F485713

General Info

Members Datasets Scaffolds Average Seq Length
919 356 798 211

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_040902|Ga0495617_040902_155_901
Length 248
Sequence MASKGQFAQAWQWTYEIGHQWLLQQTNSLPRMQAFAKENLSMYTPRAFAIEELSQLHELILATRLAILVTHGENGLQASHVPVLLHCEQGEYGTLYGHLARANPQWKDLRDGAEAMLIFAGADAYISPGFYPSKAEHGKVVPTWNYIAVHAYGHAETFSDGGRLLDIVSTLTDRHEAGRAQPWSVDDAPADYIDGMLKAIVGFAIPIDRLEGKRKLSQNRSSEDIAGVREGLAASPEINDQTLARLMR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
21 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
22 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
23 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
24 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
25 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
26 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
27 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
28 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
29 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
30 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
31 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
32 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
33 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
34 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
35 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
36 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
37 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
38 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
39 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
40 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
41 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
42 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
43 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
44 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
45 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
46 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
47 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
48 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
49 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
50 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
51 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
52 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
53 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
54 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
55 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
56 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
57 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
58 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
59 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
60 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
61 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
62 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
63 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
64 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
65 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
66 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
67 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
68 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
69 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
70 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
71 2773857670 Pseudomonas sp. 478 Isolate Unclassified
72 2773857673 Pseudomonas sp. 443 Isolate Unclassified
73 2784132063 Pseudomonas sp. 424 Isolate Unclassified
74 2784132072 Pseudomonas sp. 460 Isolate Unclassified
75 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
76 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
77 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
78 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
79 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
80 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
81 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
82 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
83 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
84 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
85 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
86 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
87 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
88 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
89 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
90 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
91 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
92 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
93 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
94 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
95 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
96 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
97 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
98 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
99 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
100 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
101 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
102 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
103 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
104 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
105 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
106 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
107 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
108 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
109 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
110 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
111 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
112 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
113 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
114 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
115 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
116 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
117 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
118 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
119 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
120 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
121 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
122 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
123 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
125 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
126 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
129 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
149 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
216 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
217 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
218 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
219 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
220 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
221 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
222 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
223 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
224 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
225 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
226 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
235 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
236 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
345 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
350 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
351 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
352 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
353 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
354 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
355 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
356 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.83
Metatranscriptomes 0
Isolates 13.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 2.5
Rhizoplane 4.68
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_41 2124908027 Bacteria 51011
2 SwRhRL2b_contig_863144 2162886007 Bacteria 1734
3 JGI25163J39215_1000536 3300002771 Bacteria 11107
4 JGI25164J39214_1000058 3300002772 Bacteria 112599
5 JGI25165J46597_1000154 3300003214 Bacteria 112599
6 Ga0055536_1000476 3300003781 Bacteria 27924
7 Ga0055536_1000603 3300003781 Bacteria 24478
8 Ga0055536_1018301 3300003781 Bacteria 2251
9 Ga0055530_10001077 3300003791 Bacteria 21490
10 Ga0055530_10019195 3300003791 Bacteria 2078
11 Ga0055540_1000288 3300003792 Bacteria 45131
12 Ga0055540_1000605 3300003792 Bacteria 25721
13 Ga0055531_10009540 3300003794 Bacteria 4949
14 Ga0055531_10056411 3300003794 Bacteria 991
15 Ga0065714_10003396 3300005288 Bacteria 10603
16 Ga0065714_10018027 3300005288 Bacteria 1492
17 Ga0065714_10031771 3300005288 Bacteria 1271
18 Ga0065714_10064648 3300005288 Bacteria 26129
19 Ga0065714_10138730 3300005288 Bacteria 1188
20 Ga0065704_10133198 3300005289 Bacteria 1603
21 Ga0065715_10166688 3300005293 Bacteria 1579
22 Ga0070669_100003148 3300005353 Bacteria 11877
23 Ga0070663_100405938 3300005455 Bacteria 1115
24 Ga0070662_100016649 3300005457 Bacteria 4940
25 Ga0070665_100013854 3300005548 Bacteria 8109
26 Ga0075363_100194715 3300006048 Bacteria 1157
27 Ga0075364_10062544 3300006051 Bacteria 2442
28 Ga0075364_10228013 3300006051 Bacteria 1265
29 Ga0075432_10032885 3300006058 Bacteria 1797
30 Ga0075362_10081078 3300006177 Bacteria 1496
31 Ga0075362_10138416 3300006177 Bacteria 1162
32 Ga0075431_100424331 3300006847 Bacteria 1329
33 Ga0079104_1000262 3300006946 Bacteria 69874
34 Ga0079104_1003439 3300006946 Bacteria 7369
35 Ga0099826_10055754 3300006948 Bacteria 2613
36 Ga0105251_10000674 3300009011 Bacteria 31403
37 Ga0105251_10001737 3300009011 Bacteria 18191
38 Ga0105251_10005123 3300009011 Bacteria 8670
39 Ga0105251_10022911 3300009011 Bacteria 3232
40 Ga0105251_10132138 3300009011 Bacteria 1131
41 Ga0105251_10150882 3300009011 Bacteria 1050
42 Ga0105251_10177691 3300009011 Bacteria 959
43 Ga0105244_10000073 3300009036 Bacteria 115279
44 Ga0105244_10018244 3300009036 Bacteria 3942
45 Ga0105244_10018513 3300009036 Bacteria 3906
46 Ga0105244_10022535 3300009036 Bacteria 3466
47 Ga0105244_10030533 3300009036 Bacteria 2867
48 Ga0105244_10066299 3300009036 Bacteria 1808
49 Ga0105244_10088751 3300009036 Bacteria 1522
50 Ga0105244_10095851 3300009036 Bacteria 1455
51 Ga0105250_10000138 3300009092 Bacteria 63230
52 Ga0105250_10000857 3300009092 Bacteria 17962
53 Ga0105250_10001344 3300009092 Bacteria 13413
54 Ga0105250_10006950 3300009092 Bacteria 4896
55 Ga0105250_10045949 3300009092 Bacteria 1751
56 Ga0105250_10151863 3300009092 Bacteria 964
57 Ga0105250_10238878 3300009092 Bacteria 774
58 Ga0105240_10535996 3300009093 Bacteria 1297
59 Ga0111539_10272072 3300009094 Bacteria 1972
60 Ga0105247_10400651 3300009101 Unclassified 978
61 Ga0105243_10000132 3300009148 Bacteria 85455
62 Ga0105243_10004299 3300009148 Bacteria 11273
63 Ga0105243_10007452 3300009148 Bacteria 8408
64 Ga0105243_10008831 3300009148 Bacteria 7718
65 Ga0105243_10024118 3300009148 Bacteria 4638
66 Ga0105243_10153898 3300009148 Bacteria 1975
67 Ga0105243_10542952 3300009148 Bacteria 1109
68 Ga0105243_10638312 3300009148 Bacteria 1030
69 Ga0105242_10251986 3300009176 Bacteria 1591
70 Ga0105238_11211543 3300009551 Bacteria 779
71 Ga0105249_10007738 3300009553 Bacteria 9366
72 Ga0105246_10001455 3300011119 Bacteria 14035
73 Ga0105246_10002582 3300011119 Bacteria 10953
74 Ga0105246_10104861 3300011119 Bacteria 2065
75 Ga0105246_11143202 3300011119 Bacteria 713
76 Ga0157337_1000413 3300012483 Bacteria 1984
77 Ga0157345_1000061 3300012498 Bacteria 22884
78 Ga0157345_1000713 3300012498 Bacteria 2673
79 Ga0157373_10000959 3300013100 Bacteria 22392
80 Ga0157373_10001902 3300013100 Bacteria 15857
81 Ga0157373_10022444 3300013100 Bacteria 4579
82 Ga0157373_10041651 3300013100 Bacteria 3284
83 Ga0157373_10468615 3300013100 Bacteria 908
84 Ga0157371_10001823 3300013102 Bacteria 21467
85 Ga0157371_10002126 3300013102 Bacteria 19284
86 Ga0157371_10007445 3300013102 Bacteria 8862
87 Ga0157370_10006857 3300013104 Bacteria 12473
88 Ga0157370_10163010 3300013104 Bacteria 2074
89 Ga0157370_10357195 3300013104 Bacteria 1346
90 Ga0157370_11015388 3300013104 Bacteria 751
91 Ga0157369_10002087 3300013105 Bacteria 24158
92 Ga0157369_10057159 3300013105 Bacteria 4209
93 Ga0157369_10127023 3300013105 Bacteria 2703
94 Ga0157369_10699835 3300013105 Bacteria 1044
95 Ga0163162_10000334 3300013306 Bacteria 43059
96 Ga0163162_10065423 3300013306 Bacteria 3682
97 Ga0157372_10001023 3300013307 Bacteria 30562
98 Ga0157375_10598746 3300013308 Bacteria 1262
99 Ga0182008_10000699 3300014497 Bacteria 24106
100 Ga0182008_10001025 3300014497 Bacteria 19407
101 Ga0182008_10003284 3300014497 Bacteria 9840
102 Ga0182008_10004033 3300014497 Bacteria 8669
