F485713
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 919 | 356 | 798 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300046452|Ga0495617_040902|Ga0495617_040902_155_901 |
| Length | 248 |
| Sequence | MASKGQFAQAWQWTYEIGHQWLLQQTNSLPRMQAFAKENLSMYTPRAFAIEELSQLHELILATRLAILVTHGENGLQASHVPVLLHCEQGEYGTLYGHLARANPQWKDLRDGAEAMLIFAGADAYISPGFYPSKAEHGKVVPTWNYIAVHAYGHAETFSDGGRLLDIVSTLTDRHEAGRAQPWSVDDAPADYIDGMLKAIVGFAIPIDRLEGKRKLSQNRSSEDIAGVREGLAASPEINDQTLARLMR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 21 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 22 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 23 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 24 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 25 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 26 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 27 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 28 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 29 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 30 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 31 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 32 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 33 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 34 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 35 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 36 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 37 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 38 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 39 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 40 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 41 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 42 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 43 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 44 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 45 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 46 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 47 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 48 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 49 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 50 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 51 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 52 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 53 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 54 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 55 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 56 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 57 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 58 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 59 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 60 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 61 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 62 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 63 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 64 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 65 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 66 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 67 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 68 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 69 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 70 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 71 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 72 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 73 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 74 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 75 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 76 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 77 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 78 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 79 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 80 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 81 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 82 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 83 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 84 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 85 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 86 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 87 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 88 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 89 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 90 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 91 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 92 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 93 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 94 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 95 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 96 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 97 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 98 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 99 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 100 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 101 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 102 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 103 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 104 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 105 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 106 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 107 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 108 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 109 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 110 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 111 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 112 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 113 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 114 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 115 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 116 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 117 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 118 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 119 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 120 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 122 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 124 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 131 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 132 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 133 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 136 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 137 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 149 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 202 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 203 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 204 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 205 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 206 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 211 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 212 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 213 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 214 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 215 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 216 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 217 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 218 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 219 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 220 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 221 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 222 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 223 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 224 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 225 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 226 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 229 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 235 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 236 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 349 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 350 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 351 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 352 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 353 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 354 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 355 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 356 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.83 |
| Metatranscriptomes | 0 |
| Isolates | 13.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.03 |
| Nodule | 2.5 |
| Rhizoplane | 4.68 |
| Rhizosphere | 81.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_41 | 2124908027 | Bacteria | 51011 |
| 2 | SwRhRL2b_contig_863144 | 2162886007 | Bacteria | 1734 |
| 3 | JGI25163J39215_1000536 | 3300002771 | Bacteria | 11107 |
| 4 | JGI25164J39214_1000058 | 3300002772 | Bacteria | 112599 |
| 5 | JGI25165J46597_1000154 | 3300003214 | Bacteria | 112599 |
| 6 | Ga0055536_1000476 | 3300003781 | Bacteria | 27924 |
| 7 | Ga0055536_1000603 | 3300003781 | Bacteria | 24478 |
| 8 | Ga0055536_1018301 | 3300003781 | Bacteria | 2251 |
| 9 | Ga0055530_10001077 | 3300003791 | Bacteria | 21490 |
| 10 | Ga0055530_10019195 | 3300003791 | Bacteria | 2078 |
| 11 | Ga0055540_1000288 | 3300003792 | Bacteria | 45131 |
| 12 | Ga0055540_1000605 | 3300003792 | Bacteria | 25721 |
| 13 | Ga0055531_10009540 | 3300003794 | Bacteria | 4949 |
| 14 | Ga0055531_10056411 | 3300003794 | Bacteria | 991 |
| 15 | Ga0065714_10003396 | 3300005288 | Bacteria | 10603 |
| 16 | Ga0065714_10018027 | 3300005288 | Bacteria | 1492 |
| 17 | Ga0065714_10031771 | 3300005288 | Bacteria | 1271 |
| 18 | Ga0065714_10064648 | 3300005288 | Bacteria | 26129 |
| 19 | Ga0065714_10138730 | 3300005288 | Bacteria | 1188 |
| 20 | Ga0065704_10133198 | 3300005289 | Bacteria | 1603 |
| 21 | Ga0065715_10166688 | 3300005293 | Bacteria | 1579 |
| 22 | Ga0070669_100003148 | 3300005353 | Bacteria | 11877 |
| 23 | Ga0070663_100405938 | 3300005455 | Bacteria | 1115 |
| 24 | Ga0070662_100016649 | 3300005457 | Bacteria | 4940 |
| 25 | Ga0070665_100013854 | 3300005548 | Bacteria | 8109 |
| 26 | Ga0075363_100194715 | 3300006048 | Bacteria | 1157 |
| 27 | Ga0075364_10062544 | 3300006051 | Bacteria | 2442 |
| 28 | Ga0075364_10228013 | 3300006051 | Bacteria | 1265 |
| 29 | Ga0075432_10032885 | 3300006058 | Bacteria | 1797 |
| 30 | Ga0075362_10081078 | 3300006177 | Bacteria | 1496 |
| 31 | Ga0075362_10138416 | 3300006177 | Bacteria | 1162 |
| 32 | Ga0075431_100424331 | 3300006847 | Bacteria | 1329 |
| 33 | Ga0079104_1000262 | 3300006946 | Bacteria | 69874 |
| 34 | Ga0079104_1003439 | 3300006946 | Bacteria | 7369 |
| 35 | Ga0099826_10055754 | 3300006948 | Bacteria | 2613 |
| 36 | Ga0105251_10000674 | 3300009011 | Bacteria | 31403 |
| 37 | Ga0105251_10001737 | 3300009011 | Bacteria | 18191 |
| 38 | Ga0105251_10005123 | 3300009011 | Bacteria | 8670 |
| 39 | Ga0105251_10022911 | 3300009011 | Bacteria | 3232 |
| 40 | Ga0105251_10132138 | 3300009011 | Bacteria | 1131 |
| 41 | Ga0105251_10150882 | 3300009011 | Bacteria | 1050 |
| 42 | Ga0105251_10177691 | 3300009011 | Bacteria | 959 |
| 43 | Ga0105244_10000073 | 3300009036 | Bacteria | 115279 |
| 44 | Ga0105244_10018244 | 3300009036 | Bacteria | 3942 |
| 45 | Ga0105244_10018513 | 3300009036 | Bacteria | 3906 |
| 46 | Ga0105244_10022535 | 3300009036 | Bacteria | 3466 |
| 47 | Ga0105244_10030533 | 3300009036 | Bacteria | 2867 |
| 48 | Ga0105244_10066299 | 3300009036 | Bacteria | 1808 |
| 49 | Ga0105244_10088751 | 3300009036 | Bacteria | 1522 |
| 50 | Ga0105244_10095851 | 3300009036 | Bacteria | 1455 |
| 51 | Ga0105250_10000138 | 3300009092 | Bacteria | 63230 |
| 52 | Ga0105250_10000857 | 3300009092 | Bacteria | 17962 |
| 53 | Ga0105250_10001344 | 3300009092 | Bacteria | 13413 |
| 54 | Ga0105250_10006950 | 3300009092 | Bacteria | 4896 |
| 55 | Ga0105250_10045949 | 3300009092 | Bacteria | 1751 |
| 56 | Ga0105250_10151863 | 3300009092 | Bacteria | 964 |
| 57 | Ga0105250_10238878 | 3300009092 | Bacteria | 774 |
| 58 | Ga0105240_10535996 | 3300009093 | Bacteria | 1297 |
| 59 | Ga0111539_10272072 | 3300009094 | Bacteria | 1972 |
| 60 | Ga0105247_10400651 | 3300009101 | Unclassified | 978 |
| 61 | Ga0105243_10000132 | 3300009148 | Bacteria | 85455 |
| 62 | Ga0105243_10004299 | 3300009148 | Bacteria | 11273 |
| 63 | Ga0105243_10007452 | 3300009148 | Bacteria | 8408 |
| 64 | Ga0105243_10008831 | 3300009148 | Bacteria | 7718 |
| 65 | Ga0105243_10024118 | 3300009148 | Bacteria | 4638 |
| 66 | Ga0105243_10153898 | 3300009148 | Bacteria | 1975 |
| 67 | Ga0105243_10542952 | 3300009148 | Bacteria | 1109 |
| 68 | Ga0105243_10638312 | 3300009148 | Bacteria | 1030 |
| 69 | Ga0105242_10251986 | 3300009176 | Bacteria | 1591 |
| 70 | Ga0105238_11211543 | 3300009551 | Bacteria | 779 |
| 71 | Ga0105249_10007738 | 3300009553 | Bacteria | 9366 |
| 72 | Ga0105246_10001455 | 3300011119 | Bacteria | 14035 |
| 73 | Ga0105246_10002582 | 3300011119 | Bacteria | 10953 |
| 74 | Ga0105246_10104861 | 3300011119 | Bacteria | 2065 |
| 75 | Ga0105246_11143202 | 3300011119 | Bacteria | 713 |
| 76 | Ga0157337_1000413 | 3300012483 | Bacteria | 1984 |
| 77 | Ga0157345_1000061 | 3300012498 | Bacteria | 22884 |
| 78 | Ga0157345_1000713 | 3300012498 | Bacteria | 2673 |
| 79 | Ga0157373_10000959 | 3300013100 | Bacteria | 22392 |
