F485753

General Info

Members Datasets Scaffolds Average Seq Length
921 327 1842 78

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_101055970|Ga0070705_1010559702
Length 86
Sequence MGKGYAEGPALEERLAAAESGPATTWRRRPRKAVFGSTQKKRDRHFLGWLGEVDPDELFDSGQAWGLSVTEIADETPRKAAAPRAS

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
110 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
111 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
236 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
237 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 11.07
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_101055970 3300005440 Unclassified 662
2 JGI24737J22298_10190900 3300001990 Bacteria 605
3 JGI24743J22301_10013514 3300001991 Bacteria 1496
4 JGI24738J21930_10020539 3300002075 Bacteria 1373
5 JGI25406J46586_10034684 3300003203 Bacteria 1849
6 JGI25404J52841_10012223 3300003659 Bacteria 1858
7 Ga0070658_10256720 3300005327 Bacteria 1483
8 Ga0070658_11650446 3300005327 Bacteria 555
9 Ga0070676_10149224 3300005328 Bacteria 1495
10 Ga0070676_10593347 3300005328 Bacteria 798
11 Ga0070676_10708095 3300005328 Bacteria 736
12 Ga0070683_100004187 3300005329 Bacteria 11827
13 Ga0070683_100009295 3300005329 Bacteria 8401
14 Ga0070683_100017232 3300005329 Bacteria 6382
15 Ga0070683_100044799 3300005329 Bacteria 4081
16 Ga0070683_100168394 3300005329 Bacteria 2079
17 Ga0070683_100272013 3300005329 Bacteria 1611
18 Ga0070683_101164505 3300005329 Bacteria 741
19 Ga0070690_100273930 3300005330 Bacteria 1202
20 Ga0070677_10632460 3300005333 Unclassified 596
21 Ga0068869_100073954 3300005334 Bacteria 2528
22 Ga0068869_100666380 3300005334 Bacteria 884
23 Ga0070666_11007603 3300005335 Bacteria 618
24 Ga0070680_100008967 3300005336 Bacteria 7669
25 Ga0070680_100264099 3300005336 Bacteria 1457
26 Ga0070680_100456192 3300005336 Bacteria 1092
27 Ga0070680_100487061 3300005336 Bacteria 1054
28 Ga0070680_100943486 3300005336 Bacteria 745
29 Ga0070682_100024989 3300005337 Bacteria 3562
30 Ga0070682_100040603 3300005337 Bacteria 2863
31 Ga0070682_100070650 3300005337 Bacteria 2232
32 Ga0070682_100541123 3300005337 Bacteria 910
33 Ga0068868_100040090 3300005338 Bacteria 3643
34 Ga0068868_100181678 3300005338 Bacteria 1745
35 Ga0068868_100211588 3300005338 Bacteria 1621
36 Ga0068868_100473634 3300005338 Bacteria 1093
37 Ga0068868_100477093 3300005338 Bacteria 1089
38 Ga0068868_100783243 3300005338 Bacteria 859
39 Ga0068868_101875638 3300005338 Bacteria 567
40 Ga0070660_100016432 3300005339 Bacteria 5370
41 Ga0070660_100222984 3300005339 Bacteria 1532
42 Ga0070660_100581352 3300005339 Bacteria 936
43 Ga0070660_101109540 3300005339 Bacteria 670
44 Ga0070689_100199121 3300005340 Bacteria 1634
45 Ga0070689_100200905 3300005340 Bacteria 1628
46 Ga0070691_10108896 3300005341 Bacteria 1384
47 Ga0070691_10270511 3300005341 Bacteria 918
48 Ga0070691_10686930 3300005341 Unclassified 613
49 Ga0070691_11048878 3300005341 Unclassified 511
50 Ga0070687_100229069 3300005343 Unclassified 1143
51 Ga0070687_100732612 3300005343 Bacteria 694
52 Ga0070661_100006593 3300005344 Bacteria 8005
53 Ga0070661_100319411 3300005344 Bacteria 1212
54 Ga0070692_10024071 3300005345 Bacteria 2989
55 Ga0070692_10051722 3300005345 Bacteria 2137
56 Ga0070692_10106002 3300005345 Bacteria 1548
57 Ga0070692_10107647 3300005345 Bacteria 1537
58 Ga0070668_100203618 3300005347 Bacteria 1625
59 Ga0070668_100303362 3300005347 Bacteria 1340
60 Ga0070668_100639986 3300005347 Bacteria 933
61 Ga0070668_100842599 3300005347 Unclassified 817
62 Ga0070668_101772557 3300005347 Bacteria 567
63 Ga0070675_100149358 3300005354 Bacteria 2002
64 Ga0070675_100378269 3300005354 Bacteria 1260
65 Ga0070671_100129369 3300005355 Bacteria 2126
66 Ga0070671_101979463 3300005355 Bacteria 518
67 Ga0070674_100069468 3300005356 Bacteria 2485
68 Ga0070674_100355808 3300005356 Bacteria 1184
69 Ga0070674_100383843 3300005356 Bacteria 1143
70 Ga0070674_101248313 3300005356 Bacteria 661
71 Ga0070674_101360126 3300005356 Bacteria 635
72 Ga0070674_101548775 3300005356 Bacteria 597
73 Ga0070673_100025464 3300005364 Bacteria 4355
74 Ga0070673_100192644 3300005364 Bacteria 1752
75 Ga0070673_100577312 3300005364 Bacteria 1023
76 Ga0070673_101263549 3300005364 Bacteria 693
77 Ga0070673_101537862 3300005364 Bacteria 628
78 Ga0070673_102049678 3300005364 Unclassified 543
79 Ga0070688_100003608 3300005365 Bacteria 7987
80 Ga0070688_100454156 3300005365 Bacteria 959
81 Ga0070688_100716930 3300005365 Bacteria 776
82 Ga0070659_100036350 3300005366 Bacteria 3840
83 Ga0070659_100121076 3300005366 Bacteria 2119
84 Ga0070659_101017632 3300005366 Bacteria 728
85 Ga0070659_101205320 3300005366 Bacteria 669
86 Ga0070659_101970613 3300005366 Archaea 524
87 Ga0070667_100594549 3300005367 Bacteria 1019
88 Ga0070703_10140885 3300005406 Bacteria 896
89 Ga0070703_10545381 3300005406 Bacteria 528
90 Ga0070713_100022984 3300005436 Bacteria 4828
91 Ga0070710_11421924 3300005437 Bacteria 519
92 Ga0070701_10284012 3300005438 Bacteria 1012
93 Ga0070705_100089502 3300005440 Bacteria 1913
94 Ga0070705_100579358 3300005440 Bacteria 865
95 Ga0070705_100588542 3300005440 Bacteria 859
96 Ga0070705_100739093 3300005440 Bacteria 777
97 Ga0070700_100107924 3300005441 Bacteria 1846
98 Ga0070700_100125766 3300005441 Bacteria 1723
99 Ga0070694_100566975 3300005444 Unclassified 911
100 Ga0070694_100765830 3300005444 Bacteria 789
101 Ga0070694_101880363 3300005444 Bacteria 511
102 Ga0070663_101092612 3300005455 Bacteria 697
103 Ga0070678_100021888 3300005456 Bacteria 4226
104 Ga0070678_100151635 3300005456 Bacteria 1868
105 Ga0070678_100513621 3300005456 Bacteria 1059
106 Ga0070678_101060583 3300005456 Bacteria 747
107 Ga0070662_100021694 3300005457 Bacteria 4389
108 Ga0070662_100039565 3300005457 Bacteria 3353
109 Ga0070662_100048457 3300005457 Bacteria 3061
110 Ga0070662_100642126 3300005457 Bacteria 895
111 Ga0070681_10038304 3300005458 Bacteria 4807
112 Ga0070681_10040518 3300005458 Bacteria 4666
113 Ga0070681_11804617 3300005458 Bacteria 539
114 Ga0068867_100046516 3300005459 Bacteria 3187
115 Ga0068867_100201746 3300005459 Unclassified 1592
116 Ga0068867_100758544 3300005459 Bacteria 862
117 Ga0068867_101492957 3300005459 Bacteria 629
118 Ga0070685_10249667 3300005466 Bacteria 1175
119 Ga0070685_10361197 3300005466 Bacteria 995
120 Ga0070706_100486670 3300005467 Unclassified 1148
121 Ga0070707_100099324 3300005468 Bacteria 2820
122 Ga0070707_100489130 3300005468 Bacteria 1192
123 Ga0070699_100771548 3300005518 Bacteria 880
124 Ga0070679_100016785 3300005530 Bacteria 7076
125 Ga0070679_100046212 3300005530 Bacteria 4339
126 Ga0070679_100111207 3300005530 Bacteria 2725
127 Ga0070679_100593872 3300005530 Bacteria 1050
128 Ga0070679_101135059 3300005530 Bacteria 726
129 Ga0070684_100036549 3300005535 Bacteria 4209
130 Ga0070684_100049803 3300005535 Bacteria 3637
131 Ga0070684_100062427 3300005535 Bacteria 3264
132 Ga0070684_100064871 3300005535 Bacteria 3204
133 Ga0070684_100097995 3300005535 Bacteria 2615
134 Ga0070684_100124781 3300005535 Bacteria 2318
135 Ga0070684_100267737 3300005535 Bacteria 1564
136 Ga0070684_100269003 3300005535 Bacteria 1560
137 Ga0070684_101934732 3300005535 Bacteria 556
138 Ga0070697_100871427 3300005536 Unclassified 798
139 Ga0070697_101817825 3300005536 Unclassified 545
140 Ga0068853_100197175 3300005539 Bacteria 1831
141 Ga0068853_100260431 3300005539 Bacteria 1594
142 Ga0068853_100538946 3300005539 Bacteria 1105
143 Ga0070672_100070398 3300005543 Bacteria 2779
144 Ga0070672_100071365 3300005543 Bacteria 2762
145 Ga0070672_101716742 3300005543 Bacteria 564
146 Ga0070686_100016843 3300005544 Bacteria 4258
147 Ga0070686_100017937 3300005544 Bacteria 4144
148 Ga0070686_100071411 3300005544 Bacteria 2272
149 Ga0070686_100477747 3300005544 Bacteria 963
150 Ga0070695_100174990 3300005545 Bacteria 1517
151 Ga0070695_100486346 3300005545 Bacteria 952
152 Ga0070695_101281538 3300005545 Bacteria 605
153 Ga0070696_100171194 3300005546 Bacteria 1605
154 Ga0070696_100892145 3300005546 Unclassified 737
155 Ga0070693_100122850 3300005547 Bacteria 1613
156 Ga0070693_100212207 3300005547 Bacteria 1264
157 Ga0070693_100305273 3300005547 Bacteria 1074
158 Ga0070693_100398586 3300005547 Bacteria 953
159 Ga0070693_100555202 3300005547 Bacteria 823
160 Ga0070693_101054961 3300005547 Bacteria 617
161 Ga0070665_100181017 3300005548 Bacteria 2108
162 Ga0070665_102017666 3300005548 Bacteria 582
163 Ga0070704_100062878 3300005549 Bacteria 2662
164 Ga0070704_100189901 3300005549 Bacteria 1650