103 Ga0182008_10010070 3300014497 Bacteria 5072
104 Ga0182008_10021998 3300014497 Bacteria 3268
105 Ga0182008_10081961 3300014497 Bacteria 1588
106 Ga0182006_1001164 3300015261 Bacteria 16587
107 Ga0182006_1001423 3300015261 Bacteria 14483
108 Ga0182006_1006835 3300015261 Bacteria 5265
109 Ga0182006_1009181 3300015261 Bacteria 4443
110 Ga0182006_1019175 3300015261 Bacteria 2882
111 Ga0182006_1029571 3300015261 Bacteria 2219
112 Ga0182006_1049558 3300015261 Bacteria 1621
113 Ga0182007_10002451 3300015262 Bacteria 9216
114 Ga0182007_10110278 3300015262 Bacteria 915
115 Ga0182005_1000991 3300015265 Bacteria 12230
116 Ga0182005_1002546 3300015265 Bacteria 6473
117 Ga0182005_1003025 3300015265 Bacteria 5811
118 Ga0182005_1024728 3300015265 Bacteria 1640
119 Ga0163161_10001007 3300017792 Bacteria 21460
120 Ga0163161_10001974 3300017792 Bacteria 14883
121 Ga0163161_10025060 3300017792 Bacteria 4218
122 Ga0163161_10025234 3300017792 Bacteria 4206
123 Ga0163161_10030726 3300017792 Bacteria 3825
124 Ga0163161_10034086 3300017792 Bacteria 3640
125 Ga0163161_10742622 3300017792 Bacteria 820
126 Ga0209760_100148 3300025207 Bacteria 43685
127 Ga0209563_100453 3300025230 Bacteria 14219
128 Ga0207427_100005 3300025231 Bacteria 797999
129 Ga0209437_100018 3300025233 Bacteria 694400
130 Ga0209759_1018281 3300025256 Bacteria 1697
131 Ga0209233_1000021 3300025261 Bacteria 798078
132 Ga0209676_1000015 3300025292 Bacteria 784458
133 Ga0209676_1000278 3300025292 Bacteria 106516
134 Ga0209676_1003102 3300025292 Bacteria 10686
135 Ga0209676_1004940 3300025292 Bacteria 7166
136 Ga0209050_1000030 3300025298 Bacteria 463381
137 Ga0209050_1000061 3300025298 Bacteria 321435
138 Ga0209050_1003835 3300025298 Bacteria 10715
139 Ga0209050_1052904 3300025298 Bacteria 1013
140 Ga0209051_1000012 3300025303 Bacteria 595474
141 Ga0209051_1000088 3300025303 Bacteria 180480
142 Ga0209051_1023888 3300025303 Bacteria 2530
143 Ga0209257_1000143 3300025304 Bacteria 199975
144 Ga0209257_1037097 3300025304 Bacteria 1489
145 Ga0207696_1000078 3300025711 Bacteria 207623
146 Ga0207696_1000180 3300025711 Bacteria 98909
147 Ga0207696_1000184 3300025711 Bacteria 97606
148 Ga0207696_1000612 3300025711 Bacteria 26543
149 Ga0207696_1000698 3300025711 Bacteria 23009
150 Ga0207696_1031641 3300025711 Bacteria 1599
151 Ga0207696_1048095 3300025711 Bacteria 1227
152 Ga0207655_1000033 3300025728 Bacteria 377066
153 Ga0207655_1000116 3300025728 Bacteria 161950
154 Ga0207655_1001603 3300025728 Bacteria 20215
155 Ga0207655_1001803 3300025728 Bacteria 18535
156 Ga0207655_1006251 3300025728 Bacteria 7919
157 Ga0207655_1024651 3300025728 Bacteria 2942
158 Ga0207655_1054218 3300025728 Bacteria 1596
159 Ga0207655_1058182 3300025728 Bacteria 1513
160 Ga0207713_1000010 3300025735 Bacteria 528374
161 Ga0207713_1000961 3300025735 Bacteria 25561
162 Ga0207713_1001062 3300025735 Bacteria 23732
163 Ga0207713_1002196 3300025735 Bacteria 14459
164 Ga0207713_1002402 3300025735 Bacteria 13682
165 Ga0207713_1004217 3300025735 Bacteria 9408
166 Ga0207713_1008043 3300025735 Bacteria 6128
167 Ga0207713_1009976 3300025735 Bacteria 5302
168 Ga0207707_10123370 3300025912 Bacteria 2265
169 Ga0207707_10139388 3300025912 Unclassified 2121
170 Ga0207652_10067601 3300025921 Unclassified 3099
171 Ga0207681_10009500 3300025923 Bacteria 5943
172 Ga0207706_10004797 3300025933 Bacteria 12664
173 Ga0207686_10137578 3300025934 Bacteria 1684
174 Ga0207709_10000061 3300025935 Bacteria 199097
175 Ga0207709_10000063 3300025935 Bacteria 191397
176 Ga0207709_10139634 3300025935 Bacteria 1664
177 Ga0207709_10316577 3300025935 Bacteria 1166
178 Ga0207712_10012351 3300025961 Bacteria 5455
179 Ga0207678_10667672 3300026067 Bacteria 914
180 Ga0209281_1000016 3300027111 Bacteria 588107
181 Ga0209281_1000091 3300027111 Bacteria 242588
182 Ga0209282_1044203 3300027666 Bacteria 2614
183 Ga0207428_10088321 3300027907 Bacteria 2411
184 Ga0268266_10004185 3300028379 Bacteria 13905
185 Ga0307511_10017143 3300030521 Bacteria 6956
186 Ga0307511_10160949 3300030521 Bacteria 1261
187 Ga0316178_1077247 3300030735 Bacteria 21182
188 Ga0307408_100001323 3300031548 Bacteria 18593
189 Ga0307408_100002282 3300031548 Bacteria 13657
190 Ga0307408_100083672 3300031548 Bacteria 2391
191 Ga0307516_10129374 3300031730 Bacteria 2306
192 Ga0307516_10254482 3300031730 Bacteria 1449
193 Ga0307516_10316612 3300031730 Bacteria 1232
194 Ga0307405_10000143 3300031731 Bacteria 27538
195 Ga0307413_10209476 3300031824 Bacteria 1414
196 Ga0307413_10229648 3300031824 Bacteria 1362
197 Ga0307406_10009349 3300031901 Bacteria 5493
198 Ga0307406_10266698 3300031901 Bacteria 1298
199 Ga0307407_10046413 3300031903 Bacteria 2459
200 Ga0307412_10005109 3300031911 Bacteria 7343
201 Ga0307412_10024630 3300031911 Bacteria 3716
202 Ga0307412_10042733 3300031911 Bacteria 2947
203 Ga0307412_10167760 3300031911 Bacteria 1638
204 Ga0307409_100003401 3300031995 Bacteria 8640
205 Ga0307416_100038540 3300032002 Bacteria 3688
206 Ga0307414_10002499 3300032004 Bacteria 9643
207 Ga0307414_10061753 3300032004 Bacteria 2655
208 Ga0307414_10065522 3300032004 Bacteria 2592
209 Ga0307414_10087086 3300032004 Bacteria 2306
210 Ga0307411_10071206 3300032005 Bacteria 2355
211 Ga0307510_10001990 3300033180 Bacteria 23014
212 Ga0237819_00815 3300038705 Bacteria 9887
213 Ga0436360_1303388 3300039438 Bacteria 880
214 Ga0439438_000698 3300041405 Bacteria 14993
215 Ga0439438_000904 3300041405 Bacteria 13194
216 Ga0439438_001459 3300041405 Bacteria 10416
217 Ga0439438_001774 3300041405 Bacteria 9466
218 Ga0439438_005021 3300041405 Bacteria 4937
219 Ga0439438_006414 3300041405 Bacteria 4150
220 Ga0439447_000218 3300041407 Bacteria 20245
221 Ga0439447_000413 3300041407 Bacteria 15824
222 Ga0439447_000995 3300041407 Bacteria 10348
223 Ga0439447_001822 3300041407 Bacteria 7812
224 Ga0439447_002379 3300041407 Bacteria 6877
225 Ga0439447_012866 3300041407 Bacteria 2391
226 Ga0439447_026469 3300041407 Bacteria 1487
227 Ga0439461_0092357 3300041410 Bacteria 727
228 Ga0439466_0002737 3300041411 Bacteria 6899
229 Ga0439466_0002814 3300041411 Bacteria 6813
230 Ga0439466_0004530 3300041411 Bacteria 5337
231 Ga0439466_0011984 3300041411 Bacteria 3202
232 Ga0439466_0014760 3300041411 Bacteria 2840
233 Ga0439466_0019021 3300041411 Bacteria 2460
234 Ga0439466_0021412 3300041411 Bacteria 2291
235 Ga0439466_0025303 3300041411 Bacteria 2072
236 Ga0439465_0004541 3300041413 Bacteria 4486
237 Ga0439431_0053597 3300041997 Bacteria 1050
238 Ga0439445_0049602 3300042004 Bacteria 1130
239 Ga0439445_0065947 3300042004 Bacteria 996
240 Ga0439432_000241 3300042006 Bacteria 19671
241 Ga0439432_002077 3300042006 Bacteria 7561
242 Ga0439432_021286 3300042006 Bacteria 2151
243 Ga0439451_002539 3300042009 Bacteria 3712
244 Ga0439451_005322 3300042009 Bacteria 2621
245 Ga0439452_000402 3300042010 Bacteria 25551
246 Ga0439452_000459 3300042010 Bacteria 22949
247 Ga0439452_001139 3300042010 Bacteria 11612
248 Ga0439452_007719 3300042010 Bacteria 3278
249 Ga0439452_032084 3300042010 Bacteria 1285
250 Ga0439456_001931 3300042013 Bacteria 4176
251 Ga0439456_005462 3300042013 Bacteria 2579
252 Ga0439456_013402 3300042013 Bacteria 1705
253 Ga0439456_027140 3300042013 Bacteria 1219
254 Ga0439456_032977 3300042013 Bacteria 1113
255 Ga0439463_000465 3300042016 Bacteria 11270
256 Ga0439463_003225 3300042016 Bacteria 4143
257 Ga0450911_000228 3300042115 Bacteria 21716
258 Ga0450911_000480 3300042115 Bacteria 12755
259 Ga0450911_001251 3300042115 Bacteria 6091
260 Ga0450919_001557 3300042121 Bacteria 2993
261 Ga0450922_001336 3300042124 Bacteria 2432
262 Ga0450890_000187 3300042127 Bacteria 9400
263 Ga0450891_000346 3300042129 Bacteria 4795
264 Ga0450902_002970 3300042137 Bacteria 2442
265 Ga0450902_012448 3300042137 Bacteria 1361
266 Ga0450902_013025 3300042137 Bacteria 1336
267 Ga0450902_020865 3300042137 Bacteria 1081
268 Ga0450902_021301 3300042137 Bacteria 1071
269 Ga0450902_022583 3300042137 Bacteria 1042
270 Ga0450903_000418 3300042138 Bacteria 9121
271 Ga0450903_001427 3300042138 Bacteria 4455
272 Ga0450903_006350 3300042138 Bacteria 1964
273 Ga0450904_004416 3300042139 Bacteria 1461
274 Ga0450905_007958 3300042142 Bacteria 1448
275 Ga0450905_012490 3300042142 Bacteria 1196
276 Ga0450906_000070 3300042145 Bacteria 16295
277 Ga0450906_000339 3300042145 Bacteria 9514
278 Ga0450907_000189 3300042146 Bacteria 22476
279 Ga0450907_000613 3300042146 Bacteria 9470
280 Ga0450910_000383 3300042147 Bacteria 5192
281 Ga0439446_0000216 3300042156 Bacteria 10579
282 Ga0439446_0002002 3300042156 Bacteria 4819
283 Ga0439446_0006086 3300042156 Bacteria 3130
284 Ga0450908_002191 3300042184 Bacteria 3831
285 Ga0450908_022608 3300042184 Bacteria 1101
286 Ga0450909_000428 3300042185 Bacteria 5418
287 Ga0450909_001868 3300042185 Bacteria 2965
288 Ga0450909_016251 3300042185 Bacteria 1099
289 Ga0439434_0000252 3300042435 Bacteria 15121
290 Ga0439434_0002868 3300042435 Bacteria 5032
291 Ga0439464_0003584 3300042439 Bacteria 3931
292 Ga0439460_0000396 3300042461 Bacteria 9260
293 Ga0439460_0002073 3300042461 Bacteria 4795
294 Ga0439460_0049612 3300042461 Bacteria 1255
295 Ga0450918_002070 3300042531 Bacteria 3842
296 Ga0450918_035185 3300042531 Bacteria 890
297 Ga0450893_0001324 3300042532 Bacteria 3759
298 Ga0450901_001267 3300042533 Bacteria 2907
299 Ga0439440_0004160 3300042993 Bacteria 2830
300 Ga0495617_000773 3300046452 Bacteria 15612
301 Ga0495617_003698 3300046452 Bacteria 5699
302 Ga0495617_011679 3300046452 Bacteria 2995
303 Ga0495617_017255 3300046452 Bacteria 2437
304 Ga0495617_040902 3300046452 Bacteria 1549
305 Ga0495617_043526 3300046452 Bacteria 1499
306 Ga0495617_139839 3300046452 Bacteria 773
307 Ga0495627_000699 3300046453 Bacteria 25601
308 Ga0495627_001303 3300046453 Bacteria 15214
309 Ga0495627_001371 3300046453 Bacteria 14531
310 Ga0495627_004876 3300046453 Bacteria 5523
311 Ga0495627_038118 3300046453 Bacteria 1488
312 Ga0495627_073862 3300046453 Bacteria 993
313 Ga0495603_0004624 3300046455 Bacteria 8219
314 Ga0495590_0001763 3300046457 Bacteria 9179
315 Ga0495590_0005614 3300046457 Bacteria 4947
316 Ga0495590_0006823 3300046457 Bacteria 4436
317 Ga0495590_0028052 3300046457 Bacteria 1974
318 Ga0495590_0036714 3300046457 Bacteria 1709
319 Ga0495591_000617 3300046458 Bacteria 26703
320 Ga0495591_000754 3300046458 Bacteria 23377
321 Ga0495591_000770 3300046458 Bacteria 23160
322 Ga0495591_001717 3300046458 Bacteria 13046
323 Ga0495591_002517 3300046458 Bacteria 10125
324 Ga0495591_003388 3300046458 Bacteria 8262
325 Ga0495591_005593 3300046458 Bacteria 5770
326 Ga0495591_009920 3300046458 Bacteria 3738
327 Ga0495591_011452 3300046458 Bacteria 3359
328 Ga0495591_025978 3300046458 Bacteria 1829
329 Ga0495591_041514 3300046458 Bacteria 1305
330 Ga0495591_051357 3300046458 Bacteria 1125
331 Ga0495629_0059385 3300046459 Bacteria 2673
332 Ga0495638_0000698 3300046460 Bacteria 36406
333 Ga0495638_0001198 3300046460 Bacteria 24807
334 Ga0495638_0002225 3300046460 Bacteria 16118
335 Ga0495638_0019430 3300046460 Bacteria 4496
336 Ga0495638_0021288 3300046460 Bacteria 4275
337 Ga0495638_0023806 3300046460 Bacteria 4000
338 Ga0495638_0064840 3300046460 Bacteria 2249
339 Ga0495638_0129161 3300046460 Bacteria 1486
340 Ga0495638_0214397 3300046460 Bacteria 1079
341 Ga0495653_0001621 3300046463 Bacteria 17676
342 Ga0495653_0004821 3300046463 Bacteria 10937
343 Ga0495653_0325690 3300046463 Bacteria 994
344 Ga0495650_0002905 3300046471 Bacteria 13025
345 Ga0495650_0003275 3300046471 Bacteria 11989
346 Ga0495650_0005040 3300046471 Bacteria 8761
347 Ga0495650_0006979 3300046471 Bacteria 6896
348 Ga0495650_0012881 3300046471 Bacteria 4465
349 Ga0495650_0017643 3300046471 Bacteria 3572
350 Ga0495650_0040066 3300046471 Bacteria 2015
351 Ga0495650_0058134 3300046471 Bacteria 1562
352 Ga0495650_0069713 3300046471 Bacteria 1382
353 Ga0495582_0027713 3300046473 Bacteria 3106
354 Ga0495605_0000485 3300046474 Bacteria 34525
355 Ga0495605_0000970 3300046474 Bacteria 19491
356 Ga0495605_0001636 3300046474 Bacteria 14472
357 Ga0495605_0002342 3300046474 Bacteria 11791
358 Ga0495605_0003022 3300046474 Bacteria 10153
359 Ga0495605_0014689 3300046474 Bacteria 4280
360 Ga0495605_0021015 3300046474 Bacteria 3461
361 Ga0495605_0044851 3300046474 Bacteria 2183
362 Ga0495639_0001819 3300046475 Bacteria 9456
363 Ga0495639_0044282 3300046475 Bacteria 2012
364 Ga0495584_0000804 3300046491 Bacteria 20641
365 Ga0495584_0001305 3300046491 Bacteria 15171
366 Ga0495584_0001792 3300046491 Bacteria 12492
367 Ga0495584_0001969 3300046491 Bacteria 11812
368 Ga0495584_0002222 3300046491 Bacteria 11079
369 Ga0495584_0007163 3300046491 Bacteria 5826
370 Ga0495584_0009062 3300046491 Bacteria 5141
371 Ga0495584_0025515 3300046491 Bacteria 2996
372 Ga0495584_0031046 3300046491 Bacteria 2704
373 Ga0495585_0001389 3300046492 Bacteria 19127
