000027 Ga0495673_0000027_365123_365824 231
829 3300047470 Ga0495681_0004920 Ga0495681_0004920_2515_3225 231
830 3300047472 Ga0495686_0046935 Ga0495686_0046935_1993_2703 231
831 3300048091 Ga0495626_0017784 Ga0495626_0017784_1279_1977 231
832 3300048917 Ga0496114_0053290 Ga0496114_0053290_1163_1867 231
833 3300048919 Ga0496116_0017091 Ga0496116_0017091_3659_4354 231
834 3300048924 Ga0496121_0018751 Ga0496121_0018751_4005_4700 231
835 3300048924 Ga0496121_0247420 Ga0496121_0247420_344_1048 231
836 3300048925 Ga0496122_0002002 Ga0496122_0002002_18958_19653 231
837 3300048925 Ga0496122_0074559 Ga0496122_0074559_817_1521 231
838 3300048926 Ga0496123_0004103 Ga0496123_0004103_4245_4940 231
839 3300048926 Ga0496123_0016418 Ga0496123_0016418_4046_4750 231
840 3300048929 Ga0496126_0248364 Ga0496126_0248364_39_737 231
841 3300049459 Ga0495678_000001 Ga0495678_000001_762960_763673 231
842 3300049459 Ga0495678_000803 Ga0495678_000803_23459_24166 231
843 3300049459 Ga0495678_002759 Ga0495678_002759_6983_7684 231
844 3300049459 Ga0495678_004468 Ga0495678_004468_3582_4289 231
845 3300049459 Ga0495678_004946 Ga0495678_004946_4117_4827 231
846 3300049459 Ga0495678_044473 Ga0495678_044473_470_1171 231
847 3300049459 Ga0495678_048515 Ga0495678_048515_768_1478 231
848 3300049460 Ga0495682_0000543 Ga0495682_0000543_2064_2774 231
849 3300049460 Ga0495682_0000830 Ga0495682_0000830_11230_11940 231
850 3300049460 Ga0495682_0039303 Ga0495682_0039303_957_1655 231
851 3300049571 Ga0501034_0000056 Ga0501034_0000056_108965_109660 231
852 3300049571 Ga0501034_0055622 Ga0501034_0055622_1475_2170 231
853 3300053145 Ga0500586_002231 Ga0500586_002231_3587_4288 231
854 3300039447 Ga0436361_0285442 Ga0436361_0285442_9728_10432 232
855 3300046810 Ga0495660_0002148 Ga0495660_0002148_3464_4177 232
856 3300047472 Ga0495686_0015955 Ga0495686_0015955_1121_1834 232
857 iso_pu_bacteria 2643221645 2644249598 232
858 iso_pu_bacteria 2643221664 2644359708 232
859 iso_pu_bacteria 2738541280 2738739185 232
860 iso_pu_bacteria 2738541300 2738845329 232
861 iso_pu_bacteria 2738543018 2739274924 232
862 iso_pu_bacteria 2738543030 2739343968 232
863 3300046507 Ga0495606_0000744 Ga0495606_0000744_15523_16227 233
864 3300046512 Ga0495610_0014075 Ga0495610_0014075_3517_4227 233
865 3300046512 Ga0495610_0196324 Ga0495610_0196324_101_811 233
866 3300046616 Ga0495668_0002805 Ga0495668_0002805_2598_3302 233
867 3300047470 Ga0495681_0022896 Ga0495681_0022896_1892_2602 233
868 3300047472 Ga0495686_0018738 Ga0495686_0018738_3126_3830 233
869 3300048919 Ga0496116_0025790 Ga0496116_0025790_484_1188 233
870 3300003323 rootH1_10044440 rootH1_100444402 234
871 3300005564 Ga0070664_100000014 Ga0070664_10000001437 234
872 3300005614 Ga0068856_100000457 Ga0068856_1000004578 234
873 3300006177 Ga0075362_10177505 Ga0075362_101775052 234
874 3300009036 Ga0105244_10009135 Ga0105244_100091357 234
875 3300009093 Ga0105240_10112192 Ga0105240_101121922 234
876 3300013100 Ga0157373_10005551 Ga0157373_1000555110 234
877 3300013102 Ga0157371_10000118 Ga0157371_1000011886 234
878 3300013104 Ga0157370_10000038 Ga0157370_1000003894 234
879 3300015261 Ga0182006_1002614 Ga0182006_10026144 234
880 3300015262 Ga0182007_10008801 Ga0182007_100088013 234
881 3300020070 Ga0206356_11913180 Ga0206356_119131802 234
882 3300025224 Ga0209784_100006 Ga0209784_10000660 234
883 3300025224 Ga0209784_100108 Ga0209784_10010865 234
884 3300025225 Ga0209566_100002 Ga0209566_10000260 234
885 3300025225 Ga0209566_101652 Ga0209566_1016524 234
886 3300025226 Ga0209674_100097 Ga0209674_10009760 234
887 3300025230 Ga0209563_100136 Ga0209563_10013624 234