165 Ga0070704_101223038 3300005549 Bacteria 686
166 Ga0070704_102052071 3300005549 Bacteria 531
167 Ga0070704_102111069 3300005549 Bacteria 523
168 Ga0068855_100020351 3300005563 Bacteria 7959
169 Ga0068855_100068256 3300005563 Bacteria 4140
170 Ga0068855_100096059 3300005563 Bacteria 3416
171 Ga0068855_100784457 3300005563 Bacteria 1014
172 Ga0068855_102095052 3300005563 Bacteria 570
173 Ga0070664_100208256 3300005564 Bacteria 1747
174 Ga0070664_100409660 3300005564 Bacteria 1240
175 Ga0070664_100427434 3300005564 Unclassified 1214
176 Ga0070664_100475232 3300005564 Bacteria 1150
177 Ga0068857_101591349 3300005577 Unclassified 638
178 Ga0068854_100192583 3300005578 Bacteria 1598
179 Ga0068854_100254415 3300005578 Bacteria 1404
180 Ga0068854_100434648 3300005578 Bacteria 1093
181 Ga0068854_101916622 3300005578 Bacteria 545
182 Ga0068856_100036581 3300005614 Bacteria 4813
183 Ga0068856_100077802 3300005614 Bacteria 3287
184 Ga0068856_100144989 3300005614 Bacteria 2382
185 Ga0068856_100611494 3300005614 Bacteria 1111
186 Ga0068856_101465612 3300005614 Bacteria 697
187 Ga0068856_102496901 3300005614 Bacteria 523
188 Ga0070702_100010629 3300005615 Bacteria 4544
189 Ga0070702_100342625 3300005615 Unclassified 1050
190 Ga0070702_101109646 3300005615 Bacteria 632
191 Ga0070702_101351026 3300005615 Bacteria 581
192 Ga0068852_100219396 3300005616 Bacteria 1808
193 Ga0068852_100266846 3300005616 Bacteria 1646
194 Ga0068852_100445887 3300005616 Bacteria 1280
195 Ga0068852_100786849 3300005616 Bacteria 965
196 Ga0068852_102826170 3300005616 Bacteria 504
197 Ga0068859_100081294 3300005617 Bacteria 3282
198 Ga0068864_100015893 3300005618 Bacteria 6264
199 Ga0068864_100048158 3300005618 Bacteria 3663
200 Ga0068864_100176828 3300005618 Bacteria 1949
201 Ga0068864_101392873 3300005618 Bacteria 703
202 Ga0068864_101538972 3300005618 Bacteria 668
203 Ga0068866_10033553 3300005718 Bacteria 2492
204 Ga0068866_10064853 3300005718 Bacteria 1909
205 Ga0068866_10952635 3300005718 Bacteria 607
206 Ga0068861_100010813 3300005719 Bacteria 6343
207 Ga0068861_100324161 3300005719 Bacteria 1342
208 Ga0068861_101712586 3300005719 Unclassified 622
209 Ga0068851_10076213 3300005834 Bacteria 1744
210 Ga0068851_10096013 3300005834 Bacteria 1567
211 Ga0068870_10042671 3300005840 Bacteria 2362
212 Ga0068870_10120621 3300005840 Bacteria 1510
213 Ga0068870_10264045 3300005840 Bacteria 1073
214 Ga0068870_10298231 3300005840 Bacteria 1016
215 Ga0068870_10510642 3300005840 Bacteria 803
216 Ga0068870_11432667 3300005840 Bacteria 507
217 Ga0068863_100324635 3300005841 Bacteria 1495
218 Ga0068863_100671841 3300005841 Unclassified 1028
219 Ga0068858_100110298 3300005842 Bacteria 2569
220 Ga0068858_100494287 3300005842 Bacteria 1181
221 Ga0068858_101926221 3300005842 Bacteria 584
222 Ga0068860_100286833 3300005843 Bacteria 1610
223 Ga0068860_100676816 3300005843 Bacteria 1041
224 Ga0068860_100882083 3300005843 Bacteria 910
225 Ga0081455_10030039 3300005937 Bacteria 4945
226 Ga0081455_10603165 3300005937 Bacteria 715
227 Ga0081540_1003454 3300005983 Bacteria 12471
228 Ga0081540_1023280 3300005983 Bacteria 3628
229 Ga0081539_10000978 3300005985 Bacteria 53262
230 Ga0070717_10013090 3300006028 Bacteria 6340
231 Ga0075365_10183687 3300006038 Bacteria 1462
232 Ga0075365_10442478 3300006038 Bacteria 918
233 Ga0075368_10229450 3300006042 Bacteria 790
234 Ga0075363_100363227 3300006048 Bacteria 847
235 Ga0075363_100393991 3300006048 Bacteria 813
236 Ga0075363_100553814 3300006048 Bacteria 686
237 Ga0075364_10529289 3300006051 Bacteria 806
238 Ga0075432_10001539 3300006058 Bacteria 7567
239 Ga0070712_100308107 3300006175 Bacteria 1284
240 Ga0070712_100873024 3300006175 Bacteria 775
241 Ga0075367_11113454 3300006178 Unclassified 505
242 Ga0097621_100051825 3300006237 Bacteria 3341
243 Ga0097621_100249911 3300006237 Bacteria 1552
244 Ga0097621_100375602 3300006237 Bacteria 1269
245 Ga0097621_100866051 3300006237 Bacteria 840
246 Ga0075370_10783005 3300006353 Unclassified 581
247 Ga0068871_100097648 3300006358 Bacteria 2456
248 Ga0068871_100227263 3300006358 Bacteria 1619
249 Ga0068871_101848257 3300006358 Bacteria 574
250 Ga0075428_100003460 3300006844 Bacteria 17277
251 Ga0075428_100237586 3300006844 Bacteria 1966
252 Ga0075428_100393187 3300006844 Bacteria 1486
253 Ga0075431_100301091 3300006847 Bacteria 1620
254 Ga0075434_100660933 3300006871 Bacteria 1063
255 Ga0075434_100889686 3300006871 Bacteria 905
256 Ga0075434_101373460 3300006871 Bacteria 717
257 Ga0075434_101420462 3300006871 Bacteria 704
258 Ga0075429_100297257 3300006880 Bacteria 1414
259 Ga0075429_100360990 3300006880 Unclassified 1272
260 Ga0068865_100028182 3300006881 Bacteria 3717
261 Ga0068865_100391962 3300006881 Bacteria 1135
262 Ga0068865_101202200 3300006881 Bacteria 671
263 Ga0068865_101576751 3300006881 Bacteria 590
264 Ga0068865_101829732 3300006881 Bacteria 549
265 Ga0075436_100018846 3300006914 Bacteria 4725
266 Ga0075436_100049205 3300006914 Bacteria 2909
267 Ga0075436_100987440 3300006914 Bacteria 632
268 Ga0097620_100081297 3300006931 Bacteria 3282
269 Ga0105244_10112925 3300009036 Bacteria 1320
270 Ga0105240_10420972 3300009093 Bacteria 1501
271 Ga0111539_10036879 3300009094 Bacteria 5907
272 Ga0111539_10069292 3300009094 Bacteria 4164
273 Ga0111539_10499976 3300009094 Bacteria 1416
274 Ga0105245_10065228 3300009098 Bacteria 3293
275 Ga0105245_10087256 3300009098 Bacteria 2864
276 Ga0105245_10087373 3300009098 Bacteria 2862
277 Ga0105245_10097243 3300009098 Bacteria 2718
278 Ga0105245_10184885 3300009098 Bacteria 1993
279 Ga0105245_10576279 3300009098 Bacteria 1150
280 Ga0105245_10908018 3300009098 Bacteria 922
281 Ga0105245_11607953 3300009098 Bacteria 702
282 Ga0105245_12162962 3300009098 Bacteria 610
283 Ga0105245_13021208 3300009098 Bacteria 521
284 Ga0105247_10050683 3300009101 Bacteria 2555
285 Ga0105247_10792207 3300009101 Bacteria 722
286 Ga0105247_10907001 3300009101 Bacteria 681
287 Ga0114129_10256385 3300009147 Bacteria 2346
288 Ga0114129_10506931 3300009147 Bacteria 1575
289 Ga0114129_10669098 3300009147 Bacteria 1338
290 Ga0114129_10749384 3300009147 Bacteria 1250
291 Ga0105243_10003840 3300009148 Bacteria 12008
292 Ga0105243_10143297 3300009148 Bacteria 2041
293 Ga0105243_10179958 3300009148 Bacteria 1838
294 Ga0105243_10553661 3300009148 Bacteria 1099
295 Ga0105243_12045669 3300009148 Bacteria 608
296 Ga0105241_10324872 3300009174 Bacteria 1328
297 Ga0105241_10680635 3300009174 Bacteria 937
298 Ga0105241_11107754 3300009174 Bacteria 746
299 Ga0105242_10132792 3300009176 Bacteria 2151
300 Ga0105242_10141952 3300009176 Bacteria 2085
301 Ga0105242_10158916 3300009176 Bacteria 1976
302 Ga0105242_10390537 3300009176 Bacteria 1296
303 Ga0105242_10447675 3300009176 Bacteria 1217
304 Ga0105242_10472801 3300009176 Unclassified 1186
305 Ga0105242_10838446 3300009176 Bacteria 914
306 Ga0105242_12484357 3300009176 Bacteria 566
307 Ga0105248_10131241 3300009177 Bacteria 2827
308 Ga0105248_10230788 3300009177 Bacteria 2083
309 Ga0105248_10363727 3300009177 Bacteria 1629
310 Ga0105248_10785240 3300009177 Bacteria 1075
311 Ga0105237_10105371 3300009545 Bacteria 2811
312 Ga0105237_10665403 3300009545 Bacteria 1048
313 Ga0105238_10241071 3300009551 Bacteria 1785
314 Ga0105238_10259710 3300009551 Bacteria 1716
315 Ga0105238_10294251 3300009551 Bacteria 1606
316 Ga0105238_10376241 3300009551 Bacteria 1411
317 Ga0105238_11440903 3300009551 Unclassified 716
318 Ga0105249_10083739 3300009553 Bacteria 2969
319 Ga0105249_10528149 3300009553 Bacteria 1228
320 Ga0105249_12823852 3300009553 Bacteria 557
321 Ga0105239_10033305 3300010375 Bacteria 5659
322 Ga0105239_10046075 3300010375 Bacteria 4778
323 Ga0105239_10051615 3300010375 Bacteria 4508
324 Ga0105239_10157597 3300010375 Bacteria 2536
325 Ga0105239_10452257 3300010375 Bacteria 1457
326 Ga0105239_10570863 3300010375 Unclassified 1289
327 Ga0105239_11911367 3300010375 Bacteria 688
328 Ga0105246_10106901 3300011119 Bacteria 2048
329 Ga0105246_10254337 3300011119 Bacteria 1396
330 Ga0105246_10312602 3300011119 Bacteria 1273
331 Ga0105246_10420601 3300011119 Bacteria 1115
332 Ga0157337_1008902 3300012483 Bacteria 747
333 Ga0157341_1005684 3300012494 Bacteria 944
334 Ga0157313_1054633 3300012503 Bacteria 530
335 Ga0157373_11110812 3300013100 Bacteria 593
336 Ga0157373_11476584 3300013100 Bacteria 518
337 Ga0157371_10096399 3300013102 Bacteria 2096
338 Ga0157371_10438163 3300013102 Bacteria 960
339 Ga0157371_10513727 3300013102 Bacteria 885
340 Ga0157370_10103163 3300013104 Bacteria 2670