374 Ga0495585_0001612 3300046492 Bacteria 17388
375 Ga0495585_0001711 3300046492 Bacteria 16724
376 Ga0495585_0003356 3300046492 Bacteria 10838
377 Ga0495585_0048829 3300046492 Bacteria 2352
378 Ga0495585_0221537 3300046492 Bacteria 954
379 Ga0495594_0001003 3300046499 Bacteria 14698
380 Ga0495594_0004242 3300046499 Bacteria 7360
381 Ga0495594_0093492 3300046499 Bacteria 1686
382 Ga0495596_0000009 3300046500 Bacteria 145647
383 Ga0495596_0031870 3300046500 Bacteria 2103
384 Ga0495607_0000113 3300046501 Bacteria 84993
385 Ga0495607_0000257 3300046501 Bacteria 57042
386 Ga0495607_0002320 3300046501 Bacteria 15588
387 Ga0495607_0003411 3300046501 Bacteria 12181
388 Ga0495607_0004383 3300046501 Bacteria 10405
389 Ga0495607_0007831 3300046501 Bacteria 7352
390 Ga0495607_0008187 3300046501 Bacteria 7161
391 Ga0495607_0039787 3300046501 Bacteria 2805
392 Ga0495607_0050421 3300046501 Bacteria 2423
393 Ga0495607_0090406 3300046501 Bacteria 1659
394 Ga0495607_0100652 3300046501 Bacteria 1548
395 Ga0495583_0000362 3300046506 Bacteria 71060
396 Ga0495583_0006903 3300046506 Bacteria 7300
397 Ga0495583_0007240 3300046506 Bacteria 7025
398 Ga0495583_0011515 3300046506 Bacteria 5072
399 Ga0495583_0044269 3300046506 Bacteria 2066
400 Ga0495583_0230444 3300046506 Bacteria 746
401 Ga0495606_0003219 3300046507 Bacteria 17574
402 Ga0495606_0004373 3300046507 Bacteria 14165
403 Ga0495606_0006204 3300046507 Bacteria 11118
404 Ga0495606_0009801 3300046507 Bacteria 8047
405 Ga0495606_0022693 3300046507 Bacteria 4562
406 Ga0495606_0035883 3300046507 Bacteria 3384
407 Ga0495606_0372296 3300046507 Bacteria 752
408 Ga0495610_0001250 3300046512 Bacteria 22829
409 Ga0495610_0001288 3300046512 Bacteria 22409
410 Ga0495610_0003510 3300046512 Bacteria 12171
411 Ga0495610_0003640 3300046512 Bacteria 11866
412 Ga0495610_0006721 3300046512 Bacteria 7822
413 Ga0495610_0009436 3300046512 Bacteria 6168
414 Ga0495610_0011027 3300046512 Bacteria 5557
415 Ga0495610_0015974 3300046512 Bacteria 4341
416 Ga0495610_0085471 3300046512 Bacteria 1439
417 Ga0495610_0114087 3300046512 Bacteria 1193
418 Ga0495610_0134226 3300046512 Bacteria 1072
419 Ga0495616_0000759 3300046513 Bacteria 23580
420 Ga0495616_0004366 3300046513 Bacteria 8921
421 Ga0495616_0005169 3300046513 Bacteria 8088
422 Ga0495616_0008750 3300046513 Bacteria 5966
423 Ga0495616_0009160 3300046513 Bacteria 5808
424 Ga0495616_0036775 3300046513 Bacteria 2525
425 Ga0495616_0040971 3300046513 Bacteria 2364
426 Ga0495616_0047434 3300046513 Bacteria 2163
427 Ga0495620_0000044 3300046515 Bacteria 110431
428 Ga0495620_0000847 3300046515 Bacteria 18908
429 Ga0495620_0001676 3300046515 Bacteria 13062
430 Ga0495620_0002610 3300046515 Bacteria 10426
431 Ga0495620_0004241 3300046515 Bacteria 8101
432 Ga0495620_0025632 3300046515 Bacteria 2786
433 Ga0495620_0099525 3300046515 Bacteria 1160
434 Ga0495630_0004905 3300046517 Bacteria 9400
435 Ga0495630_0053976 3300046517 Bacteria 3010
436 Ga0495630_0392219 3300046517 Bacteria 1063
437 Ga0495631_0000613 3300046518 Bacteria 23488
438 Ga0495631_0000644 3300046518 Bacteria 22675
439 Ga0495631_0002854 3300046518 Bacteria 9588
440 Ga0495631_0003031 3300046518 Bacteria 9287
441 Ga0495631_0017266 3300046518 Bacteria 3418
442 Ga0495632_0001236 3300046519 Bacteria 21667
443 Ga0495632_0002808 3300046519 Bacteria 12900
444 Ga0495632_0002947 3300046519 Bacteria 12492
445 Ga0495632_0003223 3300046519 Bacteria 11719
446 Ga0495632_0003284 3300046519 Bacteria 11551
447 Ga0495632_0003459 3300046519 Bacteria 11185
448 Ga0495632_0012356 3300046519 Bacteria 4928
449 Ga0495632_0013823 3300046519 Bacteria 4590
450 Ga0495632_0016598 3300046519 Bacteria 4089
451 Ga0495632_0045022 3300046519 Bacteria 2200
452 Ga0495632_0068398 3300046519 Bacteria 1711
453 Ga0495632_0072958 3300046519 Bacteria 1646
454 Ga0495632_0116942 3300046519 Bacteria 1248
455 Ga0495637_0000702 3300046520 Bacteria 23022
456 Ga0495637_0000930 3300046520 Bacteria 18727
457 Ga0495637_0000976 3300046520 Bacteria 18148
458 Ga0495637_0001608 3300046520 Bacteria 13104
459 Ga0495637_0001701 3300046520 Bacteria 12706
460 Ga0495637_0002053 3300046520 Bacteria 11331
461 Ga0495637_0002305 3300046520 Bacteria 10579
462 Ga0495637_0004874 3300046520 Bacteria 6903
463 Ga0495637_0005270 3300046520 Bacteria 6616
464 Ga0495637_0007274 3300046520 Bacteria 5505
465 Ga0495637_0022190 3300046520 Bacteria 2899
466 Ga0495637_0023348 3300046520 Bacteria 2813
467 Ga0495637_0082942 3300046520 Bacteria 1276
468 Ga0495643_0001374 3300046522 Bacteria 22765
469 Ga0495643_0006486 3300046522 Bacteria 7701
470 Ga0495643_0007088 3300046522 Bacteria 7274
471 Ga0495643_0110285 3300046522 Bacteria 1399
472 Ga0495643_0188471 3300046522 Bacteria 997
473 Ga0495644_0000403 3300046523 Bacteria 19392
474 Ga0495644_0028764 3300046523 Bacteria 2102
475 Ga0495644_0082461 3300046523 Bacteria 1212
476 Ga0495648_0002031 3300046524 Bacteria 19197
477 Ga0495648_0003053 3300046524 Bacteria 14984
478 Ga0495648_0003418 3300046524 Bacteria 13955
479 Ga0495648_0006654 3300046524 Bacteria 9357
480 Ga0495648_0006717 3300046524 Bacteria 9308
481 Ga0495648_0012529 3300046524 Bacteria 6319
482 Ga0495648_0014511 3300046524 Bacteria 5764
483 Ga0495648_0016746 3300046524 Bacteria 5273
484 Ga0495648_0020395 3300046524 Bacteria 4623
485 Ga0495648_0029167 3300046524 Bacteria 3665
486 Ga0495648_0030581 3300046524 Bacteria 3557
487 Ga0495648_0034998 3300046524 Bacteria 3260
488 Ga0495648_0079198 3300046524 Bacteria 1876
489 Ga0495648_0154287 3300046524 Bacteria 1194
490 Ga0495666_0002157 3300046526 Bacteria 9780
491 Ga0495666_0003124 3300046526 Bacteria 8322
492 Ga0495666_0069698 3300046526 Bacteria 1672
493 Ga0495666_0078780 3300046526 Bacteria 1560
494 Ga0495666_0157140 3300046526 Bacteria 1056
495 Ga0495642_0000290 3300046528 Bacteria 28374
496 Ga0495642_0000591 3300046528 Bacteria 18212
497 Ga0495642_0002466 3300046528 Bacteria 7522
498 Ga0495652_0130975 3300046529 Bacteria 1986
499 Ga0495654_0000354 3300046530 Bacteria 39704
500 Ga0495654_0001459 3300046530 Bacteria 16192
501 Ga0495654_0002728 3300046530 Bacteria 11145
502 Ga0495654_0003616 3300046530 Bacteria 9406
503 Ga0495654_0003695 3300046530 Bacteria 9292
504 Ga0495654_0004029 3300046530 Bacteria 8826
505 Ga0495654_0006729 3300046530 Bacteria 6501
506 Ga0495654_0016644 3300046530 Bacteria 3879
507 Ga0495654_0028485 3300046530 Bacteria 2856
508 Ga0495654_0029259 3300046530 Bacteria 2810
509 Ga0495654_0035307 3300046530 Bacteria 2519
510 Ga0495654_0056872 3300046530 Bacteria 1890
511 Ga0495654_0122532 3300046530 Bacteria 1175
512 Ga0495654_0161858 3300046530 Bacteria 982
513 Ga0495586_0003371 3300046535 Bacteria 8569
514 Ga0495587_0004270 3300046536 Bacteria 9438
515 Ga0495587_0010206 3300046536 Bacteria 5988
516 Ga0495609_0000471 3300046538 Bacteria 32562
517 Ga0495609_0000906 3300046538 Bacteria 21565
518 Ga0495609_0001060 3300046538 Bacteria 19247
519 Ga0495609_0002247 3300046538 Bacteria 12057
520 Ga0495609_0047615 3300046538 Bacteria 1918
521 Ga0495597_0000890 3300046542 Bacteria 23277
522 Ga0495597_0003052 3300046542 Bacteria 10083
523 Ga0495597_0003491 3300046542 Bacteria 9119
524 Ga0495597_0003635 3300046542 Bacteria 8861
525 Ga0495597_0011363 3300046542 Bacteria 4318
526 Ga0495597_0020119 3300046542 Bacteria 3114
527 Ga0495597_0026447 3300046542 Bacteria 2665
528 Ga0495597_0037109 3300046542 Bacteria 2189
529 Ga0495597_0041067 3300046542 Bacteria 2067
530 Ga0495645_0107979 3300046543 Bacteria 1972
531 Ga0495622_0000847 3300046557 Bacteria 16848
532 Ga0495622_0000869 3300046557 Bacteria 16563
533 Ga0495622_0012301 3300046557 Bacteria 3958
534 Ga0495622_0049380 3300046557 Bacteria 1953
535 Ga0495622_0097220 3300046557 Bacteria 1351
536 Ga0495633_0000201 3300046558 Bacteria 76414
537 Ga0495633_0001196 3300046558 Bacteria 20847
538 Ga0495633_0026522 3300046558 Bacteria 2842
539 Ga0495633_0073975 3300046558 Bacteria 1588
540 Ga0495633_0173221 3300046558 Bacteria 994
541 Ga0495656_0001906 3300046615 Bacteria 6879
542 Ga0495656_0137486 3300046615 Bacteria 1168
543 Ga0495668_0001342 3300046616 Bacteria 24188
544 Ga0495668_0001843 3300046616 Bacteria 19109
545 Ga0495668_0002812 3300046616 Bacteria 13842
546 Ga0495668_0070094 3300046616 Bacteria 1927
547 Ga0495668_0220517 3300046616 Bacteria 1038
548 Ga0495634_0001305 3300046642 Bacteria 22770
549 Ga0495634_0037499 3300046642 Bacteria 3312
550 Ga0495611_0000456 3300046648 Bacteria 24506
551 Ga0495611_0002642 3300046648 Bacteria 8104
552 Ga0495611_0004162 3300046648 Bacteria 6297
553 Ga0495611_0006544 3300046648 Bacteria 4964
554 Ga0495611_0160407 3300046648 Bacteria 1050
555 Ga0495625_0001368 3300046660 Bacteria 29974
556 Ga0495625_0003229 3300046660 Bacteria 16509
557 Ga0495625_0003768 3300046660 Bacteria 14722
558 Ga0495625_0006972 3300046660 Bacteria 9965
559 Ga0495625_0027147 3300046660 Bacteria 4316
560 Ga0495625_0075275 3300046660 Bacteria 2362
561 Ga0495625_0087490 3300046660 Bacteria 2159
562 Ga0495625_0128584 3300046660 Bacteria 1717
563 Ga0495625_0273551 3300046660 Bacteria 1089
564 Ga0495625_0298689 3300046660 Bacteria 1031
565 Ga0495635_0000719 3300046663 Bacteria 21364
566 Ga0495659_0000494 3300046664 Bacteria 14549
567 Ga0495659_0012016 3300046664 Bacteria 2796
568 Ga0495661_0001174 3300046665 Bacteria 22811
569 Ga0495661_0006967 3300046665 Bacteria 7903
570 Ga0495661_0007188 3300046665 Bacteria 7769
571 Ga0495661_0017678 3300046665 Bacteria 4704
572 Ga0495661_0106356 3300046665 Bacteria 1570
573 Ga0495661_0153612 3300046665 Bacteria 1241
574 Ga0495661_0234154 3300046665 Bacteria 945
575 Ga0495588_0008565 3300046674 Bacteria 4698
576 Ga0495588_0016923 3300046674 Bacteria 3532
577 Ga0495588_0066685 3300046674 Bacteria 1868
578 Ga0495599_0308262 3300046678 Bacteria 954
579 Ga0495623_0003391 3300046679 Bacteria 10534
580 Ga0495646_0036530 3300046680 Bacteria 3042
581 Ga0495669_0002748 3300046684 Bacteria 7218
582 Ga0495613_0003935 3300046689 Bacteria 11122
583 Ga0495624_0001088 3300046690 Bacteria 21459
584 Ga0495670_0000448 3300046691 Bacteria 19692
585 Ga0495670_0001143 3300046691 Bacteria 12898
586 Ga0495670_0002696 3300046691 Bacteria 8769
587 Ga0495670_0023859 3300046691 Bacteria 3020
588 Ga0495670_0040788 3300046691 Bacteria 2315
589 Ga0495670_0139157 3300046691 Bacteria 1268
590 Ga0495670_0144800 3300046691 Bacteria 1244
591 Ga0495670_0216661 3300046691 Bacteria 1016
592 Ga0495670_0289701 3300046691 Bacteria 876
593 Ga0495671_0000837 3300046692 Bacteria 21991
594 Ga0495671_0001280 3300046692 Bacteria 17169
595 Ga0495671_0001795 3300046692 Bacteria 13890
596 Ga0495671_0002184 3300046692 Bacteria 12469
597 Ga0495671_0002267 3300046692 Bacteria 12236
598 Ga0495671_0005418 3300046692 Bacteria 7468
599 Ga0495671_0010789 3300046692 Bacteria 5050
600 Ga0495671_0017599 3300046692 Bacteria 3802
601 Ga0495671_0073828 3300046692 Bacteria 1674
602 Ga0495671_0096241 3300046692 Bacteria 1448
603 Ga0495671_0109725 3300046692 Bacteria 1348
604 Ga0495671_0125489 3300046692 Bacteria 1251
605 Ga0495649_0001977 3300046694 Bacteria 14872
606 Ga0495649_0002048 3300046694 Bacteria 14530
607 Ga0495649_0003123 3300046694 Bacteria 11350
608 Ga0495649_0006006 3300046694 Bacteria 7603
609 Ga0495649_0006617 3300046694 Bacteria 7201
610 Ga0495649_0009826 3300046694 Bacteria 5663
611 Ga0495649_0010758 3300046694 Bacteria 5390
612 Ga0495649_0017236 3300046694 Bacteria 4078
613 Ga0495649_0019793 3300046694 Bacteria 3780
614 Ga0495649_0022012 3300046694 Bacteria 3569
615 Ga0495649_0039514 3300046694 Bacteria 2586
616 Ga0495649_0093850 3300046694 Bacteria 1597
617 Ga0495649_0224274 3300046694 Bacteria 971
618 Ga0495649_0371814 3300046694 Bacteria 720
619 Ga0495589_0000664 3300046794 Bacteria 22547
620 Ga0495589_0001080 3300046794 Bacteria 16265
621 Ga0495589_0002883 3300046794 Bacteria 9518
622 Ga0495589_0006279 3300046794 Bacteria 6276
623 Ga0495589_0054060 3300046794 Bacteria 1980
624 Ga0495600_0009474 3300046809 Bacteria 6018
625 Ga0495600_0041322 3300046809 Bacteria 3004
626 Ga0495600_0261871 3300046809 Bacteria 1098
627 Ga0495660_0001341 3300046810 Bacteria 16925
628 Ga0495660_0001625 3300046810 Bacteria 15082
629 Ga0495660_0001699 3300046810 Bacteria 14733
630 Ga0495660_0003037 3300046810 Bacteria 10468
631 Ga0495660_0005433 3300046810 Bacteria 7629
632 Ga0495660_0009145 3300046810 Bacteria 5785
633 Ga0495660_0009717 3300046810 Bacteria 5604
634 Ga0495660_0030311 3300046810 Bacteria 3047
635 Ga0495660_0043614 3300046810 Bacteria 2472
636 Ga0495660_0068432 3300046810 Bacteria 1889
637 Ga0495660_0068649 3300046810 Bacteria 1885
638 Ga0495660_0250685 3300046810 Bacteria 821
639 Ga0495581_0053772 3300047315 Bacteria 2325
640 Ga0495604_0065354 3300047317 Bacteria 2769
641 Ga0495604_0069564 3300047317 Bacteria 2667
642 Ga0495604_0074295 3300047317 Bacteria 2562
643 Ga0495636_0057945 3300047318 Bacteria 1632