| 80 | Ga0157373_10001902 | 3300013100 | Bacteria | 15857 |
| 81 | Ga0157373_10022444 | 3300013100 | Bacteria | 4579 |
| 82 | Ga0157373_10041651 | 3300013100 | Bacteria | 3284 |
| 83 | Ga0157373_10468615 | 3300013100 | Bacteria | 908 |
| 84 | Ga0157371_10001823 | 3300013102 | Bacteria | 21467 |
| 85 | Ga0157371_10002126 | 3300013102 | Bacteria | 19284 |
| 86 | Ga0157371_10007445 | 3300013102 | Bacteria | 8862 |
| 87 | Ga0157370_10006857 | 3300013104 | Bacteria | 12473 |
| 88 | Ga0157370_10163010 | 3300013104 | Bacteria | 2074 |
| 89 | Ga0157370_10357195 | 3300013104 | Bacteria | 1346 |
| 90 | Ga0157370_11015388 | 3300013104 | Bacteria | 751 |
| 91 | Ga0157369_10002087 | 3300013105 | Bacteria | 24158 |
| 92 | Ga0157369_10057159 | 3300013105 | Bacteria | 4209 |
| 93 | Ga0157369_10127023 | 3300013105 | Bacteria | 2703 |
| 94 | Ga0157369_10699835 | 3300013105 | Bacteria | 1044 |
| 95 | Ga0163162_10000334 | 3300013306 | Bacteria | 43059 |
| 96 | Ga0163162_10065423 | 3300013306 | Bacteria | 3682 |
| 97 | Ga0157372_10001023 | 3300013307 | Bacteria | 30562 |
| 98 | Ga0157375_10598746 | 3300013308 | Bacteria | 1262 |
| 99 | Ga0182008_10000699 | 3300014497 | Bacteria | 24106 |
| 100 | Ga0182008_10001025 | 3300014497 | Bacteria | 19407 |
| 101 | Ga0182008_10003284 | 3300014497 | Bacteria | 9840 |
| 102 | Ga0182008_10004033 | 3300014497 | Bacteria | 8669 |
| 103 | Ga0182008_10010070 | 3300014497 | Bacteria | 5072 |
| 104 | Ga0182008_10021998 | 3300014497 | Bacteria | 3268 |
| 105 | Ga0182008_10081961 | 3300014497 | Bacteria | 1588 |
| 106 | Ga0182006_1001164 | 3300015261 | Bacteria | 16587 |
| 107 | Ga0182006_1001423 | 3300015261 | Bacteria | 14483 |
| 108 | Ga0182006_1006835 | 3300015261 | Bacteria | 5265 |
| 109 | Ga0182006_1009181 | 3300015261 | Bacteria | 4443 |
| 110 | Ga0182006_1019175 | 3300015261 | Bacteria | 2882 |
| 111 | Ga0182006_1029571 | 3300015261 | Bacteria | 2219 |
| 112 | Ga0182006_1049558 | 3300015261 | Bacteria | 1621 |
| 113 | Ga0182007_10002451 | 3300015262 | Bacteria | 9216 |
| 114 | Ga0182007_10110278 | 3300015262 | Bacteria | 915 |
| 115 | Ga0182005_1000991 | 3300015265 | Bacteria | 12230 |
| 116 | Ga0182005_1002546 | 3300015265 | Bacteria | 6473 |
| 117 | Ga0182005_1003025 | 3300015265 | Bacteria | 5811 |
| 118 | Ga0182005_1024728 | 3300015265 | Bacteria | 1640 |
| 119 | Ga0163161_10001007 | 3300017792 | Bacteria | 21460 |
| 120 | Ga0163161_10001974 | 3300017792 | Bacteria | 14883 |
| 121 | Ga0163161_10025060 | 3300017792 | Bacteria | 4218 |
| 122 | Ga0163161_10025234 | 3300017792 | Bacteria | 4206 |
| 123 | Ga0163161_10030726 | 3300017792 | Bacteria | 3825 |
| 124 | Ga0163161_10034086 | 3300017792 | Bacteria | 3640 |
| 125 | Ga0163161_10742622 | 3300017792 | Bacteria | 820 |
| 126 | Ga0209760_100148 | 3300025207 | Bacteria | 43685 |
| 127 | Ga0209563_100453 | 3300025230 | Bacteria | 14219 |
| 128 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 129 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 130 | Ga0209759_1018281 | 3300025256 | Bacteria | 1697 |
| 131 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 132 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 133 | Ga0209676_1000278 | 3300025292 | Bacteria | 106516 |
| 134 | Ga0209676_1003102 | 3300025292 | Bacteria | 10686 |
| 135 | Ga0209676_1004940 | 3300025292 | Bacteria | 7166 |
| 136 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 137 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 138 | Ga0209050_1003835 | 3300025298 | Bacteria | 10715 |
| 139 | Ga0209050_1052904 | 3300025298 | Bacteria | 1013 |
| 140 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 141 | Ga0209051_1000088 | 3300025303 | Bacteria | 180480 |
| 142 | Ga0209051_1023888 | 3300025303 | Bacteria | 2530 |
| 143 | Ga0209257_1000143 | 3300025304 | Bacteria | 199975 |
| 144 | Ga0209257_1037097 | 3300025304 | Bacteria | 1489 |
| 145 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 146 | Ga0207696_1000180 | 3300025711 | Bacteria | 98909 |
| 147 | Ga0207696_1000184 | 3300025711 | Bacteria | 97606 |
| 148 | Ga0207696_1000612 | 3300025711 | Bacteria | 26543 |
| 149 | Ga0207696_1000698 | 3300025711 | Bacteria | 23009 |
| 150 | Ga0207696_1031641 | 3300025711 | Bacteria | 1599 |
| 151 | Ga0207696_1048095 | 3300025711 | Bacteria | 1227 |
| 152 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 153 | Ga0207655_1000116 | 3300025728 | Bacteria | 161950 |
| 154 | Ga0207655_1001603 | 3300025728 | Bacteria | 20215 |
| 155 | Ga0207655_1001803 | 3300025728 | Bacteria | 18535 |
| 156 | Ga0207655_1006251 | 3300025728 | Bacteria | 7919 |
| 157 | Ga0207655_1024651 | 3300025728 | Bacteria | 2942 |
| 158 | Ga0207655_1054218 | 3300025728 | Bacteria | 1596 |
| 159 | Ga0207655_1058182 | 3300025728 | Bacteria | 1513 |
| 160 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 161 | Ga0207713_1000961 | 3300025735 | Bacteria | 25561 |
| 162 | Ga0207713_1001062 | 3300025735 | Bacteria | 23732 |
| 163 | Ga0207713_1002196 | 3300025735 | Bacteria | 14459 |
| 164 | Ga0207713_1002402 | 3300025735 | Bacteria | 13682 |
| 165 | Ga0207713_1004217 | 3300025735 | Bacteria | 9408 |
| 166 | Ga0207713_1008043 | 3300025735 | Bacteria | 6128 |
| 167 | Ga0207713_1009976 | 3300025735 | Bacteria | 5302 |
| 168 | Ga0207707_10123370 | 3300025912 | Bacteria | 2265 |
| 169 | Ga0207707_10139388 | 3300025912 | Unclassified | 2121 |
| 170 | Ga0207652_10067601 | 3300025921 | Unclassified | 3099 |
| 171 | Ga0207681_10009500 | 3300025923 | Bacteria | 5943 |
| 172 | Ga0207706_10004797 | 3300025933 | Bacteria | 12664 |
| 173 | Ga0207686_10137578 | 3300025934 | Bacteria | 1684 |
| 174 | Ga0207709_10000061 | 3300025935 | Bacteria | 199097 |
| 175 | Ga0207709_10000063 | 3300025935 | Bacteria | 191397 |
| 176 | Ga0207709_10139634 | 3300025935 | Bacteria | 1664 |
| 177 | Ga0207709_10316577 | 3300025935 | Bacteria | 1166 |
| 178 | Ga0207712_10012351 | 3300025961 | Bacteria | 5455 |
| 179 | Ga0207678_10667672 | 3300026067 | Bacteria | 914 |
| 180 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 181 | Ga0209281_1000091 | 3300027111 | Bacteria | 242588 |
| 182 | Ga0209282_1044203 | 3300027666 | Bacteria | 2614 |
| 183 | Ga0207428_10088321 | 3300027907 | Bacteria | 2411 |
| 184 | Ga0268266_10004185 | 3300028379 | Bacteria | 13905 |
| 185 | Ga0307511_10017143 | 3300030521 | Bacteria | 6956 |
| 186 | Ga0307511_10160949 | 3300030521 | Bacteria | 1261 |
| 187 | Ga0316178_1077247 | 3300030735 | Bacteria | 21182 |
| 188 | Ga0307408_100001323 | 3300031548 | Bacteria | 18593 |
| 189 | Ga0307408_100002282 | 3300031548 | Bacteria | 13657 |
| 190 | Ga0307408_100083672 | 3300031548 | Bacteria | 2391 |
| 191 | Ga0307516_10129374 | 3300031730 | Bacteria | 2306 |
| 192 | Ga0307516_10254482 | 3300031730 | Bacteria | 1449 |
| 193 | Ga0307516_10316612 | 3300031730 | Bacteria | 1232 |
| 194 | Ga0307405_10000143 | 3300031731 | Bacteria | 27538 |
| 195 | Ga0307413_10209476 | 3300031824 | Bacteria | 1414 |
| 196 | Ga0307413_10229648 | 3300031824 | Bacteria | 1362 |
| 197 | Ga0307406_10009349 | 3300031901 | Bacteria | 5493 |
| 198 | Ga0307406_10266698 | 3300031901 | Bacteria | 1298 |
| 199 | Ga0307407_10046413 | 3300031903 | Bacteria | 2459 |
| 200 | Ga0307412_10005109 | 3300031911 | Bacteria | 7343 |
| 201 | Ga0307412_10024630 | 3300031911 | Bacteria | 3716 |
| 202 | Ga0307412_10042733 | 3300031911 | Bacteria | 2947 |
| 203 | Ga0307412_10167760 | 3300031911 | Bacteria | 1638 |
| 204 | Ga0307409_100003401 | 3300031995 | Bacteria | 8640 |
| 205 | Ga0307416_100038540 | 3300032002 | Bacteria | 3688 |
| 206 | Ga0307414_10002499 | 3300032004 | Bacteria | 9643 |
| 207 | Ga0307414_10061753 | 3300032004 | Bacteria | 2655 |
| 208 | Ga0307414_10065522 | 3300032004 | Bacteria | 2592 |
| 209 | Ga0307414_10087086 | 3300032004 | Bacteria | 2306 |
| 210 | Ga0307411_10071206 | 3300032005 | Bacteria | 2355 |
| 211 | Ga0307510_10001990 | 3300033180 | Bacteria | 23014 |
| 212 | Ga0237819_00815 | 3300038705 | Bacteria | 9887 |
| 213 | Ga0436360_1303388 | 3300039438 | Bacteria | 880 |
| 214 | Ga0439438_000698 | 3300041405 | Bacteria | 14993 |
| 215 | Ga0439438_000904 | 3300041405 | Bacteria | 13194 |
| 216 | Ga0439438_001459 | 3300041405 | Bacteria | 10416 |
| 217 | Ga0439438_001774 | 3300041405 | Bacteria | 9466 |
| 218 | Ga0439438_005021 | 3300041405 | Bacteria | 4937 |
| 219 | Ga0439438_006414 | 3300041405 | Bacteria | 4150 |
| 220 | Ga0439447_000218 | 3300041407 | Bacteria | 20245 |
| 221 | Ga0439447_000413 | 3300041407 | Bacteria | 15824 |
| 222 | Ga0439447_000995 | 3300041407 | Bacteria | 10348 |
| 223 | Ga0439447_001822 | 3300041407 | Bacteria | 7812 |
| 224 | Ga0439447_002379 | 3300041407 | Bacteria | 6877 |
| 225 | Ga0439447_012866 | 3300041407 | Bacteria | 2391 |
| 226 | Ga0439447_026469 | 3300041407 | Bacteria | 1487 |
| 227 | Ga0439461_0092357 | 3300041410 | Bacteria | 727 |
| 228 | Ga0439466_0002737 | 3300041411 | Bacteria | 6899 |
| 229 | Ga0439466_0002814 | 3300041411 | Bacteria | 6813 |
| 230 | Ga0439466_0004530 | 3300041411 | Bacteria | 5337 |
| 231 | Ga0439466_0011984 | 3300041411 | Bacteria | 3202 |
| 232 | Ga0439466_0014760 | 3300041411 | Bacteria | 2840 |
| 233 | Ga0439466_0019021 | 3300041411 | Bacteria | 2460 |
| 234 | Ga0439466_0021412 | 3300041411 | Bacteria | 2291 |
| 235 | Ga0439466_0025303 | 3300041411 | Bacteria | 2072 |
| 236 | Ga0439465_0004541 | 3300041413 | Bacteria | 4486 |
| 237 | Ga0439431_0053597 | 3300041997 | Bacteria | 1050 |
| 238 | Ga0439445_0049602 | 3300042004 | Bacteria | 1130 |
| 239 | Ga0439445_0065947 | 3300042004 | Bacteria | 996 |
| 240 | Ga0439432_000241 | 3300042006 | Bacteria | 19671 |
| 241 | Ga0439432_002077 | 3300042006 | Bacteria | 7561 |
| 242 | Ga0439432_021286 | 3300042006 | Bacteria | 2151 |
| 243 | Ga0439451_002539 | 3300042009 | Bacteria | 3712 |
| 244 | Ga0439451_005322 | 3300042009 | Bacteria | 2621 |
| 245 | Ga0439452_000402 | 3300042010 | Bacteria | 25551 |
| 246 | Ga0439452_000459 | 3300042010 | Bacteria | 22949 |
| 247 | Ga0439452_001139 | 3300042010 | Bacteria | 11612 |
| 248 | Ga0439452_007719 | 3300042010 | Bacteria | 3278 |
| 249 | Ga0439452_032084 | 3300042010 | Bacteria | 1285 |
| 250 | Ga0439456_001931 | 3300042013 | Bacteria | 4176 |
| 251 | Ga0439456_005462 | 3300042013 | Bacteria | 2579 |
| 252 | Ga0439456_013402 | 3300042013 | Bacteria | 1705 |
| 253 | Ga0439456_027140 | 3300042013 | Bacteria | 1219 |
| 254 | Ga0439456_032977 | 3300042013 | Bacteria | 1113 |
| 255 | Ga0439463_000465 | 3300042016 | Bacteria | 11270 |
| 256 | Ga0439463_003225 | 3300042016 | Bacteria | 4143 |
| 257 | Ga0450911_000228 | 3300042115 | Bacteria | 21716 |
| 258 | Ga0450911_000480 | 3300042115 | Bacteria | 12755 |
| 259 | Ga0450911_001251 | 3300042115 | Bacteria | 6091 |
| 260 | Ga0450919_001557 | 3300042121 | Bacteria | 2993 |
| 261 | Ga0450922_001336 | 3300042124 | Bacteria | 2432 |
| 262 | Ga0450890_000187 | 3300042127 | Bacteria | 9400 |
| 263 | Ga0450891_000346 | 3300042129 | Bacteria | 4795 |
| 264 | Ga0450902_002970 | 3300042137 | Bacteria | 2442 |
| 265 | Ga0450902_012448 | 3300042137 | Bacteria | 1361 |
| 266 | Ga0450902_013025 | 3300042137 | Bacteria | 1336 |
| 267 | Ga0450902_020865 | 3300042137 | Bacteria | 1081 |
| 268 | Ga0450902_021301 | 3300042137 | Bacteria | 1071 |
| 269 | Ga0450902_022583 | 3300042137 | Bacteria | 1042 |
| 270 | Ga0450903_000418 | 3300042138 | Bacteria | 9121 |
| 271 | Ga0450903_001427 | 3300042138 | Bacteria | 4455 |
| 272 | Ga0450903_006350 | 3300042138 | Bacteria | 1964 |
| 273 | Ga0450904_004416 | 3300042139 | Bacteria | 1461 |
| 274 | Ga0450905_007958 | 3300042142 | Bacteria | 1448 |
| 275 | Ga0450905_012490 | 3300042142 | Bacteria | 1196 |
| 276 | Ga0450906_000070 | 3300042145 | Bacteria | 16295 |
| 277 | Ga0450906_000339 | 3300042145 | Bacteria | 9514 |
| 278 | Ga0450907_000189 | 3300042146 | Bacteria | 22476 |
| 279 | Ga0450907_000613 | 3300042146 | Bacteria | 9470 |
| 280 | Ga0450910_000383 | 3300042147 | Bacteria | 5192 |
| 281 | Ga0439446_0000216 | 3300042156 | Bacteria | 10579 |
| 282 | Ga0439446_0002002 | 3300042156 | Bacteria | 4819 |
| 283 | Ga0439446_0006086 | 3300042156 | Bacteria | 3130 |
| 284 | Ga0450908_002191 | 3300042184 | Bacteria | 3831 |
| 285 | Ga0450908_022608 | 3300042184 | Bacteria | 1101 |
| 286 | Ga0450909_000428 | 3300042185 | Bacteria | 5418 |
| 287 | Ga0450909_001868 | 3300042185 | Bacteria | 2965 |
| 288 | Ga0450909_016251 | 3300042185 | Bacteria | 1099 |
| 289 | Ga0439434_0000252 | 3300042435 | Bacteria | 15121 |
| 290 | Ga0439434_0002868 | 3300042435 | Bacteria | 5032 |
| 291 | Ga0439464_0003584 | 3300042439 | Bacteria | 3931 |
| 292 | Ga0439460_0000396 | 3300042461 | Bacteria | 9260 |
| 293 | Ga0439460_0002073 | 3300042461 | Bacteria | 4795 |
| 294 | Ga0439460_0049612 | 3300042461 | Bacteria | 1255 |
| 295 | Ga0450918_002070 | 3300042531 | Bacteria | 3842 |
| 296 | Ga0450918_035185 | 3300042531 | Bacteria | 890 |
| 297 | Ga0450893_0001324 | 3300042532 | Bacteria | 3759 |
| 298 | Ga0450901_001267 | 3300042533 | Bacteria | 2907 |
| 299 | Ga0439440_0004160 | 3300042993 | Bacteria | 2830 |
| 300 | Ga0495617_000773 | 3300046452 | Bacteria | 15612 |
| 301 | Ga0495617_003698 | 3300046452 | Bacteria | 5699 |
| 302 | Ga0495617_011679 | 3300046452 | Bacteria | 2995 |
| 303 | Ga0495617_017255 | 3300046452 | Bacteria | 2437 |
| 304 | Ga0495617_040902 | 3300046452 | Bacteria | 1549 |
| 305 | Ga0495617_043526 | 3300046452 | Bacteria | 1499 |
| 306 | Ga0495617_139839 | 3300046452 | Bacteria | 773 |