341 Ga0157369_10205845 3300013105 Bacteria 2064
342 Ga0157369_10743397 3300013105 Bacteria 1009
343 Ga0157369_12303883 3300013105 Bacteria 546
344 Ga0157374_10068854 3300013296 Bacteria 3331
345 Ga0157374_10221341 3300013296 Bacteria 1857
346 Ga0157374_10765804 3300013296 Bacteria 980
347 Ga0157378_10148194 3300013297 Bacteria 2185
348 Ga0157378_11010223 3300013297 Bacteria 866
349 Ga0157378_11432563 3300013297 Bacteria 734
350 Ga0157378_12269790 3300013297 Bacteria 594
351 Ga0163162_10179778 3300013306 Bacteria 2241
352 Ga0163162_10261712 3300013306 Bacteria 1862
353 Ga0163162_11024674 3300013306 Bacteria 934
354 Ga0157372_10011911 3300013307 Bacteria 9265
355 Ga0157372_11369739 3300013307 Bacteria 816
356 Ga0157375_10025689 3300013308 Bacteria 5478
357 Ga0157375_10063532 3300013308 Bacteria 3673
358 Ga0157375_10125172 3300013308 Bacteria 2684
359 Ga0157375_10139952 3300013308 Bacteria 2546
360 Ga0157375_10331809 3300013308 Bacteria 1686
361 Ga0157375_10365241 3300013308 Bacteria 1610
362 Ga0157375_10584275 3300013308 Bacteria 1277
363 Ga0163163_10156580 3300014325 Bacteria 2323
364 Ga0163163_10230439 3300014325 Bacteria 1901
365 Ga0163163_11348760 3300014325 Bacteria 775
366 Ga0163163_11828417 3300014325 Bacteria 668
367 Ga0157380_10025107 3300014326 Bacteria 4517
368 Ga0157380_10367529 3300014326 Bacteria 1352
369 Ga0157380_10732297 3300014326 Bacteria 998
370 Ga0157380_11124684 3300014326 Bacteria 825
371 Ga0182008_10195256 3300014497 Bacteria 1028
372 Ga0157377_10019616 3300014745 Bacteria 3534
373 Ga0157377_10138047 3300014745 Bacteria 1495
374 Ga0157377_10190829 3300014745 Bacteria 1295
375 Ga0157377_10406310 3300014745 Bacteria 929
376 Ga0157377_10593726 3300014745 Bacteria 789
377 Ga0157377_10833678 3300014745 Bacteria 683
378 Ga0157379_10039429 3300014968 Bacteria 4214
379 Ga0157379_10283619 3300014968 Bacteria 1507
380 Ga0157379_11256178 3300014968 Bacteria 714
381 Ga0157376_10618443 3300014969 Bacteria 1080
382 Ga0157376_10647123 3300014969 Bacteria 1057
383 Ga0163161_10030464 3300017792 Bacteria 3841
384 Ga0163161_10075868 3300017792 Bacteria 2467
385 Ga0163161_10207043 3300017792 Bacteria 1514
386 Ga0163161_10387956 3300017792 Bacteria 1117
387 Ga0163161_10587547 3300017792 Bacteria 917
388 Ga0163161_11427611 3300017792 Unclassified 605
389 Ga0206356_10967055 3300020070 Bacteria 2069
390 Ga0206353_11449428 3300020082 Bacteria 1380
391 Ga0207656_10081554 3300025321 Bacteria 1455
392 Ga0207653_10056033 3300025885 Bacteria 1321
393 Ga0207682_10606777 3300025893 Bacteria 516
394 Ga0207642_10056236 3300025899 Bacteria 1804
395 Ga0207642_10134968 3300025899 Bacteria 1293
396 Ga0207642_10517818 3300025899 Bacteria 732
397 Ga0207642_10776860 3300025899 Bacteria 608
398 Ga0207710_10085379 3300025900 Bacteria 1470
399 Ga0207688_10040148 3300025901 Bacteria 2600
400 Ga0207688_10296281 3300025901 Bacteria 988
401 Ga0207688_10300688 3300025901 Bacteria 981
402 Ga0207688_10628115 3300025901 Bacteria 678
403 Ga0207680_11139296 3300025903 Bacteria 557
404 Ga0207647_10138491 3300025904 Bacteria 1427
405 Ga0207645_10112108 3300025907 Bacteria 1766
406 Ga0207645_10168098 3300025907 Bacteria 1436
407 Ga0207645_11091398 3300025907 Bacteria 538
408 Ga0207643_10118010 3300025908 Bacteria 1569
409 Ga0207643_10140642 3300025908 Bacteria 1441
410 Ga0207705_11384143 3300025909 Unclassified 535
411 Ga0207654_10286192 3300025911 Bacteria 1116
412 Ga0207654_10391158 3300025911 Bacteria 965
413 Ga0207707_10106717 3300025912 Bacteria 2448
414 Ga0207707_10401790 3300025912 Bacteria 1176
415 Ga0207707_10902852 3300025912 Bacteria 730
416 Ga0207695_10247254 3300025913 Bacteria 1683
417 Ga0207671_10723753 3300025914 Bacteria 791
418 Ga0207693_10535382 3300025915 Bacteria 914
419 Ga0207693_10782006 3300025915 Bacteria 736
420 Ga0207660_10052394 3300025917 Bacteria 2905
421 Ga0207660_10184184 3300025917 Bacteria 1623
422 Ga0207660_10201282 3300025917 Bacteria 1555
423 Ga0207660_10606778 3300025917 Bacteria 891
424 Ga0207660_10910332 3300025917 Bacteria 718
425 Ga0207662_10759817 3300025918 Bacteria 682
426 Ga0207657_10065072 3300025919 Bacteria 3109
427 Ga0207657_10072441 3300025919 Bacteria 2915
428 Ga0207657_10567735 3300025919 Bacteria 886
429 Ga0207657_11146839 3300025919 Bacteria 593
430 Ga0207649_10050312 3300025920 Bacteria 2577
431 Ga0207649_10516617 3300025920 Bacteria 910
432 Ga0207652_10431662 3300025921 Bacteria 1188
433 Ga0207652_10622908 3300025921 Bacteria 966
434 Ga0207646_10644278 3300025922 Bacteria 949
435 Ga0207646_10900714 3300025922 Bacteria 785
436 Ga0207681_10480592 3300025923 Bacteria 1015
437 Ga0207694_10386966 3300025924 Bacteria 1161
438 Ga0207650_10179837 3300025925 Bacteria 1685
439 Ga0207659_10078197 3300025926 Bacteria 2437
440 Ga0207659_10171844 3300025926 Bacteria 1710
441 Ga0207659_10402734 3300025926 Bacteria 1145
442 Ga0207687_10048606 3300025927 Bacteria 2947
443 Ga0207687_10073118 3300025927 Bacteria 2454
444 Ga0207687_10097628 3300025927 Bacteria 2155
445 Ga0207687_10107671 3300025927 Bacteria 2063
446 Ga0207687_10192144 3300025927 Bacteria 1590
447 Ga0207687_10299451 3300025927 Bacteria 1295
448 Ga0207700_10336741 3300025928 Bacteria 1311
449 Ga0207644_10427632 3300025931 Bacteria 1086
450 Ga0207690_10077096 3300025932 Bacteria 2316
451 Ga0207690_10191705 3300025932 Bacteria 1546
452 Ga0207690_10598645 3300025932 Bacteria 900
453 Ga0207690_10631660 3300025932 Bacteria 876
454 Ga0207706_10007338 3300025933 Bacteria 10195
455 Ga0207706_10022994 3300025933 Bacteria 5597
456 Ga0207706_10097410 3300025933 Bacteria 2587
457 Ga0207706_10108954 3300025933 Bacteria 2437
458 Ga0207706_10146363 3300025933 Bacteria 2078
459 Ga0207686_10075073 3300025934 Bacteria 2187
460 Ga0207686_10455942 3300025934 Bacteria 984
461 Ga0207686_10567097 3300025934 Bacteria 889
462 Ga0207686_11154915 3300025934 Bacteria 633
463 Ga0207686_11282600 3300025934 Unclassified 601
464 Ga0207709_10042871 3300025935 Bacteria 2724
465 Ga0207709_10201754 3300025935 Bacteria 1421
466 Ga0207709_10203090 3300025935 Bacteria 1417
467 Ga0207709_10659735 3300025935 Bacteria 834
468 Ga0207709_11284256 3300025935 Unclassified 605
469 Ga0207709_11672655 3300025935 Bacteria 529
470 Ga0207669_10062349 3300025937 Bacteria 2296
471 Ga0207669_11092369 3300025937 Bacteria 673
472 Ga0207704_10112474 3300025938 Bacteria 1844
473 Ga0207704_11204705 3300025938 Bacteria 646
474 Ga0207704_11653796 3300025938 Bacteria 550
475 Ga0207704_11758596 3300025938 Bacteria 533
476 Ga0207704_11769431 3300025938 Bacteria 531
477 Ga0207665_11376094 3300025939 Unclassified 562
478 Ga0207691_10003824 3300025940 Bacteria 14604
479 Ga0207691_11128756 3300025940 Bacteria 651
480 Ga0207711_10124490 3300025941 Bacteria 2305
481 Ga0207711_10128252 3300025941 Bacteria 2271
482 Ga0207711_10135073 3300025941 Bacteria 2215
483 Ga0207689_10060488 3300025942 Bacteria 3115
484 Ga0207661_10003179 3300025944 Bacteria 11388
485 Ga0207661_10031560 3300025944 Bacteria 4094
486 Ga0207661_10112898 3300025944 Bacteria 2301
487 Ga0207661_10549953 3300025944 Bacteria 1057
488 Ga0207661_10596788 3300025944 Unclassified 1013
489 Ga0207661_10773436 3300025944 Bacteria 884
490 Ga0207661_10976420 3300025944 Bacteria 780
491 Ga0207661_11505420 3300025944 Bacteria 617
492 Ga0207661_12033437 3300025944 Bacteria 520
493 Ga0207679_10100206 3300025945 Bacteria 2263
494 Ga0207679_10558087 3300025945 Bacteria 1028
495 Ga0207679_11316497 3300025945 Bacteria 663
496 Ga0207667_10105163 3300025949 Bacteria 2912
497 Ga0207667_10149058 3300025949 Bacteria 2408
498 Ga0207667_10183674 3300025949 Bacteria 2147
499 Ga0207651_10998074 3300025960 Bacteria 748
500 Ga0207712_10397255 3300025961 Bacteria 1158
501 Ga0207712_10815956 3300025961 Unclassified 821
502 Ga0207712_11222525 3300025961 Bacteria 671
503 Ga0207668_10173483 3300025972 Bacteria 1693
504 Ga0207668_10231621 3300025972 Bacteria 1490
505 Ga0207668_10383154 3300025972 Bacteria 1184
506 Ga0207640_10058274 3300025981 Bacteria 2544
507 Ga0207640_10090318 3300025981 Bacteria 2119
508 Ga0207640_10093969 3300025981 Bacteria 2084
509 Ga0207640_10305066 3300025981 Bacteria 1261
510 Ga0207640_10373240 3300025981 Bacteria 1153
511 Ga0207658_10809604 3300025986 Bacteria 851
512 Ga0207658_11262801 3300025986 Bacteria 675
513 Ga0207677_10040542 3300026023 Bacteria 3071
514 Ga0207677_11771581 3300026023 Unclassified 573
515 Ga0207677_11787631 3300026023 Bacteria 570
516 Ga0207677_11864405 3300026023 Bacteria 558
517 Ga0207703_11206747 3300026035 Bacteria 727
518 Ga0207703_11758041 3300026035 Bacteria 596