644 Ga0495636_0223636 3300047318 Bacteria 864
645 Ga0495636_0248879 3300047318 Bacteria 821
646 Ga0495674_0008413 3300047319 Bacteria 9828
647 Ga0495674_0366816 3300047319 Bacteria 1167
648 Ga0495672_0000143 3300047320 Bacteria 105045
649 Ga0495672_0000612 3300047320 Bacteria 39954
650 Ga0495672_0001326 3300047320 Bacteria 24594
651 Ga0495672_0001433 3300047320 Bacteria 23422
652 Ga0495672_0002425 3300047320 Bacteria 17186
653 Ga0495672_0005238 3300047320 Bacteria 10331
654 Ga0495672_0008205 3300047320 Bacteria 7745
655 Ga0495672_0018144 3300047320 Bacteria 4683
656 Ga0495672_0025262 3300047320 Bacteria 3806
657 Ga0495672_0036794 3300047320 Bacteria 3002
658 Ga0495676_0001157 3300047321 Bacteria 22447
659 Ga0495680_0025037 3300047322 Bacteria 4942
660 Ga0495680_0084923 3300047322 Bacteria 2384
661 Ga0495680_0160872 3300047322 Bacteria 1630
662 Ga0495683_0000141 3300047323 Bacteria 70994
663 Ga0495683_0000788 3300047323 Bacteria 22569
664 Ga0495683_0002329 3300047323 Bacteria 11545
665 Ga0495683_0003010 3300047323 Bacteria 9933
666 Ga0495683_0014639 3300047323 Bacteria 4087
667 Ga0495683_0029470 3300047323 Bacteria 2804
668 Ga0495683_0039248 3300047323 Bacteria 2393
669 Ga0495687_001742 3300047443 Bacteria 19255
670 Ga0495687_003676 3300047443 Bacteria 10919
671 Ga0495675_0054812 3300047444 Bacteria 2529
672 Ga0495675_0096294 3300047444 Bacteria 1855
673 Ga0495675_0120676 3300047444 Bacteria 1632
674 Ga0495677_0000776 3300047445 Bacteria 12877
675 Ga0495679_001299 3300047446 Bacteria 14550
676 Ga0495679_002459 3300047446 Bacteria 9442
677 Ga0495679_002686 3300047446 Bacteria 8884
678 Ga0495679_003317 3300047446 Bacteria 7785
679 Ga0495679_018611 3300047446 Bacteria 2461
680 Ga0495685_024540 3300047447 Bacteria 2075
681 Ga0495685_025297 3300047447 Bacteria 2043
682 Ga0495673_0001105 3300047469 Bacteria 23223
683 Ga0495673_0001211 3300047469 Bacteria 21479
684 Ga0495673_0001953 3300047469 Bacteria 15307
685 Ga0495673_0002138 3300047469 Bacteria 14346
686 Ga0495673_0004438 3300047469 Bacteria 8785
687 Ga0495673_0004611 3300047469 Bacteria 8582
688 Ga0495673_0005043 3300047469 Bacteria 8086
689 Ga0495673_0005123 3300047469 Bacteria 7993
690 Ga0495673_0009989 3300047469 Bacteria 5198
691 Ga0495673_0036391 3300047469 Bacteria 2259
692 Ga0495673_0081790 3300047469 Bacteria 1337
693 Ga0495681_0000949 3300047470 Bacteria 22272
694 Ga0495681_0002095 3300047470 Bacteria 14509
695 Ga0495681_0005016 3300047470 Bacteria 8924
696 Ga0495681_0005762 3300047470 Bacteria 8238
697 Ga0495681_0007738 3300047470 Bacteria 6815
698 Ga0495681_0008488 3300047470 Bacteria 6440
699 Ga0495681_0010449 3300047470 Bacteria 5619
700 Ga0495681_0012034 3300047470 Bacteria 5106
701 Ga0495681_0013596 3300047470 Bacteria 4712
702 Ga0495681_0015051 3300047470 Bacteria 4394
703 Ga0495681_0078234 3300047470 Bacteria 1482
704 Ga0495686_0002212 3300047472 Bacteria 18892
705 Ga0495686_0003437 3300047472 Bacteria 13730
706 Ga0495686_0018619 3300047472 Bacteria 4655
707 Ga0495686_0046695 3300047472 Bacteria 2736
708 Ga0495686_0170888 3300047472 Bacteria 1264
709 Ga0495593_0001903 3300047673 Bacteria 12437
710 Ga0495593_0122550 3300047673 Bacteria 1322
711 Ga0495593_0127412 3300047673 Bacteria 1293
712 Ga0495593_0196094 3300047673 Bacteria 1015
713 Ga0495602_0002882 3300048088 Bacteria 17623
714 Ga0495614_0062619 3300048089 Bacteria 1599
715 Ga0495614_0148146 3300048089 Bacteria 1046
716 Ga0495626_0000437 3300048091 Bacteria 42568
717 Ga0495626_0000824 3300048091 Bacteria 27826
718 Ga0495626_0001145 3300048091 Bacteria 22152
719 Ga0495626_0001360 3300048091 Bacteria 19768
720 Ga0495626_0002102 3300048091 Bacteria 14483
721 Ga0495626_0002796 3300048091 Bacteria 11705
722 Ga0495626_0003391 3300048091 Bacteria 10258
723 Ga0495626_0010816 3300048091 Bacteria 4848
724 Ga0495626_0014335 3300048091 Bacteria 4093
725 Ga0496102_0001122 3300048905 Bacteria 24548
726 Ga0496103_0001780 3300048906 Bacteria 14059
727 Ga0496110_0120856 3300048913 Bacteria 2359
728 Ga0496110_0189484 3300048913 Bacteria 1868
729 Ga0496110_0227077 3300048913 Bacteria 1698
730 Ga0496115_0204197 3300048918 Bacteria 1632
731 Ga0496116_0000295 3300048919 Bacteria 84486
732 Ga0496116_0001666 3300048919 Bacteria 24407
733 Ga0496116_0004219 3300048919 Bacteria 13813
734 Ga0496116_0007393 3300048919 Bacteria 9755
735 Ga0496116_0243322 3300048919 Bacteria 902
736 Ga0496117_0004224 3300048920 Bacteria 16036
737 Ga0496117_0007026 3300048920 Bacteria 11143
738 Ga0496117_0077854 3300048920 Bacteria 2192
739 Ga0496117_0144314 3300048920 Bacteria 1420
740 Ga0496118_0005826 3300048921 Bacteria 13811
741 Ga0496118_0009592 3300048921 Bacteria 9744
742 Ga0496118_0054722 3300048921 Bacteria 3019
743 Ga0496118_0313689 3300048921 Bacteria 854
744 Ga0496119_0127776 3300048922 Bacteria 1389
745 Ga0496121_0003721 3300048924 Bacteria 21386
746 Ga0496121_0029975 3300048924 Bacteria 5009
747 Ga0496121_0037966 3300048924 Bacteria 4272
748 Ga0496121_0154434 3300048924 Bacteria 1685
749 Ga0496122_0015065 3300048925 Bacteria 7420
750 Ga0496122_0021525 3300048925 Bacteria 5768
751 Ga0496122_0046399 3300048925 Bacteria 3365
752 Ga0496123_0006939 3300048926 Bacteria 10820
753 Ga0496123_0008089 3300048926 Bacteria 9726
754 Ga0496123_0019015 3300048926 Bacteria 5427
755 Ga0496124_0005235 3300048927 Bacteria 14712
756 Ga0496124_0011129 3300048927 Bacteria 9026
757 Ga0496124_0025409 3300048927 Bacteria 5364
758 Ga0496124_0069700 3300048927 Bacteria 2919
759 Ga0496125_0004168 3300048928 Bacteria 16851
760 Ga0496125_0007935 3300048928 Bacteria 11209
761 Ga0496125_0117753 3300048928 Bacteria 1904
762 Ga0495678_000054 3300049459 Bacteria 153487
763 Ga0495678_000909 3300049459 Bacteria 25996
764 Ga0495678_001455 3300049459 Bacteria 18592
765 Ga0495678_001993 3300049459 Bacteria 14674
766 Ga0495678_002476 3300049459 Bacteria 12450
767 Ga0495678_003280 3300049459 Bacteria 10112
768 Ga0495678_003799 3300049459 Bacteria 9112
769 Ga0495678_009422 3300049459 Bacteria 4833
770 Ga0495678_012866 3300049459 Bacteria 3948
771 Ga0495678_013356 3300049459 Bacteria 3859
772 Ga0495678_022320 3300049459 Bacteria 2769
773 Ga0495678_031595 3300049459 Bacteria 2206
774 Ga0495678_085903 3300049459 Bacteria 1119
775 Ga0495682_0000898 3300049460 Bacteria 18398
776 Ga0495682_0001298 3300049460 Bacteria 13894
777 Ga0495682_0001917 3300049460 Bacteria 10357
778 Ga0495682_0014363 3300049460 Bacteria 3005
779 Ga0495682_0032577 3300049460 Bacteria 1925
780 Ga0495682_0042966 3300049460 Bacteria 1655
781 Ga0495682_0044990 3300049460 Bacteria 1614
782 Ga0495682_0172872 3300049460 Bacteria 768
783 Ga0501041_0041254 3300049577 Bacteria 2803
784 Ga0501072_0018468 3300049588 Bacteria 5371
785 Ga0501074_0033612 3300049590 Bacteria 3717
786 Ga0501076_0020672 3300049592 Bacteria 5041
787 Ga0501077_0394552 3300049593 Bacteria 884
788 Ga0501081_0145705 3300049743 Bacteria 1699
789 Ga0501241_000068 3300049758 Bacteria 24952
790 Ga0501045_0065159 3300049824 Bacteria 2675
791 Ga0501226_000008 3300049853 Bacteria 199119
792 nmdc:mga08y16_56354_c1 3300050511 Bacteria 4108
793 nmdc:mga08x19_33464_c1 3300050514 Bacteria 3244
794 Ga0500572_000576 3300053111 Bacteria 12491
795 Ga0500573_0004190 3300053140 Bacteria 7558
796 Ga0501084_0059600 3300054114 Bacteria 3195
797 Ga0501082_0219280 3300060353 Bacteria 1655
798 Ga0530510_0020094 3300061734 Bacteria 4748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231031 2511412570 192
2 3300013306 Ga0163162_10000334 Ga0163162_100003347 193
3 3300046453 Ga0495627_000699 Ga0495627_000699_11971_12717 193
4 3300046491 Ga0495584_0001969 Ga0495584_0001969_10210_10956 193
5 3300046500 Ga0495596_0031870 Ga0495596_0031870_699_1445 193
6 3300046512 Ga0495610_0001250 Ga0495610_0001250_10290_11036 193
7 3300046519 Ga0495632_0003284 Ga0495632_0003284_8599_9345 193
8 3300046520 Ga0495637_0000702 Ga0495637_0000702_10340_11086 193
9 3300046524 Ga0495648_0003418 Ga0495648_0003418_10300_11043 193
10 3300046530 Ga0495654_0029259 Ga0495654_0029259_410_1156 193
11 3300046648 Ga0495611_0000456 Ga0495611_0000456_10329_11075 193
12 3300046660 Ga0495625_0001368 Ga0495625_0001368_18877_19623 193
13 3300047470 Ga0495681_0002095 Ga0495681_0002095_11142_11888 193
14 3300054114 Ga0501084_0059600 Ga0501084_0059600_563_1171 195
15 3300046515 Ga0495620_0001676 Ga0495620_0001676_2058_2813 196
16 3300046520 Ga0495637_0001608 Ga0495637_0001608_2213_2959 196
17 3300046538 Ga0495609_0000906 Ga0495609_0000906_10207_10953 196
18 3300046794 Ga0495589_0000664 Ga0495589_0000664_11500_12246 196
19 3300006847 Ga0075431_100424331 Ga0075431_1004243312 202
20 3300009094 Ga0111539_10272072 Ga0111539_102720723 202
21 3300048913 Ga0496110_0227077 Ga0496110_0227077_302_946 202
22 3300049577 Ga0501041_0041254 Ga0501041_0041254_829_1458 202
23 3300049588 Ga0501072_0018468 Ga0501072_0018468_852_1481 202
24 3300049590 Ga0501074_0033612 Ga0501074_0033612_890_1519 202
25 3300049592 Ga0501076_0020672 Ga0501076_0020672_1715_2344 202
26 3300049593 Ga0501077_0394552 Ga0501077_0394552_65_694 202
27 3300049743 Ga0501081_0145705 Ga0501081_0145705_23_652 202
28 3300049824 Ga0501045_0065159 Ga0501045_0065159_1540_2169 202
29 3300050511 nmdc:mga08y16_56354_c1 nmdc:mga08y16_56354_c1_2423_3049 202
30 3300060353 Ga0501082_0219280 Ga0501082_0219280_714_1343 202
31 3300061734 Ga0530510_0020094 Ga0530510_0020094_98_727 202
32 iso_pu_bacteria 2511231004 2511253541 203
33 iso_pu_bacteria 2511231007 2511269882 203
34 iso_pu_bacteria 2511231008 2511275843 203
35 iso_pu_bacteria 2511231010 2511289800 203
36 iso_pu_bacteria 2511231011 2511294301 203
37 iso_pu_bacteria 2511231012 2511300094 203
38 iso_pu_bacteria 2511231014 2511315383 203
39 iso_pu_bacteria 2511231015 2511318909 203
40 iso_pu_bacteria 2511231016 2511325146 203
41 iso_pu_bacteria 2511231017 2511332139 203
42 iso_pu_bacteria 2511231018 2511339241 203
43 iso_pu_bacteria 2511231019 2511343226 203
44 iso_pu_bacteria 2511231020 2511347913 203
45 iso_pu_bacteria 2511231021 2511357982 203
46 iso_pu_bacteria 2511231022 2511364327 203
47 iso_pu_bacteria 2554235341 2555673054 203
48 iso_pu_bacteria 2599185155 2599327903 203
49 iso_pu_bacteria 2599185160 2599355740 203
50 iso_pu_bacteria 2599185161 2599362858 203
51 iso_pu_bacteria 2599185162 2599368836 203
52 iso_pu_bacteria 2599185163 2599375967 203
53 iso_pu_bacteria 2599185164 2599380846 203
54 iso_pu_bacteria 2599185165 2599387638 203
55 iso_pu_bacteria 2599185166 2599394825 203
56 iso_pu_bacteria 2599185168 2599406590 203
57 iso_pu_bacteria 2599185181 2599462574 203
58 iso_pu_bacteria 2599185182 2599468004 203
59 iso_pu_bacteria 2599185186 2599491591 203
60 iso_pu_bacteria 2599185188 2599503676 203
61 iso_pu_bacteria 2599185248 2599767948 203
62 iso_pu_bacteria 2599185289 2599887747 203
63 iso_pu_bacteria 2599185291 2599899562 203
64 iso_pu_bacteria 2599185300 2599933111 203
65 iso_pu_bacteria 2599185305 2599962212 203
66 iso_pu_bacteria 2599185306 2599969049 203
67 iso_pu_bacteria 2599185308 2599980278 203
68 iso_pu_bacteria 2599185309 2599984483 203
69 iso_pu_bacteria 2599185310 2599990765 203
70 iso_pu_bacteria 2599185312 2600000686 203
71 iso_pu_bacteria 2599185313 2600007097 203
72 iso_pu_bacteria 2599185314 2600014090 203
73 iso_pu_bacteria 2599185315 2600019584 203
74 iso_pu_bacteria 2599185320 2600049718 203
75 iso_pu_bacteria 2599185321 2600054094 203
76 iso_pu_bacteria 2599185324 2600072128 203
77 iso_pu_bacteria 2599185356 2600215198 203
78 iso_pu_bacteria 2600255313 2601775364 203
79 iso_pu_bacteria 2600255318 2601798334 203
80 iso_pu_bacteria 2603880185 2606077228 203
81 iso_pu_bacteria 2603880199 2606129526 203
82 iso_pu_bacteria 2623620443 2624483632 203
83 iso_pu_bacteria 2643221565 2643843280 203
84 iso_pu_bacteria 2643221589 2643956131 203
85 iso_pu_bacteria 2643221602 2644020253 203
86 iso_pu_bacteria 2643221633 2644184266 203
87 iso_pu_bacteria 2651869719 2652545732 203
88 iso_pu_bacteria 2667528170 2671092066 203
89 iso_pu_bacteria 2667528171 2671099499 203
90 iso_pu_bacteria 2713897149 2715754623 203
91 iso_pu_bacteria 2718217725 2718636827 203
92 iso_pu_bacteria 2738543004 2739201050 203
93 iso_pu_bacteria 2738543015 2739260588 203
94 iso_pu_bacteria 2738543020 2739285877 203
95 iso_pu_bacteria 2738543021 2739291190 203
96 iso_pu_bacteria 2738543025 2739312280 203
97 iso_pu_bacteria 2773857670 2774118137 203
98 iso_pu_bacteria 2773857673 2774136409 203
99 iso_pu_bacteria 2784132063 2784261595 203
100 iso_pu_bacteria 2784132072 2784316905 203
101 iso_pu_bacteria 2791355520 2794598984 203
102 iso_pu_bacteria 2808606361 2808856640 203
103 iso_pu_bacteria 2808606376 2808925826 203
104 iso_pu_bacteria 2808606377 2808928226 203
105 iso_pu_bacteria 2808606378 2808936606 203
106 iso_pu_bacteria 2808606380 2808947933 203
107 iso_pu_bacteria 2808606381 2808950592 203
108 iso_pu_bacteria 2808606382 2808961419 203
109 iso_pu_bacteria 2808606383 2808965101 203