| 307 | Ga0495627_000699 | 3300046453 | Bacteria | 25601 |
| 308 | Ga0495627_001303 | 3300046453 | Bacteria | 15214 |
| 309 | Ga0495627_001371 | 3300046453 | Bacteria | 14531 |
| 310 | Ga0495627_004876 | 3300046453 | Bacteria | 5523 |
| 311 | Ga0495627_038118 | 3300046453 | Bacteria | 1488 |
| 312 | Ga0495627_073862 | 3300046453 | Bacteria | 993 |
| 313 | Ga0495603_0004624 | 3300046455 | Bacteria | 8219 |
| 314 | Ga0495590_0001763 | 3300046457 | Bacteria | 9179 |
| 315 | Ga0495590_0005614 | 3300046457 | Bacteria | 4947 |
| 316 | Ga0495590_0006823 | 3300046457 | Bacteria | 4436 |
| 317 | Ga0495590_0028052 | 3300046457 | Bacteria | 1974 |
| 318 | Ga0495590_0036714 | 3300046457 | Bacteria | 1709 |
| 319 | Ga0495591_000617 | 3300046458 | Bacteria | 26703 |
| 320 | Ga0495591_000754 | 3300046458 | Bacteria | 23377 |
| 321 | Ga0495591_000770 | 3300046458 | Bacteria | 23160 |
| 322 | Ga0495591_001717 | 3300046458 | Bacteria | 13046 |
| 323 | Ga0495591_002517 | 3300046458 | Bacteria | 10125 |
| 324 | Ga0495591_003388 | 3300046458 | Bacteria | 8262 |
| 325 | Ga0495591_005593 | 3300046458 | Bacteria | 5770 |
| 326 | Ga0495591_009920 | 3300046458 | Bacteria | 3738 |
| 327 | Ga0495591_011452 | 3300046458 | Bacteria | 3359 |
| 328 | Ga0495591_025978 | 3300046458 | Bacteria | 1829 |
| 329 | Ga0495591_041514 | 3300046458 | Bacteria | 1305 |
| 330 | Ga0495591_051357 | 3300046458 | Bacteria | 1125 |
| 331 | Ga0495629_0059385 | 3300046459 | Bacteria | 2673 |
| 332 | Ga0495638_0000698 | 3300046460 | Bacteria | 36406 |
| 333 | Ga0495638_0001198 | 3300046460 | Bacteria | 24807 |
| 334 | Ga0495638_0002225 | 3300046460 | Bacteria | 16118 |
| 335 | Ga0495638_0019430 | 3300046460 | Bacteria | 4496 |
| 336 | Ga0495638_0021288 | 3300046460 | Bacteria | 4275 |
| 337 | Ga0495638_0023806 | 3300046460 | Bacteria | 4000 |
| 338 | Ga0495638_0064840 | 3300046460 | Bacteria | 2249 |
| 339 | Ga0495638_0129161 | 3300046460 | Bacteria | 1486 |
| 340 | Ga0495638_0214397 | 3300046460 | Bacteria | 1079 |
| 341 | Ga0495653_0001621 | 3300046463 | Bacteria | 17676 |
| 342 | Ga0495653_0004821 | 3300046463 | Bacteria | 10937 |
| 343 | Ga0495653_0325690 | 3300046463 | Bacteria | 994 |
| 344 | Ga0495650_0002905 | 3300046471 | Bacteria | 13025 |
| 345 | Ga0495650_0003275 | 3300046471 | Bacteria | 11989 |
| 346 | Ga0495650_0005040 | 3300046471 | Bacteria | 8761 |
| 347 | Ga0495650_0006979 | 3300046471 | Bacteria | 6896 |
| 348 | Ga0495650_0012881 | 3300046471 | Bacteria | 4465 |
| 349 | Ga0495650_0017643 | 3300046471 | Bacteria | 3572 |
| 350 | Ga0495650_0040066 | 3300046471 | Bacteria | 2015 |
| 351 | Ga0495650_0058134 | 3300046471 | Bacteria | 1562 |
| 352 | Ga0495650_0069713 | 3300046471 | Bacteria | 1382 |
| 353 | Ga0495582_0027713 | 3300046473 | Bacteria | 3106 |
| 354 | Ga0495605_0000485 | 3300046474 | Bacteria | 34525 |
| 355 | Ga0495605_0000970 | 3300046474 | Bacteria | 19491 |
| 356 | Ga0495605_0001636 | 3300046474 | Bacteria | 14472 |
| 357 | Ga0495605_0002342 | 3300046474 | Bacteria | 11791 |
| 358 | Ga0495605_0003022 | 3300046474 | Bacteria | 10153 |
| 359 | Ga0495605_0014689 | 3300046474 | Bacteria | 4280 |
| 360 | Ga0495605_0021015 | 3300046474 | Bacteria | 3461 |
| 361 | Ga0495605_0044851 | 3300046474 | Bacteria | 2183 |
| 362 | Ga0495639_0001819 | 3300046475 | Bacteria | 9456 |
| 363 | Ga0495639_0044282 | 3300046475 | Bacteria | 2012 |
| 364 | Ga0495584_0000804 | 3300046491 | Bacteria | 20641 |
| 365 | Ga0495584_0001305 | 3300046491 | Bacteria | 15171 |
| 366 | Ga0495584_0001792 | 3300046491 | Bacteria | 12492 |
| 367 | Ga0495584_0001969 | 3300046491 | Bacteria | 11812 |
| 368 | Ga0495584_0002222 | 3300046491 | Bacteria | 11079 |
| 369 | Ga0495584_0007163 | 3300046491 | Bacteria | 5826 |
| 370 | Ga0495584_0009062 | 3300046491 | Bacteria | 5141 |
| 371 | Ga0495584_0025515 | 3300046491 | Bacteria | 2996 |
| 372 | Ga0495584_0031046 | 3300046491 | Bacteria | 2704 |
| 373 | Ga0495585_0001389 | 3300046492 | Bacteria | 19127 |
| 374 | Ga0495585_0001612 | 3300046492 | Bacteria | 17388 |
| 375 | Ga0495585_0001711 | 3300046492 | Bacteria | 16724 |
| 376 | Ga0495585_0003356 | 3300046492 | Bacteria | 10838 |
| 377 | Ga0495585_0048829 | 3300046492 | Bacteria | 2352 |
| 378 | Ga0495585_0221537 | 3300046492 | Bacteria | 954 |
| 379 | Ga0495594_0001003 | 3300046499 | Bacteria | 14698 |
| 380 | Ga0495594_0004242 | 3300046499 | Bacteria | 7360 |
| 381 | Ga0495594_0093492 | 3300046499 | Bacteria | 1686 |
| 382 | Ga0495596_0000009 | 3300046500 | Bacteria | 145647 |
| 383 | Ga0495596_0031870 | 3300046500 | Bacteria | 2103 |
| 384 | Ga0495607_0000113 | 3300046501 | Bacteria | 84993 |
| 385 | Ga0495607_0000257 | 3300046501 | Bacteria | 57042 |
| 386 | Ga0495607_0002320 | 3300046501 | Bacteria | 15588 |
| 387 | Ga0495607_0003411 | 3300046501 | Bacteria | 12181 |
| 388 | Ga0495607_0004383 | 3300046501 | Bacteria | 10405 |
| 389 | Ga0495607_0007831 | 3300046501 | Bacteria | 7352 |
| 390 | Ga0495607_0008187 | 3300046501 | Bacteria | 7161 |
| 391 | Ga0495607_0039787 | 3300046501 | Bacteria | 2805 |
| 392 | Ga0495607_0050421 | 3300046501 | Bacteria | 2423 |
| 393 | Ga0495607_0090406 | 3300046501 | Bacteria | 1659 |
| 394 | Ga0495607_0100652 | 3300046501 | Bacteria | 1548 |
| 395 | Ga0495583_0000362 | 3300046506 | Bacteria | 71060 |
| 396 | Ga0495583_0006903 | 3300046506 | Bacteria | 7300 |
| 397 | Ga0495583_0007240 | 3300046506 | Bacteria | 7025 |
| 398 | Ga0495583_0011515 | 3300046506 | Bacteria | 5072 |
| 399 | Ga0495583_0044269 | 3300046506 | Bacteria | 2066 |
| 400 | Ga0495583_0230444 | 3300046506 | Bacteria | 746 |
| 401 | Ga0495606_0003219 | 3300046507 | Bacteria | 17574 |
| 402 | Ga0495606_0004373 | 3300046507 | Bacteria | 14165 |
| 403 | Ga0495606_0006204 | 3300046507 | Bacteria | 11118 |
| 404 | Ga0495606_0009801 | 3300046507 | Bacteria | 8047 |
| 405 | Ga0495606_0022693 | 3300046507 | Bacteria | 4562 |
| 406 | Ga0495606_0035883 | 3300046507 | Bacteria | 3384 |
| 407 | Ga0495606_0372296 | 3300046507 | Bacteria | 752 |
| 408 | Ga0495610_0001250 | 3300046512 | Bacteria | 22829 |
| 409 | Ga0495610_0001288 | 3300046512 | Bacteria | 22409 |
| 410 | Ga0495610_0003510 | 3300046512 | Bacteria | 12171 |
| 411 | Ga0495610_0003640 | 3300046512 | Bacteria | 11866 |
| 412 | Ga0495610_0006721 | 3300046512 | Bacteria | 7822 |
| 413 | Ga0495610_0009436 | 3300046512 | Bacteria | 6168 |
| 414 | Ga0495610_0011027 | 3300046512 | Bacteria | 5557 |
| 415 | Ga0495610_0015974 | 3300046512 | Bacteria | 4341 |
| 416 | Ga0495610_0085471 | 3300046512 | Bacteria | 1439 |
| 417 | Ga0495610_0114087 | 3300046512 | Bacteria | 1193 |
| 418 | Ga0495610_0134226 | 3300046512 | Bacteria | 1072 |
| 419 | Ga0495616_0000759 | 3300046513 | Bacteria | 23580 |
| 420 | Ga0495616_0004366 | 3300046513 | Bacteria | 8921 |
| 421 | Ga0495616_0005169 | 3300046513 | Bacteria | 8088 |
| 422 | Ga0495616_0008750 | 3300046513 | Bacteria | 5966 |
| 423 | Ga0495616_0009160 | 3300046513 | Bacteria | 5808 |
| 424 | Ga0495616_0036775 | 3300046513 | Bacteria | 2525 |
| 425 | Ga0495616_0040971 | 3300046513 | Bacteria | 2364 |
| 426 | Ga0495616_0047434 | 3300046513 | Bacteria | 2163 |
| 427 | Ga0495620_0000044 | 3300046515 | Bacteria | 110431 |
| 428 | Ga0495620_0000847 | 3300046515 | Bacteria | 18908 |
| 429 | Ga0495620_0001676 | 3300046515 | Bacteria | 13062 |
| 430 | Ga0495620_0002610 | 3300046515 | Bacteria | 10426 |
| 431 | Ga0495620_0004241 | 3300046515 | Bacteria | 8101 |
| 432 | Ga0495620_0025632 | 3300046515 | Bacteria | 2786 |
| 433 | Ga0495620_0099525 | 3300046515 | Bacteria | 1160 |
| 434 | Ga0495630_0004905 | 3300046517 | Bacteria | 9400 |
| 435 | Ga0495630_0053976 | 3300046517 | Bacteria | 3010 |
| 436 | Ga0495630_0392219 | 3300046517 | Bacteria | 1063 |
| 437 | Ga0495631_0000613 | 3300046518 | Bacteria | 23488 |
| 438 | Ga0495631_0000644 | 3300046518 | Bacteria | 22675 |
| 439 | Ga0495631_0002854 | 3300046518 | Bacteria | 9588 |
| 440 | Ga0495631_0003031 | 3300046518 | Bacteria | 9287 |
| 441 | Ga0495631_0017266 | 3300046518 | Bacteria | 3418 |
| 442 | Ga0495632_0001236 | 3300046519 | Bacteria | 21667 |
| 443 | Ga0495632_0002808 | 3300046519 | Bacteria | 12900 |
| 444 | Ga0495632_0002947 | 3300046519 | Bacteria | 12492 |
| 445 | Ga0495632_0003223 | 3300046519 | Bacteria | 11719 |
| 446 | Ga0495632_0003284 | 3300046519 | Bacteria | 11551 |
| 447 | Ga0495632_0003459 | 3300046519 | Bacteria | 11185 |
| 448 | Ga0495632_0012356 | 3300046519 | Bacteria | 4928 |
| 449 | Ga0495632_0013823 | 3300046519 | Bacteria | 4590 |
| 450 | Ga0495632_0016598 | 3300046519 | Bacteria | 4089 |
| 451 | Ga0495632_0045022 | 3300046519 | Bacteria | 2200 |
| 452 | Ga0495632_0068398 | 3300046519 | Bacteria | 1711 |
| 453 | Ga0495632_0072958 | 3300046519 | Bacteria | 1646 |
| 454 | Ga0495632_0116942 | 3300046519 | Bacteria | 1248 |
| 455 | Ga0495637_0000702 | 3300046520 | Bacteria | 23022 |
| 456 | Ga0495637_0000930 | 3300046520 | Bacteria | 18727 |
| 457 | Ga0495637_0000976 | 3300046520 | Bacteria | 18148 |
| 458 | Ga0495637_0001608 | 3300046520 | Bacteria | 13104 |
| 459 | Ga0495637_0001701 | 3300046520 | Bacteria | 12706 |
| 460 | Ga0495637_0002053 | 3300046520 | Bacteria | 11331 |
| 461 | Ga0495637_0002305 | 3300046520 | Bacteria | 10579 |
| 462 | Ga0495637_0004874 | 3300046520 | Bacteria | 6903 |
| 463 | Ga0495637_0005270 | 3300046520 | Bacteria | 6616 |
| 464 | Ga0495637_0007274 | 3300046520 | Bacteria | 5505 |
| 465 | Ga0495637_0022190 | 3300046520 | Bacteria | 2899 |
| 466 | Ga0495637_0023348 | 3300046520 | Bacteria | 2813 |
| 467 | Ga0495637_0082942 | 3300046520 | Bacteria | 1276 |
| 468 | Ga0495643_0001374 | 3300046522 | Bacteria | 22765 |
| 469 | Ga0495643_0006486 | 3300046522 | Bacteria | 7701 |
| 470 | Ga0495643_0007088 | 3300046522 | Bacteria | 7274 |
| 471 | Ga0495643_0110285 | 3300046522 | Bacteria | 1399 |
| 472 | Ga0495643_0188471 | 3300046522 | Bacteria | 997 |
| 473 | Ga0495644_0000403 | 3300046523 | Bacteria | 19392 |
| 474 | Ga0495644_0028764 | 3300046523 | Bacteria | 2102 |
| 475 | Ga0495644_0082461 | 3300046523 | Bacteria | 1212 |
| 476 | Ga0495648_0002031 | 3300046524 | Bacteria | 19197 |
| 477 | Ga0495648_0003053 | 3300046524 | Bacteria | 14984 |
| 478 | Ga0495648_0003418 | 3300046524 | Bacteria | 13955 |
| 479 | Ga0495648_0006654 | 3300046524 | Bacteria | 9357 |
| 480 | Ga0495648_0006717 | 3300046524 | Bacteria | 9308 |
| 481 | Ga0495648_0012529 | 3300046524 | Bacteria | 6319 |
| 482 | Ga0495648_0014511 | 3300046524 | Bacteria | 5764 |
| 483 | Ga0495648_0016746 | 3300046524 | Bacteria | 5273 |
| 484 | Ga0495648_0020395 | 3300046524 | Bacteria | 4623 |
| 485 | Ga0495648_0029167 | 3300046524 | Bacteria | 3665 |
| 486 | Ga0495648_0030581 | 3300046524 | Bacteria | 3557 |
| 487 | Ga0495648_0034998 | 3300046524 | Bacteria | 3260 |
| 488 | Ga0495648_0079198 | 3300046524 | Bacteria | 1876 |
| 489 | Ga0495648_0154287 | 3300046524 | Bacteria | 1194 |
| 490 | Ga0495666_0002157 | 3300046526 | Bacteria | 9780 |
| 491 | Ga0495666_0003124 | 3300046526 | Bacteria | 8322 |
| 492 | Ga0495666_0069698 | 3300046526 | Bacteria | 1672 |
| 493 | Ga0495666_0078780 | 3300046526 | Bacteria | 1560 |
| 494 | Ga0495666_0157140 | 3300046526 | Bacteria | 1056 |
| 495 | Ga0495642_0000290 | 3300046528 | Bacteria | 28374 |
| 496 | Ga0495642_0000591 | 3300046528 | Bacteria | 18212 |
| 497 | Ga0495642_0002466 | 3300046528 | Bacteria | 7522 |
| 498 | Ga0495652_0130975 | 3300046529 | Bacteria | 1986 |
| 499 | Ga0495654_0000354 | 3300046530 | Bacteria | 39704 |
| 500 | Ga0495654_0001459 | 3300046530 | Bacteria | 16192 |
| 501 | Ga0495654_0002728 | 3300046530 | Bacteria | 11145 |
| 502 | Ga0495654_0003616 | 3300046530 | Bacteria | 9406 |
| 503 | Ga0495654_0003695 | 3300046530 | Bacteria | 9292 |
| 504 | Ga0495654_0004029 | 3300046530 | Bacteria | 8826 |
| 505 | Ga0495654_0006729 | 3300046530 | Bacteria | 6501 |
| 506 | Ga0495654_0016644 | 3300046530 | Bacteria | 3879 |
| 507 | Ga0495654_0028485 | 3300046530 | Bacteria | 2856 |
| 508 | Ga0495654_0029259 | 3300046530 | Bacteria | 2810 |
| 509 | Ga0495654_0035307 | 3300046530 | Bacteria | 2519 |
| 510 | Ga0495654_0056872 | 3300046530 | Bacteria | 1890 |
| 511 | Ga0495654_0122532 | 3300046530 | Bacteria | 1175 |
| 512 | Ga0495654_0161858 | 3300046530 | Bacteria | 982 |
| 513 | Ga0495586_0003371 | 3300046535 | Bacteria | 8569 |
| 514 | Ga0495587_0004270 | 3300046536 | Bacteria | 9438 |
| 515 | Ga0495587_0010206 | 3300046536 | Bacteria | 5988 |
| 516 | Ga0495609_0000471 | 3300046538 | Bacteria | 32562 |
| 517 | Ga0495609_0000906 | 3300046538 | Bacteria | 21565 |
| 518 | Ga0495609_0001060 | 3300046538 | Bacteria | 19247 |
| 519 | Ga0495609_0002247 | 3300046538 | Bacteria | 12057 |
| 520 | Ga0495609_0047615 | 3300046538 | Bacteria | 1918 |
| 521 | Ga0495597_0000890 | 3300046542 | Bacteria | 23277 |
| 522 | Ga0495597_0003052 | 3300046542 | Bacteria | 10083 |
| 523 | Ga0495597_0003491 | 3300046542 | Bacteria | 9119 |
| 524 | Ga0495597_0003635 | 3300046542 | Bacteria | 8861 |
| 525 | Ga0495597_0011363 | 3300046542 | Bacteria | 4318 |
| 526 | Ga0495597_0020119 | 3300046542 | Bacteria | 3114 |
| 527 | Ga0495597_0026447 | 3300046542 | Bacteria | 2665 |
| 528 | Ga0495597_0037109 | 3300046542 | Bacteria | 2189 |
| 529 | Ga0495597_0041067 | 3300046542 | Bacteria | 2067 |
| 530 | Ga0495645_0107979 | 3300046543 | Bacteria | 1972 |
| 531 | Ga0495622_0000847 | 3300046557 | Bacteria | 16848 |
| 532 | Ga0495622_0000869 | 3300046557 | Bacteria | 16563 |