519 Ga0207639_10618827 3300026041 Bacteria 1000
520 Ga0207678_10023618 3300026067 Bacteria 5376
521 Ga0207678_10648890 3300026067 Bacteria 927
522 Ga0207708_10071592 3300026075 Bacteria 2656
523 Ga0207708_10164864 3300026075 Bacteria 1752
524 Ga0207708_11719216 3300026075 Bacteria 551
525 Ga0207702_10132896 3300026078 Bacteria 2241
526 Ga0207702_10176673 3300026078 Bacteria 1963
527 Ga0207702_10334125 3300026078 Bacteria 1446
528 Ga0207702_10803870 3300026078 Bacteria 930
529 Ga0207702_10998949 3300026078 Bacteria 830
530 Ga0207641_10361399 3300026088 Bacteria 1386
531 Ga0207641_10939699 3300026088 Bacteria 860
532 Ga0207641_11186825 3300026088 Bacteria 763
533 Ga0207641_12438867 3300026088 Bacteria 522
534 Ga0207648_10036314 3300026089 Bacteria 4341
535 Ga0207648_10086057 3300026089 Bacteria 2742
536 Ga0207648_10304862 3300026089 Bacteria 1429
537 Ga0207676_10149396 3300026095 Bacteria 2010
538 Ga0207676_10368215 3300026095 Bacteria 1334
539 Ga0207676_10744518 3300026095 Bacteria 953
540 Ga0207674_10008061 3300026116 Bacteria 12212
541 Ga0207674_10356864 3300026116 Bacteria 1413
542 Ga0207675_100000592 3300026118 Bacteria 35478
543 Ga0207675_100114884 3300026118 Bacteria 2543
544 Ga0207675_100347281 3300026118 Bacteria 1453
545 Ga0207675_100390657 3300026118 Bacteria 1369
546 Ga0207675_100439391 3300026118 Bacteria 1291
547 Ga0207675_101791554 3300026118 Bacteria 633
548 Ga0207683_10066596 3300026121 Bacteria 3176
549 Ga0207683_10191690 3300026121 Bacteria 1856
550 Ga0207683_10230459 3300026121 Bacteria 1689
551 Ga0207683_10690474 3300026121 Bacteria 946
552 Ga0207698_10381444 3300026142 Bacteria 1341
553 Ga0207698_10572022 3300026142 Bacteria 1110
554 Ga0207698_10668934 3300026142 Bacteria 1030
555 Ga0207698_11694482 3300026142 Unclassified 647
556 Ga0207698_11807638 3300026142 Unclassified 626
557 Ga0209966_1053278 3300027695 Bacteria 864
558 Ga0209813_10183075 3300027866 Bacteria 767
559 Ga0207428_10022408 3300027907 Bacteria 5332
560 Ga0207428_10044083 3300027907 Bacteria 3599
561 Ga0207428_10048822 3300027907 Bacteria 3394
562 Ga0268266_10131246 3300028379 Bacteria 2241
563 Ga0268266_10530191 3300028379 Bacteria 1127
564 Ga0268265_12571629 3300028380 Unclassified 515
565 Ga0268264_10336162 3300028381 Unclassified 1433
566 Ga0268264_10457007 3300028381 Bacteria 1238
567 Ga0268264_10756036 3300028381 Bacteria 969
568 Ga0268264_11013335 3300028381 Bacteria 837
569 Ga0307408_100416610 3300031548 Bacteria 1157
570 Ga0307406_11436023 3300031901 Unclassified 606
571 Ga0307409_100500339 3300031995 Bacteria 1183
572 Ga0307416_101247565 3300032002 Bacteria 849
573 Ga0373948_0060023 3300034817 Bacteria 833
574 Ga0373950_0057520 3300034818 Bacteria 775
575 Ga0373959_0067710 3300034820 Bacteria 802
576 Ga0373940_0156173 3300035088 Bacteria 730
577 Ga0373944_0044377 3300035089 Bacteria 1384
578 Ga0373939_0192769 3300035114 Bacteria 766
579 Ga0373941_0139404 3300035115 Bacteria 881
580 Ga0373945_0436617 3300035116 Bacteria 577
581 Ga0373960_0023995 3300035121 Bacteria 1646
582 Ga0373960_0160830 3300035121 Unclassified 773
583 Ga0373943_0001408 3300035170 Bacteria 10836
584 Ga0373946_0012024 3300035171 Bacteria 3236
585 Ga0373942_0033833 3300035207 Bacteria 1365
586 Ga0373961_0197532 3300035241 Bacteria 708
587 Ga0373962_0154988 3300035242 Unclassified 752
588 Ga0373931_0055637 3300035691 Bacteria 2118
589 Ga0373931_0272217 3300035691 Bacteria 1037
590 Ga0373931_0465517 3300035691 Bacteria 811
591 Ga0373935_0039298 3300035692 Bacteria 2967
592 Ga0373927_0052390 3300035695 Bacteria 2640
593 Ga0373947_0002309 3300035725 Bacteria 11529
594 Ga0373947_1063685 3300035725 Bacteria 552
595 Ga0373925_0609103 3300037068 Bacteria 899
596 Ga0395899_0004235 3300037312 Bacteria 11237
597 Ga0395899_0035464 3300037312 Bacteria 3744
598 Ga0395899_0629407 3300037312 Bacteria 680
599 Ga0395900_0012636 3300037418 Bacteria 8633
600 Ga0395900_0073202 3300037418 Bacteria 3522
601 Ga0395900_0847468 3300037418 Bacteria 840
602 Ga0395900_1694501 3300037418 Bacteria 543
603 Ga0395900_1713923 3300037418 Bacteria 539
604 Ga0395900_1734728 3300037418 Bacteria 535
605 Ga0395900_1894148 3300037418 Bacteria 507
606 Ga0395898_0001134 3300037466 Bacteria 40919
607 Ga0395898_0073008 3300037466 Bacteria 3314
608 Ga0395898_0138887 3300037466 Bacteria 2326
609 Ga0395898_0214125 3300037466 Bacteria 1838
610 Ga0395898_0487288 3300037466 Bacteria 1173
611 Ga0395898_1071164 3300037466 Bacteria 740
612 Ga0395905_0003817 3300037471 Bacteria 15928
613 Ga0395905_0076236 3300037471 Bacteria 3142
614 Ga0395905_0117919 3300037471 Bacteria 2495
615 Ga0395901_0002439 3300038443 Bacteria 18851
616 Ga0395901_0034721 3300038443 Bacteria 5209
617 Ga0395901_0047755 3300038443 Bacteria 4444
618 Ga0395901_0159746 3300038443 Bacteria 2367
619 Ga0395901_1033374 3300038443 Bacteria 796
620 Ga0451798_1046905 3300041458 Bacteria 814
621 Ga0451807_0586679 3300041486 Bacteria 735
622 Ga0451839_0752502 3300041496 Bacteria 876
623 Ga0451841_0604828 3300041498 Bacteria 606
624 Ga0451851_0837961 3300041507 Bacteria 737
625 Ga0451853_1044495 3300041512 Bacteria 2666
626 Ga0439448_0009113 3300042005 Bacteria 2921
627 Ga0439448_0079156 3300042005 Bacteria 1102
628 Ga0439450_027198 3300042008 Bacteria 1266
629 Ga0439450_192264 3300042008 Unclassified 544
630 Ga0439463_096675 3300042016 Unclassified 761
631 Ga0450920_007272 3300042122 Bacteria 2004
632 Ga0450920_098856 3300042122 Unclassified 605
633 Ga0450923_042339 3300042125 Bacteria 960
634 Ga0450896_082328 3300042133 Bacteria 543
635 Ga0450907_028852 3300042146 Bacteria 942
636 Ga0450910_007335 3300042147 Bacteria 1536
637 Ga0450908_036241 3300042184 Bacteria 855
638 Ga0439444_0157302 3300042437 Bacteria 553
639 Ga0439460_0081954 3300042461 Bacteria 1014
640 Ga0439460_0214045 3300042461 Bacteria 659
641 Ga0466964_0062236 3300044706 Bacteria 1556
642 Ga0451576_0060640 3300045051 Bacteria 3946
643 Ga0495603_0000062 3300046455 Bacteria 46880
644 Ga0495603_0016767 3300046455 Bacteria 4431
645 Ga0495603_0025838 3300046455 Bacteria 3550
646 Ga0495641_0003838 3300046461 Bacteria 10974
647 Ga0495580_0039712 3300046472 Bacteria 3367
648 Ga0495582_0036669 3300046473 Bacteria 2697
649 Ga0495605_0320720 3300046474 Bacteria 653
650 Ga0495584_0165597 3300046491 Bacteria 1124
651 Ga0495594_0002020 3300046499 Bacteria 10571
652 Ga0495594_0106650 3300046499 Bacteria 1578
653 Ga0495596_0061112 3300046500 Bacteria 1468
654 Ga0495596_0334296 3300046500 Bacteria 589
655 Ga0495596_0341388 3300046500 Bacteria 583
656 Ga0495596_0360814 3300046500 Bacteria 566
657 Ga0495644_0197700 3300046523 Bacteria 775
658 Ga0495666_0124225 3300046526 Bacteria 1207
659 Ga0495665_0392461 3300046531 Bacteria 704
660 Ga0495609_0301016 3300046538 Bacteria 653
661 Ga0495656_0269587 3300046615 Bacteria 865
662 Ga0495656_0715657 3300046615 Bacteria 539
663 Ga0495668_0206420 3300046616 Bacteria 1076
664 Ga0495659_0173834 3300046664 Bacteria 875
665 Ga0495588_0005698 3300046674 Bacteria 5556
666 Ga0495588_0069734 3300046674 Bacteria 1827
667 Ga0495658_0180881 3300046683 Bacteria 1308
668 Ga0495669_0195988 3300046684 Bacteria 965
669 Ga0495624_0849902 3300046690 Bacteria 538
670 Ga0495671_0332850 3300046692 Bacteria 729
671 Ga0495676_0000253 3300047321 Bacteria 43107
672 Ga0495676_0096553 3300047321 Bacteria 2197
673 Ga0495677_0075933 3300047445 Bacteria 1256
674 Ga0495677_0193026 3300047445 Bacteria 791
675 Ga0495677_0253959 3300047445 Bacteria 688
676 Ga0496100_0052119 3300048903 Bacteria 2659
677 Ga0496100_0127948 3300048903 Bacteria 1785
678 Ga0496100_0634510 3300048903 Bacteria 831
679 Ga0496100_0828651 3300048903 Bacteria 725
680 Ga0496100_0999625 3300048903 Bacteria 658
681 Ga0496100_1297894 3300048903 Bacteria 574
682 Ga0496101_0256785 3300048904 Bacteria 1362
683 Ga0496101_0277442 3300048904 Bacteria 1309
684 Ga0496101_0461887 3300048904 Bacteria 1002
685 Ga0496101_0610755 3300048904 Bacteria 862
686 Ga0496101_0637387 3300048904 Bacteria 842
687 Ga0496101_0667487 3300048904 Bacteria 821
688 Ga0496101_0724211 3300048904 Bacteria 785
689 Ga0496101_1145429 3300048904 Bacteria 610
690 Ga0496102_0094447 3300048905 Bacteria 2771
691 Ga0496102_0126898 3300048905 Bacteria 2385
692 Ga0496102_0302348 3300048905 Bacteria 1508
693 Ga0496102_0325628 3300048905 Bacteria 1447
694 Ga0496102_0420931 3300048905 Bacteria 1255
695 Ga0496102_0601168 3300048905 Bacteria 1023
696 Ga0496102_0699399 3300048905 Bacteria 937
697 Ga0496103_0095855 3300048906 Bacteria 1875
698 Ga0496104_0002395 3300048907 Bacteria 16153