110 iso_pu_bacteria 2808606389 2808999993 203
111 iso_pu_bacteria 2818991456 2819655350 203
112 iso_pu_bacteria 2842805378 2842807629 203
113 iso_pu_bacteria 2842832357 2842833676 203
114 iso_pu_bacteria 2842843487 2842845908 203
115 iso_pu_bacteria 2852657418 2852660031 203
116 iso_pu_bacteria 2860339153 2860341936 203
117 iso_pu_bacteria 2878029506 2878029636 203
118 iso_pu_bacteria 2880230671 2880236217 203
119 iso_pu_bacteria 2904518522 2904518734 203
120 iso_pu_bacteria 2904550169 2904555678 203
121 iso_pu_bacteria 2917070673 2917076954 203
122 iso_pu_bacteria 2919063839 2919068158 203
123 iso_pu_bacteria 2919385768 2919388975 203
124 iso_pu_bacteria 2919456309 2919457793 203
125 iso_pu_bacteria 2919481497 2919487180 203
126 iso_pu_bacteria 2919487758 2919487905 203
127 iso_pu_bacteria 2923586266 2923589398 203
128 iso_pu_bacteria 2931369376 2931372247 203
129 iso_pu_bacteria 2931396565 2931398333 203
130 iso_pu_bacteria 2939636861 2939640621 203
131 iso_pu_bacteria 2969304461 2969310434 203
132 iso_pu_bacteria 2988728565 2988731699 203
133 iso_pu_bacteria 3007419365 3007419492 203
134 iso_pu_bacteria 3007511990 3007517392 203
135 iso_pu_bacteria 3007614139 3007619293 203
136 iso_pu_bacteria 3007619802 3007624134 203
137 iso_pu_bacteria 3007718800 3007723091 203
138 iso_pu_bacteria 3007861166 3007864880 203
139 iso_pu_bacteria 637000220 637323484 203
140 iso_pu_bacteria 8056125926 8056126000 203
141 iso_pu_bacteria 8056155041 8056159962 203
142 iso_pu_bacteria 8056172158 8056177208 203
143 iso_pu_bacteria 8056177738 8056182294 203
144 iso_pu_bacteria 8056569372 8056570689 203
145 3300039438 Ga0436360_1303388 Ga0436360_1303388_168_797 205
146 2124908027 MRS2a_Contig_41 MRS2a_00299740 207
147 2162886007 SwRhRL2b_contig_863144 SwRhRL2b_0832.00004750 207
148 3300002771 JGI25163J39215_1000536 JGI25163J39215_10005369 207
149 3300002772 JGI25164J39214_1000058 JGI25164J39214_100005810 207
150 3300003214 JGI25165J46597_1000154 JGI25165J46597_100015410 207
151 3300003781 Ga0055536_1000476 Ga0055536_100047614 207
152 3300003781 Ga0055536_1000603 Ga0055536_100060310 207
153 3300003781 Ga0055536_1018301 Ga0055536_10183012 207
154 3300003791 Ga0055530_10001077 Ga0055530_100010779 207
155 3300003791 Ga0055530_10019195 Ga0055530_100191953 207
156 3300003792 Ga0055540_1000288 Ga0055540_100028811 207
157 3300003792 Ga0055540_1000605 Ga0055540_10006056 207
158 3300003794 Ga0055531_10009540 Ga0055531_100095401 207
159 3300003794 Ga0055531_10056411 Ga0055531_100564112 207
160 3300005288 Ga0065714_10003396 Ga0065714_100033968 207
161 3300005288 Ga0065714_10018027 Ga0065714_100180273 207
162 3300005288 Ga0065714_10031771 Ga0065714_100317712 207
163 3300005288 Ga0065714_10064648 Ga0065714_100646487 207
164 3300005288 Ga0065714_10138730 Ga0065714_101387301 207
165 3300005289 Ga0065704_10133198 Ga0065704_101331982 207
166 3300005293 Ga0065715_10166688 Ga0065715_101666882 207
167 3300005353 Ga0070669_100003148 Ga0070669_1000031487 207
168 3300005455 Ga0070663_100405938 Ga0070663_1004059381 207
169 3300005457 Ga0070662_100016649 Ga0070662_1000166492 207
170 3300005548 Ga0070665_100013854 Ga0070665_1000138544 207
171 3300006048 Ga0075363_100194715 Ga0075363_1001947152 207
172 3300006051 Ga0075364_10062544 Ga0075364_100625442 207
173 3300006051 Ga0075364_10228013 Ga0075364_102280132 207
174 3300006058 Ga0075432_10032885 Ga0075432_100328852 207
175 3300006177 Ga0075362_10081078 Ga0075362_100810781 207
176 3300006177 Ga0075362_10138416 Ga0075362_101384162 207
177 3300006946 Ga0079104_1000262 Ga0079104_100026210 207
178 3300006946 Ga0079104_1003439 Ga0079104_10034395 207
179 3300006948 Ga0099826_10055754 Ga0099826_100557543 207
180 3300009011 Ga0105251_10000674 Ga0105251_100006749 207
181 3300009011 Ga0105251_10001737 Ga0105251_100017377 207
182 3300009011 Ga0105251_10005123 Ga0105251_100051238 207
183 3300009011 Ga0105251_10022911 Ga0105251_100229113 207
184 3300009011 Ga0105251_10132138 Ga0105251_101321381 207
185 3300009011 Ga0105251_10150882 Ga0105251_101508821 207
186 3300009011 Ga0105251_10177691 Ga0105251_101776912 207
187 3300009036 Ga0105244_10000073 Ga0105244_1000007346 207
188 3300009036 Ga0105244_10018244 Ga0105244_100182442 207
189 3300009036 Ga0105244_10018513 Ga0105244_100185134 207
190 3300009036 Ga0105244_10022535 Ga0105244_100225354 207
191 3300009036 Ga0105244_10030533 Ga0105244_100305333 207
192 3300009036 Ga0105244_10066299 Ga0105244_100662993 207
193 3300009036 Ga0105244_10088751 Ga0105244_100887512 207
194 3300009036 Ga0105244_10095851 Ga0105244_100958511 207
195 3300009092 Ga0105250_10000138 Ga0105250_1000013843 207
196 3300009092 Ga0105250_10000857 Ga0105250_100008579 207
197 3300009092 Ga0105250_10001344 Ga0105250_100013447 207
198 3300009092 Ga0105250_10006950 Ga0105250_100069502 207
199 3300009092 Ga0105250_10045949 Ga0105250_100459492 207
200 3300009092 Ga0105250_10151863 Ga0105250_101518631 207
201 3300009092 Ga0105250_10238878 Ga0105250_102388782 207
202 3300009093 Ga0105240_10535996 Ga0105240_105359962 207
203 3300009101 Ga0105247_10400651 Ga0105247_104006511 207
204 3300009148 Ga0105243_10000132 Ga0105243_1000013211 207
205 3300009148 Ga0105243_10004299 Ga0105243_100042998 207
206 3300009148 Ga0105243_10007452 Ga0105243_100074522 207
207 3300009148 Ga0105243_10008831 Ga0105243_100088315 207
208 3300009148 Ga0105243_10024118 Ga0105243_100241182 207
209 3300009148 Ga0105243_10153898 Ga0105243_101538982 207
210 3300009148 Ga0105243_10542952 Ga0105243_105429521 207
211 3300009148 Ga0105243_10638312 Ga0105243_106383121 207
212 3300009176 Ga0105242_10251986 Ga0105242_102519863 207
213 3300009551 Ga0105238_11211543 Ga0105238_112115432 207
214 3300009553 Ga0105249_10007738 Ga0105249_100077382 207
215 3300011119 Ga0105246_10001455 Ga0105246_100014557 207
216 3300011119 Ga0105246_10002582 Ga0105246_100025827 207
217 3300011119 Ga0105246_10104861 Ga0105246_101048613 207
218 3300011119 Ga0105246_11143202 Ga0105246_111432021 207
219 3300012483 Ga0157337_1000413 Ga0157337_10004132 207
220 3300012498 Ga0157345_1000061 Ga0157345_10000617 207
221 3300012498 Ga0157345_1000713 Ga0157345_10007132 207
222 3300013100 Ga0157373_10000959 Ga0157373_100009599 207
223 3300013100 Ga0157373_10001902 Ga0157373_100019026 207
224 3300013100 Ga0157373_10022444 Ga0157373_100224446 207
225 3300013100 Ga0157373_10041651 Ga0157373_100416513 207
226 3300013100 Ga0157373_10468615 Ga0157373_104686152 207
227 3300013102 Ga0157371_10001823 Ga0157371_100018238 207
228 3300013102 Ga0157371_10002126 Ga0157371_1000212610 207
229 3300013102 Ga0157371_10007445 Ga0157371_100074455 207
230 3300013104 Ga0157370_10006857 Ga0157370_100068574 207
231 3300013104 Ga0157370_10163010 Ga0157370_101630102 207
232 3300013104 Ga0157370_10357195 Ga0157370_103571952 207
233 3300013104 Ga0157370_11015388 Ga0157370_110153881 207
234 3300013105 Ga0157369_10002087 Ga0157369_1000208712 207
235 3300013105 Ga0157369_10057159 Ga0157369_100571594 207
236 3300013105 Ga0157369_10127023 Ga0157369_101270234 207
237 3300013105 Ga0157369_10699835 Ga0157369_106998351 207
238 3300013306 Ga0163162_10065423 Ga0163162_100654232 207
239 3300013307 Ga0157372_10001023 Ga0157372_1000102310 207
240 3300013308 Ga0157375_10598746 Ga0157375_105987462 207
241 3300014497 Ga0182008_10000699 Ga0182008_100006998 207
242 3300014497 Ga0182008_10001025 Ga0182008_100010255 207
243 3300014497 Ga0182008_10003284 Ga0182008_100032842 207
244 3300014497 Ga0182008_10004033 Ga0182008_100040333 207
245 3300014497 Ga0182008_10010070 Ga0182008_100100704 207
246 3300014497 Ga0182008_10021998 Ga0182008_100219981 207
247 3300014497 Ga0182008_10081961 Ga0182008_100819612 207
248 3300015261 Ga0182006_1001164 Ga0182006_10011646 207
249 3300015261 Ga0182006_1001423 Ga0182006_10014233 207
250 3300015261 Ga0182006_1006835 Ga0182006_10068356 207
251 3300015261 Ga0182006_1009181 Ga0182006_10091813 207
252 3300015261 Ga0182006_1019175 Ga0182006_10191752 207
253 3300015261 Ga0182006_1029571 Ga0182006_10295713 207
254 3300015261 Ga0182006_1049558 Ga0182006_10495583 207
255 3300015262 Ga0182007_10002451 Ga0182007_100024513 207
256 3300015262 Ga0182007_10110278 Ga0182007_101102781 207
257 3300015265 Ga0182005_1000991 Ga0182005_10009915 207
258 3300015265 Ga0182005_1002546 Ga0182005_10025462 207
259 3300015265 Ga0182005_1003025 Ga0182005_10030252 207
260 3300015265 Ga0182005_1024728 Ga0182005_10247282 207
261 3300017792 Ga0163161_10001007 Ga0163161_1000100711 207
262 3300017792 Ga0163161_10001974 Ga0163161_100019744 207
263 3300017792 Ga0163161_10025060 Ga0163161_100250601 207
264 3300017792 Ga0163161_10025234 Ga0163161_100252344 207
265 3300017792 Ga0163161_10030726 Ga0163161_100307264 207
266 3300017792 Ga0163161_10034086 Ga0163161_100340862 207
267 3300017792 Ga0163161_10742622 Ga0163161_107426222 207
268 3300025207 Ga0209760_100148 Ga0209760_10014823 207
269 3300025230 Ga0209563_100453 Ga0209563_1004533 207
270 3300025231 Ga0207427_100005 Ga0207427_100005545 207
271 3300025233 Ga0209437_100018 Ga0209437_100018455 207
272 3300025256 Ga0209759_1018281 Ga0209759_10182812 207
273 3300025261 Ga0209233_1000021 Ga0209233_1000021545 207
274 3300025292 Ga0209676_1000015 Ga0209676_1000015197 207
275 3300025292 Ga0209676_1000278 Ga0209676_100027857 207
276 3300025292 Ga0209676_1003102 Ga0209676_10031024 207
277 3300025292 Ga0209676_1004940 Ga0209676_10049402 207
278 3300025298 Ga0209050_1000030 Ga0209050_1000030241 207
279 3300025298 Ga0209050_1000061 Ga0209050_100006170 207
280 3300025298 Ga0209050_1003835 Ga0209050_10038354 207
281 3300025298 Ga0209050_1052904 Ga0209050_10529042 207
282 3300025303 Ga0209051_1000012 Ga0209051_1000012482 207
283 3300025303 Ga0209051_1000088 Ga0209051_100008824 207
284 3300025303 Ga0209051_1023888 Ga0209051_10238882 207
285 3300025304 Ga0209257_1000143 Ga0209257_1000143115 207
286 3300025304 Ga0209257_1037097 Ga0209257_10370972 207
287 3300025711 Ga0207696_1000078 Ga0207696_100007843 207
288 3300025711 Ga0207696_1000180 Ga0207696_100018069 207
289 3300025711 Ga0207696_1000184 Ga0207696_100018410 207
290 3300025711 Ga0207696_1000612 Ga0207696_100061211 207
291 3300025711 Ga0207696_1000698 Ga0207696_10006987 207
292 3300025711 Ga0207696_1031641 Ga0207696_10316412 207
293 3300025711 Ga0207696_1048095 Ga0207696_10480952 207
294 3300025728 Ga0207655_1000033 Ga0207655_1000033280 207
295 3300025728 Ga0207655_1000116 Ga0207655_100011687 207
296 3300025728 Ga0207655_1001603 Ga0207655_10016037 207
297 3300025728 Ga0207655_1001803 Ga0207655_10018032 207
298 3300025728 Ga0207655_1006251 Ga0207655_10062512 207
299 3300025728 Ga0207655_1024651 Ga0207655_10246513 207
300 3300025728 Ga0207655_1054218 Ga0207655_10542182 207
301 3300025728 Ga0207655_1058182 Ga0207655_10581822 207
302 3300025735 Ga0207713_1000010 Ga0207713_1000010462 207
303 3300025735 Ga0207713_1000961 Ga0207713_10009617 207
304 3300025735 Ga0207713_1001062 Ga0207713_100106221 207
305 3300025735 Ga0207713_1002196 Ga0207713_10021965 207
306 3300025735 Ga0207713_1002402 Ga0207713_10024027 207
307 3300025735 Ga0207713_1004217 Ga0207713_10042173 207
308 3300025735 Ga0207713_1008043 Ga0207713_10080436 207
309 3300025735 Ga0207713_1009976 Ga0207713_10099766 207
310 3300025912 Ga0207707_10123370 Ga0207707_101233702 207
311 3300025912 Ga0207707_10139388 Ga0207707_101393882 207
312 3300025921 Ga0207652_10067601 Ga0207652_100676012 207
313 3300025923 Ga0207681_10009500 Ga0207681_100095003 207
314 3300025933 Ga0207706_10004797 Ga0207706_1000479710 207
315 3300025934 Ga0207686_10137578 Ga0207686_101375784 207
316 3300025935 Ga0207709_10000061 Ga0207709_1000006161 207
317 3300025935 Ga0207709_10000063 Ga0207709_1000006369 207
318 3300025935 Ga0207709_10139634 Ga0207709_101396342 207
319 3300025935 Ga0207709_10316577 Ga0207709_103165772 207
320 3300025961 Ga0207712_10012351 Ga0207712_100123514 207
321 3300026067 Ga0207678_10667672 Ga0207678_106676722 207
322 3300027111 Ga0209281_1000016 Ga0209281_1000016481 207
323 3300027111 Ga0209281_1000091 Ga0209281_10000913 207
324 3300027666 Ga0209282_1044203 Ga0209282_10442033 207
325 3300027907 Ga0207428_10088321 Ga0207428_100883212 207
326 3300028379 Ga0268266_10004185 Ga0268266_100041855 207
327 3300030521 Ga0307511_10017143 Ga0307511_100171433 207
328 3300030521 Ga0307511_10160949 Ga0307511_101609492 207
329 3300030735 Ga0316178_1077247 Ga0316178_10772477 207
330 3300031548 Ga0307408_100001323 Ga0307408_1000013235 207
331 3300031548 Ga0307408_100002282 Ga0307408_1000022823 207
332 3300031548 Ga0307408_100083672 Ga0307408_1000836724 207
333 3300031730 Ga0307516_10129374 Ga0307516_101293743 207
334 3300031730 Ga0307516_10254482 Ga0307516_102544822 207
335 3300031730 Ga0307516_10316612 Ga0307516_103166122 207
336 3300031731 Ga0307405_10000143 Ga0307405_100001439 207
337 3300031824 Ga0307413_10209476 Ga0307413_102094762 207
338 3300031824 Ga0307413_10229648 Ga0307413_102296482 207