| 533 | Ga0495622_0012301 | 3300046557 | Bacteria | 3958 |
| 534 | Ga0495622_0049380 | 3300046557 | Bacteria | 1953 |
| 535 | Ga0495622_0097220 | 3300046557 | Bacteria | 1351 |
| 536 | Ga0495633_0000201 | 3300046558 | Bacteria | 76414 |
| 537 | Ga0495633_0001196 | 3300046558 | Bacteria | 20847 |
| 538 | Ga0495633_0026522 | 3300046558 | Bacteria | 2842 |
| 539 | Ga0495633_0073975 | 3300046558 | Bacteria | 1588 |
| 540 | Ga0495633_0173221 | 3300046558 | Bacteria | 994 |
| 541 | Ga0495656_0001906 | 3300046615 | Bacteria | 6879 |
| 542 | Ga0495656_0137486 | 3300046615 | Bacteria | 1168 |
| 543 | Ga0495668_0001342 | 3300046616 | Bacteria | 24188 |
| 544 | Ga0495668_0001843 | 3300046616 | Bacteria | 19109 |
| 545 | Ga0495668_0002812 | 3300046616 | Bacteria | 13842 |
| 546 | Ga0495668_0070094 | 3300046616 | Bacteria | 1927 |
| 547 | Ga0495668_0220517 | 3300046616 | Bacteria | 1038 |
| 548 | Ga0495634_0001305 | 3300046642 | Bacteria | 22770 |
| 549 | Ga0495634_0037499 | 3300046642 | Bacteria | 3312 |
| 550 | Ga0495611_0000456 | 3300046648 | Bacteria | 24506 |
| 551 | Ga0495611_0002642 | 3300046648 | Bacteria | 8104 |
| 552 | Ga0495611_0004162 | 3300046648 | Bacteria | 6297 |
| 553 | Ga0495611_0006544 | 3300046648 | Bacteria | 4964 |
| 554 | Ga0495611_0160407 | 3300046648 | Bacteria | 1050 |
| 555 | Ga0495625_0001368 | 3300046660 | Bacteria | 29974 |
| 556 | Ga0495625_0003229 | 3300046660 | Bacteria | 16509 |
| 557 | Ga0495625_0003768 | 3300046660 | Bacteria | 14722 |
| 558 | Ga0495625_0006972 | 3300046660 | Bacteria | 9965 |
| 559 | Ga0495625_0027147 | 3300046660 | Bacteria | 4316 |
| 560 | Ga0495625_0075275 | 3300046660 | Bacteria | 2362 |
| 561 | Ga0495625_0087490 | 3300046660 | Bacteria | 2159 |
| 562 | Ga0495625_0128584 | 3300046660 | Bacteria | 1717 |
| 563 | Ga0495625_0273551 | 3300046660 | Bacteria | 1089 |
| 564 | Ga0495625_0298689 | 3300046660 | Bacteria | 1031 |
| 565 | Ga0495635_0000719 | 3300046663 | Bacteria | 21364 |
| 566 | Ga0495659_0000494 | 3300046664 | Bacteria | 14549 |
| 567 | Ga0495659_0012016 | 3300046664 | Bacteria | 2796 |
| 568 | Ga0495661_0001174 | 3300046665 | Bacteria | 22811 |
| 569 | Ga0495661_0006967 | 3300046665 | Bacteria | 7903 |
| 570 | Ga0495661_0007188 | 3300046665 | Bacteria | 7769 |
| 571 | Ga0495661_0017678 | 3300046665 | Bacteria | 4704 |
| 572 | Ga0495661_0106356 | 3300046665 | Bacteria | 1570 |
| 573 | Ga0495661_0153612 | 3300046665 | Bacteria | 1241 |
| 574 | Ga0495661_0234154 | 3300046665 | Bacteria | 945 |
| 575 | Ga0495588_0008565 | 3300046674 | Bacteria | 4698 |
| 576 | Ga0495588_0016923 | 3300046674 | Bacteria | 3532 |
| 577 | Ga0495588_0066685 | 3300046674 | Bacteria | 1868 |
| 578 | Ga0495599_0308262 | 3300046678 | Bacteria | 954 |
| 579 | Ga0495623_0003391 | 3300046679 | Bacteria | 10534 |
| 580 | Ga0495646_0036530 | 3300046680 | Bacteria | 3042 |
| 581 | Ga0495669_0002748 | 3300046684 | Bacteria | 7218 |
| 582 | Ga0495613_0003935 | 3300046689 | Bacteria | 11122 |
| 583 | Ga0495624_0001088 | 3300046690 | Bacteria | 21459 |
| 584 | Ga0495670_0000448 | 3300046691 | Bacteria | 19692 |
| 585 | Ga0495670_0001143 | 3300046691 | Bacteria | 12898 |
| 586 | Ga0495670_0002696 | 3300046691 | Bacteria | 8769 |
| 587 | Ga0495670_0023859 | 3300046691 | Bacteria | 3020 |
| 588 | Ga0495670_0040788 | 3300046691 | Bacteria | 2315 |
| 589 | Ga0495670_0139157 | 3300046691 | Bacteria | 1268 |
| 590 | Ga0495670_0144800 | 3300046691 | Bacteria | 1244 |
| 591 | Ga0495670_0216661 | 3300046691 | Bacteria | 1016 |
| 592 | Ga0495670_0289701 | 3300046691 | Bacteria | 876 |
| 593 | Ga0495671_0000837 | 3300046692 | Bacteria | 21991 |
| 594 | Ga0495671_0001280 | 3300046692 | Bacteria | 17169 |
| 595 | Ga0495671_0001795 | 3300046692 | Bacteria | 13890 |
| 596 | Ga0495671_0002184 | 3300046692 | Bacteria | 12469 |
| 597 | Ga0495671_0002267 | 3300046692 | Bacteria | 12236 |
| 598 | Ga0495671_0005418 | 3300046692 | Bacteria | 7468 |
| 599 | Ga0495671_0010789 | 3300046692 | Bacteria | 5050 |
| 600 | Ga0495671_0017599 | 3300046692 | Bacteria | 3802 |
| 601 | Ga0495671_0073828 | 3300046692 | Bacteria | 1674 |
| 602 | Ga0495671_0096241 | 3300046692 | Bacteria | 1448 |
| 603 | Ga0495671_0109725 | 3300046692 | Bacteria | 1348 |
| 604 | Ga0495671_0125489 | 3300046692 | Bacteria | 1251 |
| 605 | Ga0495649_0001977 | 3300046694 | Bacteria | 14872 |
| 606 | Ga0495649_0002048 | 3300046694 | Bacteria | 14530 |
| 607 | Ga0495649_0003123 | 3300046694 | Bacteria | 11350 |
| 608 | Ga0495649_0006006 | 3300046694 | Bacteria | 7603 |
| 609 | Ga0495649_0006617 | 3300046694 | Bacteria | 7201 |
| 610 | Ga0495649_0009826 | 3300046694 | Bacteria | 5663 |
| 611 | Ga0495649_0010758 | 3300046694 | Bacteria | 5390 |
| 612 | Ga0495649_0017236 | 3300046694 | Bacteria | 4078 |
| 613 | Ga0495649_0019793 | 3300046694 | Bacteria | 3780 |
| 614 | Ga0495649_0022012 | 3300046694 | Bacteria | 3569 |
| 615 | Ga0495649_0039514 | 3300046694 | Bacteria | 2586 |
| 616 | Ga0495649_0093850 | 3300046694 | Bacteria | 1597 |
| 617 | Ga0495649_0224274 | 3300046694 | Bacteria | 971 |
| 618 | Ga0495649_0371814 | 3300046694 | Bacteria | 720 |
| 619 | Ga0495589_0000664 | 3300046794 | Bacteria | 22547 |
| 620 | Ga0495589_0001080 | 3300046794 | Bacteria | 16265 |
| 621 | Ga0495589_0002883 | 3300046794 | Bacteria | 9518 |
| 622 | Ga0495589_0006279 | 3300046794 | Bacteria | 6276 |
| 623 | Ga0495589_0054060 | 3300046794 | Bacteria | 1980 |
| 624 | Ga0495600_0009474 | 3300046809 | Bacteria | 6018 |
| 625 | Ga0495600_0041322 | 3300046809 | Bacteria | 3004 |
| 626 | Ga0495600_0261871 | 3300046809 | Bacteria | 1098 |
| 627 | Ga0495660_0001341 | 3300046810 | Bacteria | 16925 |
| 628 | Ga0495660_0001625 | 3300046810 | Bacteria | 15082 |
| 629 | Ga0495660_0001699 | 3300046810 | Bacteria | 14733 |
| 630 | Ga0495660_0003037 | 3300046810 | Bacteria | 10468 |
| 631 | Ga0495660_0005433 | 3300046810 | Bacteria | 7629 |
| 632 | Ga0495660_0009145 | 3300046810 | Bacteria | 5785 |
| 633 | Ga0495660_0009717 | 3300046810 | Bacteria | 5604 |
| 634 | Ga0495660_0030311 | 3300046810 | Bacteria | 3047 |
| 635 | Ga0495660_0043614 | 3300046810 | Bacteria | 2472 |
| 636 | Ga0495660_0068432 | 3300046810 | Bacteria | 1889 |
| 637 | Ga0495660_0068649 | 3300046810 | Bacteria | 1885 |
| 638 | Ga0495660_0250685 | 3300046810 | Bacteria | 821 |
| 639 | Ga0495581_0053772 | 3300047315 | Bacteria | 2325 |
| 640 | Ga0495604_0065354 | 3300047317 | Bacteria | 2769 |
| 641 | Ga0495604_0069564 | 3300047317 | Bacteria | 2667 |
| 642 | Ga0495604_0074295 | 3300047317 | Bacteria | 2562 |
| 643 | Ga0495636_0057945 | 3300047318 | Bacteria | 1632 |
| 644 | Ga0495636_0223636 | 3300047318 | Bacteria | 864 |
| 645 | Ga0495636_0248879 | 3300047318 | Bacteria | 821 |
| 646 | Ga0495674_0008413 | 3300047319 | Bacteria | 9828 |
| 647 | Ga0495674_0366816 | 3300047319 | Bacteria | 1167 |
| 648 | Ga0495672_0000143 | 3300047320 | Bacteria | 105045 |
| 649 | Ga0495672_0000612 | 3300047320 | Bacteria | 39954 |
| 650 | Ga0495672_0001326 | 3300047320 | Bacteria | 24594 |
| 651 | Ga0495672_0001433 | 3300047320 | Bacteria | 23422 |
| 652 | Ga0495672_0002425 | 3300047320 | Bacteria | 17186 |
| 653 | Ga0495672_0005238 | 3300047320 | Bacteria | 10331 |
| 654 | Ga0495672_0008205 | 3300047320 | Bacteria | 7745 |
| 655 | Ga0495672_0018144 | 3300047320 | Bacteria | 4683 |
| 656 | Ga0495672_0025262 | 3300047320 | Bacteria | 3806 |
| 657 | Ga0495672_0036794 | 3300047320 | Bacteria | 3002 |
| 658 | Ga0495676_0001157 | 3300047321 | Bacteria | 22447 |
| 659 | Ga0495680_0025037 | 3300047322 | Bacteria | 4942 |
| 660 | Ga0495680_0084923 | 3300047322 | Bacteria | 2384 |
| 661 | Ga0495680_0160872 | 3300047322 | Bacteria | 1630 |
| 662 | Ga0495683_0000141 | 3300047323 | Bacteria | 70994 |
| 663 | Ga0495683_0000788 | 3300047323 | Bacteria | 22569 |
| 664 | Ga0495683_0002329 | 3300047323 | Bacteria | 11545 |
| 665 | Ga0495683_0003010 | 3300047323 | Bacteria | 9933 |
| 666 | Ga0495683_0014639 | 3300047323 | Bacteria | 4087 |
| 667 | Ga0495683_0029470 | 3300047323 | Bacteria | 2804 |
| 668 | Ga0495683_0039248 | 3300047323 | Bacteria | 2393 |
| 669 | Ga0495687_001742 | 3300047443 | Bacteria | 19255 |
| 670 | Ga0495687_003676 | 3300047443 | Bacteria | 10919 |
| 671 | Ga0495675_0054812 | 3300047444 | Bacteria | 2529 |
| 672 | Ga0495675_0096294 | 3300047444 | Bacteria | 1855 |
| 673 | Ga0495675_0120676 | 3300047444 | Bacteria | 1632 |
| 674 | Ga0495677_0000776 | 3300047445 | Bacteria | 12877 |
| 675 | Ga0495679_001299 | 3300047446 | Bacteria | 14550 |
| 676 | Ga0495679_002459 | 3300047446 | Bacteria | 9442 |
| 677 | Ga0495679_002686 | 3300047446 | Bacteria | 8884 |
| 678 | Ga0495679_003317 | 3300047446 | Bacteria | 7785 |
| 679 | Ga0495679_018611 | 3300047446 | Bacteria | 2461 |
| 680 | Ga0495685_024540 | 3300047447 | Bacteria | 2075 |
| 681 | Ga0495685_025297 | 3300047447 | Bacteria | 2043 |
| 682 | Ga0495673_0001105 | 3300047469 | Bacteria | 23223 |
| 683 | Ga0495673_0001211 | 3300047469 | Bacteria | 21479 |
| 684 | Ga0495673_0001953 | 3300047469 | Bacteria | 15307 |
| 685 | Ga0495673_0002138 | 3300047469 | Bacteria | 14346 |
| 686 | Ga0495673_0004438 | 3300047469 | Bacteria | 8785 |
| 687 | Ga0495673_0004611 | 3300047469 | Bacteria | 8582 |
| 688 | Ga0495673_0005043 | 3300047469 | Bacteria | 8086 |
| 689 | Ga0495673_0005123 | 3300047469 | Bacteria | 7993 |
| 690 | Ga0495673_0009989 | 3300047469 | Bacteria | 5198 |
| 691 | Ga0495673_0036391 | 3300047469 | Bacteria | 2259 |
| 692 | Ga0495673_0081790 | 3300047469 | Bacteria | 1337 |
| 693 | Ga0495681_0000949 | 3300047470 | Bacteria | 22272 |
| 694 | Ga0495681_0002095 | 3300047470 | Bacteria | 14509 |
| 695 | Ga0495681_0005016 | 3300047470 | Bacteria | 8924 |
| 696 | Ga0495681_0005762 | 3300047470 | Bacteria | 8238 |
| 697 | Ga0495681_0007738 | 3300047470 | Bacteria | 6815 |
| 698 | Ga0495681_0008488 | 3300047470 | Bacteria | 6440 |
| 699 | Ga0495681_0010449 | 3300047470 | Bacteria | 5619 |
| 700 | Ga0495681_0012034 | 3300047470 | Bacteria | 5106 |
| 701 | Ga0495681_0013596 | 3300047470 | Bacteria | 4712 |
| 702 | Ga0495681_0015051 | 3300047470 | Bacteria | 4394 |
| 703 | Ga0495681_0078234 | 3300047470 | Bacteria | 1482 |
| 704 | Ga0495686_0002212 | 3300047472 | Bacteria | 18892 |
| 705 | Ga0495686_0003437 | 3300047472 | Bacteria | 13730 |
| 706 | Ga0495686_0018619 | 3300047472 | Bacteria | 4655 |
| 707 | Ga0495686_0046695 | 3300047472 | Bacteria | 2736 |
| 708 | Ga0495686_0170888 | 3300047472 | Bacteria | 1264 |
| 709 | Ga0495593_0001903 | 3300047673 | Bacteria | 12437 |
| 710 | Ga0495593_0122550 | 3300047673 | Bacteria | 1322 |
| 711 | Ga0495593_0127412 | 3300047673 | Bacteria | 1293 |
| 712 | Ga0495593_0196094 | 3300047673 | Bacteria | 1015 |
| 713 | Ga0495602_0002882 | 3300048088 | Bacteria | 17623 |
| 714 | Ga0495614_0062619 | 3300048089 | Bacteria | 1599 |
| 715 | Ga0495614_0148146 | 3300048089 | Bacteria | 1046 |
| 716 | Ga0495626_0000437 | 3300048091 | Bacteria | 42568 |
| 717 | Ga0495626_0000824 | 3300048091 | Bacteria | 27826 |
| 718 | Ga0495626_0001145 | 3300048091 | Bacteria | 22152 |
| 719 | Ga0495626_0001360 | 3300048091 | Bacteria | 19768 |
| 720 | Ga0495626_0002102 | 3300048091 | Bacteria | 14483 |
| 721 | Ga0495626_0002796 | 3300048091 | Bacteria | 11705 |
| 722 | Ga0495626_0003391 | 3300048091 | Bacteria | 10258 |
| 723 | Ga0495626_0010816 | 3300048091 | Bacteria | 4848 |
| 724 | Ga0495626_0014335 | 3300048091 | Bacteria | 4093 |
| 725 | Ga0496102_0001122 | 3300048905 | Bacteria | 24548 |
| 726 | Ga0496103_0001780 | 3300048906 | Bacteria | 14059 |
| 727 | Ga0496110_0120856 | 3300048913 | Bacteria | 2359 |
| 728 | Ga0496110_0189484 | 3300048913 | Bacteria | 1868 |
| 729 | Ga0496110_0227077 | 3300048913 | Bacteria | 1698 |
| 730 | Ga0496115_0204197 | 3300048918 | Bacteria | 1632 |
| 731 | Ga0496116_0000295 | 3300048919 | Bacteria | 84486 |
| 732 | Ga0496116_0001666 | 3300048919 | Bacteria | 24407 |
| 733 | Ga0496116_0004219 | 3300048919 | Bacteria | 13813 |
| 734 | Ga0496116_0007393 | 3300048919 | Bacteria | 9755 |
| 735 | Ga0496116_0243322 | 3300048919 | Bacteria | 902 |
| 736 | Ga0496117_0004224 | 3300048920 | Bacteria | 16036 |
| 737 | Ga0496117_0007026 | 3300048920 | Bacteria | 11143 |
| 738 | Ga0496117_0077854 | 3300048920 | Bacteria | 2192 |
| 739 | Ga0496117_0144314 | 3300048920 | Bacteria | 1420 |
| 740 | Ga0496118_0005826 | 3300048921 | Bacteria | 13811 |
| 741 | Ga0496118_0009592 | 3300048921 | Bacteria | 9744 |
| 742 | Ga0496118_0054722 | 3300048921 | Bacteria | 3019 |
| 743 | Ga0496118_0313689 | 3300048921 | Bacteria | 854 |
| 744 | Ga0496119_0127776 | 3300048922 | Bacteria | 1389 |
| 745 | Ga0496121_0003721 | 3300048924 | Bacteria | 21386 |
| 746 | Ga0496121_0029975 | 3300048924 | Bacteria | 5009 |
| 747 | Ga0496121_0037966 | 3300048924 | Bacteria | 4272 |
| 748 | Ga0496121_0154434 | 3300048924 | Bacteria | 1685 |
| 749 | Ga0496122_0015065 | 3300048925 | Bacteria | 7420 |
| 750 | Ga0496122_0021525 | 3300048925 | Bacteria | 5768 |
| 751 | Ga0496122_0046399 | 3300048925 | Bacteria | 3365 |
| 752 | Ga0496123_0006939 | 3300048926 | Bacteria | 10820 |
| 753 | Ga0496123_0008089 | 3300048926 | Bacteria | 9726 |
| 754 | Ga0496123_0019015 | 3300048926 | Bacteria | 5427 |
| 755 | Ga0496124_0005235 | 3300048927 | Bacteria | 14712 |
| 756 | Ga0496124_0011129 | 3300048927 | Bacteria | 9026 |
| 757 | Ga0496124_0025409 | 3300048927 | Bacteria | 5364 |
| 758 | Ga0496124_0069700 | 3300048927 | Bacteria | 2919 |
| 759 | Ga0496125_0004168 | 3300048928 | Bacteria | 16851 |