699 Ga0496104_0073363 3300048907 Bacteria 3256
700 Ga0496104_0274975 3300048907 Bacteria 1597
701 Ga0496104_0563780 3300048907 Bacteria 1049
702 Ga0496104_0999672 3300048907 Bacteria 740
703 Ga0496105_0000042 3300048908 Bacteria 114886
704 Ga0496105_0305387 3300048908 Bacteria 1278
705 Ga0496105_0384457 3300048908 Bacteria 1116
706 Ga0496106_0178991 3300048909 Bacteria 1683
707 Ga0496106_0188681 3300048909 Bacteria 1638
708 Ga0496106_0271575 3300048909 Bacteria 1358
709 Ga0496106_0414042 3300048909 Bacteria 1083
710 Ga0496106_0636972 3300048909 Bacteria 852
711 Ga0496106_0662847 3300048909 Bacteria 833
712 Ga0496106_0704778 3300048909 Bacteria 804
713 Ga0496106_0768142 3300048909 Bacteria 765
714 Ga0496106_1396170 3300048909 Bacteria 541
715 Ga0496107_0077492 3300048910 Bacteria 2421
716 Ga0496107_0105455 3300048910 Bacteria 2069
717 Ga0496107_0439682 3300048910 Bacteria 969
718 Ga0496107_0564734 3300048910 Bacteria 842
719 Ga0496107_0664988 3300048910 Bacteria 767
720 Ga0496107_0725021 3300048910 Bacteria 730
721 Ga0496107_1349502 3300048910 Unclassified 509
722 Ga0496108_0002754 3300048911 Bacteria 14078
723 Ga0496108_0033119 3300048911 Bacteria 4292
724 Ga0496108_0051012 3300048911 Bacteria 3466
725 Ga0496108_0171426 3300048911 Bacteria 1877
726 Ga0496108_0492105 3300048911 Bacteria 1071
727 Ga0496108_0732674 3300048911 Bacteria 856
728 Ga0496108_0967658 3300048911 Bacteria 728
729 Ga0496108_1322306 3300048911 Bacteria 605
730 Ga0496108_1390801 3300048911 Unclassified 587
731 Ga0496109_0001556 3300048912 Bacteria 19097
732 Ga0496109_0009811 3300048912 Bacteria 8174
733 Ga0496109_0127897 3300048912 Bacteria 2369
734 Ga0496109_0140923 3300048912 Bacteria 2254
735 Ga0496109_0227760 3300048912 Bacteria 1753
736 Ga0496109_0338711 3300048912 Bacteria 1420
737 Ga0496109_0594858 3300048912 Bacteria 1042
738 Ga0496109_0627211 3300048912 Bacteria 1011
739 Ga0496109_0821848 3300048912 Bacteria 867
740 Ga0496110_0000050 3300048913 Bacteria 59023
741 Ga0496110_0013446 3300048913 Bacteria 6767
742 Ga0496110_0033837 3300048913 Bacteria 4423
743 Ga0496110_0048460 3300048913 Bacteria 3725
744 Ga0496110_0108922 3300048913 Bacteria 2487
745 Ga0496110_0449580 3300048913 Bacteria 1174
746 Ga0496110_0536734 3300048913 Bacteria 1063
747 Ga0496110_1253515 3300048913 Bacteria 650
748 Ga0496110_1266990 3300048913 Bacteria 646
749 Ga0496110_1700993 3300048913 Bacteria 541
750 Ga0496111_0000526 3300048914 Bacteria 19794
751 Ga0496111_0002269 3300048914 Bacteria 11550
752 Ga0496111_0023501 3300048914 Bacteria 4328
753 Ga0496111_0068576 3300048914 Bacteria 2578
754 Ga0496111_0109820 3300048914 Bacteria 2031
755 Ga0496111_0357351 3300048914 Bacteria 1081
756 Ga0496111_0432774 3300048914 Bacteria 971
757 Ga0496111_0478566 3300048914 Bacteria 917
758 Ga0496112_0000082 3300048915 Bacteria 62404
759 Ga0496112_0235958 3300048915 Bacteria 1782
760 Ga0496112_0452856 3300048915 Bacteria 1221
761 Ga0496112_1320767 3300048915 Bacteria 637
762 Ga0496113_0001494 3300048916 Bacteria 13081
763 Ga0496113_0026440 3300048916 Bacteria 4150
764 Ga0496113_0406984 3300048916 Bacteria 1092
765 Ga0496113_0512444 3300048916 Bacteria 963
766 Ga0496113_0629562 3300048916 Bacteria 858
767 Ga0496114_0072179 3300048917 Bacteria 2902
768 Ga0496114_0083012 3300048917 Bacteria 2710
769 Ga0496114_0148235 3300048917 Bacteria 2035
770 Ga0496114_0217577 3300048917 Bacteria 1676
771 Ga0496114_0278952 3300048917 Bacteria 1473
772 Ga0496114_0474317 3300048917 Bacteria 1107
773 Ga0496114_0515124 3300048917 Bacteria 1058
774 Ga0496114_0674194 3300048917 Bacteria 908
775 Ga0496115_0002613 3300048918 Bacteria 12927
776 Ga0501031_0017813 3300049568 Bacteria 4619
777 Ga0501031_0220325 3300049568 Bacteria 1235
778 Ga0501031_0478068 3300049568 Bacteria 804
779 Ga0501032_0083075 3300049569 Bacteria 2130
780 Ga0501032_0111752 3300049569 Bacteria 1808
781 Ga0501032_1047636 3300049569 Bacteria 512
782 Ga0501033_0371812 3300049570 Bacteria 999
783 Ga0501034_0419815 3300049571 Unclassified 1259
784 Ga0501036_0063466 3300049572 Bacteria 3128
785 Ga0501036_0078082 3300049572 Bacteria 2800
786 Ga0501036_0468141 3300049572 Bacteria 1049
787 Ga0501037_0016378 3300049573 Bacteria 5455
788 Ga0501037_0309598 3300049573 Bacteria 1095
789 Ga0501038_0036729 3300049574 Bacteria 4299
790 Ga0501038_0592874 3300049574 Bacteria 839
791 Ga0501038_0657468 3300049574 Bacteria 788
792 Ga0501038_0906625 3300049574 Bacteria 650
793 Ga0501039_0018179 3300049575 Bacteria 5395
794 Ga0501039_0072042 3300049575 Bacteria 2685
795 Ga0501039_0288361 3300049575 Bacteria 1290
796 Ga0501040_0049904 3300049576 Bacteria 2861
797 Ga0501040_0165071 3300049576 Bacteria 1566
798 Ga0501040_0737684 3300049576 Bacteria 712
799 Ga0501041_0005410 3300049577 Bacteria 7479
800 Ga0501041_0067255 3300049577 Bacteria 2196
801 Ga0501041_0111961 3300049577 Bacteria 1693
802 Ga0501042_0018997 3300049578 Bacteria 4768
803 Ga0501042_0088596 3300049578 Bacteria 2220
804 Ga0501042_0113166 3300049578 Bacteria 1954
805 Ga0501042_0589134 3300049578 Bacteria 808
806 Ga0501042_0755863 3300049578 Unclassified 707
807 Ga0501042_1104858 3300049578 Bacteria 578
808 Ga0501043_1179549 3300049579 Unclassified 538
809 Ga0501046_0007561 3300049580 Bacteria 9531
810 Ga0501046_0402085 3300049580 Bacteria 989
811 Ga0501047_0603148 3300049581 Bacteria 919
812 Ga0501048_0032605 3300049582 Bacteria 3764
813 Ga0501048_0041377 3300049582 Bacteria 3301
814 Ga0501048_0093518 3300049582 Bacteria 2120
815 Ga0501048_0230973 3300049582 Bacteria 1313
816 Ga0501068_0013004 3300049584 Bacteria 4729
817 Ga0501068_0026326 3300049584 Bacteria 3425
818 Ga0501068_0249429 3300049584 Bacteria 1131
819 Ga0501068_0692005 3300049584 Bacteria 666
820 Ga0501069_0018148 3300049585 Bacteria 3794
821 Ga0501069_0651481 3300049585 Bacteria 634
822 Ga0501070_0033872 3300049586 Bacteria 4273
823 Ga0501070_0224690 3300049586 Bacteria 1539
824 Ga0501070_1388283 3300049586 Bacteria 534
825 Ga0501071_0009522 3300049587 Bacteria 6476
826 Ga0501071_0014401 3300049587 Bacteria 5409
827 Ga0501071_0015339 3300049587 Bacteria 5258
828 Ga0501071_0171424 3300049587 Bacteria 1624
829 Ga0501071_0616010 3300049587 Bacteria 835
830 Ga0501072_0008485 3300049588 Bacteria 7796
831 Ga0501072_0008586 3300049588 Bacteria 7751
832 Ga0501072_0018481 3300049588 Bacteria 5369
833 Ga0501072_0048393 3300049588 Bacteria 3348
834 Ga0501072_1092005 3300049588 Bacteria 621
835 Ga0501073_0009910 3300049589 Bacteria 7010
836 Ga0501073_0136950 3300049589 Bacteria 1697
837 Ga0501074_0010041 3300049590 Bacteria 6872
838 Ga0501074_0078386 3300049590 Bacteria 2371
839 Ga0501074_0082791 3300049590 Bacteria 2301
840 Ga0501075_0038515 3300049591 Bacteria 3574
841 Ga0501075_0044561 3300049591 Bacteria 3328
842 Ga0501075_0142329 3300049591 Bacteria 1828
843 Ga0501075_0196945 3300049591 Bacteria 1536
844 Ga0501075_0705588 3300049591 Bacteria 768
845 Ga0501076_0010968 3300049592 Bacteria 6740
846 Ga0501076_0014607 3300049592 Bacteria 5920
847 Ga0501076_0053952 3300049592 Bacteria 3186
848 Ga0501076_0111260 3300049592 Bacteria 2213
849 Ga0501076_0487882 3300049592 Bacteria 1015
850 Ga0501077_0005770 3300049593 Bacteria 7542
851 Ga0501077_0010295 3300049593 Bacteria 5820
852 Ga0501077_0017115 3300049593 Bacteria 4571
853 Ga0501079_0005628 3300049741 Bacteria 9352
854 Ga0501079_0026199 3300049741 Bacteria 4470
855 Ga0501079_0028987 3300049741 Bacteria 4249
856 Ga0501079_0122850 3300049741 Bacteria 2019
857 Ga0501080_0027888 3300049742 Bacteria 5251
858 Ga0501080_0079641 3300049742 Bacteria 3045
859 Ga0501080_0111636 3300049742 Bacteria 2534
860 Ga0501080_0667025 3300049742 Bacteria 919
861 Ga0501080_1307842 3300049742 Bacteria 621
862 Ga0501080_1400738 3300049742 Bacteria 596
863 Ga0501081_0008677 3300049743 Bacteria 6604
864 Ga0501081_0069479 3300049743 Bacteria 2454
865 Ga0501081_0084541 3300049743 Bacteria 2226
866 Ga0501081_0163777 3300049743 Bacteria 1603
867 Ga0501081_0679893 3300049743 Bacteria 772
868 Ga0501083_0009849 3300049744 Bacteria 6745
869 Ga0501083_0247609 3300049744 Bacteria 1160
870 Ga0501083_0356567 3300049744 Bacteria 951
871 Ga0501035_0031335 3300049822 Bacteria 4843
872 Ga0501035_0054816 3300049822 Bacteria 3561
873 Ga0501035_0579613 3300049822 Bacteria 916
874 Ga0501044_0230646 3300049823 Bacteria 1799
875 Ga0501044_0385605 3300049823 Bacteria 1316
876 Ga0501044_1406775 3300049823 Bacteria 563
877 Ga0501045_0006345 3300049824 Bacteria 8181
878 Ga0501045_0027992 3300049824 Bacteria 4065
879 Ga0501045_0135421 3300049824 Bacteria 1831
880 Ga0501045_0887607 3300049824 Bacteria 655