339 3300031901 Ga0307406_10009349 Ga0307406_100093494 207
340 3300031901 Ga0307406_10266698 Ga0307406_102666983 207
341 3300031903 Ga0307407_10046413 Ga0307407_100464131 207
342 3300031911 Ga0307412_10005109 Ga0307412_100051098 207
343 3300031911 Ga0307412_10024630 Ga0307412_100246304 207
344 3300031911 Ga0307412_10042733 Ga0307412_100427331 207
345 3300031911 Ga0307412_10167760 Ga0307412_101677603 207
346 3300031995 Ga0307409_100003401 Ga0307409_1000034013 207
347 3300032002 Ga0307416_100038540 Ga0307416_1000385402 207
348 3300032004 Ga0307414_10002499 Ga0307414_100024995 207
349 3300032004 Ga0307414_10061753 Ga0307414_100617532 207
350 3300032004 Ga0307414_10065522 Ga0307414_100655222 207
351 3300032004 Ga0307414_10087086 Ga0307414_100870863 207
352 3300032005 Ga0307411_10071206 Ga0307411_100712063 207
353 3300033180 Ga0307510_10001990 Ga0307510_1000199012 207
354 3300038705 Ga0237819_00815 Ga0237819_00815_5309_5962 207
355 3300041405 Ga0439438_000698 Ga0439438_000698_7077_7730 207
356 3300041405 Ga0439438_000904 Ga0439438_000904_359_1000 207
357 3300041405 Ga0439438_001459 Ga0439438_001459_6811_7434 207
358 3300041405 Ga0439438_001774 Ga0439438_001774_773_1426 207
359 3300041405 Ga0439438_005021 Ga0439438_005021_3187_3810 207
360 3300041405 Ga0439438_006414 Ga0439438_006414_3118_3771 207
361 3300041407 Ga0439447_000218 Ga0439447_000218_7936_8559 207
362 3300041407 Ga0439447_000413 Ga0439447_000413_7104_7727 207
363 3300041407 Ga0439447_000995 Ga0439447_000995_7589_8242 207
364 3300041407 Ga0439447_001822 Ga0439447_001822_7100_7723 207
365 3300041407 Ga0439447_002379 Ga0439447_002379_5673_6296 207
366 3300041407 Ga0439447_012866 Ga0439447_012866_1656_2279 207
367 3300041407 Ga0439447_026469 Ga0439447_026469_194_817 207
368 3300041410 Ga0439461_0092357 Ga0439461_0092357_35_658 207
369 3300041411 Ga0439466_0002737 Ga0439466_0002737_2284_2907 207
370 3300041411 Ga0439466_0002814 Ga0439466_0002814_4826_5449 207
371 3300041411 Ga0439466_0004530 Ga0439466_0004530_398_1039 207
372 3300041411 Ga0439466_0011984 Ga0439466_0011984_1389_2012 207
373 3300041411 Ga0439466_0014760 Ga0439466_0014760_905_1558 207
374 3300041411 Ga0439466_0019021 Ga0439466_0019021_153_806 207
375 3300041411 Ga0439466_0021412 Ga0439466_0021412_1514_2137 207
376 3300041411 Ga0439466_0025303 Ga0439466_0025303_362_985 207
377 3300041413 Ga0439465_0004541 Ga0439465_0004541_3428_4051 207
378 3300041997 Ga0439431_0053597 Ga0439431_0053597_55_696 207
379 3300042004 Ga0439445_0049602 Ga0439445_0049602_399_1040 207
380 3300042004 Ga0439445_0065947 Ga0439445_0065947_346_969 207
381 3300042006 Ga0439432_000241 Ga0439432_000241_7124_7765 207
382 3300042006 Ga0439432_002077 Ga0439432_002077_5673_6296 207
383 3300042006 Ga0439432_021286 Ga0439432_021286_93_746 207
384 3300042009 Ga0439451_002539 Ga0439451_002539_2983_3606 207
385 3300042009 Ga0439451_005322 Ga0439451_005322_1780_2403 207
386 3300042010 Ga0439452_000402 Ga0439452_000402_6387_7010 207
387 3300042010 Ga0439452_000459 Ga0439452_000459_11421_12074 207
388 3300042010 Ga0439452_001139 Ga0439452_001139_7651_8274 207
389 3300042010 Ga0439452_007719 Ga0439452_007719_1180_1803 207
390 3300042010 Ga0439452_032084 Ga0439452_032084_287_928 207
391 3300042013 Ga0439456_001931 Ga0439456_001931_79_702 207
392 3300042013 Ga0439456_005462 Ga0439456_005462_1325_1978 207
393 3300042013 Ga0439456_013402 Ga0439456_013402_177_800 207
394 3300042013 Ga0439456_027140 Ga0439456_027140_342_965 207
395 3300042013 Ga0439456_032977 Ga0439456_032977_207_848 207
396 3300042016 Ga0439463_000465 Ga0439463_000465_8664_9287 207
397 3300042016 Ga0439463_003225 Ga0439463_003225_3288_3911 207
398 3300042115 Ga0450911_000228 Ga0450911_000228_11379_12032 207
399 3300042115 Ga0450911_000480 Ga0450911_000480_11477_12130 207
400 3300042115 Ga0450911_001251 Ga0450911_001251_4509_5132 207
401 3300042121 Ga0450919_001557 Ga0450919_001557_2225_2848 207
402 3300042124 Ga0450922_001336 Ga0450922_001336_160_783 207
403 3300042127 Ga0450890_000187 Ga0450890_000187_5488_6111 207
404 3300042129 Ga0450891_000346 Ga0450891_000346_1721_2389 207
405 3300042137 Ga0450902_002970 Ga0450902_002970_256_879 207
406 3300042137 Ga0450902_012448 Ga0450902_012448_329_952 207
407 3300042137 Ga0450902_013025 Ga0450902_013025_329_952 207
408 3300042137 Ga0450902_020865 Ga0450902_020865_349_972 207
409 3300042137 Ga0450902_021301 Ga0450902_021301_130_753 207
410 3300042137 Ga0450902_022583 Ga0450902_022583_253_876 207
411 3300042138 Ga0450903_000418 Ga0450903_000418_1460_2083 207
412 3300042138 Ga0450903_001427 Ga0450903_001427_3560_4183 207
413 3300042138 Ga0450903_006350 Ga0450903_006350_158_781 207
414 3300042139 Ga0450904_004416 Ga0450904_004416_479_1102 207
415 3300042142 Ga0450905_007958 Ga0450905_007958_661_1284 207
416 3300042142 Ga0450905_012490 Ga0450905_012490_168_791 207
417 3300042145 Ga0450906_000070 Ga0450906_000070_8916_9569 207
418 3300042145 Ga0450906_000339 Ga0450906_000339_7641_8294 207
419 3300042146 Ga0450907_000189 Ga0450907_000189_8437_9060 207
420 3300042146 Ga0450907_000613 Ga0450907_000613_6922_7575 207
421 3300042147 Ga0450910_000383 Ga0450910_000383_2027_2650 207
422 3300042156 Ga0439446_0000216 Ga0439446_0000216_4165_4797 207
423 3300042156 Ga0439446_0002002 Ga0439446_0002002_3381_4004 207
424 3300042156 Ga0439446_0006086 Ga0439446_0006086_141_764 207
425 3300042184 Ga0450908_002191 Ga0450908_002191_933_1556 207
426 3300042184 Ga0450908_022608 Ga0450908_022608_465_1088 207
427 3300042185 Ga0450909_000428 Ga0450909_000428_1605_2228 207
428 3300042185 Ga0450909_001868 Ga0450909_001868_255_878 207
429 3300042185 Ga0450909_016251 Ga0450909_016251_145_768 207
430 3300042435 Ga0439434_0000252 Ga0439434_0000252_6903_7526 207
431 3300042435 Ga0439434_0002868 Ga0439434_0002868_1909_2532 207
432 3300042439 Ga0439464_0003584 Ga0439464_0003584_2786_3409 207
433 3300042461 Ga0439460_0000396 Ga0439460_0000396_5754_6377 207
434 3300042461 Ga0439460_0002073 Ga0439460_0002073_827_1480 207
435 3300042461 Ga0439460_0049612 Ga0439460_0049612_403_1044 207
436 3300042531 Ga0450918_002070 Ga0450918_002070_659_1282 207
437 3300042531 Ga0450918_035185 Ga0450918_035185_170_793 207
438 3300042532 Ga0450893_0001324 Ga0450893_0001324_2535_3158 207
439 3300042533 Ga0450901_001267 Ga0450901_001267_1202_1825 207
440 3300042993 Ga0439440_0004160 Ga0439440_0004160_1881_2504 207
441 3300046452 Ga0495617_000773 Ga0495617_000773_6088_6711 207
442 3300046452 Ga0495617_003698 Ga0495617_003698_941_1564 207
443 3300046452 Ga0495617_011679 Ga0495617_011679_1566_2189 207
444 3300046452 Ga0495617_017255 Ga0495617_017255_99_722 207
445 3300046452 Ga0495617_040902 Ga0495617_040902_155_901 207
446 3300046452 Ga0495617_043526 Ga0495617_043526_385_1008 207
447 3300046452 Ga0495617_139839 Ga0495617_139839_65_688 207
448 3300046453 Ga0495627_001303 Ga0495627_001303_12206_12859 207
449 3300046453 Ga0495627_001371 Ga0495627_001371_11567_12313 207
450 3300046453 Ga0495627_004876 Ga0495627_004876_1673_2299 207
451 3300046453 Ga0495627_038118 Ga0495627_038118_515_1138 207
452 3300046453 Ga0495627_073862 Ga0495627_073862_270_893 207
453 3300046455 Ga0495603_0004624 Ga0495603_0004624_6685_7308 207
454 3300046457 Ga0495590_0001763 Ga0495590_0001763_832_1485 207
455 3300046457 Ga0495590_0005614 Ga0495590_0005614_510_1133 207
456 3300046457 Ga0495590_0006823 Ga0495590_0006823_49_672 207
457 3300046457 Ga0495590_0028052 Ga0495590_0028052_295_918 207
458 3300046457 Ga0495590_0036714 Ga0495590_0036714_559_1182 207
459 3300046458 Ga0495591_000617 Ga0495591_000617_9370_9993 207
460 3300046458 Ga0495591_000754 Ga0495591_000754_10958_11704 207
461 3300046458 Ga0495591_000770 Ga0495591_000770_11165_11818 207
462 3300046458 Ga0495591_001717 Ga0495591_001717_10293_10946 207
463 3300046458 Ga0495591_002517 Ga0495591_002517_6779_7402 207
464 3300046458 Ga0495591_003388 Ga0495591_003388_1007_1630 207
465 3300046458 Ga0495591_005593 Ga0495591_005593_4184_4807 207
466 3300046458 Ga0495591_009920 Ga0495591_009920_2586_3212 207
467 3300046458 Ga0495591_011452 Ga0495591_011452_382_1041 207
468 3300046458 Ga0495591_025978 Ga0495591_025978_775_1398 207
469 3300046458 Ga0495591_041514 Ga0495591_041514_338_961 207
470 3300046458 Ga0495591_051357 Ga0495591_051357_349_972 207
471 3300046459 Ga0495629_0059385 Ga0495629_0059385_1640_2263 207
472 3300046460 Ga0495638_0000698 Ga0495638_0000698_24233_24856 207
473 3300046460 Ga0495638_0001198 Ga0495638_0001198_9096_9749 207
474 3300046460 Ga0495638_0002225 Ga0495638_0002225_14679_15308 207
475 3300046460 Ga0495638_0019430 Ga0495638_0019430_2173_2826 207
476 3300046460 Ga0495638_0021288 Ga0495638_0021288_984_1607 207
477 3300046460 Ga0495638_0023806 Ga0495638_0023806_2456_3085 207
478 3300046460 Ga0495638_0064840 Ga0495638_0064840_49_672 207
479 3300046460 Ga0495638_0129161 Ga0495638_0129161_81_704 207
480 3300046460 Ga0495638_0214397 Ga0495638_0214397_291_914 207
481 3300046463 Ga0495653_0001621 Ga0495653_0001621_5359_6012 207
482 3300046463 Ga0495653_0004821 Ga0495653_0004821_2035_2658 207
483 3300046463 Ga0495653_0325690 Ga0495653_0325690_66_719 207
484 3300046471 Ga0495650_0002905 Ga0495650_0002905_11538_12161 207
485 3300046471 Ga0495650_0003275 Ga0495650_0003275_4387_5010 207
486 3300046471 Ga0495650_0005040 Ga0495650_0005040_1478_2131 207
487 3300046471 Ga0495650_0006979 Ga0495650_0006979_3648_4271 207
488 3300046471 Ga0495650_0012881 Ga0495650_0012881_756_1382 207
489 3300046471 Ga0495650_0017643 Ga0495650_0017643_2748_3371 207
490 3300046471 Ga0495650_0040066 Ga0495650_0040066_556_1302 207
491 3300046471 Ga0495650_0058134 Ga0495650_0058134_226_885 207
492 3300046471 Ga0495650_0069713 Ga0495650_0069713_260_889 207
493 3300046473 Ga0495582_0027713 Ga0495582_0027713_2095_2718 207
494 3300046474 Ga0495605_0000485 Ga0495605_0000485_18011_18637 207
495 3300046474 Ga0495605_0000970 Ga0495605_0000970_7324_8070 207
496 3300046474 Ga0495605_0001636 Ga0495605_0001636_6548_7171 207
497 3300046474 Ga0495605_0002342 Ga0495605_0002342_10828_11481 207
498 3300046474 Ga0495605_0003022 Ga0495605_0003022_2992_3615 207
499 3300046474 Ga0495605_0014689 Ga0495605_0014689_3583_4242 207
500 3300046474 Ga0495605_0021015 Ga0495605_0021015_2352_2975 207
501 3300046474 Ga0495605_0044851 Ga0495605_0044851_689_1312 207
502 3300046475 Ga0495639_0001819 Ga0495639_0001819_8536_9159 207
503 3300046475 Ga0495639_0044282 Ga0495639_0044282_791_1414 207
504 3300046491 Ga0495584_0000804 Ga0495584_0000804_8178_8801 207
505 3300046491 Ga0495584_0001305 Ga0495584_0001305_7655_8284 207
506 3300046491 Ga0495584_0001792 Ga0495584_0001792_4943_5566 207
507 3300046491 Ga0495584_0002222 Ga0495584_0002222_4753_5412 207
508 3300046491 Ga0495584_0007163 Ga0495584_0007163_2214_2843 207
509 3300046491 Ga0495584_0009062 Ga0495584_0009062_2693_3322 207
510 3300046491 Ga0495584_0025515 Ga0495584_0025515_1545_2168 207
511 3300046491 Ga0495584_0031046 Ga0495584_0031046_2031_2660 207
512 3300046492 Ga0495585_0001389 Ga0495585_0001389_6987_7646 207
513 3300046492 Ga0495585_0001612 Ga0495585_0001612_666_1289 207
514 3300046492 Ga0495585_0001711 Ga0495585_0001711_9269_9892 207
515 3300046492 Ga0495585_0003356 Ga0495585_0003356_703_1326 207
516 3300046492 Ga0495585_0048829 Ga0495585_0048829_1035_1658 207
517 3300046492 Ga0495585_0221537 Ga0495585_0221537_79_702 207
518 3300046499 Ga0495594_0001003 Ga0495594_0001003_10484_11110 207
519 3300046499 Ga0495594_0004242 Ga0495594_0004242_5525_6148 207
520 3300046499 Ga0495594_0093492 Ga0495594_0093492_298_921 207
521 3300046500 Ga0495596_0000009 Ga0495596_0000009_53386_54009 207
522 3300046501 Ga0495607_0000113 Ga0495607_0000113_50981_51604 207
523 3300046501 Ga0495607_0000257 Ga0495607_0000257_9617_10240 207
524 3300046501 Ga0495607_0002320 Ga0495607_0002320_8118_8771 207
525 3300046501 Ga0495607_0003411 Ga0495607_0003411_11297_11920 207
526 3300046501 Ga0495607_0004383 Ga0495607_0004383_2363_2986 207
527 3300046501 Ga0495607_0007831 Ga0495607_0007831_2218_2964 207
528 3300046501 Ga0495607_0008187 Ga0495607_0008187_644_1267 207
529 3300046501 Ga0495607_0039787 Ga0495607_0039787_980_1603 207
530 3300046501 Ga0495607_0050421 Ga0495607_0050421_168_809 207
531 3300046501 Ga0495607_0090406 Ga0495607_0090406_965_1588 207
532 3300046501 Ga0495607_0100652 Ga0495607_0100652_630_1253 207
533 3300046506 Ga0495583_0000362 Ga0495583_0000362_65261_65887 207
534 3300046506 Ga0495583_0006903 Ga0495583_0006903_1714_2343 207
535 3300046506 Ga0495583_0007240 Ga0495583_0007240_72_695 207
536 3300046506 Ga0495583_0011515 Ga0495583_0011515_206_847 207
537 3300046506 Ga0495583_0044269 Ga0495583_0044269_1417_2040 207
538 3300046506 Ga0495583_0230444 Ga0495583_0230444_30_653 207
539 3300046507 Ga0495606_0003219 Ga0495606_0003219_5460_6119 207
540 3300046507 Ga0495606_0004373 Ga0495606_0004373_12328_12981 207