| 760 | Ga0496125_0007935 | 3300048928 | Bacteria | 11209 |
| 761 | Ga0496125_0117753 | 3300048928 | Bacteria | 1904 |
| 762 | Ga0495678_000054 | 3300049459 | Bacteria | 153487 |
| 763 | Ga0495678_000909 | 3300049459 | Bacteria | 25996 |
| 764 | Ga0495678_001455 | 3300049459 | Bacteria | 18592 |
| 765 | Ga0495678_001993 | 3300049459 | Bacteria | 14674 |
| 766 | Ga0495678_002476 | 3300049459 | Bacteria | 12450 |
| 767 | Ga0495678_003280 | 3300049459 | Bacteria | 10112 |
| 768 | Ga0495678_003799 | 3300049459 | Bacteria | 9112 |
| 769 | Ga0495678_009422 | 3300049459 | Bacteria | 4833 |
| 770 | Ga0495678_012866 | 3300049459 | Bacteria | 3948 |
| 771 | Ga0495678_013356 | 3300049459 | Bacteria | 3859 |
| 772 | Ga0495678_022320 | 3300049459 | Bacteria | 2769 |
| 773 | Ga0495678_031595 | 3300049459 | Bacteria | 2206 |
| 774 | Ga0495678_085903 | 3300049459 | Bacteria | 1119 |
| 775 | Ga0495682_0000898 | 3300049460 | Bacteria | 18398 |
| 776 | Ga0495682_0001298 | 3300049460 | Bacteria | 13894 |
| 777 | Ga0495682_0001917 | 3300049460 | Bacteria | 10357 |
| 778 | Ga0495682_0014363 | 3300049460 | Bacteria | 3005 |
| 779 | Ga0495682_0032577 | 3300049460 | Bacteria | 1925 |
| 780 | Ga0495682_0042966 | 3300049460 | Bacteria | 1655 |
| 781 | Ga0495682_0044990 | 3300049460 | Bacteria | 1614 |
| 782 | Ga0495682_0172872 | 3300049460 | Bacteria | 768 |
| 783 | Ga0501041_0041254 | 3300049577 | Bacteria | 2803 |
| 784 | Ga0501072_0018468 | 3300049588 | Bacteria | 5371 |
| 785 | Ga0501074_0033612 | 3300049590 | Bacteria | 3717 |
| 786 | Ga0501076_0020672 | 3300049592 | Bacteria | 5041 |
| 787 | Ga0501077_0394552 | 3300049593 | Bacteria | 884 |
| 788 | Ga0501081_0145705 | 3300049743 | Bacteria | 1699 |
| 789 | Ga0501241_000068 | 3300049758 | Bacteria | 24952 |
| 790 | Ga0501045_0065159 | 3300049824 | Bacteria | 2675 |
| 791 | Ga0501226_000008 | 3300049853 | Bacteria | 199119 |
| 792 | nmdc:mga08y16_56354_c1 | 3300050511 | Bacteria | 4108 |
| 793 | nmdc:mga08x19_33464_c1 | 3300050514 | Bacteria | 3244 |
| 794 | Ga0500572_000576 | 3300053111 | Bacteria | 12491 |
| 795 | Ga0500573_0004190 | 3300053140 | Bacteria | 7558 |
| 796 | Ga0501084_0059600 | 3300054114 | Bacteria | 3195 |
| 797 | Ga0501082_0219280 | 3300060353 | Bacteria | 1655 |
| 798 | Ga0530510_0020094 | 3300061734 | Bacteria | 4748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2511231031 | 2511412570 | 192 |
| 2 | 3300013306 | Ga0163162_10000334 | Ga0163162_100003347 | 193 |
| 3 | 3300046453 | Ga0495627_000699 | Ga0495627_000699_11971_12717 | 193 |
| 4 | 3300046491 | Ga0495584_0001969 | Ga0495584_0001969_10210_10956 | 193 |
| 5 | 3300046500 | Ga0495596_0031870 | Ga0495596_0031870_699_1445 | 193 |
| 6 | 3300046512 | Ga0495610_0001250 | Ga0495610_0001250_10290_11036 | 193 |
| 7 | 3300046519 | Ga0495632_0003284 | Ga0495632_0003284_8599_9345 | 193 |
| 8 | 3300046520 | Ga0495637_0000702 | Ga0495637_0000702_10340_11086 | 193 |
| 9 | 3300046524 | Ga0495648_0003418 | Ga0495648_0003418_10300_11043 | 193 |
| 10 | 3300046530 | Ga0495654_0029259 | Ga0495654_0029259_410_1156 | 193 |
| 11 | 3300046648 | Ga0495611_0000456 | Ga0495611_0000456_10329_11075 | 193 |
| 12 | 3300046660 | Ga0495625_0001368 | Ga0495625_0001368_18877_19623 | 193 |
| 13 | 3300047470 | Ga0495681_0002095 | Ga0495681_0002095_11142_11888 | 193 |
| 14 | 3300054114 | Ga0501084_0059600 | Ga0501084_0059600_563_1171 | 195 |
| 15 | 3300046515 | Ga0495620_0001676 | Ga0495620_0001676_2058_2813 | 196 |
| 16 | 3300046520 | Ga0495637_0001608 | Ga0495637_0001608_2213_2959 | 196 |
| 17 | 3300046538 | Ga0495609_0000906 | Ga0495609_0000906_10207_10953 | 196 |
| 18 | 3300046794 | Ga0495589_0000664 | Ga0495589_0000664_11500_12246 | 196 |
| 19 | 3300006847 | Ga0075431_100424331 | Ga0075431_1004243312 | 202 |
| 20 | 3300009094 | Ga0111539_10272072 | Ga0111539_102720723 | 202 |
| 21 | 3300048913 | Ga0496110_0227077 | Ga0496110_0227077_302_946 | 202 |
| 22 | 3300049577 | Ga0501041_0041254 | Ga0501041_0041254_829_1458 | 202 |
| 23 | 3300049588 | Ga0501072_0018468 | Ga0501072_0018468_852_1481 | 202 |
| 24 | 3300049590 | Ga0501074_0033612 | Ga0501074_0033612_890_1519 | 202 |
| 25 | 3300049592 | Ga0501076_0020672 | Ga0501076_0020672_1715_2344 | 202 |
| 26 | 3300049593 | Ga0501077_0394552 | Ga0501077_0394552_65_694 | 202 |
| 27 | 3300049743 | Ga0501081_0145705 | Ga0501081_0145705_23_652 | 202 |
| 28 | 3300049824 | Ga0501045_0065159 | Ga0501045_0065159_1540_2169 | 202 |
| 29 | 3300050511 | nmdc:mga08y16_56354_c1 | nmdc:mga08y16_56354_c1_2423_3049 | 202 |
| 30 | 3300060353 | Ga0501082_0219280 | Ga0501082_0219280_714_1343 | 202 |
| 31 | 3300061734 | Ga0530510_0020094 | Ga0530510_0020094_98_727 | 202 |
| 32 | iso_pu_bacteria | 2511231004 | 2511253541 | 203 |
| 33 | iso_pu_bacteria | 2511231007 | 2511269882 | 203 |
| 34 | iso_pu_bacteria | 2511231008 | 2511275843 | 203 |
| 35 | iso_pu_bacteria | 2511231010 | 2511289800 | 203 |
| 36 | iso_pu_bacteria | 2511231011 | 2511294301 | 203 |
| 37 | iso_pu_bacteria | 2511231012 | 2511300094 | 203 |
| 38 | iso_pu_bacteria | 2511231014 | 2511315383 | 203 |
| 39 | iso_pu_bacteria | 2511231015 | 2511318909 | 203 |
| 40 | iso_pu_bacteria | 2511231016 | 2511325146 | 203 |
| 41 | iso_pu_bacteria | 2511231017 | 2511332139 | 203 |
| 42 | iso_pu_bacteria | 2511231018 | 2511339241 | 203 |
| 43 | iso_pu_bacteria | 2511231019 | 2511343226 | 203 |
| 44 | iso_pu_bacteria | 2511231020 | 2511347913 | 203 |
| 45 | iso_pu_bacteria | 2511231021 | 2511357982 | 203 |
| 46 | iso_pu_bacteria | 2511231022 | 2511364327 | 203 |
| 47 | iso_pu_bacteria | 2554235341 | 2555673054 | 203 |
| 48 | iso_pu_bacteria | 2599185155 | 2599327903 | 203 |
| 49 | iso_pu_bacteria | 2599185160 | 2599355740 | 203 |
| 50 | iso_pu_bacteria | 2599185161 | 2599362858 | 203 |
| 51 | iso_pu_bacteria | 2599185162 | 2599368836 | 203 |
| 52 | iso_pu_bacteria | 2599185163 | 2599375967 | 203 |
| 53 | iso_pu_bacteria | 2599185164 | 2599380846 | 203 |
| 54 | iso_pu_bacteria | 2599185165 | 2599387638 | 203 |
| 55 | iso_pu_bacteria | 2599185166 | 2599394825 | 203 |
| 56 | iso_pu_bacteria | 2599185168 | 2599406590 | 203 |
| 57 | iso_pu_bacteria | 2599185181 | 2599462574 | 203 |
| 58 | iso_pu_bacteria | 2599185182 | 2599468004 | 203 |
| 59 | iso_pu_bacteria | 2599185186 | 2599491591 | 203 |
| 60 | iso_pu_bacteria | 2599185188 | 2599503676 | 203 |
| 61 | iso_pu_bacteria | 2599185248 | 2599767948 | 203 |
| 62 | iso_pu_bacteria | 2599185289 | 2599887747 | 203 |
| 63 | iso_pu_bacteria | 2599185291 | 2599899562 | 203 |
| 64 | iso_pu_bacteria | 2599185300 | 2599933111 | 203 |
| 65 | iso_pu_bacteria | 2599185305 | 2599962212 | 203 |
| 66 | iso_pu_bacteria | 2599185306 | 2599969049 | 203 |
| 67 | iso_pu_bacteria | 2599185308 | 2599980278 | 203 |
| 68 | iso_pu_bacteria | 2599185309 | 2599984483 | 203 |
| 69 | iso_pu_bacteria | 2599185310 | 2599990765 | 203 |
| 70 | iso_pu_bacteria | 2599185312 | 2600000686 | 203 |
| 71 | iso_pu_bacteria | 2599185313 | 2600007097 | 203 |
| 72 | iso_pu_bacteria | 2599185314 | 2600014090 | 203 |
| 73 | iso_pu_bacteria | 2599185315 | 2600019584 | 203 |
| 74 | iso_pu_bacteria | 2599185320 | 2600049718 | 203 |
| 75 | iso_pu_bacteria | 2599185321 | 2600054094 | 203 |
| 76 | iso_pu_bacteria | 2599185324 | 2600072128 | 203 |
| 77 | iso_pu_bacteria | 2599185356 | 2600215198 | 203 |
| 78 | iso_pu_bacteria | 2600255313 | 2601775364 | 203 |
| 79 | iso_pu_bacteria | 2600255318 | 2601798334 | 203 |
| 80 | iso_pu_bacteria | 2603880185 | 2606077228 | 203 |
| 81 | iso_pu_bacteria | 2603880199 | 2606129526 | 203 |
| 82 | iso_pu_bacteria | 2623620443 | 2624483632 | 203 |
| 83 | iso_pu_bacteria | 2643221565 | 2643843280 | 203 |
| 84 | iso_pu_bacteria | 2643221589 | 2643956131 | 203 |
| 85 | iso_pu_bacteria | 2643221602 | 2644020253 | 203 |
| 86 | iso_pu_bacteria | 2643221633 | 2644184266 | 203 |
| 87 | iso_pu_bacteria | 2651869719 | 2652545732 | 203 |
| 88 | iso_pu_bacteria | 2667528170 | 2671092066 | 203 |
| 89 | iso_pu_bacteria | 2667528171 | 2671099499 | 203 |
| 90 | iso_pu_bacteria | 2713897149 | 2715754623 | 203 |
| 91 | iso_pu_bacteria | 2718217725 | 2718636827 | 203 |
| 92 | iso_pu_bacteria | 2738543004 | 2739201050 | 203 |
| 93 | iso_pu_bacteria | 2738543015 | 2739260588 | 203 |
| 94 | iso_pu_bacteria | 2738543020 | 2739285877 | 203 |
| 95 | iso_pu_bacteria | 2738543021 | 2739291190 | 203 |
| 96 | iso_pu_bacteria | 2738543025 | 2739312280 | 203 |
| 97 | iso_pu_bacteria | 2773857670 | 2774118137 | 203 |
| 98 | iso_pu_bacteria | 2773857673 | 2774136409 | 203 |
| 99 | iso_pu_bacteria | 2784132063 | 2784261595 | 203 |
| 100 | iso_pu_bacteria | 2784132072 | 2784316905 | 203 |
| 101 | iso_pu_bacteria | 2791355520 | 2794598984 | 203 |
| 102 | iso_pu_bacteria | 2808606361 | 2808856640 | 203 |
| 103 | iso_pu_bacteria | 2808606376 | 2808925826 | 203 |
| 104 | iso_pu_bacteria | 2808606377 | 2808928226 | 203 |
| 105 | iso_pu_bacteria | 2808606378 | 2808936606 | 203 |
| 106 | iso_pu_bacteria | 2808606380 | 2808947933 | 203 |
| 107 | iso_pu_bacteria | 2808606381 | 2808950592 | 203 |
| 108 | iso_pu_bacteria | 2808606382 | 2808961419 | 203 |
| 109 | iso_pu_bacteria | 2808606383 | 2808965101 | 203 |
| 110 | iso_pu_bacteria | 2808606389 | 2808999993 | 203 |
| 111 | iso_pu_bacteria | 2818991456 | 2819655350 | 203 |
| 112 | iso_pu_bacteria | 2842805378 | 2842807629 | 203 |
| 113 | iso_pu_bacteria | 2842832357 | 2842833676 | 203 |
| 114 | iso_pu_bacteria | 2842843487 | 2842845908 | 203 |
| 115 | iso_pu_bacteria | 2852657418 | 2852660031 | 203 |
| 116 | iso_pu_bacteria | 2860339153 | 2860341936 | 203 |
| 117 | iso_pu_bacteria | 2878029506 | 2878029636 | 203 |
| 118 | iso_pu_bacteria | 2880230671 | 2880236217 | 203 |
| 119 | iso_pu_bacteria | 2904518522 | 2904518734 | 203 |
| 120 | iso_pu_bacteria | 2904550169 | 2904555678 | 203 |
| 121 | iso_pu_bacteria | 2917070673 | 2917076954 | 203 |
| 122 | iso_pu_bacteria | 2919063839 | 2919068158 | 203 |
| 123 | iso_pu_bacteria | 2919385768 | 2919388975 | 203 |
| 124 | iso_pu_bacteria | 2919456309 | 2919457793 | 203 |
| 125 | iso_pu_bacteria | 2919481497 | 2919487180 | 203 |
| 126 | iso_pu_bacteria | 2919487758 | 2919487905 | 203 |
| 127 | iso_pu_bacteria | 2923586266 | 2923589398 | 203 |
| 128 | iso_pu_bacteria | 2931369376 | 2931372247 | 203 |
| 129 | iso_pu_bacteria | 2931396565 | 2931398333 | 203 |
| 130 | iso_pu_bacteria | 2939636861 | 2939640621 | 203 |
| 131 | iso_pu_bacteria | 2969304461 | 2969310434 | 203 |
| 132 | iso_pu_bacteria | 2988728565 | 2988731699 | 203 |
| 133 | iso_pu_bacteria | 3007419365 | 3007419492 | 203 |
| 134 | iso_pu_bacteria | 3007511990 | 3007517392 | 203 |
| 135 | iso_pu_bacteria | 3007614139 | 3007619293 | 203 |
| 136 | iso_pu_bacteria | 3007619802 | 3007624134 | 203 |
| 137 | iso_pu_bacteria | 3007718800 | 3007723091 | 203 |
| 138 | iso_pu_bacteria | 3007861166 | 3007864880 | 203 |
| 139 | iso_pu_bacteria | 637000220 | 637323484 | 203 |
| 140 | iso_pu_bacteria | 8056125926 | 8056126000 | 203 |
| 141 | iso_pu_bacteria | 8056155041 | 8056159962 | 203 |
| 142 | iso_pu_bacteria | 8056172158 | 8056177208 | 203 |
| 143 | iso_pu_bacteria | 8056177738 | 8056182294 | 203 |
| 144 | iso_pu_bacteria | 8056569372 | 8056570689 | 203 |
| 145 | 3300039438 | Ga0436360_1303388 | Ga0436360_1303388_168_797 | 205 |
| 146 | 2124908027 | MRS2a_Contig_41 | MRS2a_00299740 | 207 |
| 147 | 2162886007 | SwRhRL2b_contig_863144 | SwRhRL2b_0832.00004750 | 207 |
| 148 | 3300002771 | JGI25163J39215_1000536 | JGI25163J39215_10005369 | 207 |
| 149 | 3300002772 | JGI25164J39214_1000058 | JGI25164J39214_100005810 | 207 |
| 150 | 3300003214 | JGI25165J46597_1000154 | JGI25165J46597_100015410 | 207 |
| 151 | 3300003781 | Ga0055536_1000476 | Ga0055536_100047614 | 207 |
| 152 | 3300003781 | Ga0055536_1000603 | Ga0055536_100060310 | 207 |
| 153 | 3300003781 | Ga0055536_1018301 | Ga0055536_10183012 | 207 |
| 154 | 3300003791 | Ga0055530_10001077 | Ga0055530_100010779 | 207 |
| 155 | 3300003791 | Ga0055530_10019195 | Ga0055530_100191953 | 207 |
| 156 | 3300003792 | Ga0055540_1000288 | Ga0055540_100028811 | 207 |
| 157 | 3300003792 | Ga0055540_1000605 | Ga0055540_10006056 | 207 |
| 158 | 3300003794 | Ga0055531_10009540 | Ga0055531_100095401 | 207 |
| 159 | 3300003794 | Ga0055531_10056411 | Ga0055531_100564112 | 207 |
| 160 | 3300005288 | Ga0065714_10003396 | Ga0065714_100033968 | 207 |
| 161 | 3300005288 | Ga0065714_10018027 | Ga0065714_100180273 | 207 |
| 162 | 3300005288 | Ga0065714_10031771 | Ga0065714_100317712 | 207 |
| 163 | 3300005288 | Ga0065714_10064648 | Ga0065714_100646487 | 207 |
| 164 | 3300005288 | Ga0065714_10138730 | Ga0065714_101387301 | 207 |
| 165 | 3300005289 | Ga0065704_10133198 | Ga0065704_101331982 | 207 |
| 166 | 3300005293 | Ga0065715_10166688 | Ga0065715_101666882 | 207 |
| 167 | 3300005353 | Ga0070669_100003148 | Ga0070669_1000031487 | 207 |
| 168 | 3300005455 | Ga0070663_100405938 | Ga0070663_1004059381 | 207 |
| 169 | 3300005457 | Ga0070662_100016649 | Ga0070662_1000166492 | 207 |
| 170 | 3300005548 | Ga0070665_100013854 | Ga0070665_1000138544 | 207 |
| 171 | 3300006048 | Ga0075363_100194715 | Ga0075363_1001947152 | 207 |
| 172 | 3300006051 | Ga0075364_10062544 | Ga0075364_100625442 | 207 |
| 173 | 3300006051 | Ga0075364_10228013 | Ga0075364_102280132 | 207 |
| 174 | 3300006058 | Ga0075432_10032885 | Ga0075432_100328852 | 207 |
| 175 | 3300006177 | Ga0075362_10081078 | Ga0075362_100810781 | 207 |
| 176 | 3300006177 | Ga0075362_10138416 | Ga0075362_101384162 | 207 |
| 177 | 3300006946 | Ga0079104_1000262 | Ga0079104_100026210 | 207 |