881 nmdc:mga00v17_291940_c1 3300050491 Bacteria 1059
882 nmdc:mga06z11_1020904_c1 3300050494 Unclassified 504
883 nmdc:mga06z11_127894_c1 3300050494 Bacteria 1423
884 nmdc:mga04h51_182743_c1 3300050495 Bacteria 817
885 nmdc:mga07m45_901530_c1 3300050496 Unclassified 506
886 nmdc:mga05p37_1229887_c1 3300050507 Unclassified 771
887 nmdc:mga05p37_292783_c1 3300050507 Bacteria 1937
888 nmdc:mga05p37_602208_c1 3300050507 Bacteria 1240
889 nmdc:mga09592_298310_c1 3300050508 Bacteria 1397
890 nmdc:mga06r32_593548_c1 3300050510 Bacteria 1079
891 nmdc:mga08y16_2108790_c1 3300050511 Unclassified 511
892 nmdc:mga08y16_57166_c1 3300050511 Bacteria 4077
893 nmdc:mga08y16_974595_c1 3300050511 Unclassified 829
894 nmdc:mga0n895_1179968_c1 3300050512 Bacteria 740
895 nmdc:mga0n895_1185129_c1 3300050512 Bacteria 738
896 nmdc:mga0n895_198878_c1 3300050512 Bacteria 2036
897 nmdc:mga0n895_530970_c1 3300050512 Bacteria 1183
898 nmdc:mga0n895_550770_c1 3300050512 Bacteria 1159
899 nmdc:mga0rr50_1047425_c1 3300050513 Bacteria 695
900 nmdc:mga0rr50_1219476_c1 3300050513 Bacteria 639
901 nmdc:mga0rr50_124593_c1 3300050513 Bacteria 2055
902 nmdc:mga0rr50_1438969_c1 3300050513 Bacteria 583
903 nmdc:mga08x19_211196_c1 3300050514 Archaea 1332
904 nmdc:mga08x19_505739_c1 3300050514 Bacteria 853
905 nmdc:mga08x19_80181_c1 3300050514 Bacteria 2142
906 nmdc:mga0a205_406258_c1 3300050515 Bacteria 1225
907 Ga0501084_0006750 3300054114 Bacteria 9435
908 Ga0501084_0009833 3300054114 Bacteria 7902
909 Ga0501084_0139744 3300054114 Bacteria 2039
910 Ga0501084_0257220 3300054114 Bacteria 1474
911 Ga0501084_0381876 3300054114 Bacteria 1190
912 Ga0501084_1554570 3300054114 Bacteria 553
913 Ga0501082_0007473 3300060353 Bacteria 9428
914 Ga0501082_0151030 3300060353 Bacteria 2017
915 Ga0501082_0485771 3300060353 Bacteria 1079
916 Ga0501082_1644841 3300060353 Bacteria 560
917 Ga0530510_0016010 3300061734 Bacteria 5299
918 Ga0530510_0037375 3300061734 Bacteria 3501
919 Ga0530510_0472334 3300061734 Bacteria 949
920 Ga0530510_0646574 3300061734 Bacteria 805
921 Ga0530510_0701598 3300061734 Bacteria 771
922 Ga0070705_101055970
923 JGI24737J22298_10190900
924 JGI24743J22301_10013514
925 JGI24738J21930_10020539
926 JGI25406J46586_10034684
927 JGI25404J52841_10012223
928 Ga0070658_10256720
929 Ga0070658_11650446
930 Ga0070676_10149224
931 Ga0070676_10593347
932 Ga0070676_10708095
933 Ga0070683_100004187
934 Ga0070683_100009295
935 Ga0070683_100017232
936 Ga0070683_100044799
937 Ga0070683_100168394
938 Ga0070683_100272013
939 Ga0070683_101164505
940 Ga0070690_100273930
941 Ga0070677_10632460
942 Ga0068869_100073954
943 Ga0068869_100666380
944 Ga0070666_11007603
945 Ga0070680_100008967
946 Ga0070680_100264099
947 Ga0070680_100456192
948 Ga0070680_100487061
949 Ga0070680_100943486
950 Ga0070682_100024989
951 Ga0070682_100040603
952 Ga0070682_100070650
953 Ga0070682_100541123
954 Ga0068868_100040090
955 Ga0068868_100181678
956 Ga0068868_100211588
957 Ga0068868_100473634
958 Ga0068868_100477093
959 Ga0068868_100783243
960 Ga0068868_101875638
961 Ga0070660_100016432
962 Ga0070660_100222984
963 Ga0070660_100581352
964 Ga0070660_101109540
965 Ga0070689_100199121
966 Ga0070689_100200905
967 Ga0070691_10108896
968 Ga0070691_10270511
969 Ga0070691_10686930
970 Ga0070691_11048878
971 Ga0070687_100229069
972 Ga0070687_100732612
973 Ga0070661_100006593
974 Ga0070661_100319411
975 Ga0070692_10024071
976 Ga0070692_10051722
977 Ga0070692_10106002
978 Ga0070692_10107647
979 Ga0070668_100203618
980 Ga0070668_100303362
981 Ga0070668_100639986
982 Ga0070668_100842599
983 Ga0070668_101772557
984 Ga0070675_100149358
985 Ga0070675_100378269
986 Ga0070671_100129369
987 Ga0070671_101979463
988 Ga0070674_100069468
989 Ga0070674_100355808
990 Ga0070674_100383843
991 Ga0070674_101248313
992 Ga0070674_101360126
993 Ga0070674_101548775
994 Ga0070673_100025464
995 Ga0070673_100192644
996 Ga0070673_100577312
997 Ga0070673_101263549
998 Ga0070673_101537862
999 Ga0070673_102049678
1000 Ga0070688_100003608
1001 Ga0070688_100454156
1002 Ga0070688_100716930
1003 Ga0070659_100036350
1004 Ga0070659_100121076
1005 Ga0070659_101017632
1006 Ga0070659_101205320
1007 Ga0070659_101970613
1008 Ga0070667_100594549
1009 Ga0070703_10140885
1010 Ga0070703_10545381
1011 Ga0070713_100022984
1012 Ga0070710_11421924
1013 Ga0070701_10284012
1014 Ga0070705_100089502
1015 Ga0070705_100579358
1016 Ga0070705_100588542
1017 Ga0070705_100739093
1018 Ga0070700_100107924
1019 Ga0070700_100125766
1020 Ga0070694_100566975
1021 Ga0070694_100765830
1022 Ga0070694_101880363
1023 Ga0070663_101092612
1024 Ga0070678_100021888
1025 Ga0070678_100151635
1026 Ga0070678_100513621
1027 Ga0070678_101060583
1028 Ga0070662_100021694
1029 Ga0070662_100039565
1030 Ga0070662_100048457
1031 Ga0070662_100642126
1032 Ga0070681_10038304
1033 Ga0070681_10040518
1034 Ga0070681_11804617
1035 Ga0068867_100046516
1036 Ga0068867_100201746
1037 Ga0068867_100758544
1038 Ga0068867_101492957
1039 Ga0070685_10249667
1040 Ga0070685_10361197
1041 Ga0070706_100486670
1042 Ga0070707_100099324
1043 Ga0070707_100489130
1044 Ga0070699_100771548
1045 Ga0070679_100016785
1046 Ga0070679_100046212
1047 Ga0070679_100111207
1048 Ga0070679_100593872
1049 Ga0070679_101135059
1050 Ga0070684_100036549
1051 Ga0070684_100049803
1052 Ga0070684_100062427
1053 Ga0070684_100064871
1054 Ga0070684_100097995
1055 Ga0070684_100124781
1056 Ga0070684_100267737
1057 Ga0070684_100269003
1058 Ga0070684_101934732
1059 Ga0070697_100871427
1060 Ga0070697_101817825
1061 Ga0068853_100197175
1062 Ga0068853_100260431
1063 Ga0068853_100538946
1064 Ga0070672_100070398
1065 Ga0070672_100071365
1066 Ga0070672_101716742
1067 Ga0070686_100016843
1068 Ga0070686_100017937
1069 Ga0070686_100071411
1070 Ga0070686_100477747
1071 Ga0070695_100174990
1072 Ga0070695_100486346
1073 Ga0070695_101281538
1074 Ga0070696_100171194
1075 Ga0070696_100892145
1076 Ga0070693_100122850
1077 Ga0070693_100212207
1078 Ga0070693_100305273
1079 Ga0070693_100398586
1080 Ga0070693_100555202
1081 Ga0070693_101054961
1082 Ga0070665_100181017
1083 Ga0070665_102017666
1084 Ga0070704_100062878
1085 Ga0070704_100189901
1086 Ga0070704_101223038
1087 Ga0070704_102052071
1088 Ga0070704_102111069
1089 Ga0068855_100020351
1090 Ga0068855_100068256
1091 Ga0068855_100096059
1092 Ga0068855_100784457
1093 Ga0068855_102095052
1094 Ga0070664_100208256
1095 Ga0070664_100409660
1096 Ga0070664_100427434
1097 Ga0070664_100475232
1098 Ga0068857_101591349
1099 Ga0068854_100192583
1100 Ga0068854_100254415
1101 Ga0068854_100434648
1102 Ga0068854_101916622
1103 Ga0068856_100036581
1104 Ga0068856_100077802
1105 Ga0068856_100144989
1106 Ga0068856_100611494
1107 Ga0068856_101465612
1108 Ga0068856_102496901
1109 Ga0070702_100010629
1110 Ga0070702_100342625
1111 Ga0070702_101109646
1112 Ga0070702_101351026
1113 Ga0068852_100219396
1114 Ga0068852_100266846
1115 Ga0068852_100445887
1116 Ga0068852_100786849
1117 Ga0068852_102826170
1118 Ga0068859_100081294
1119 Ga0068864_100015893
1120 Ga0068864_100048158
1121 Ga0068864_100176828
1122 Ga0068864_101392873
1123 Ga0068864_101538972
1124 Ga0068866_10033553
1125 Ga0068866_10064853
1126 Ga0068866_10952635
1127 Ga0068861_100010813
1128 Ga0068861_100324161
1129 Ga0068861_101712586
1130 Ga0068851_10076213
1131 Ga0068851_10096013
1132 Ga0068870_10042671
1133 Ga0068870_10120621
1134 Ga0068870_10264045
1135 Ga0068870_10298231
1136 Ga0068870_10510642
1137 Ga0068870_11432667
1138 Ga0068863_100324635
1139 Ga0068863_100671841
1140 Ga0068858_100110298
1141 Ga0068858_100494287
1142 Ga0068858_101926221
1143 Ga0068860_100286833
1144 Ga0068860_100676816
1145 Ga0068860_100882083
1146 Ga0081455_10030039
1147 Ga0081455_10603165
1148 Ga0081540_1003454
1149 Ga0081540_1023280
1150 Ga0081539_10000978
1151 Ga0070717_10013090
1152 Ga0075365_10183687
1153 Ga0075365_10442478
1154 Ga0075368_10229450
1155 Ga0075363_100363227
1156 Ga0075363_100393991
1157 Ga0075363_100553814
1158 Ga0075364_10529289
1159 Ga0075432_10001539
1160 Ga0070712_100308107
1161 Ga0070712_100873024
1162 Ga0075367_11113454
1163 Ga0097621_100051825
1164 Ga0097621_100249911
1165 Ga0097621_100375602
1166 Ga0097621_100866051
1167 Ga0075370_10783005
1168 Ga0068871_100097648
1169 Ga0068871_100227263
1170 Ga0068871_101848257
1171 Ga0075428_100003460
1172 Ga0075428_100237586
1173 Ga0075428_100393187
1174 Ga0075431_100301091
1175 Ga0075434_100660933
1176 Ga0075434_100889686
1177 Ga0075434_101373460
1178 Ga0075434_101420462
1179 Ga0075429_100297257
1180 Ga0075429_100360990
1181 Ga0068865_100028182
1182 Ga0068865_100391962