541 3300046507 Ga0495606_0006204 Ga0495606_0006204_2267_2920 207
542 3300046507 Ga0495606_0009801 Ga0495606_0009801_7249_7980 207
543 3300046507 Ga0495606_0022693 Ga0495606_0022693_2179_2802 207
544 3300046507 Ga0495606_0035883 Ga0495606_0035883_13_636 207
545 3300046507 Ga0495606_0372296 Ga0495606_0372296_56_679 207
546 3300046512 Ga0495610_0001288 Ga0495610_0001288_16787_17518 207
547 3300046512 Ga0495610_0003510 Ga0495610_0003510_9258_9917 207
548 3300046512 Ga0495610_0003640 Ga0495610_0003640_4454_5077 207
549 3300046512 Ga0495610_0006721 Ga0495610_0006721_5439_6062 207
550 3300046512 Ga0495610_0009436 Ga0495610_0009436_3240_3893 207
551 3300046512 Ga0495610_0011027 Ga0495610_0011027_3980_4603 207
552 3300046512 Ga0495610_0015974 Ga0495610_0015974_2608_3261 207
553 3300046512 Ga0495610_0085471 Ga0495610_0085471_44_670 207
554 3300046512 Ga0495610_0114087 Ga0495610_0114087_443_1066 207
555 3300046512 Ga0495610_0134226 Ga0495610_0134226_153_791 207
556 3300046513 Ga0495616_0000759 Ga0495616_0000759_11829_12575 207
557 3300046513 Ga0495616_0004366 Ga0495616_0004366_1754_2383 207
558 3300046513 Ga0495616_0005169 Ga0495616_0005169_4883_5506 207
559 3300046513 Ga0495616_0008750 Ga0495616_0008750_3084_3707 207
560 3300046513 Ga0495616_0009160 Ga0495616_0009160_2400_3023 207
561 3300046513 Ga0495616_0036775 Ga0495616_0036775_673_1299 207
562 3300046513 Ga0495616_0040971 Ga0495616_0040971_1509_2132 207
563 3300046513 Ga0495616_0047434 Ga0495616_0047434_624_1247 207
564 3300046515 Ga0495620_0000044 Ga0495620_0000044_53073_53699 207
565 3300046515 Ga0495620_0000847 Ga0495620_0000847_15396_16055 207
566 3300046515 Ga0495620_0002610 Ga0495620_0002610_7490_8113 207
567 3300046515 Ga0495620_0004241 Ga0495620_0004241_1301_1954 207
568 3300046515 Ga0495620_0025632 Ga0495620_0025632_1109_1732 207
569 3300046515 Ga0495620_0099525 Ga0495620_0099525_79_708 207
570 3300046517 Ga0495630_0004905 Ga0495630_0004905_1921_2574 207
571 3300046517 Ga0495630_0053976 Ga0495630_0053976_1801_2424 207
572 3300046517 Ga0495630_0392219 Ga0495630_0392219_125_748 207
573 3300046518 Ga0495631_0000613 Ga0495631_0000613_14018_14641 207
574 3300046518 Ga0495631_0000644 Ga0495631_0000644_11762_12415 207
575 3300046518 Ga0495631_0002854 Ga0495631_0002854_1796_2419 207
576 3300046518 Ga0495631_0003031 Ga0495631_0003031_3899_4525 207
577 3300046518 Ga0495631_0017266 Ga0495631_0017266_1290_1913 207
578 3300046519 Ga0495632_0001236 Ga0495632_0001236_8243_8866 207
579 3300046519 Ga0495632_0002808 Ga0495632_0002808_4185_4844 207
580 3300046519 Ga0495632_0002947 Ga0495632_0002947_4950_5573 207
581 3300046519 Ga0495632_0003223 Ga0495632_0003223_8113_8772 207
582 3300046519 Ga0495632_0003459 Ga0495632_0003459_2138_2884 207
583 3300046519 Ga0495632_0012356 Ga0495632_0012356_481_1134 207
584 3300046519 Ga0495632_0013823 Ga0495632_0013823_3062_3685 207
585 3300046519 Ga0495632_0016598 Ga0495632_0016598_1342_1995 207
586 3300046519 Ga0495632_0045022 Ga0495632_0045022_915_1538 207
587 3300046519 Ga0495632_0068398 Ga0495632_0068398_672_1325 207
588 3300046519 Ga0495632_0072958 Ga0495632_0072958_29_652 207
589 3300046519 Ga0495632_0116942 Ga0495632_0116942_94_717 207
590 3300046520 Ga0495637_0000930 Ga0495637_0000930_6440_7063 207
591 3300046520 Ga0495637_0000976 Ga0495637_0000976_10332_10955 207
592 3300046520 Ga0495637_0001701 Ga0495637_0001701_1821_2480 207
593 3300046520 Ga0495637_0002053 Ga0495637_0002053_1559_2212 207
594 3300046520 Ga0495637_0002305 Ga0495637_0002305_1337_1960 207
595 3300046520 Ga0495637_0004874 Ga0495637_0004874_357_980 207
596 3300046520 Ga0495637_0005270 Ga0495637_0005270_4839_5468 207
597 3300046520 Ga0495637_0007274 Ga0495637_0007274_1219_1845 207
598 3300046520 Ga0495637_0022190 Ga0495637_0022190_2152_2775 207
599 3300046520 Ga0495637_0023348 Ga0495637_0023348_306_965 207
600 3300046520 Ga0495637_0082942 Ga0495637_0082942_231_884 207
601 3300046522 Ga0495643_0001374 Ga0495643_0001374_9504_10142 207
602 3300046522 Ga0495643_0006486 Ga0495643_0006486_4570_5208 207
603 3300046522 Ga0495643_0007088 Ga0495643_0007088_4254_4877 207
604 3300046522 Ga0495643_0110285 Ga0495643_0110285_689_1312 207
605 3300046522 Ga0495643_0188471 Ga0495643_0188471_22_645 207
606 3300046523 Ga0495644_0000403 Ga0495644_0000403_15975_16598 207
607 3300046523 Ga0495644_0028764 Ga0495644_0028764_955_1578 207
608 3300046523 Ga0495644_0082461 Ga0495644_0082461_114_737 207
609 3300046524 Ga0495648_0002031 Ga0495648_0002031_11729_12382 207
610 3300046524 Ga0495648_0003053 Ga0495648_0003053_12582_13235 207
611 3300046524 Ga0495648_0006654 Ga0495648_0006654_5522_6268 207
612 3300046524 Ga0495648_0006717 Ga0495648_0006717_7182_7805 207
613 3300046524 Ga0495648_0012529 Ga0495648_0012529_3400_4023 207
614 3300046524 Ga0495648_0014511 Ga0495648_0014511_4485_5111 207
615 3300046524 Ga0495648_0016746 Ga0495648_0016746_4348_5001 207
616 3300046524 Ga0495648_0020395 Ga0495648_0020395_2845_3498 207
617 3300046524 Ga0495648_0029167 Ga0495648_0029167_395_1048 207
618 3300046524 Ga0495648_0030581 Ga0495648_0030581_632_1291 207
619 3300046524 Ga0495648_0034998 Ga0495648_0034998_615_1238 207
620 3300046524 Ga0495648_0079198 Ga0495648_0079198_1052_1675 207
621 3300046524 Ga0495648_0154287 Ga0495648_0154287_104_727 207
622 3300046526 Ga0495666_0002157 Ga0495666_0002157_341_994 207
623 3300046526 Ga0495666_0003124 Ga0495666_0003124_5134_5787 207
624 3300046526 Ga0495666_0069698 Ga0495666_0069698_354_977 207
625 3300046526 Ga0495666_0078780 Ga0495666_0078780_377_1000 207
626 3300046526 Ga0495666_0157140 Ga0495666_0157140_120_743 207
627 3300046528 Ga0495642_0000290 Ga0495642_0000290_18245_18868 207
628 3300046528 Ga0495642_0000591 Ga0495642_0000591_13089_13742 207
629 3300046528 Ga0495642_0002466 Ga0495642_0002466_1942_2565 207
630 3300046529 Ga0495652_0130975 Ga0495652_0130975_981_1604 207
631 3300046530 Ga0495654_0000354 Ga0495654_0000354_20837_21583 207
632 3300046530 Ga0495654_0001459 Ga0495654_0001459_6200_6823 207
633 3300046530 Ga0495654_0002728 Ga0495654_0002728_3272_3925 207
634 3300046530 Ga0495654_0003616 Ga0495654_0003616_3879_4502 207
635 3300046530 Ga0495654_0003695 Ga0495654_0003695_2177_2800 207
636 3300046530 Ga0495654_0004029 Ga0495654_0004029_6830_7459 207
637 3300046530 Ga0495654_0006729 Ga0495654_0006729_4368_4991 207
638 3300046530 Ga0495654_0016644 Ga0495654_0016644_1723_2352 207
639 3300046530 Ga0495654_0028485 Ga0495654_0028485_955_1578 207
640 3300046530 Ga0495654_0035307 Ga0495654_0035307_1393_2028 207
641 3300046530 Ga0495654_0056872 Ga0495654_0056872_571_1194 207
642 3300046530 Ga0495654_0122532 Ga0495654_0122532_375_1004 207
643 3300046530 Ga0495654_0161858 Ga0495654_0161858_274_897 207
644 3300046535 Ga0495586_0003371 Ga0495586_0003371_928_1551 207
645 3300046536 Ga0495587_0004270 Ga0495587_0004270_1014_1637 207
646 3300046536 Ga0495587_0010206 Ga0495587_0010206_637_1260 207
647 3300046538 Ga0495609_0000471 Ga0495609_0000471_17814_18437 207
648 3300046538 Ga0495609_0001060 Ga0495609_0001060_18528_19154 207
649 3300046538 Ga0495609_0002247 Ga0495609_0002247_4553_5176 207
650 3300046538 Ga0495609_0047615 Ga0495609_0047615_855_1478 207
651 3300046542 Ga0495597_0000890 Ga0495597_0000890_12300_12953 207
652 3300046542 Ga0495597_0003052 Ga0495597_0003052_2585_3208 207
653 3300046542 Ga0495597_0003491 Ga0495597_0003491_328_987 207
654 3300046542 Ga0495597_0003635 Ga0495597_0003635_4168_4794 207
655 3300046542 Ga0495597_0011363 Ga0495597_0011363_390_1013 207
656 3300046542 Ga0495597_0020119 Ga0495597_0020119_2174_2797 207
657 3300046542 Ga0495597_0026447 Ga0495597_0026447_1390_2019 207
658 3300046542 Ga0495597_0037109 Ga0495597_0037109_941_1564 207
659 3300046542 Ga0495597_0041067 Ga0495597_0041067_647_1276 207
660 3300046543 Ga0495645_0107979 Ga0495645_0107979_78_701 207
661 3300046557 Ga0495622_0000847 Ga0495622_0000847_7390_8043 207
662 3300046557 Ga0495622_0000869 Ga0495622_0000869_5324_5947 207
663 3300046557 Ga0495622_0012301 Ga0495622_0012301_1055_1678 207
664 3300046557 Ga0495622_0049380 Ga0495622_0049380_274_897 207
665 3300046557 Ga0495622_0097220 Ga0495622_0097220_625_1248 207
666 3300046558 Ga0495633_0000201 Ga0495633_0000201_10624_11250 207
667 3300046558 Ga0495633_0001196 Ga0495633_0001196_9868_10521 207
668 3300046558 Ga0495633_0026522 Ga0495633_0026522_315_938 207
669 3300046558 Ga0495633_0073975 Ga0495633_0073975_832_1455 207
670 3300046558 Ga0495633_0173221 Ga0495633_0173221_183_806 207
671 3300046615 Ga0495656_0001906 Ga0495656_0001906_94_717 207
672 3300046615 Ga0495656_0137486 Ga0495656_0137486_330_953 207
673 3300046616 Ga0495668_0001342 Ga0495668_0001342_14896_15519 207
674 3300046616 Ga0495668_0001843 Ga0495668_0001843_6938_7669 207
675 3300046616 Ga0495668_0002812 Ga0495668_0002812_10689_11342 207
676 3300046616 Ga0495668_0070094 Ga0495668_0070094_1236_1859 207
677 3300046616 Ga0495668_0220517 Ga0495668_0220517_144_767 207
678 3300046642 Ga0495634_0001305 Ga0495634_0001305_10215_10838 207
679 3300046642 Ga0495634_0037499 Ga0495634_0037499_2381_3004 207
680 3300046648 Ga0495611_0002642 Ga0495611_0002642_4527_5153 207
681 3300046648 Ga0495611_0004162 Ga0495611_0004162_2542_3165 207
682 3300046648 Ga0495611_0006544 Ga0495611_0006544_832_1455 207
683 3300046648 Ga0495611_0160407 Ga0495611_0160407_102_725 207
684 3300046660 Ga0495625_0003229 Ga0495625_0003229_11587_12333 207
685 3300046660 Ga0495625_0003768 Ga0495625_0003768_8152_8775 207
686 3300046660 Ga0495625_0006972 Ga0495625_0006972_2525_3148 207
687 3300046660 Ga0495625_0027147 Ga0495625_0027147_392_1045 207
688 3300046660 Ga0495625_0075275 Ga0495625_0075275_1228_1851 207
689 3300046660 Ga0495625_0087490 Ga0495625_0087490_1451_2074 207
690 3300046660 Ga0495625_0128584 Ga0495625_0128584_86_709 207
691 3300046660 Ga0495625_0273551 Ga0495625_0273551_179_817 207
692 3300046660 Ga0495625_0298689 Ga0495625_0298689_83_706 207
693 3300046663 Ga0495635_0000719 Ga0495635_0000719_12230_12853 207
694 3300046664 Ga0495659_0000494 Ga0495659_0000494_758_1381 207
695 3300046664 Ga0495659_0012016 Ga0495659_0012016_669_1292 207
696 3300046665 Ga0495661_0001174 Ga0495661_0001174_17954_18580 207
697 3300046665 Ga0495661_0006967 Ga0495661_0006967_6376_6999 207
698 3300046665 Ga0495661_0007188 Ga0495661_0007188_5948_6571 207
699 3300046665 Ga0495661_0017678 Ga0495661_0017678_2252_2875 207
700 3300046665 Ga0495661_0106356 Ga0495661_0106356_76_729 207
701 3300046665 Ga0495661_0153612 Ga0495661_0153612_516_1139 207
702 3300046665 Ga0495661_0234154 Ga0495661_0234154_113_736 207
703 3300046674 Ga0495588_0008565 Ga0495588_0008565_3879_4532 207
704 3300046674 Ga0495588_0016923 Ga0495588_0016923_1809_2432 207
705 3300046674 Ga0495588_0066685 Ga0495588_0066685_793_1416 207
706 3300046678 Ga0495599_0308262 Ga0495599_0308262_259_882 207
707 3300046679 Ga0495623_0003391 Ga0495623_0003391_3144_3767 207
708 3300046680 Ga0495646_0036530 Ga0495646_0036530_2087_2710 207
709 3300046684 Ga0495669_0002748 Ga0495669_0002748_3027_3650 207
710 3300046689 Ga0495613_0003935 Ga0495613_0003935_1617_2240 207
711 3300046690 Ga0495624_0001088 Ga0495624_0001088_11780_12433 207
712 3300046691 Ga0495670_0000448 Ga0495670_0000448_8754_9407 207
713 3300046691 Ga0495670_0001143 Ga0495670_0001143_6808_7431 207
714 3300046691 Ga0495670_0002696 Ga0495670_0002696_2266_2889 207
715 3300046691 Ga0495670_0023859 Ga0495670_0023859_258_881 207
716 3300046691 Ga0495670_0040788 Ga0495670_0040788_489_1112 207
717 3300046691 Ga0495670_0139157 Ga0495670_0139157_560_1183 207
718 3300046691 Ga0495670_0144800 Ga0495670_0144800_542_1165 207
719 3300046691 Ga0495670_0216661 Ga0495670_0216661_86_712 207
720 3300046691 Ga0495670_0289701 Ga0495670_0289701_36_659 207
721 3300046692 Ga0495671_0000837 Ga0495671_0000837_7692_8315 207
722 3300046692 Ga0495671_0001280 Ga0495671_0001280_12025_12678 207
723 3300046692 Ga0495671_0001795 Ga0495671_0001795_129_752 207
724 3300046692 Ga0495671_0002184 Ga0495671_0002184_11509_12255 207
725 3300046692 Ga0495671_0002267 Ga0495671_0002267_2272_2910 207
726 3300046692 Ga0495671_0005418 Ga0495671_0005418_141_770 207
727 3300046692 Ga0495671_0010789 Ga0495671_0010789_2666_3289 207
728 3300046692 Ga0495671_0017599 Ga0495671_0017599_493_1116 207
729 3300046692 Ga0495671_0073828 Ga0495671_0073828_668_1291 207
730 3300046692 Ga0495671_0096241 Ga0495671_0096241_324_950 207
731 3300046692 Ga0495671_0109725 Ga0495671_0109725_355_978 207
732 3300046692 Ga0495671_0125489 Ga0495671_0125489_49_672 207
733 3300046694 Ga0495649_0001977 Ga0495649_0001977_821_1444 207
734 3300046694 Ga0495649_0002048 Ga0495649_0002048_2233_2979 207
735 3300046694 Ga0495649_0003123 Ga0495649_0003123_4960_5583 207
736 3300046694 Ga0495649_0006006 Ga0495649_0006006_6383_7006 207
737 3300046694 Ga0495649_0006617 Ga0495649_0006617_2791_3444 207
738 3300046694 Ga0495649_0009826 Ga0495649_0009826_3191_3844 207
739 3300046694 Ga0495649_0010758 Ga0495649_0010758_1533_2186 207