| 178 | 3300006946 | Ga0079104_1003439 | Ga0079104_10034395 | 207 |
| 179 | 3300006948 | Ga0099826_10055754 | Ga0099826_100557543 | 207 |
| 180 | 3300009011 | Ga0105251_10000674 | Ga0105251_100006749 | 207 |
| 181 | 3300009011 | Ga0105251_10001737 | Ga0105251_100017377 | 207 |
| 182 | 3300009011 | Ga0105251_10005123 | Ga0105251_100051238 | 207 |
| 183 | 3300009011 | Ga0105251_10022911 | Ga0105251_100229113 | 207 |
| 184 | 3300009011 | Ga0105251_10132138 | Ga0105251_101321381 | 207 |
| 185 | 3300009011 | Ga0105251_10150882 | Ga0105251_101508821 | 207 |
| 186 | 3300009011 | Ga0105251_10177691 | Ga0105251_101776912 | 207 |
| 187 | 3300009036 | Ga0105244_10000073 | Ga0105244_1000007346 | 207 |
| 188 | 3300009036 | Ga0105244_10018244 | Ga0105244_100182442 | 207 |
| 189 | 3300009036 | Ga0105244_10018513 | Ga0105244_100185134 | 207 |
| 190 | 3300009036 | Ga0105244_10022535 | Ga0105244_100225354 | 207 |
| 191 | 3300009036 | Ga0105244_10030533 | Ga0105244_100305333 | 207 |
| 192 | 3300009036 | Ga0105244_10066299 | Ga0105244_100662993 | 207 |
| 193 | 3300009036 | Ga0105244_10088751 | Ga0105244_100887512 | 207 |
| 194 | 3300009036 | Ga0105244_10095851 | Ga0105244_100958511 | 207 |
| 195 | 3300009092 | Ga0105250_10000138 | Ga0105250_1000013843 | 207 |
| 196 | 3300009092 | Ga0105250_10000857 | Ga0105250_100008579 | 207 |
| 197 | 3300009092 | Ga0105250_10001344 | Ga0105250_100013447 | 207 |
| 198 | 3300009092 | Ga0105250_10006950 | Ga0105250_100069502 | 207 |
| 199 | 3300009092 | Ga0105250_10045949 | Ga0105250_100459492 | 207 |
| 200 | 3300009092 | Ga0105250_10151863 | Ga0105250_101518631 | 207 |
| 201 | 3300009092 | Ga0105250_10238878 | Ga0105250_102388782 | 207 |
| 202 | 3300009093 | Ga0105240_10535996 | Ga0105240_105359962 | 207 |
| 203 | 3300009101 | Ga0105247_10400651 | Ga0105247_104006511 | 207 |
| 204 | 3300009148 | Ga0105243_10000132 | Ga0105243_1000013211 | 207 |
| 205 | 3300009148 | Ga0105243_10004299 | Ga0105243_100042998 | 207 |
| 206 | 3300009148 | Ga0105243_10007452 | Ga0105243_100074522 | 207 |
| 207 | 3300009148 | Ga0105243_10008831 | Ga0105243_100088315 | 207 |
| 208 | 3300009148 | Ga0105243_10024118 | Ga0105243_100241182 | 207 |
| 209 | 3300009148 | Ga0105243_10153898 | Ga0105243_101538982 | 207 |
| 210 | 3300009148 | Ga0105243_10542952 | Ga0105243_105429521 | 207 |
| 211 | 3300009148 | Ga0105243_10638312 | Ga0105243_106383121 | 207 |
| 212 | 3300009176 | Ga0105242_10251986 | Ga0105242_102519863 | 207 |
| 213 | 3300009551 | Ga0105238_11211543 | Ga0105238_112115432 | 207 |
| 214 | 3300009553 | Ga0105249_10007738 | Ga0105249_100077382 | 207 |
| 215 | 3300011119 | Ga0105246_10001455 | Ga0105246_100014557 | 207 |
| 216 | 3300011119 | Ga0105246_10002582 | Ga0105246_100025827 | 207 |
| 217 | 3300011119 | Ga0105246_10104861 | Ga0105246_101048613 | 207 |
| 218 | 3300011119 | Ga0105246_11143202 | Ga0105246_111432021 | 207 |
| 219 | 3300012483 | Ga0157337_1000413 | Ga0157337_10004132 | 207 |
| 220 | 3300012498 | Ga0157345_1000061 | Ga0157345_10000617 | 207 |
| 221 | 3300012498 | Ga0157345_1000713 | Ga0157345_10007132 | 207 |
| 222 | 3300013100 | Ga0157373_10000959 | Ga0157373_100009599 | 207 |
| 223 | 3300013100 | Ga0157373_10001902 | Ga0157373_100019026 | 207 |
| 224 | 3300013100 | Ga0157373_10022444 | Ga0157373_100224446 | 207 |
| 225 | 3300013100 | Ga0157373_10041651 | Ga0157373_100416513 | 207 |
| 226 | 3300013100 | Ga0157373_10468615 | Ga0157373_104686152 | 207 |
| 227 | 3300013102 | Ga0157371_10001823 | Ga0157371_100018238 | 207 |
| 228 | 3300013102 | Ga0157371_10002126 | Ga0157371_1000212610 | 207 |
| 229 | 3300013102 | Ga0157371_10007445 | Ga0157371_100074455 | 207 |
| 230 | 3300013104 | Ga0157370_10006857 | Ga0157370_100068574 | 207 |
| 231 | 3300013104 | Ga0157370_10163010 | Ga0157370_101630102 | 207 |
| 232 | 3300013104 | Ga0157370_10357195 | Ga0157370_103571952 | 207 |
| 233 | 3300013104 | Ga0157370_11015388 | Ga0157370_110153881 | 207 |
| 234 | 3300013105 | Ga0157369_10002087 | Ga0157369_1000208712 | 207 |
| 235 | 3300013105 | Ga0157369_10057159 | Ga0157369_100571594 | 207 |
| 236 | 3300013105 | Ga0157369_10127023 | Ga0157369_101270234 | 207 |
| 237 | 3300013105 | Ga0157369_10699835 | Ga0157369_106998351 | 207 |
| 238 | 3300013306 | Ga0163162_10065423 | Ga0163162_100654232 | 207 |
| 239 | 3300013307 | Ga0157372_10001023 | Ga0157372_1000102310 | 207 |
| 240 | 3300013308 | Ga0157375_10598746 | Ga0157375_105987462 | 207 |
| 241 | 3300014497 | Ga0182008_10000699 | Ga0182008_100006998 | 207 |
| 242 | 3300014497 | Ga0182008_10001025 | Ga0182008_100010255 | 207 |
| 243 | 3300014497 | Ga0182008_10003284 | Ga0182008_100032842 | 207 |
| 244 | 3300014497 | Ga0182008_10004033 | Ga0182008_100040333 | 207 |
| 245 | 3300014497 | Ga0182008_10010070 | Ga0182008_100100704 | 207 |
| 246 | 3300014497 | Ga0182008_10021998 | Ga0182008_100219981 | 207 |
| 247 | 3300014497 | Ga0182008_10081961 | Ga0182008_100819612 | 207 |
| 248 | 3300015261 | Ga0182006_1001164 | Ga0182006_10011646 | 207 |
| 249 | 3300015261 | Ga0182006_1001423 | Ga0182006_10014233 | 207 |
| 250 | 3300015261 | Ga0182006_1006835 | Ga0182006_10068356 | 207 |
| 251 | 3300015261 | Ga0182006_1009181 | Ga0182006_10091813 | 207 |
| 252 | 3300015261 | Ga0182006_1019175 | Ga0182006_10191752 | 207 |
| 253 | 3300015261 | Ga0182006_1029571 | Ga0182006_10295713 | 207 |
| 254 | 3300015261 | Ga0182006_1049558 | Ga0182006_10495583 | 207 |
| 255 | 3300015262 | Ga0182007_10002451 | Ga0182007_100024513 | 207 |
| 256 | 3300015262 | Ga0182007_10110278 | Ga0182007_101102781 | 207 |
| 257 | 3300015265 | Ga0182005_1000991 | Ga0182005_10009915 | 207 |
| 258 | 3300015265 | Ga0182005_1002546 | Ga0182005_10025462 | 207 |
| 259 | 3300015265 | Ga0182005_1003025 | Ga0182005_10030252 | 207 |
| 260 | 3300015265 | Ga0182005_1024728 | Ga0182005_10247282 | 207 |
| 261 | 3300017792 | Ga0163161_10001007 | Ga0163161_1000100711 | 207 |
| 262 | 3300017792 | Ga0163161_10001974 | Ga0163161_100019744 | 207 |
| 263 | 3300017792 | Ga0163161_10025060 | Ga0163161_100250601 | 207 |
| 264 | 3300017792 | Ga0163161_10025234 | Ga0163161_100252344 | 207 |
| 265 | 3300017792 | Ga0163161_10030726 | Ga0163161_100307264 | 207 |
| 266 | 3300017792 | Ga0163161_10034086 | Ga0163161_100340862 | 207 |
| 267 | 3300017792 | Ga0163161_10742622 | Ga0163161_107426222 | 207 |
| 268 | 3300025207 | Ga0209760_100148 | Ga0209760_10014823 | 207 |
| 269 | 3300025230 | Ga0209563_100453 | Ga0209563_1004533 | 207 |
| 270 | 3300025231 | Ga0207427_100005 | Ga0207427_100005545 | 207 |
| 271 | 3300025233 | Ga0209437_100018 | Ga0209437_100018455 | 207 |
| 272 | 3300025256 | Ga0209759_1018281 | Ga0209759_10182812 | 207 |
| 273 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021545 | 207 |
| 274 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015197 | 207 |
| 275 | 3300025292 | Ga0209676_1000278 | Ga0209676_100027857 | 207 |
| 276 | 3300025292 | Ga0209676_1003102 | Ga0209676_10031024 | 207 |
| 277 | 3300025292 | Ga0209676_1004940 | Ga0209676_10049402 | 207 |
| 278 | 3300025298 | Ga0209050_1000030 | Ga0209050_1000030241 | 207 |
| 279 | 3300025298 | Ga0209050_1000061 | Ga0209050_100006170 | 207 |
| 280 | 3300025298 | Ga0209050_1003835 | Ga0209050_10038354 | 207 |
| 281 | 3300025298 | Ga0209050_1052904 | Ga0209050_10529042 | 207 |
| 282 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012482 | 207 |
| 283 | 3300025303 | Ga0209051_1000088 | Ga0209051_100008824 | 207 |
| 284 | 3300025303 | Ga0209051_1023888 | Ga0209051_10238882 | 207 |
| 285 | 3300025304 | Ga0209257_1000143 | Ga0209257_1000143115 | 207 |
| 286 | 3300025304 | Ga0209257_1037097 | Ga0209257_10370972 | 207 |
| 287 | 3300025711 | Ga0207696_1000078 | Ga0207696_100007843 | 207 |
| 288 | 3300025711 | Ga0207696_1000180 | Ga0207696_100018069 | 207 |
| 289 | 3300025711 | Ga0207696_1000184 | Ga0207696_100018410 | 207 |
| 290 | 3300025711 | Ga0207696_1000612 | Ga0207696_100061211 | 207 |
| 291 | 3300025711 | Ga0207696_1000698 | Ga0207696_10006987 | 207 |
| 292 | 3300025711 | Ga0207696_1031641 | Ga0207696_10316412 | 207 |
| 293 | 3300025711 | Ga0207696_1048095 | Ga0207696_10480952 | 207 |
| 294 | 3300025728 | Ga0207655_1000033 | Ga0207655_1000033280 | 207 |
| 295 | 3300025728 | Ga0207655_1000116 | Ga0207655_100011687 | 207 |
| 296 | 3300025728 | Ga0207655_1001603 | Ga0207655_10016037 | 207 |
| 297 | 3300025728 | Ga0207655_1001803 | Ga0207655_10018032 | 207 |
| 298 | 3300025728 | Ga0207655_1006251 | Ga0207655_10062512 | 207 |
| 299 | 3300025728 | Ga0207655_1024651 | Ga0207655_10246513 | 207 |
| 300 | 3300025728 | Ga0207655_1054218 | Ga0207655_10542182 | 207 |
| 301 | 3300025728 | Ga0207655_1058182 | Ga0207655_10581822 | 207 |
| 302 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010462 | 207 |
| 303 | 3300025735 | Ga0207713_1000961 | Ga0207713_10009617 | 207 |
| 304 | 3300025735 | Ga0207713_1001062 | Ga0207713_100106221 | 207 |
| 305 | 3300025735 | Ga0207713_1002196 | Ga0207713_10021965 | 207 |
| 306 | 3300025735 | Ga0207713_1002402 | Ga0207713_10024027 | 207 |
| 307 | 3300025735 | Ga0207713_1004217 | Ga0207713_10042173 | 207 |
| 308 | 3300025735 | Ga0207713_1008043 | Ga0207713_10080436 | 207 |
| 309 | 3300025735 | Ga0207713_1009976 | Ga0207713_10099766 | 207 |
| 310 | 3300025912 | Ga0207707_10123370 | Ga0207707_101233702 | 207 |
| 311 | 3300025912 | Ga0207707_10139388 | Ga0207707_101393882 | 207 |
| 312 | 3300025921 | Ga0207652_10067601 | Ga0207652_100676012 | 207 |
| 313 | 3300025923 | Ga0207681_10009500 | Ga0207681_100095003 | 207 |
| 314 | 3300025933 | Ga0207706_10004797 | Ga0207706_1000479710 | 207 |
| 315 | 3300025934 | Ga0207686_10137578 | Ga0207686_101375784 | 207 |
| 316 | 3300025935 | Ga0207709_10000061 | Ga0207709_1000006161 | 207 |
| 317 | 3300025935 | Ga0207709_10000063 | Ga0207709_1000006369 | 207 |
| 318 | 3300025935 | Ga0207709_10139634 | Ga0207709_101396342 | 207 |
| 319 | 3300025935 | Ga0207709_10316577 | Ga0207709_103165772 | 207 |
| 320 | 3300025961 | Ga0207712_10012351 | Ga0207712_100123514 | 207 |
| 321 | 3300026067 | Ga0207678_10667672 | Ga0207678_106676722 | 207 |
| 322 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016481 | 207 |
| 323 | 3300027111 | Ga0209281_1000091 | Ga0209281_10000913 | 207 |
| 324 | 3300027666 | Ga0209282_1044203 | Ga0209282_10442033 | 207 |
| 325 | 3300027907 | Ga0207428_10088321 | Ga0207428_100883212 | 207 |
| 326 | 3300028379 | Ga0268266_10004185 | Ga0268266_100041855 | 207 |
| 327 | 3300030521 | Ga0307511_10017143 | Ga0307511_100171433 | 207 |
| 328 | 3300030521 | Ga0307511_10160949 | Ga0307511_101609492 | 207 |
| 329 | 3300030735 | Ga0316178_1077247 | Ga0316178_10772477 | 207 |
| 330 | 3300031548 | Ga0307408_100001323 | Ga0307408_1000013235 | 207 |
| 331 | 3300031548 | Ga0307408_100002282 | Ga0307408_1000022823 | 207 |
| 332 | 3300031548 | Ga0307408_100083672 | Ga0307408_1000836724 | 207 |
| 333 | 3300031730 | Ga0307516_10129374 | Ga0307516_101293743 | 207 |
| 334 | 3300031730 | Ga0307516_10254482 | Ga0307516_102544822 | 207 |
| 335 | 3300031730 | Ga0307516_10316612 | Ga0307516_103166122 | 207 |
| 336 | 3300031731 | Ga0307405_10000143 | Ga0307405_100001439 | 207 |
| 337 | 3300031824 | Ga0307413_10209476 | Ga0307413_102094762 | 207 |
| 338 | 3300031824 | Ga0307413_10229648 | Ga0307413_102296482 | 207 |
| 339 | 3300031901 | Ga0307406_10009349 | Ga0307406_100093494 | 207 |
| 340 | 3300031901 | Ga0307406_10266698 | Ga0307406_102666983 | 207 |
| 341 | 3300031903 | Ga0307407_10046413 | Ga0307407_100464131 | 207 |
| 342 | 3300031911 | Ga0307412_10005109 | Ga0307412_100051098 | 207 |
| 343 | 3300031911 | Ga0307412_10024630 | Ga0307412_100246304 | 207 |
| 344 | 3300031911 | Ga0307412_10042733 | Ga0307412_100427331 | 207 |
| 345 | 3300031911 | Ga0307412_10167760 | Ga0307412_101677603 | 207 |
| 346 | 3300031995 | Ga0307409_100003401 | Ga0307409_1000034013 | 207 |
| 347 | 3300032002 | Ga0307416_100038540 | Ga0307416_1000385402 | 207 |
| 348 | 3300032004 | Ga0307414_10002499 | Ga0307414_100024995 | 207 |
| 349 | 3300032004 | Ga0307414_10061753 | Ga0307414_100617532 | 207 |
| 350 | 3300032004 | Ga0307414_10065522 | Ga0307414_100655222 | 207 |
| 351 | 3300032004 | Ga0307414_10087086 | Ga0307414_100870863 | 207 |
| 352 | 3300032005 | Ga0307411_10071206 | Ga0307411_100712063 | 207 |
| 353 | 3300033180 | Ga0307510_10001990 | Ga0307510_1000199012 | 207 |
| 354 | 3300038705 | Ga0237819_00815 | Ga0237819_00815_5309_5962 | 207 |
| 355 | 3300041405 | Ga0439438_000698 | Ga0439438_000698_7077_7730 | 207 |
| 356 | 3300041405 | Ga0439438_000904 | Ga0439438_000904_359_1000 | 207 |
| 357 | 3300041405 | Ga0439438_001459 | Ga0439438_001459_6811_7434 | 207 |
| 358 | 3300041405 | Ga0439438_001774 | Ga0439438_001774_773_1426 | 207 |
| 359 | 3300041405 | Ga0439438_005021 | Ga0439438_005021_3187_3810 | 207 |
| 360 | 3300041405 | Ga0439438_006414 | Ga0439438_006414_3118_3771 | 207 |
| 361 | 3300041407 | Ga0439447_000218 | Ga0439447_000218_7936_8559 | 207 |
| 362 | 3300041407 | Ga0439447_000413 | Ga0439447_000413_7104_7727 | 207 |
| 363 | 3300041407 | Ga0439447_000995 | Ga0439447_000995_7589_8242 | 207 |
| 364 | 3300041407 | Ga0439447_001822 | Ga0439447_001822_7100_7723 | 207 |
| 365 | 3300041407 | Ga0439447_002379 | Ga0439447_002379_5673_6296 | 207 |
| 366 | 3300041407 | Ga0439447_012866 | Ga0439447_012866_1656_2279 | 207 |
| 367 | 3300041407 | Ga0439447_026469 | Ga0439447_026469_194_817 | 207 |
| 368 | 3300041410 | Ga0439461_0092357 | Ga0439461_0092357_35_658 | 207 |