1183 Ga0068865_101202200
1184 Ga0068865_101576751
1185 Ga0068865_101829732
1186 Ga0075436_100018846
1187 Ga0075436_100049205
1188 Ga0075436_100987440
1189 Ga0097620_100081297
1190 Ga0105244_10112925
1191 Ga0105240_10420972
1192 Ga0111539_10036879
1193 Ga0111539_10069292
1194 Ga0111539_10499976
1195 Ga0105245_10065228
1196 Ga0105245_10087256
1197 Ga0105245_10087373
1198 Ga0105245_10097243
1199 Ga0105245_10184885
1200 Ga0105245_10576279
1201 Ga0105245_10908018
1202 Ga0105245_11607953
1203 Ga0105245_12162962
1204 Ga0105245_13021208
1205 Ga0105247_10050683
1206 Ga0105247_10792207
1207 Ga0105247_10907001
1208 Ga0114129_10256385
1209 Ga0114129_10506931
1210 Ga0114129_10669098
1211 Ga0114129_10749384
1212 Ga0105243_10003840
1213 Ga0105243_10143297
1214 Ga0105243_10179958
1215 Ga0105243_10553661
1216 Ga0105243_12045669
1217 Ga0105241_10324872
1218 Ga0105241_10680635
1219 Ga0105241_11107754
1220 Ga0105242_10132792
1221 Ga0105242_10141952
1222 Ga0105242_10158916
1223 Ga0105242_10390537
1224 Ga0105242_10447675
1225 Ga0105242_10472801
1226 Ga0105242_10838446
1227 Ga0105242_12484357
1228 Ga0105248_10131241
1229 Ga0105248_10230788
1230 Ga0105248_10363727
1231 Ga0105248_10785240
1232 Ga0105237_10105371
1233 Ga0105237_10665403
1234 Ga0105238_10241071
1235 Ga0105238_10259710
1236 Ga0105238_10294251
1237 Ga0105238_10376241
1238 Ga0105238_11440903
1239 Ga0105249_10083739
1240 Ga0105249_10528149
1241 Ga0105249_12823852
1242 Ga0105239_10033305
1243 Ga0105239_10046075
1244 Ga0105239_10051615
1245 Ga0105239_10157597
1246 Ga0105239_10452257
1247 Ga0105239_10570863
1248 Ga0105239_11911367
1249 Ga0105246_10106901
1250 Ga0105246_10254337
1251 Ga0105246_10312602
1252 Ga0105246_10420601
1253 Ga0157337_1008902
1254 Ga0157341_1005684
1255 Ga0157313_1054633
1256 Ga0157373_11110812
1257 Ga0157373_11476584
1258 Ga0157371_10096399
1259 Ga0157371_10438163
1260 Ga0157371_10513727
1261 Ga0157370_10103163
1262 Ga0157369_10205845
1263 Ga0157369_10743397
1264 Ga0157369_12303883
1265 Ga0157374_10068854
1266 Ga0157374_10221341
1267 Ga0157374_10765804
1268 Ga0157378_10148194
1269 Ga0157378_11010223
1270 Ga0157378_11432563
1271 Ga0157378_12269790
1272 Ga0163162_10179778
1273 Ga0163162_10261712
1274 Ga0163162_11024674
1275 Ga0157372_10011911
1276 Ga0157372_11369739
1277 Ga0157375_10025689
1278 Ga0157375_10063532
1279 Ga0157375_10125172
1280 Ga0157375_10139952
1281 Ga0157375_10331809
1282 Ga0157375_10365241
1283 Ga0157375_10584275
1284 Ga0163163_10156580
1285 Ga0163163_10230439
1286 Ga0163163_11348760
1287 Ga0163163_11828417
1288 Ga0157380_10025107
1289 Ga0157380_10367529
1290 Ga0157380_10732297
1291 Ga0157380_11124684
1292 Ga0182008_10195256
1293 Ga0157377_10019616
1294 Ga0157377_10138047
1295 Ga0157377_10190829
1296 Ga0157377_10406310
1297 Ga0157377_10593726
1298 Ga0157377_10833678
1299 Ga0157379_10039429
1300 Ga0157379_10283619
1301 Ga0157379_11256178
1302 Ga0157376_10618443
1303 Ga0157376_10647123
1304 Ga0163161_10030464
1305 Ga0163161_10075868
1306 Ga0163161_10207043
1307 Ga0163161_10387956
1308 Ga0163161_10587547
1309 Ga0163161_11427611
1310 Ga0206356_10967055
1311 Ga0206353_11449428
1312 Ga0207656_10081554
1313 Ga0207653_10056033
1314 Ga0207682_10606777
1315 Ga0207642_10056236
1316 Ga0207642_10134968
1317 Ga0207642_10517818
1318 Ga0207642_10776860
1319 Ga0207710_10085379
1320 Ga0207688_10040148
1321 Ga0207688_10296281
1322 Ga0207688_10300688
1323 Ga0207688_10628115
1324 Ga0207680_11139296
1325 Ga0207647_10138491
1326 Ga0207645_10112108
1327 Ga0207645_10168098
1328 Ga0207645_11091398
1329 Ga0207643_10118010
1330 Ga0207643_10140642
1331 Ga0207705_11384143
1332 Ga0207654_10286192
1333 Ga0207654_10391158
1334 Ga0207707_10106717
1335 Ga0207707_10401790
1336 Ga0207707_10902852
1337 Ga0207695_10247254
1338 Ga0207671_10723753
1339 Ga0207693_10535382
1340 Ga0207693_10782006
1341 Ga0207660_10052394
1342 Ga0207660_10184184
1343 Ga0207660_10201282
1344 Ga0207660_10606778
1345 Ga0207660_10910332
1346 Ga0207662_10759817
1347 Ga0207657_10065072
1348 Ga0207657_10072441
1349 Ga0207657_10567735
1350 Ga0207657_11146839
1351 Ga0207649_10050312
1352 Ga0207649_10516617
1353 Ga0207652_10431662
1354 Ga0207652_10622908
1355 Ga0207646_10644278
1356 Ga0207646_10900714
1357 Ga0207681_10480592
1358 Ga0207694_10386966
1359 Ga0207650_10179837
1360 Ga0207659_10078197
1361 Ga0207659_10171844
1362 Ga0207659_10402734
1363 Ga0207687_10048606
1364 Ga0207687_10073118
1365 Ga0207687_10097628
1366 Ga0207687_10107671
1367 Ga0207687_10192144
1368 Ga0207687_10299451
1369 Ga0207700_10336741
1370 Ga0207644_10427632
1371 Ga0207690_10077096
1372 Ga0207690_10191705
1373 Ga0207690_10598645
1374 Ga0207690_10631660
1375 Ga0207706_10007338
1376 Ga0207706_10022994
1377 Ga0207706_10097410
1378 Ga0207706_10108954
1379 Ga0207706_10146363
1380 Ga0207686_10075073
1381 Ga0207686_10455942
1382 Ga0207686_10567097
1383 Ga0207686_11154915
1384 Ga0207686_11282600
1385 Ga0207709_10042871
1386 Ga0207709_10201754
1387 Ga0207709_10203090
1388 Ga0207709_10659735
1389 Ga0207709_11284256
1390 Ga0207709_11672655
1391 Ga0207669_10062349
1392 Ga0207669_11092369
1393 Ga0207704_10112474
1394 Ga0207704_11204705
1395 Ga0207704_11653796
1396 Ga0207704_11758596
1397 Ga0207704_11769431
1398 Ga0207665_11376094
1399 Ga0207691_10003824
1400 Ga0207691_11128756
1401 Ga0207711_10124490
1402 Ga0207711_10128252
1403 Ga0207711_10135073
1404 Ga0207689_10060488
1405 Ga0207661_10003179
1406 Ga0207661_10031560
1407 Ga0207661_10112898
1408 Ga0207661_10549953
1409 Ga0207661_10596788
1410 Ga0207661_10773436
1411 Ga0207661_10976420
1412 Ga0207661_11505420
1413 Ga0207661_12033437
1414 Ga0207679_10100206
1415 Ga0207679_10558087
1416 Ga0207679_11316497
1417 Ga0207667_10105163
1418 Ga0207667_10149058
1419 Ga0207667_10183674
1420 Ga0207651_10998074
1421 Ga0207712_10397255
1422 Ga0207712_10815956
1423 Ga0207712_11222525
1424 Ga0207668_10173483
1425 Ga0207668_10231621
1426 Ga0207668_10383154
1427 Ga0207640_10058274
1428 Ga0207640_10090318
1429 Ga0207640_10093969
1430 Ga0207640_10305066
1431 Ga0207640_10373240
1432 Ga0207658_10809604
1433 Ga0207658_11262801
1434 Ga0207677_10040542
1435 Ga0207677_11771581
1436 Ga0207677_11787631
1437 Ga0207677_11864405
1438 Ga0207703_11206747
1439 Ga0207703_11758041
1440 Ga0207639_10618827
1441 Ga0207678_10023618
1442 Ga0207678_10648890
1443 Ga0207708_10071592
1444 Ga0207708_10164864
1445 Ga0207708_11719216
1446 Ga0207702_10132896
1447 Ga0207702_10176673
1448 Ga0207702_10334125
1449 Ga0207702_10803870
1450 Ga0207702_10998949
1451 Ga0207641_10361399
1452 Ga0207641_10939699
1453 Ga0207641_11186825
1454 Ga0207641_12438867
1455 Ga0207648_10036314
1456 Ga0207648_10086057
1457 Ga0207648_10304862
1458 Ga0207676_10149396
1459 Ga0207676_10368215
1460 Ga0207676_10744518
1461 Ga0207674_10008061
1462 Ga0207674_10356864
1463 Ga0207675_100000592
1464 Ga0207675_100114884
1465 Ga0207675_100347281
1466 Ga0207675_100390657
1467 Ga0207675_100439391
1468 Ga0207675_101791554
1469 Ga0207683_10066596
1470 Ga0207683_10191690
1471 Ga0207683_10230459
1472 Ga0207683_10690474
1473 Ga0207698_10381444
1474 Ga0207698_10572022
1475 Ga0207698_10668934
1476 Ga0207698_11694482
1477 Ga0207698_11807638
1478 Ga0209966_1053278
1479 Ga0209813_10183075
1480 Ga0207428_10022408
1481 Ga0207428_10044083
1482 Ga0207428_10048822
1483 Ga0268266_10131246
1484 Ga0268266_10530191
1485 Ga0268265_12571629
1486 Ga0268264_10336162
1487 Ga0268264_10457007
1488 Ga0268264_10756036
1489 Ga0268264_11013335
1490 Ga0307408_100416610
1491 Ga0307406_11436023
1492 Ga0307409_100500339
1493 Ga0307416_101247565
1494 Ga0373948_0060023
1495 Ga0373950_0057520
1496 Ga0373959_0067710
1497 Ga0373940_0156173
1498 Ga0373944_0044377
1499 Ga0373939_0192769
1500 Ga0373941_0139404
1501 Ga0373945_0436617
1502 Ga0373960_0023995
1503 Ga0373960_0160830
1504 Ga0373943_0001408
1505 Ga0373946_0012024
1506 Ga0373942_0033833
1507 Ga0373961_0197532
1508 Ga0373962_0154988
1509 Ga0373931_0055637
1510 Ga0373931_0272217
1511 Ga0373931_0465517
1512 Ga0373935_0039298
1513 Ga0373927_0052390
1514 Ga0373947_0002309
1515 Ga0373947_1063685
1516 Ga0373925_0609103
1517 Ga0395899_0004235
1518 Ga0395899_0035464
1519 Ga0395899_0629407
1520 Ga0395900_0012636
1521 Ga0395900_0073202
1522 Ga0395900_0847468
1523 Ga0395900_1694501
1524 Ga0395900_1713923
1525 Ga0395900_1734728
1526 Ga0395900_1894148
1527 Ga0395898_0001134
1528 Ga0395898_0073008
1529 Ga0395898_0138887
1530 Ga0395898_0214125
1531 Ga0395898_0487288
1532 Ga0395898_1071164
1533 Ga0395905_0003817
1534 Ga0395905_0076236
1535 Ga0395905_0117919
1536 Ga0395901_0002439
1537 Ga0395901_0034721
1538 Ga0395901_0047755