740 3300046694 Ga0495649_0017236 Ga0495649_0017236_604_1257 207
741 3300046694 Ga0495649_0019793 Ga0495649_0019793_1019_1642 207
742 3300046694 Ga0495649_0022012 Ga0495649_0022012_653_1306 207
743 3300046694 Ga0495649_0039514 Ga0495649_0039514_838_1476 207
744 3300046694 Ga0495649_0093850 Ga0495649_0093850_560_1183 207
745 3300046694 Ga0495649_0224274 Ga0495649_0224274_238_861 207
746 3300046694 Ga0495649_0371814 Ga0495649_0371814_38_679 207
747 3300046794 Ga0495589_0001080 Ga0495589_0001080_8899_9522 207
748 3300046794 Ga0495589_0002883 Ga0495589_0002883_5046_5672 207
749 3300046794 Ga0495589_0006279 Ga0495589_0006279_5061_5684 207
750 3300046794 Ga0495589_0054060 Ga0495589_0054060_1087_1710 207
751 3300046809 Ga0495600_0009474 Ga0495600_0009474_4916_5569 207
752 3300046809 Ga0495600_0041322 Ga0495600_0041322_830_1453 207
753 3300046809 Ga0495600_0261871 Ga0495600_0261871_64_717 207
754 3300046810 Ga0495660_0001341 Ga0495660_0001341_9521_10174 207
755 3300046810 Ga0495660_0001625 Ga0495660_0001625_11666_12412 207
756 3300046810 Ga0495660_0001699 Ga0495660_0001699_11948_12601 207
757 3300046810 Ga0495660_0003037 Ga0495660_0003037_810_1439 207
758 3300046810 Ga0495660_0005433 Ga0495660_0005433_5028_5651 207
759 3300046810 Ga0495660_0009145 Ga0495660_0009145_4717_5370 207
760 3300046810 Ga0495660_0009717 Ga0495660_0009717_1334_1987 207
761 3300046810 Ga0495660_0030311 Ga0495660_0030311_941_1564 207
762 3300046810 Ga0495660_0043614 Ga0495660_0043614_527_1153 207
763 3300046810 Ga0495660_0068432 Ga0495660_0068432_73_696 207
764 3300046810 Ga0495660_0068649 Ga0495660_0068649_244_867 207
765 3300046810 Ga0495660_0250685 Ga0495660_0250685_135_773 207
766 3300047315 Ga0495581_0053772 Ga0495581_0053772_964_1587 207
767 3300047317 Ga0495604_0065354 Ga0495604_0065354_884_1507 207
768 3300047317 Ga0495604_0069564 Ga0495604_0069564_1324_1977 207
769 3300047317 Ga0495604_0074295 Ga0495604_0074295_131_784 207
770 3300047318 Ga0495636_0057945 Ga0495636_0057945_593_1216 207
771 3300047318 Ga0495636_0223636 Ga0495636_0223636_81_704 207
772 3300047318 Ga0495636_0248879 Ga0495636_0248879_161_784 207
773 3300047319 Ga0495674_0008413 Ga0495674_0008413_3367_3990 207
774 3300047319 Ga0495674_0366816 Ga0495674_0366816_68_691 207
775 3300047320 Ga0495672_0000143 Ga0495672_0000143_11755_12384 207
776 3300047320 Ga0495672_0000612 Ga0495672_0000612_15100_15723 207
777 3300047320 Ga0495672_0001326 Ga0495672_0001326_12319_12972 207
778 3300047320 Ga0495672_0001433 Ga0495672_0001433_12977_13600 207
779 3300047320 Ga0495672_0002425 Ga0495672_0002425_13029_13652 207
780 3300047320 Ga0495672_0005238 Ga0495672_0005238_2825_3478 207
781 3300047320 Ga0495672_0008205 Ga0495672_0008205_2007_2630 207
782 3300047320 Ga0495672_0018144 Ga0495672_0018144_602_1225 207
783 3300047320 Ga0495672_0025262 Ga0495672_0025262_1063_1716 207
784 3300047320 Ga0495672_0036794 Ga0495672_0036794_1566_2219 207
785 3300047321 Ga0495676_0001157 Ga0495676_0001157_11456_12109 207
786 3300047322 Ga0495680_0025037 Ga0495680_0025037_1734_2357 207
787 3300047322 Ga0495680_0084923 Ga0495680_0084923_691_1344 207
788 3300047322 Ga0495680_0160872 Ga0495680_0160872_396_1049 207
789 3300047323 Ga0495683_0000141 Ga0495683_0000141_65184_65810 207
790 3300047323 Ga0495683_0000788 Ga0495683_0000788_13078_13701 207
791 3300047323 Ga0495683_0002329 Ga0495683_0002329_7026_7649 207
792 3300047323 Ga0495683_0003010 Ga0495683_0003010_2653_3276 207
793 3300047323 Ga0495683_0014639 Ga0495683_0014639_2479_3132 207
794 3300047323 Ga0495683_0029470 Ga0495683_0029470_653_1276 207
795 3300047323 Ga0495683_0039248 Ga0495683_0039248_1276_1899 207
796 3300047443 Ga0495687_001742 Ga0495687_001742_11261_11884 207
797 3300047443 Ga0495687_003676 Ga0495687_003676_3239_3892 207
798 3300047444 Ga0495675_0054812 Ga0495675_0054812_748_1401 207
799 3300047444 Ga0495675_0096294 Ga0495675_0096294_271_894 207
800 3300047444 Ga0495675_0120676 Ga0495675_0120676_677_1300 207
801 3300047445 Ga0495677_0000776 Ga0495677_0000776_11552_12175 207
802 3300047446 Ga0495679_001299 Ga0495679_001299_2220_2966 207
803 3300047446 Ga0495679_002459 Ga0495679_002459_4566_5192 207
804 3300047446 Ga0495679_002686 Ga0495679_002686_6975_7598 207
805 3300047446 Ga0495679_003317 Ga0495679_003317_7089_7742 207
806 3300047446 Ga0495679_018611 Ga0495679_018611_904_1527 207
807 3300047447 Ga0495685_024540 Ga0495685_024540_988_1611 207
808 3300047447 Ga0495685_025297 Ga0495685_025297_46_669 207
809 3300047469 Ga0495673_0001105 Ga0495673_0001105_5168_5791 207
810 3300047469 Ga0495673_0001211 Ga0495673_0001211_9031_9777 207
811 3300047469 Ga0495673_0001953 Ga0495673_0001953_11597_12220 207
812 3300047469 Ga0495673_0002138 Ga0495673_0002138_12337_12990 207
813 3300047469 Ga0495673_0004438 Ga0495673_0004438_7806_8432 207
814 3300047469 Ga0495673_0004611 Ga0495673_0004611_968_1591 207
815 3300047469 Ga0495673_0005043 Ga0495673_0005043_5132_5755 207
816 3300047469 Ga0495673_0005123 Ga0495673_0005123_5350_5973 207
817 3300047469 Ga0495673_0009989 Ga0495673_0009989_720_1343 207
818 3300047469 Ga0495673_0036391 Ga0495673_0036391_1180_1821 207
819 3300047469 Ga0495673_0081790 Ga0495673_0081790_420_1043 207
820 3300047470 Ga0495681_0000949 Ga0495681_0000949_12443_13066 207
821 3300047470 Ga0495681_0005016 Ga0495681_0005016_2054_2677 207
822 3300047470 Ga0495681_0005762 Ga0495681_0005762_3363_3989 207
823 3300047470 Ga0495681_0007738 Ga0495681_0007738_5977_6600 207
824 3300047470 Ga0495681_0008488 Ga0495681_0008488_5660_6283 207
825 3300047470 Ga0495681_0010449 Ga0495681_0010449_1610_2248 207
826 3300047470 Ga0495681_0012034 Ga0495681_0012034_1921_2550 207
827 3300047470 Ga0495681_0013596 Ga0495681_0013596_1671_2330 207
828 3300047470 Ga0495681_0015051 Ga0495681_0015051_3688_4317 207
829 3300047470 Ga0495681_0078234 Ga0495681_0078234_98_721 207
830 3300047472 Ga0495686_0002212 Ga0495686_0002212_6836_7495 207
831 3300047472 Ga0495686_0003437 Ga0495686_0003437_2222_2875 207
832 3300047472 Ga0495686_0018619 Ga0495686_0018619_3045_3668 207
833 3300047472 Ga0495686_0046695 Ga0495686_0046695_1095_1718 207
834 3300047472 Ga0495686_0170888 Ga0495686_0170888_150_773 207
835 3300047673 Ga0495593_0001903 Ga0495593_0001903_5318_5971 207
836 3300047673 Ga0495593_0122550 Ga0495593_0122550_477_1100 207
837 3300047673 Ga0495593_0127412 Ga0495593_0127412_194_817 207
838 3300047673 Ga0495593_0196094 Ga0495593_0196094_56_679 207
839 3300048088 Ga0495602_0002882 Ga0495602_0002882_5368_6021 207
840 3300048089 Ga0495614_0062619 Ga0495614_0062619_145_768 207
841 3300048089 Ga0495614_0148146 Ga0495614_0148146_284_907 207
842 3300048091 Ga0495626_0000437 Ga0495626_0000437_1083_1736 207
843 3300048091 Ga0495626_0000824 Ga0495626_0000824_21474_22133 207
844 3300048091 Ga0495626_0001145 Ga0495626_0001145_9588_10334 207
845 3300048091 Ga0495626_0001360 Ga0495626_0001360_2094_2747 207
846 3300048091 Ga0495626_0002102 Ga0495626_0002102_10728_11351 207
847 3300048091 Ga0495626_0002796 Ga0495626_0002796_9536_10189 207
848 3300048091 Ga0495626_0003391 Ga0495626_0003391_2792_3445 207
849 3300048091 Ga0495626_0010816 Ga0495626_0010816_2277_2900 207
850 3300048091 Ga0495626_0014335 Ga0495626_0014335_703_1326 207
851 3300048905 Ga0496102_0001122 Ga0496102_0001122_11549_12172 207
852 3300048906 Ga0496103_0001780 Ga0496103_0001780_6896_7519 207
853 3300048913 Ga0496110_0120856 Ga0496110_0120856_1414_2037 207
854 3300048913 Ga0496110_0189484 Ga0496110_0189484_1029_1652 207
855 3300048918 Ga0496115_0204197 Ga0496115_0204197_902_1525 207
856 3300048919 Ga0496116_0000295 Ga0496116_0000295_12709_13332 207
857 3300048919 Ga0496116_0001666 Ga0496116_0001666_10895_11548 207
858 3300048919 Ga0496116_0004219 Ga0496116_0004219_6468_7091 207
859 3300048919 Ga0496116_0007393 Ga0496116_0007393_2116_2769 207
860 3300048919 Ga0496116_0243322 Ga0496116_0243322_25_648 207
861 3300048920 Ga0496117_0004224 Ga0496117_0004224_8281_8904 207
862 3300048920 Ga0496117_0007026 Ga0496117_0007026_2146_2799 207
863 3300048920 Ga0496117_0077854 Ga0496117_0077854_926_1561 207
864 3300048920 Ga0496117_0144314 Ga0496117_0144314_111_734 207
865 3300048921 Ga0496118_0005826 Ga0496118_0005826_6716_7339 207
866 3300048921 Ga0496118_0009592 Ga0496118_0009592_2115_2768 207
867 3300048921 Ga0496118_0054722 Ga0496118_0054722_1610_2233 207
868 3300048921 Ga0496118_0313689 Ga0496118_0313689_105_728 207
869 3300048922 Ga0496119_0127776 Ga0496119_0127776_585_1208 207
870 3300048924 Ga0496121_0003721 Ga0496121_0003721_8110_8733 207
871 3300048924 Ga0496121_0029975 Ga0496121_0029975_69_692 207
872 3300048924 Ga0496121_0037966 Ga0496121_0037966_303_926 207
873 3300048924 Ga0496121_0154434 Ga0496121_0154434_602_1225 207
874 3300048925 Ga0496122_0015065 Ga0496122_0015065_1032_1658 207
875 3300048925 Ga0496122_0021525 Ga0496122_0021525_3536_4159 207
876 3300048925 Ga0496122_0046399 Ga0496122_0046399_800_1453 207
877 3300048926 Ga0496123_0006939 Ga0496123_0006939_6762_7385 207
878 3300048926 Ga0496123_0008089 Ga0496123_0008089_6983_7636 207
879 3300048926 Ga0496123_0019015 Ga0496123_0019015_3141_3794 207
880 3300048927 Ga0496124_0005235 Ga0496124_0005235_2681_3304 207
881 3300048927 Ga0496124_0011129 Ga0496124_0011129_8300_8923 207
882 3300048927 Ga0496124_0025409 Ga0496124_0025409_3362_4015 207
883 3300048927 Ga0496124_0069700 Ga0496124_0069700_1695_2333 207
884 3300048928 Ga0496125_0004168 Ga0496125_0004168_7890_8513 207
885 3300048928 Ga0496125_0007935 Ga0496125_0007935_8400_9023 207
886 3300048928 Ga0496125_0117753 Ga0496125_0117753_1165_1788 207
887 3300049459 Ga0495678_000054 Ga0495678_000054_53723_54349 207
888 3300049459 Ga0495678_000909 Ga0495678_000909_13004_13657 207
889 3300049459 Ga0495678_001455 Ga0495678_001455_6299_6922 207
890 3300049459 Ga0495678_001993 Ga0495678_001993_2214_2960 207
891 3300049459 Ga0495678_002476 Ga0495678_002476_4942_5565 207
892 3300049459 Ga0495678_003280 Ga0495678_003280_2247_2870 207
893 3300049459 Ga0495678_003799 Ga0495678_003799_7553_8176 207
894 3300049459 Ga0495678_009422 Ga0495678_009422_3473_4096 207
895 3300049459 Ga0495678_012866 Ga0495678_012866_2049_2678 207
896 3300049459 Ga0495678_013356 Ga0495678_013356_633_1286 207
897 3300049459 Ga0495678_022320 Ga0495678_022320_1509_2132 207
898 3300049459 Ga0495678_031595 Ga0495678_031595_492_1130 207
899 3300049459 Ga0495678_085903 Ga0495678_085903_297_926 207
900 3300049460 Ga0495682_0000898 Ga0495682_0000898_10405_11058 207
901 3300049460 Ga0495682_0001298 Ga0495682_0001298_11972_12595 207
902 3300049460 Ga0495682_0001917 Ga0495682_0001917_2323_2949 207
903 3300049460 Ga0495682_0014363 Ga0495682_0014363_136_789 207
904 3300049460 Ga0495682_0032577 Ga0495682_0032577_498_1121 207
905 3300049460 Ga0495682_0042966 Ga0495682_0042966_452_1075 207
906 3300049460 Ga0495682_0044990 Ga0495682_0044990_489_1112 207
907 3300049460 Ga0495682_0172872 Ga0495682_0172872_120_743 207
908 3300049758 Ga0501241_000068 Ga0501241_000068_12715_13338 207
909 3300049853 Ga0501226_000008 Ga0501226_000008_190800_191432 207
910 3300050514 nmdc:mga08x19_33464_c1 nmdc:mga08x19_33464_c1_198_851 207
911 3300053111 Ga0500572_000576 Ga0500572_000576_5000_5653 207
912 3300053140 Ga0500573_0004190 Ga0500573_0004190_2344_2967 207
913 iso_pu_bacteria 2511231023 2511367446 207
914 iso_pu_bacteria 2713897148 2715749614 207
915 iso_pu_bacteria 2974289157 2974293862 207
916 iso_pu_bacteria 2998139840 2998139965 207
917 iso_pu_bacteria 3007855910 3007859410 207
918 iso_pu_bacteria 8029995093 8029995288 207
919 iso_pu_bacteria 8056166840 8056171086 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

42

209

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.9354 9 206
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.9314 10 207
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.9266 10 207
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.9208 9 206
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.839 11 174
ID Description Score Start End Superfamily
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9393 1 207 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.935 1 207 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9216 9 207 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9167 9 207 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.839 11 174 2.30.110.10
ID Description Score Start End GO Terms
AF-J3HC60-F1-model_v4 Transcriptional regulator 0.9816 1 207
AF-A0A3M5KQI1-F1-model_v4 Negative transcriptional regulator 0.9807 1 206
AF-Q4K3H6-F1-model_v4 Putative negative regulatory protein 0.9778 1 207
AF-A0A380SU06-F1-model_v4 Protease synthase and sporulation protein PAI 2 0.9776 1 206 GO:0006508
GO:0008233
AF-A0A0P9YDE5-F1-model_v4 Negative transcriptional regulator 0.9764 1 207

Feature Viewer

pLDDT pTM Quality
95.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map