| 369 | 3300041411 | Ga0439466_0002737 | Ga0439466_0002737_2284_2907 | 207 |
| 370 | 3300041411 | Ga0439466_0002814 | Ga0439466_0002814_4826_5449 | 207 |
| 371 | 3300041411 | Ga0439466_0004530 | Ga0439466_0004530_398_1039 | 207 |
| 372 | 3300041411 | Ga0439466_0011984 | Ga0439466_0011984_1389_2012 | 207 |
| 373 | 3300041411 | Ga0439466_0014760 | Ga0439466_0014760_905_1558 | 207 |
| 374 | 3300041411 | Ga0439466_0019021 | Ga0439466_0019021_153_806 | 207 |
| 375 | 3300041411 | Ga0439466_0021412 | Ga0439466_0021412_1514_2137 | 207 |
| 376 | 3300041411 | Ga0439466_0025303 | Ga0439466_0025303_362_985 | 207 |
| 377 | 3300041413 | Ga0439465_0004541 | Ga0439465_0004541_3428_4051 | 207 |
| 378 | 3300041997 | Ga0439431_0053597 | Ga0439431_0053597_55_696 | 207 |
| 379 | 3300042004 | Ga0439445_0049602 | Ga0439445_0049602_399_1040 | 207 |
| 380 | 3300042004 | Ga0439445_0065947 | Ga0439445_0065947_346_969 | 207 |
| 381 | 3300042006 | Ga0439432_000241 | Ga0439432_000241_7124_7765 | 207 |
| 382 | 3300042006 | Ga0439432_002077 | Ga0439432_002077_5673_6296 | 207 |
| 383 | 3300042006 | Ga0439432_021286 | Ga0439432_021286_93_746 | 207 |
| 384 | 3300042009 | Ga0439451_002539 | Ga0439451_002539_2983_3606 | 207 |
| 385 | 3300042009 | Ga0439451_005322 | Ga0439451_005322_1780_2403 | 207 |
| 386 | 3300042010 | Ga0439452_000402 | Ga0439452_000402_6387_7010 | 207 |
| 387 | 3300042010 | Ga0439452_000459 | Ga0439452_000459_11421_12074 | 207 |
| 388 | 3300042010 | Ga0439452_001139 | Ga0439452_001139_7651_8274 | 207 |
| 389 | 3300042010 | Ga0439452_007719 | Ga0439452_007719_1180_1803 | 207 |
| 390 | 3300042010 | Ga0439452_032084 | Ga0439452_032084_287_928 | 207 |
| 391 | 3300042013 | Ga0439456_001931 | Ga0439456_001931_79_702 | 207 |
| 392 | 3300042013 | Ga0439456_005462 | Ga0439456_005462_1325_1978 | 207 |
| 393 | 3300042013 | Ga0439456_013402 | Ga0439456_013402_177_800 | 207 |
| 394 | 3300042013 | Ga0439456_027140 | Ga0439456_027140_342_965 | 207 |
| 395 | 3300042013 | Ga0439456_032977 | Ga0439456_032977_207_848 | 207 |
| 396 | 3300042016 | Ga0439463_000465 | Ga0439463_000465_8664_9287 | 207 |
| 397 | 3300042016 | Ga0439463_003225 | Ga0439463_003225_3288_3911 | 207 |
| 398 | 3300042115 | Ga0450911_000228 | Ga0450911_000228_11379_12032 | 207 |
| 399 | 3300042115 | Ga0450911_000480 | Ga0450911_000480_11477_12130 | 207 |
| 400 | 3300042115 | Ga0450911_001251 | Ga0450911_001251_4509_5132 | 207 |
| 401 | 3300042121 | Ga0450919_001557 | Ga0450919_001557_2225_2848 | 207 |
| 402 | 3300042124 | Ga0450922_001336 | Ga0450922_001336_160_783 | 207 |
| 403 | 3300042127 | Ga0450890_000187 | Ga0450890_000187_5488_6111 | 207 |
| 404 | 3300042129 | Ga0450891_000346 | Ga0450891_000346_1721_2389 | 207 |
| 405 | 3300042137 | Ga0450902_002970 | Ga0450902_002970_256_879 | 207 |
| 406 | 3300042137 | Ga0450902_012448 | Ga0450902_012448_329_952 | 207 |
| 407 | 3300042137 | Ga0450902_013025 | Ga0450902_013025_329_952 | 207 |
| 408 | 3300042137 | Ga0450902_020865 | Ga0450902_020865_349_972 | 207 |
| 409 | 3300042137 | Ga0450902_021301 | Ga0450902_021301_130_753 | 207 |
| 410 | 3300042137 | Ga0450902_022583 | Ga0450902_022583_253_876 | 207 |
| 411 | 3300042138 | Ga0450903_000418 | Ga0450903_000418_1460_2083 | 207 |
| 412 | 3300042138 | Ga0450903_001427 | Ga0450903_001427_3560_4183 | 207 |
| 413 | 3300042138 | Ga0450903_006350 | Ga0450903_006350_158_781 | 207 |
| 414 | 3300042139 | Ga0450904_004416 | Ga0450904_004416_479_1102 | 207 |
| 415 | 3300042142 | Ga0450905_007958 | Ga0450905_007958_661_1284 | 207 |
| 416 | 3300042142 | Ga0450905_012490 | Ga0450905_012490_168_791 | 207 |
| 417 | 3300042145 | Ga0450906_000070 | Ga0450906_000070_8916_9569 | 207 |
| 418 | 3300042145 | Ga0450906_000339 | Ga0450906_000339_7641_8294 | 207 |
| 419 | 3300042146 | Ga0450907_000189 | Ga0450907_000189_8437_9060 | 207 |
| 420 | 3300042146 | Ga0450907_000613 | Ga0450907_000613_6922_7575 | 207 |
| 421 | 3300042147 | Ga0450910_000383 | Ga0450910_000383_2027_2650 | 207 |
| 422 | 3300042156 | Ga0439446_0000216 | Ga0439446_0000216_4165_4797 | 207 |
| 423 | 3300042156 | Ga0439446_0002002 | Ga0439446_0002002_3381_4004 | 207 |
| 424 | 3300042156 | Ga0439446_0006086 | Ga0439446_0006086_141_764 | 207 |
| 425 | 3300042184 | Ga0450908_002191 | Ga0450908_002191_933_1556 | 207 |
| 426 | 3300042184 | Ga0450908_022608 | Ga0450908_022608_465_1088 | 207 |
| 427 | 3300042185 | Ga0450909_000428 | Ga0450909_000428_1605_2228 | 207 |
| 428 | 3300042185 | Ga0450909_001868 | Ga0450909_001868_255_878 | 207 |
| 429 | 3300042185 | Ga0450909_016251 | Ga0450909_016251_145_768 | 207 |
| 430 | 3300042435 | Ga0439434_0000252 | Ga0439434_0000252_6903_7526 | 207 |
| 431 | 3300042435 | Ga0439434_0002868 | Ga0439434_0002868_1909_2532 | 207 |
| 432 | 3300042439 | Ga0439464_0003584 | Ga0439464_0003584_2786_3409 | 207 |
| 433 | 3300042461 | Ga0439460_0000396 | Ga0439460_0000396_5754_6377 | 207 |
| 434 | 3300042461 | Ga0439460_0002073 | Ga0439460_0002073_827_1480 | 207 |
| 435 | 3300042461 | Ga0439460_0049612 | Ga0439460_0049612_403_1044 | 207 |
| 436 | 3300042531 | Ga0450918_002070 | Ga0450918_002070_659_1282 | 207 |
| 437 | 3300042531 | Ga0450918_035185 | Ga0450918_035185_170_793 | 207 |
| 438 | 3300042532 | Ga0450893_0001324 | Ga0450893_0001324_2535_3158 | 207 |
| 439 | 3300042533 | Ga0450901_001267 | Ga0450901_001267_1202_1825 | 207 |
| 440 | 3300042993 | Ga0439440_0004160 | Ga0439440_0004160_1881_2504 | 207 |
| 441 | 3300046452 | Ga0495617_000773 | Ga0495617_000773_6088_6711 | 207 |
| 442 | 3300046452 | Ga0495617_003698 | Ga0495617_003698_941_1564 | 207 |
| 443 | 3300046452 | Ga0495617_011679 | Ga0495617_011679_1566_2189 | 207 |
| 444 | 3300046452 | Ga0495617_017255 | Ga0495617_017255_99_722 | 207 |
| 445 | 3300046452 | Ga0495617_040902 | Ga0495617_040902_155_901 | 207 |
| 446 | 3300046452 | Ga0495617_043526 | Ga0495617_043526_385_1008 | 207 |
| 447 | 3300046452 | Ga0495617_139839 | Ga0495617_139839_65_688 | 207 |
| 448 | 3300046453 | Ga0495627_001303 | Ga0495627_001303_12206_12859 | 207 |
| 449 | 3300046453 | Ga0495627_001371 | Ga0495627_001371_11567_12313 | 207 |
| 450 | 3300046453 | Ga0495627_004876 | Ga0495627_004876_1673_2299 | 207 |
| 451 | 3300046453 | Ga0495627_038118 | Ga0495627_038118_515_1138 | 207 |
| 452 | 3300046453 | Ga0495627_073862 | Ga0495627_073862_270_893 | 207 |
| 453 | 3300046455 | Ga0495603_0004624 | Ga0495603_0004624_6685_7308 | 207 |
| 454 | 3300046457 | Ga0495590_0001763 | Ga0495590_0001763_832_1485 | 207 |
| 455 | 3300046457 | Ga0495590_0005614 | Ga0495590_0005614_510_1133 | 207 |
| 456 | 3300046457 | Ga0495590_0006823 | Ga0495590_0006823_49_672 | 207 |
| 457 | 3300046457 | Ga0495590_0028052 | Ga0495590_0028052_295_918 | 207 |
| 458 | 3300046457 | Ga0495590_0036714 | Ga0495590_0036714_559_1182 | 207 |
| 459 | 3300046458 | Ga0495591_000617 | Ga0495591_000617_9370_9993 | 207 |
| 460 | 3300046458 | Ga0495591_000754 | Ga0495591_000754_10958_11704 | 207 |
| 461 | 3300046458 | Ga0495591_000770 | Ga0495591_000770_11165_11818 | 207 |
| 462 | 3300046458 | Ga0495591_001717 | Ga0495591_001717_10293_10946 | 207 |
| 463 | 3300046458 | Ga0495591_002517 | Ga0495591_002517_6779_7402 | 207 |
| 464 | 3300046458 | Ga0495591_003388 | Ga0495591_003388_1007_1630 | 207 |
| 465 | 3300046458 | Ga0495591_005593 | Ga0495591_005593_4184_4807 | 207 |
| 466 | 3300046458 | Ga0495591_009920 | Ga0495591_009920_2586_3212 | 207 |
| 467 | 3300046458 | Ga0495591_011452 | Ga0495591_011452_382_1041 | 207 |
| 468 | 3300046458 | Ga0495591_025978 | Ga0495591_025978_775_1398 | 207 |
| 469 | 3300046458 | Ga0495591_041514 | Ga0495591_041514_338_961 | 207 |
| 470 | 3300046458 | Ga0495591_051357 | Ga0495591_051357_349_972 | 207 |
| 471 | 3300046459 | Ga0495629_0059385 | Ga0495629_0059385_1640_2263 | 207 |
| 472 | 3300046460 | Ga0495638_0000698 | Ga0495638_0000698_24233_24856 | 207 |
| 473 | 3300046460 | Ga0495638_0001198 | Ga0495638_0001198_9096_9749 | 207 |
| 474 | 3300046460 | Ga0495638_0002225 | Ga0495638_0002225_14679_15308 | 207 |
| 475 | 3300046460 | Ga0495638_0019430 | Ga0495638_0019430_2173_2826 | 207 |
| 476 | 3300046460 | Ga0495638_0021288 | Ga0495638_0021288_984_1607 | 207 |
| 477 | 3300046460 | Ga0495638_0023806 | Ga0495638_0023806_2456_3085 | 207 |
| 478 | 3300046460 | Ga0495638_0064840 | Ga0495638_0064840_49_672 | 207 |
| 479 | 3300046460 | Ga0495638_0129161 | Ga0495638_0129161_81_704 | 207 |
| 480 | 3300046460 | Ga0495638_0214397 | Ga0495638_0214397_291_914 | 207 |
| 481 | 3300046463 | Ga0495653_0001621 | Ga0495653_0001621_5359_6012 | 207 |
| 482 | 3300046463 | Ga0495653_0004821 | Ga0495653_0004821_2035_2658 | 207 |
| 483 | 3300046463 | Ga0495653_0325690 | Ga0495653_0325690_66_719 | 207 |
| 484 | 3300046471 | Ga0495650_0002905 | Ga0495650_0002905_11538_12161 | 207 |
| 485 | 3300046471 | Ga0495650_0003275 | Ga0495650_0003275_4387_5010 | 207 |
| 486 | 3300046471 | Ga0495650_0005040 | Ga0495650_0005040_1478_2131 | 207 |
| 487 | 3300046471 | Ga0495650_0006979 | Ga0495650_0006979_3648_4271 | 207 |
| 488 | 3300046471 | Ga0495650_0012881 | Ga0495650_0012881_756_1382 | 207 |
| 489 | 3300046471 | Ga0495650_0017643 | Ga0495650_0017643_2748_3371 | 207 |
| 490 | 3300046471 | Ga0495650_0040066 | Ga0495650_0040066_556_1302 | 207 |
| 491 | 3300046471 | Ga0495650_0058134 | Ga0495650_0058134_226_885 | 207 |
| 492 | 3300046471 | Ga0495650_0069713 | Ga0495650_0069713_260_889 | 207 |
| 493 | 3300046473 | Ga0495582_0027713 | Ga0495582_0027713_2095_2718 | 207 |
| 494 | 3300046474 | Ga0495605_0000485 | Ga0495605_0000485_18011_18637 | 207 |
| 495 | 3300046474 | Ga0495605_0000970 | Ga0495605_0000970_7324_8070 | 207 |
| 496 | 3300046474 | Ga0495605_0001636 | Ga0495605_0001636_6548_7171 | 207 |
| 497 | 3300046474 | Ga0495605_0002342 | Ga0495605_0002342_10828_11481 | 207 |
| 498 | 3300046474 | Ga0495605_0003022 | Ga0495605_0003022_2992_3615 | 207 |
| 499 | 3300046474 | Ga0495605_0014689 | Ga0495605_0014689_3583_4242 | 207 |
| 500 | 3300046474 | Ga0495605_0021015 | Ga0495605_0021015_2352_2975 | 207 |
| 501 | 3300046474 | Ga0495605_0044851 | Ga0495605_0044851_689_1312 | 207 |
| 502 | 3300046475 | Ga0495639_0001819 | Ga0495639_0001819_8536_9159 | 207 |
| 503 | 3300046475 | Ga0495639_0044282 | Ga0495639_0044282_791_1414 | 207 |
| 504 | 3300046491 | Ga0495584_0000804 | Ga0495584_0000804_8178_8801 | 207 |
| 505 | 3300046491 | Ga0495584_0001305 | Ga0495584_0001305_7655_8284 | 207 |
| 506 | 3300046491 | Ga0495584_0001792 | Ga0495584_0001792_4943_5566 | 207 |
| 507 | 3300046491 | Ga0495584_0002222 | Ga0495584_0002222_4753_5412 | 207 |
| 508 | 3300046491 | Ga0495584_0007163 | Ga0495584_0007163_2214_2843 | 207 |
| 509 | 3300046491 | Ga0495584_0009062 | Ga0495584_0009062_2693_3322 | 207 |
| 510 | 3300046491 | Ga0495584_0025515 | Ga0495584_0025515_1545_2168 | 207 |
| 511 | 3300046491 | Ga0495584_0031046 | Ga0495584_0031046_2031_2660 | 207 |
| 512 | 3300046492 | Ga0495585_0001389 | Ga0495585_0001389_6987_7646 | 207 |
| 513 | 3300046492 | Ga0495585_0001612 | Ga0495585_0001612_666_1289 | 207 |
| 514 | 3300046492 | Ga0495585_0001711 | Ga0495585_0001711_9269_9892 | 207 |
| 515 | 3300046492 | Ga0495585_0003356 | Ga0495585_0003356_703_1326 | 207 |
| 516 | 3300046492 | Ga0495585_0048829 | Ga0495585_0048829_1035_1658 | 207 |
| 517 | 3300046492 | Ga0495585_0221537 | Ga0495585_0221537_79_702 | 207 |
| 518 | 3300046499 | Ga0495594_0001003 | Ga0495594_0001003_10484_11110 | 207 |
| 519 | 3300046499 | Ga0495594_0004242 | Ga0495594_0004242_5525_6148 | 207 |
| 520 | 3300046499 | Ga0495594_0093492 | Ga0495594_0093492_298_921 | 207 |
| 521 | 3300046500 | Ga0495596_0000009 | Ga0495596_0000009_53386_54009 | 207 |
| 522 | 3300046501 | Ga0495607_0000113 | Ga0495607_0000113_50981_51604 | 207 |
| 523 | 3300046501 | Ga0495607_0000257 | Ga0495607_0000257_9617_10240 | 207 |
| 524 | 3300046501 | Ga0495607_0002320 | Ga0495607_0002320_8118_8771 | 207 |
| 525 | 3300046501 | Ga0495607_0003411 | Ga0495607_0003411_11297_11920 | 207 |
| 526 | 3300046501 | Ga0495607_0004383 | Ga0495607_0004383_2363_2986 | 207 |
| 527 | 3300046501 | Ga0495607_0007831 | Ga0495607_0007831_2218_2964 | 207 |
| 528 | 3300046501 | Ga0495607_0008187 | Ga0495607_0008187_644_1267 | 207 |
| 529 | 3300046501 | Ga0495607_0039787 | Ga0495607_0039787_980_1603 | 207 |
| 530 | 3300046501 | Ga0495607_0050421 | Ga0495607_0050421_168_809 | 207 |
| 531 | 3300046501 | Ga0495607_0090406 | Ga0495607_0090406_965_1588 | 207 |
| 532 | 3300046501 | Ga0495607_0100652 | Ga0495607_0100652_630_1253 | 207 |
| 533 | 3300046506 | Ga0495583_0000362 | Ga0495583_0000362_65261_65887 | 207 |
| 534 | 3300046506 | Ga0495583_0006903 | Ga0495583_0006903_1714_2343 | 207 |
| 535 | 3300046506 | Ga0495583_0007240 | Ga0495583_0007240_72_695 | 207 |
| 536 | 3300046506 | Ga0495583_0011515 | Ga0495583_0011515_206_847 | 207 |
| 537 | 3300046506 | Ga0495583_0044269 | Ga0495583_0044269_1417_2040 | 207 |
| 538 | 3300046506 | Ga0495583_0230444 | Ga0495583_0230444_30_653 | 207 |
| 539 | 3300046507 | Ga0495606_0003219 | Ga0495606_0003219_5460_6119 | 207 |
| 540 | 3300046507 | Ga0495606_0004373 | Ga0495606_0004373_12328_12981 | 207 |
| 541 | 3300046507 | Ga0495606_0006204 | Ga0495606_0006204_2267_2920 | 207 |
| 542 | 3300046507 | Ga0495606_0009801 | Ga0495606_0009801_7249_7980 | 207 |
| 543 | 3300046507 | Ga0495606_0022693 | Ga0495606_0022693_2179_2802 | 207 |
| 544 | 3300046507 | Ga0495606_0035883 | Ga0495606_0035883_13_636 | 207 |
| 545 | 3300046507 | Ga0495606_0372296 | Ga0495606_0372296_56_679 | 207 |
| 546 | 3300046512 | Ga0495610_0001288 | Ga0495610_0001288_16787_17518 | 207 |