1539 Ga0395901_0159746
1540 Ga0395901_1033374
1541 Ga0451798_1046905
1542 Ga0451807_0586679
1543 Ga0451839_0752502
1544 Ga0451841_0604828
1545 Ga0451851_0837961
1546 Ga0451853_1044495
1547 Ga0439448_0009113
1548 Ga0439448_0079156
1549 Ga0439450_027198
1550 Ga0439450_192264
1551 Ga0439463_096675
1552 Ga0450920_007272
1553 Ga0450920_098856
1554 Ga0450923_042339
1555 Ga0450896_082328
1556 Ga0450907_028852
1557 Ga0450910_007335
1558 Ga0450908_036241
1559 Ga0439444_0157302
1560 Ga0439460_0081954
1561 Ga0439460_0214045
1562 Ga0466964_0062236
1563 Ga0451576_0060640
1564 Ga0495603_0000062
1565 Ga0495603_0016767
1566 Ga0495603_0025838
1567 Ga0495641_0003838
1568 Ga0495580_0039712
1569 Ga0495582_0036669
1570 Ga0495605_0320720
1571 Ga0495584_0165597
1572 Ga0495594_0002020
1573 Ga0495594_0106650
1574 Ga0495596_0061112
1575 Ga0495596_0334296
1576 Ga0495596_0341388
1577 Ga0495596_0360814
1578 Ga0495644_0197700
1579 Ga0495666_0124225
1580 Ga0495665_0392461
1581 Ga0495609_0301016
1582 Ga0495656_0269587
1583 Ga0495656_0715657
1584 Ga0495668_0206420
1585 Ga0495659_0173834
1586 Ga0495588_0005698
1587 Ga0495588_0069734
1588 Ga0495658_0180881
1589 Ga0495669_0195988
1590 Ga0495624_0849902
1591 Ga0495671_0332850
1592 Ga0495676_0000253
1593 Ga0495676_0096553
1594 Ga0495677_0075933
1595 Ga0495677_0193026
1596 Ga0495677_0253959
1597 Ga0496100_0052119
1598 Ga0496100_0127948
1599 Ga0496100_0634510
1600 Ga0496100_0828651
1601 Ga0496100_0999625
1602 Ga0496100_1297894
1603 Ga0496101_0256785
1604 Ga0496101_0277442
1605 Ga0496101_0461887
1606 Ga0496101_0610755
1607 Ga0496101_0637387
1608 Ga0496101_0667487
1609 Ga0496101_0724211
1610 Ga0496101_1145429
1611 Ga0496102_0094447
1612 Ga0496102_0126898
1613 Ga0496102_0302348
1614 Ga0496102_0325628
1615 Ga0496102_0420931
1616 Ga0496102_0601168
1617 Ga0496102_0699399
1618 Ga0496103_0095855
1619 Ga0496104_0002395
1620 Ga0496104_0073363
1621 Ga0496104_0274975
1622 Ga0496104_0563780
1623 Ga0496104_0999672
1624 Ga0496105_0000042
1625 Ga0496105_0305387
1626 Ga0496105_0384457
1627 Ga0496106_0178991
1628 Ga0496106_0188681
1629 Ga0496106_0271575
1630 Ga0496106_0414042
1631 Ga0496106_0636972
1632 Ga0496106_0662847
1633 Ga0496106_0704778
1634 Ga0496106_0768142
1635 Ga0496106_1396170
1636 Ga0496107_0077492
1637 Ga0496107_0105455
1638 Ga0496107_0439682
1639 Ga0496107_0564734
1640 Ga0496107_0664988
1641 Ga0496107_0725021
1642 Ga0496107_1349502
1643 Ga0496108_0002754
1644 Ga0496108_0033119
1645 Ga0496108_0051012
1646 Ga0496108_0171426
1647 Ga0496108_0492105
1648 Ga0496108_0732674
1649 Ga0496108_0967658
1650 Ga0496108_1322306
1651 Ga0496108_1390801
1652 Ga0496109_0001556
1653 Ga0496109_0009811
1654 Ga0496109_0127897
1655 Ga0496109_0140923
1656 Ga0496109_0227760
1657 Ga0496109_0338711
1658 Ga0496109_0594858
1659 Ga0496109_0627211
1660 Ga0496109_0821848
1661 Ga0496110_0000050
1662 Ga0496110_0013446
1663 Ga0496110_0033837
1664 Ga0496110_0048460
1665 Ga0496110_0108922
1666 Ga0496110_0449580
1667 Ga0496110_0536734
1668 Ga0496110_1253515
1669 Ga0496110_1266990
1670 Ga0496110_1700993
1671 Ga0496111_0000526
1672 Ga0496111_0002269
1673 Ga0496111_0023501
1674 Ga0496111_0068576
1675 Ga0496111_0109820
1676 Ga0496111_0357351
1677 Ga0496111_0432774
1678 Ga0496111_0478566
1679 Ga0496112_0000082
1680 Ga0496112_0235958
1681 Ga0496112_0452856
1682 Ga0496112_1320767
1683 Ga0496113_0001494
1684 Ga0496113_0026440
1685 Ga0496113_0406984
1686 Ga0496113_0512444
1687 Ga0496113_0629562
1688 Ga0496114_0072179
1689 Ga0496114_0083012
1690 Ga0496114_0148235
1691 Ga0496114_0217577
1692 Ga0496114_0278952
1693 Ga0496114_0474317
1694 Ga0496114_0515124
1695 Ga0496114_0674194
1696 Ga0496115_0002613
1697 Ga0501031_0017813
1698 Ga0501031_0220325
1699 Ga0501031_0478068
1700 Ga0501032_0083075
1701 Ga0501032_0111752
1702 Ga0501032_1047636
1703 Ga0501033_0371812
1704 Ga0501034_0419815
1705 Ga0501036_0063466
1706 Ga0501036_0078082
1707 Ga0501036_0468141
1708 Ga0501037_0016378
1709 Ga0501037_0309598
1710 Ga0501038_0036729
1711 Ga0501038_0592874
1712 Ga0501038_0657468
1713 Ga0501038_0906625
1714 Ga0501039_0018179
1715 Ga0501039_0072042
1716 Ga0501039_0288361
1717 Ga0501040_0049904
1718 Ga0501040_0165071
1719 Ga0501040_0737684
1720 Ga0501041_0005410
1721 Ga0501041_0067255
1722 Ga0501041_0111961
1723 Ga0501042_0018997
1724 Ga0501042_0088596
1725 Ga0501042_0113166
1726 Ga0501042_0589134
1727 Ga0501042_0755863
1728 Ga0501042_1104858
1729 Ga0501043_1179549
1730 Ga0501046_0007561
1731 Ga0501046_0402085
1732 Ga0501047_0603148
1733 Ga0501048_0032605
1734 Ga0501048_0041377
1735 Ga0501048_0093518
1736 Ga0501048_0230973
1737 Ga0501068_0013004
1738 Ga0501068_0026326
1739 Ga0501068_0249429
1740 Ga0501068_0692005
1741 Ga0501069_0018148
1742 Ga0501069_0651481
1743 Ga0501070_0033872
1744 Ga0501070_0224690
1745 Ga0501070_1388283
1746 Ga0501071_0009522
1747 Ga0501071_0014401
1748 Ga0501071_0015339
1749 Ga0501071_0171424
1750 Ga0501071_0616010
1751 Ga0501072_0008485
1752 Ga0501072_0008586
1753 Ga0501072_0018481
1754 Ga0501072_0048393
1755 Ga0501072_1092005
1756 Ga0501073_0009910
1757 Ga0501073_0136950
1758 Ga0501074_0010041
1759 Ga0501074_0078386
1760 Ga0501074_0082791
1761 Ga0501075_0038515
1762 Ga0501075_0044561
1763 Ga0501075_0142329
1764 Ga0501075_0196945
1765 Ga0501075_0705588
1766 Ga0501076_0010968
1767 Ga0501076_0014607
1768 Ga0501076_0053952
1769 Ga0501076_0111260
1770 Ga0501076_0487882
1771 Ga0501077_0005770
1772 Ga0501077_0010295
1773 Ga0501077_0017115
1774 Ga0501079_0005628
1775 Ga0501079_0026199
1776 Ga0501079_0028987
1777 Ga0501079_0122850
1778 Ga0501080_0027888
1779 Ga0501080_0079641
1780 Ga0501080_0111636
1781 Ga0501080_0667025
1782 Ga0501080_1307842
1783 Ga0501080_1400738
1784 Ga0501081_0008677
1785 Ga0501081_0069479
1786 Ga0501081_0084541
1787 Ga0501081_0163777
1788 Ga0501081_0679893
1789 Ga0501083_0009849
1790 Ga0501083_0247609
1791 Ga0501083_0356567
1792 Ga0501035_0031335
1793 Ga0501035_0054816
1794 Ga0501035_0579613
1795 Ga0501044_0230646
1796 Ga0501044_0385605
1797 Ga0501044_1406775
1798 Ga0501045_0006345
1799 Ga0501045_0027992
1800 Ga0501045_0135421
1801 Ga0501045_0887607
1802 nmdc:mga00v17_291940_c1
1803 nmdc:mga06z11_1020904_c1
1804 nmdc:mga06z11_127894_c1
1805 nmdc:mga04h51_182743_c1
1806 nmdc:mga07m45_901530_c1
1807 nmdc:mga05p37_1229887_c1
1808 nmdc:mga05p37_292783_c1
1809 nmdc:mga05p37_602208_c1
1810 nmdc:mga09592_298310_c1
1811 nmdc:mga06r32_593548_c1
1812 nmdc:mga08y16_2108790_c1
1813 nmdc:mga08y16_57166_c1
1814 nmdc:mga08y16_974595_c1
1815 nmdc:mga0n895_1179968_c1
1816 nmdc:mga0n895_1185129_c1
1817 nmdc:mga0n895_198878_c1
1818 nmdc:mga0n895_530970_c1
1819 nmdc:mga0n895_550770_c1
1820 nmdc:mga0rr50_1047425_c1
1821 nmdc:mga0rr50_1219476_c1
1822 nmdc:mga0rr50_124593_c1
1823 nmdc:mga0rr50_1438969_c1
1824 nmdc:mga08x19_211196_c1
1825 nmdc:mga08x19_505739_c1
1826 nmdc:mga08x19_80181_c1
1827 nmdc:mga0a205_406258_c1
1828 Ga0501084_0006750
1829 Ga0501084_0009833
1830 Ga0501084_0139744
1831 Ga0501084_0257220
1832 Ga0501084_0381876
1833 Ga0501084_1554570
1834 Ga0501082_0007473
1835 Ga0501082_0151030
1836 Ga0501082_0485771
1837 Ga0501082_1644841
1838 Ga0530510_0016010
1839 Ga0530510_0037375
1840 Ga0530510_0472334
1841 Ga0530510_0646574
1842 Ga0530510_0701598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8u10-assembly1.cif.gz_a in situ cryo-em structure of bacteriophage p22 gp1:gp4:gp5:gp10:gp9 n-term complex in conformation 1 at 3.2a resolution 0.6066 32 74
4tkn-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5169 30 75
7qoi-assembly1.cif.gz_FA unique vertex of the phicrass001 virion 0.51 32 74
7qoi-assembly1.cif.gz_FI unique vertex of the phicrass001 virion 0.4995 32 74
7qoi-assembly1.cif.gz_FJ unique vertex of the phicrass001 virion 0.4875 32 74
ID Description Score Start End Superfamily
af_Q9VML8_56_152_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5504 32 74 3.10.20.90
af_Q15036_112_208_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5158 32 76 3.10.20.90
af_Q9VL28_120_218_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.502 34 76 3.10.20.90
af_P53250_175_304_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.4834 32 55 3.40.20.10
af_Q9TZ34_5_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.482 33 72 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A7Y5XX91-F1-model_v4 Uncharacterized protein 0.6919 7 76
AF-A0A7Y5XX91-F1-model_v4 Uncharacterized protein 0.673 7 76
AF-A0A2G4H3K1-F1-model_v4 Uncharacterized protein 0.6406 1 76
AF-A0A2G4H3K1-F1-model_v4 Uncharacterized protein 0.6325 1 76
AF-A0A6J4UKX1-F1-model_v4 Uncharacterized protein 0.6279 1 76

Map