888 3300025253 Ga0209677_100007 Ga0209677_10000760 234
889 3300025256 Ga0209759_1020001 Ga0209759_10200011 234
890 3300025728 Ga0207655_1009587 Ga0207655_10095877 234
891 3300025920 Ga0207649_10000357 Ga0207649_1000035721 234
892 3300025945 Ga0207679_10000173 Ga0207679_1000017316 234
893 3300026067 Ga0207678_10000031 Ga0207678_1000003179 234
894 3300026078 Ga0207702_10000083 Ga0207702_1000008394 234
895 3300030744 Ga0316181_1070490 Ga0316181_10704902 234
896 3300037418 Ga0395900_0208472 Ga0395900_0208472_850_1554 234
897 3300044650 Ga0466986_0181258 Ga0466986_0181258_382_1086 234
898 3300046660 Ga0495625_0019878 Ga0495625_0019878_3692_4399 234
899 3300048928 Ga0496125_0031820 Ga0496125_0031820_2535_3239 234
900 3300049679 Ga0501249_005608 Ga0501249_005608_1162_1875 234
901 3300049766 Ga0501269_000068 Ga0501269_000068_14180_14893 234
902 3300059643 Ga0587072_002560 Ga0587072_002560_932_1636 234
903 3300046542 Ga0495597_0029769 Ga0495597_0029769_646_1371 236
904 3300046660 Ga0495625_0002365 Ga0495625_0002365_11409_12131 236
905 3300046664 Ga0495659_0000443 Ga0495659_0000443_2891_3616 236
906 3300046692 Ga0495671_0000656 Ga0495671_0000656_23148_23873 236
907 3300047320 Ga0495672_0000447 Ga0495672_0000447_41999_42724 236
908 3300033545 Ga0316214_1025106 Ga0316214_10251061 238
909 3300046557 Ga0495622_0079648 Ga0495622_0079648_762_1481 238
910 3300046674 Ga0495588_0109061 Ga0495588_0109061_526_1245 238
911 3300046689 Ga0495613_0060045 Ga0495613_0060045_847_1566 238
912 3300047444 Ga0495675_0056493 Ga0495675_0056493_1151_1870 238
913 3300021361 Ga0213872_10002323 Ga0213872_100023232 239
914 3300046507 Ga0495606_0006801 Ga0495606_0006801_1568_2290 239
915 3300046691 Ga0495670_0045816 Ga0495670_0045816_1436_2158 239
916 3300001979 JGI24740J21852_10000751 JGI24740J21852_100007513 240
917 3300003756 Ga0055533_1004958 Ga0055533_10049581 240
918 3300003763 Ga0055529_1000292 Ga0055529_100029234 240
919 3300003841 Ga0055541_1002864 Ga0055541_10028643 240
920 3300005337 Ga0070682_100268943 Ga0070682_1002689431 240
921 3300005344 Ga0070661_100000302 Ga0070661_10000030236 240
922 3300005455 Ga0070663_100000026 Ga0070663_10000002636 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

117

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9994 17 132
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9972 17 132
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9971 17 132
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9899 15 133
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.986 15 134
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 1.003 15 94 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9944 17 94 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9903 15 94 3.40.50.2300
4kfcB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.99 143 240 1.10.10.10
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.983 14 133 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A354CML5-F1-model_v4 DNA-binding response regulator 0.993 16 125 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A847D0Q5-F1-model_v4 Response regulator 0.9902 17 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A535YC29-F1-model_v4 Response regulator 0.9874 61 129 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1V5JWS4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9851 15 139 GO:0000155
GO:0005524
GO:0006355
AF-A0A7X9Q292-F1-model_v4 DNA-binding response regulator 0.982 143 239 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
90.07 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map