| 547 | 3300046512 | Ga0495610_0003510 | Ga0495610_0003510_9258_9917 | 207 |
| 548 | 3300046512 | Ga0495610_0003640 | Ga0495610_0003640_4454_5077 | 207 |
| 549 | 3300046512 | Ga0495610_0006721 | Ga0495610_0006721_5439_6062 | 207 |
| 550 | 3300046512 | Ga0495610_0009436 | Ga0495610_0009436_3240_3893 | 207 |
| 551 | 3300046512 | Ga0495610_0011027 | Ga0495610_0011027_3980_4603 | 207 |
| 552 | 3300046512 | Ga0495610_0015974 | Ga0495610_0015974_2608_3261 | 207 |
| 553 | 3300046512 | Ga0495610_0085471 | Ga0495610_0085471_44_670 | 207 |
| 554 | 3300046512 | Ga0495610_0114087 | Ga0495610_0114087_443_1066 | 207 |
| 555 | 3300046512 | Ga0495610_0134226 | Ga0495610_0134226_153_791 | 207 |
| 556 | 3300046513 | Ga0495616_0000759 | Ga0495616_0000759_11829_12575 | 207 |
| 557 | 3300046513 | Ga0495616_0004366 | Ga0495616_0004366_1754_2383 | 207 |
| 558 | 3300046513 | Ga0495616_0005169 | Ga0495616_0005169_4883_5506 | 207 |
| 559 | 3300046513 | Ga0495616_0008750 | Ga0495616_0008750_3084_3707 | 207 |
| 560 | 3300046513 | Ga0495616_0009160 | Ga0495616_0009160_2400_3023 | 207 |
| 561 | 3300046513 | Ga0495616_0036775 | Ga0495616_0036775_673_1299 | 207 |
| 562 | 3300046513 | Ga0495616_0040971 | Ga0495616_0040971_1509_2132 | 207 |
| 563 | 3300046513 | Ga0495616_0047434 | Ga0495616_0047434_624_1247 | 207 |
| 564 | 3300046515 | Ga0495620_0000044 | Ga0495620_0000044_53073_53699 | 207 |
| 565 | 3300046515 | Ga0495620_0000847 | Ga0495620_0000847_15396_16055 | 207 |
| 566 | 3300046515 | Ga0495620_0002610 | Ga0495620_0002610_7490_8113 | 207 |
| 567 | 3300046515 | Ga0495620_0004241 | Ga0495620_0004241_1301_1954 | 207 |
| 568 | 3300046515 | Ga0495620_0025632 | Ga0495620_0025632_1109_1732 | 207 |
| 569 | 3300046515 | Ga0495620_0099525 | Ga0495620_0099525_79_708 | 207 |
| 570 | 3300046517 | Ga0495630_0004905 | Ga0495630_0004905_1921_2574 | 207 |
| 571 | 3300046517 | Ga0495630_0053976 | Ga0495630_0053976_1801_2424 | 207 |
| 572 | 3300046517 | Ga0495630_0392219 | Ga0495630_0392219_125_748 | 207 |
| 573 | 3300046518 | Ga0495631_0000613 | Ga0495631_0000613_14018_14641 | 207 |
| 574 | 3300046518 | Ga0495631_0000644 | Ga0495631_0000644_11762_12415 | 207 |
| 575 | 3300046518 | Ga0495631_0002854 | Ga0495631_0002854_1796_2419 | 207 |
| 576 | 3300046518 | Ga0495631_0003031 | Ga0495631_0003031_3899_4525 | 207 |
| 577 | 3300046518 | Ga0495631_0017266 | Ga0495631_0017266_1290_1913 | 207 |
| 578 | 3300046519 | Ga0495632_0001236 | Ga0495632_0001236_8243_8866 | 207 |
| 579 | 3300046519 | Ga0495632_0002808 | Ga0495632_0002808_4185_4844 | 207 |
| 580 | 3300046519 | Ga0495632_0002947 | Ga0495632_0002947_4950_5573 | 207 |
| 581 | 3300046519 | Ga0495632_0003223 | Ga0495632_0003223_8113_8772 | 207 |
| 582 | 3300046519 | Ga0495632_0003459 | Ga0495632_0003459_2138_2884 | 207 |
| 583 | 3300046519 | Ga0495632_0012356 | Ga0495632_0012356_481_1134 | 207 |
| 584 | 3300046519 | Ga0495632_0013823 | Ga0495632_0013823_3062_3685 | 207 |
| 585 | 3300046519 | Ga0495632_0016598 | Ga0495632_0016598_1342_1995 | 207 |
| 586 | 3300046519 | Ga0495632_0045022 | Ga0495632_0045022_915_1538 | 207 |
| 587 | 3300046519 | Ga0495632_0068398 | Ga0495632_0068398_672_1325 | 207 |
| 588 | 3300046519 | Ga0495632_0072958 | Ga0495632_0072958_29_652 | 207 |
| 589 | 3300046519 | Ga0495632_0116942 | Ga0495632_0116942_94_717 | 207 |
| 590 | 3300046520 | Ga0495637_0000930 | Ga0495637_0000930_6440_7063 | 207 |
| 591 | 3300046520 | Ga0495637_0000976 | Ga0495637_0000976_10332_10955 | 207 |
| 592 | 3300046520 | Ga0495637_0001701 | Ga0495637_0001701_1821_2480 | 207 |
| 593 | 3300046520 | Ga0495637_0002053 | Ga0495637_0002053_1559_2212 | 207 |
| 594 | 3300046520 | Ga0495637_0002305 | Ga0495637_0002305_1337_1960 | 207 |
| 595 | 3300046520 | Ga0495637_0004874 | Ga0495637_0004874_357_980 | 207 |
| 596 | 3300046520 | Ga0495637_0005270 | Ga0495637_0005270_4839_5468 | 207 |
| 597 | 3300046520 | Ga0495637_0007274 | Ga0495637_0007274_1219_1845 | 207 |
| 598 | 3300046520 | Ga0495637_0022190 | Ga0495637_0022190_2152_2775 | 207 |
| 599 | 3300046520 | Ga0495637_0023348 | Ga0495637_0023348_306_965 | 207 |
| 600 | 3300046520 | Ga0495637_0082942 | Ga0495637_0082942_231_884 | 207 |
| 601 | 3300046522 | Ga0495643_0001374 | Ga0495643_0001374_9504_10142 | 207 |
| 602 | 3300046522 | Ga0495643_0006486 | Ga0495643_0006486_4570_5208 | 207 |
| 603 | 3300046522 | Ga0495643_0007088 | Ga0495643_0007088_4254_4877 | 207 |
| 604 | 3300046522 | Ga0495643_0110285 | Ga0495643_0110285_689_1312 | 207 |
| 605 | 3300046522 | Ga0495643_0188471 | Ga0495643_0188471_22_645 | 207 |
| 606 | 3300046523 | Ga0495644_0000403 | Ga0495644_0000403_15975_16598 | 207 |
| 607 | 3300046523 | Ga0495644_0028764 | Ga0495644_0028764_955_1578 | 207 |
| 608 | 3300046523 | Ga0495644_0082461 | Ga0495644_0082461_114_737 | 207 |
| 609 | 3300046524 | Ga0495648_0002031 | Ga0495648_0002031_11729_12382 | 207 |
| 610 | 3300046524 | Ga0495648_0003053 | Ga0495648_0003053_12582_13235 | 207 |
| 611 | 3300046524 | Ga0495648_0006654 | Ga0495648_0006654_5522_6268 | 207 |
| 612 | 3300046524 | Ga0495648_0006717 | Ga0495648_0006717_7182_7805 | 207 |
| 613 | 3300046524 | Ga0495648_0012529 | Ga0495648_0012529_3400_4023 | 207 |
| 614 | 3300046524 | Ga0495648_0014511 | Ga0495648_0014511_4485_5111 | 207 |
| 615 | 3300046524 | Ga0495648_0016746 | Ga0495648_0016746_4348_5001 | 207 |
| 616 | 3300046524 | Ga0495648_0020395 | Ga0495648_0020395_2845_3498 | 207 |
| 617 | 3300046524 | Ga0495648_0029167 | Ga0495648_0029167_395_1048 | 207 |
| 618 | 3300046524 | Ga0495648_0030581 | Ga0495648_0030581_632_1291 | 207 |
| 619 | 3300046524 | Ga0495648_0034998 | Ga0495648_0034998_615_1238 | 207 |
| 620 | 3300046524 | Ga0495648_0079198 | Ga0495648_0079198_1052_1675 | 207 |
| 621 | 3300046524 | Ga0495648_0154287 | Ga0495648_0154287_104_727 | 207 |
| 622 | 3300046526 | Ga0495666_0002157 | Ga0495666_0002157_341_994 | 207 |
| 623 | 3300046526 | Ga0495666_0003124 | Ga0495666_0003124_5134_5787 | 207 |
| 624 | 3300046526 | Ga0495666_0069698 | Ga0495666_0069698_354_977 | 207 |
| 625 | 3300046526 | Ga0495666_0078780 | Ga0495666_0078780_377_1000 | 207 |
| 626 | 3300046526 | Ga0495666_0157140 | Ga0495666_0157140_120_743 | 207 |
| 627 | 3300046528 | Ga0495642_0000290 | Ga0495642_0000290_18245_18868 | 207 |
| 628 | 3300046528 | Ga0495642_0000591 | Ga0495642_0000591_13089_13742 | 207 |
| 629 | 3300046528 | Ga0495642_0002466 | Ga0495642_0002466_1942_2565 | 207 |
| 630 | 3300046529 | Ga0495652_0130975 | Ga0495652_0130975_981_1604 | 207 |
| 631 | 3300046530 | Ga0495654_0000354 | Ga0495654_0000354_20837_21583 | 207 |
| 632 | 3300046530 | Ga0495654_0001459 | Ga0495654_0001459_6200_6823 | 207 |
| 633 | 3300046530 | Ga0495654_0002728 | Ga0495654_0002728_3272_3925 | 207 |
| 634 | 3300046530 | Ga0495654_0003616 | Ga0495654_0003616_3879_4502 | 207 |
| 635 | 3300046530 | Ga0495654_0003695 | Ga0495654_0003695_2177_2800 | 207 |
| 636 | 3300046530 | Ga0495654_0004029 | Ga0495654_0004029_6830_7459 | 207 |
| 637 | 3300046530 | Ga0495654_0006729 | Ga0495654_0006729_4368_4991 | 207 |
| 638 | 3300046530 | Ga0495654_0016644 | Ga0495654_0016644_1723_2352 | 207 |
| 639 | 3300046530 | Ga0495654_0028485 | Ga0495654_0028485_955_1578 | 207 |
| 640 | 3300046530 | Ga0495654_0035307 | Ga0495654_0035307_1393_2028 | 207 |
| 641 | 3300046530 | Ga0495654_0056872 | Ga0495654_0056872_571_1194 | 207 |
| 642 | 3300046530 | Ga0495654_0122532 | Ga0495654_0122532_375_1004 | 207 |
| 643 | 3300046530 | Ga0495654_0161858 | Ga0495654_0161858_274_897 | 207 |
| 644 | 3300046535 | Ga0495586_0003371 | Ga0495586_0003371_928_1551 | 207 |
| 645 | 3300046536 | Ga0495587_0004270 | Ga0495587_0004270_1014_1637 | 207 |
| 646 | 3300046536 | Ga0495587_0010206 | Ga0495587_0010206_637_1260 | 207 |
| 647 | 3300046538 | Ga0495609_0000471 | Ga0495609_0000471_17814_18437 | 207 |
| 648 | 3300046538 | Ga0495609_0001060 | Ga0495609_0001060_18528_19154 | 207 |
| 649 | 3300046538 | Ga0495609_0002247 | Ga0495609_0002247_4553_5176 | 207 |
| 650 | 3300046538 | Ga0495609_0047615 | Ga0495609_0047615_855_1478 | 207 |
| 651 | 3300046542 | Ga0495597_0000890 | Ga0495597_0000890_12300_12953 | 207 |
| 652 | 3300046542 | Ga0495597_0003052 | Ga0495597_0003052_2585_3208 | 207 |
| 653 | 3300046542 | Ga0495597_0003491 | Ga0495597_0003491_328_987 | 207 |
| 654 | 3300046542 | Ga0495597_0003635 | Ga0495597_0003635_4168_4794 | 207 |
| 655 | 3300046542 | Ga0495597_0011363 | Ga0495597_0011363_390_1013 | 207 |
| 656 | 3300046542 | Ga0495597_0020119 | Ga0495597_0020119_2174_2797 | 207 |
| 657 | 3300046542 | Ga0495597_0026447 | Ga0495597_0026447_1390_2019 | 207 |
| 658 | 3300046542 | Ga0495597_0037109 | Ga0495597_0037109_941_1564 | 207 |
| 659 | 3300046542 | Ga0495597_0041067 | Ga0495597_0041067_647_1276 | 207 |
| 660 | 3300046543 | Ga0495645_0107979 | Ga0495645_0107979_78_701 | 207 |
| 661 | 3300046557 | Ga0495622_0000847 | Ga0495622_0000847_7390_8043 | 207 |
| 662 | 3300046557 | Ga0495622_0000869 | Ga0495622_0000869_5324_5947 | 207 |
| 663 | 3300046557 | Ga0495622_0012301 | Ga0495622_0012301_1055_1678 | 207 |
| 664 | 3300046557 | Ga0495622_0049380 | Ga0495622_0049380_274_897 | 207 |
| 665 | 3300046557 | Ga0495622_0097220 | Ga0495622_0097220_625_1248 | 207 |
| 666 | 3300046558 | Ga0495633_0000201 | Ga0495633_0000201_10624_11250 | 207 |
| 667 | 3300046558 | Ga0495633_0001196 | Ga0495633_0001196_9868_10521 | 207 |
| 668 | 3300046558 | Ga0495633_0026522 | Ga0495633_0026522_315_938 | 207 |
| 669 | 3300046558 | Ga0495633_0073975 | Ga0495633_0073975_832_1455 | 207 |
| 670 | 3300046558 | Ga0495633_0173221 | Ga0495633_0173221_183_806 | 207 |
| 671 | 3300046615 | Ga0495656_0001906 | Ga0495656_0001906_94_717 | 207 |
| 672 | 3300046615 | Ga0495656_0137486 | Ga0495656_0137486_330_953 | 207 |
| 673 | 3300046616 | Ga0495668_0001342 | Ga0495668_0001342_14896_15519 | 207 |
| 674 | 3300046616 | Ga0495668_0001843 | Ga0495668_0001843_6938_7669 | 207 |
| 675 | 3300046616 | Ga0495668_0002812 | Ga0495668_0002812_10689_11342 | 207 |
| 676 | 3300046616 | Ga0495668_0070094 | Ga0495668_0070094_1236_1859 | 207 |
| 677 | 3300046616 | Ga0495668_0220517 | Ga0495668_0220517_144_767 | 207 |
| 678 | 3300046642 | Ga0495634_0001305 | Ga0495634_0001305_10215_10838 | 207 |
| 679 | 3300046642 | Ga0495634_0037499 | Ga0495634_0037499_2381_3004 | 207 |
| 680 | 3300046648 | Ga0495611_0002642 | Ga0495611_0002642_4527_5153 | 207 |
| 681 | 3300046648 | Ga0495611_0004162 | Ga0495611_0004162_2542_3165 | 207 |
| 682 | 3300046648 | Ga0495611_0006544 | Ga0495611_0006544_832_1455 | 207 |
| 683 | 3300046648 | Ga0495611_0160407 | Ga0495611_0160407_102_725 | 207 |
| 684 | 3300046660 | Ga0495625_0003229 | Ga0495625_0003229_11587_12333 | 207 |
| 685 | 3300046660 | Ga0495625_0003768 | Ga0495625_0003768_8152_8775 | 207 |
| 686 | 3300046660 | Ga0495625_0006972 | Ga0495625_0006972_2525_3148 | 207 |
| 687 | 3300046660 | Ga0495625_0027147 | Ga0495625_0027147_392_1045 | 207 |
| 688 | 3300046660 | Ga0495625_0075275 | Ga0495625_0075275_1228_1851 | 207 |
| 689 | 3300046660 | Ga0495625_0087490 | Ga0495625_0087490_1451_2074 | 207 |
| 690 | 3300046660 | Ga0495625_0128584 | Ga0495625_0128584_86_709 | 207 |
| 691 | 3300046660 | Ga0495625_0273551 | Ga0495625_0273551_179_817 | 207 |
| 692 | 3300046660 | Ga0495625_0298689 | Ga0495625_0298689_83_706 | 207 |
| 693 | 3300046663 | Ga0495635_0000719 | Ga0495635_0000719_12230_12853 | 207 |
| 694 | 3300046664 | Ga0495659_0000494 | Ga0495659_0000494_758_1381 | 207 |
| 695 | 3300046664 | Ga0495659_0012016 | Ga0495659_0012016_669_1292 | 207 |
| 696 | 3300046665 | Ga0495661_0001174 | Ga0495661_0001174_17954_18580 | 207 |
| 697 | 3300046665 | Ga0495661_0006967 | Ga0495661_0006967_6376_6999 | 207 |
| 698 | 3300046665 | Ga0495661_0007188 | Ga0495661_0007188_5948_6571 | 207 |
| 699 | 3300046665 | Ga0495661_0017678 | Ga0495661_0017678_2252_2875 | 207 |
| 700 | 3300046665 | Ga0495661_0106356 | Ga0495661_0106356_76_729 | 207 |
| 701 | 3300046665 | Ga0495661_0153612 | Ga0495661_0153612_516_1139 | 207 |
| 702 | 3300046665 | Ga0495661_0234154 | Ga0495661_0234154_113_736 | 207 |
| 703 | 3300046674 | Ga0495588_0008565 | Ga0495588_0008565_3879_4532 | 207 |
| 704 | 3300046674 | Ga0495588_0016923 | Ga0495588_0016923_1809_2432 | 207 |
| 705 | 3300046674 | Ga0495588_0066685 | Ga0495588_0066685_793_1416 | 207 |
| 706 | 3300046678 | Ga0495599_0308262 | Ga0495599_0308262_259_882 | 207 |
| 707 | 3300046679 | Ga0495623_0003391 | Ga0495623_0003391_3144_3767 | 207 |
| 708 | 3300046680 | Ga0495646_0036530 | Ga0495646_0036530_2087_2710 | 207 |
| 709 | 3300046684 | Ga0495669_0002748 | Ga0495669_0002748_3027_3650 | 207 |
| 710 | 3300046689 | Ga0495613_0003935 | Ga0495613_0003935_1617_2240 | 207 |
| 711 | 3300046690 | Ga0495624_0001088 | Ga0495624_0001088_11780_12433 | 207 |
| 712 | 3300046691 | Ga0495670_0000448 | Ga0495670_0000448_8754_9407 | 207 |
| 713 | 3300046691 | Ga0495670_0001143 | Ga0495670_0001143_6808_7431 | 207 |
| 714 | 3300046691 | Ga0495670_0002696 | Ga0495670_0002696_2266_2889 | 207 |
| 715 | 3300046691 | Ga0495670_0023859 | Ga0495670_0023859_258_881 | 207 |
| 716 | 3300046691 | Ga0495670_0040788 | Ga0495670_0040788_489_1112 | 207 |
| 717 | 3300046691 | Ga0495670_0139157 | Ga0495670_0139157_560_1183 | 207 |
| 718 | 3300046691 | Ga0495670_0144800 | Ga0495670_0144800_542_1165 | 207 |
| 719 | 3300046691 | Ga0495670_0216661 | Ga0495670_0216661_86_712 | 207 |
| 720 | 3300046691 | Ga0495670_0289701 | Ga0495670_0289701_36_659 | 207 |
| 721 | 3300046692 | Ga0495671_0000837 | Ga0495671_0000837_7692_8315 | 207 |
| 722 | 3300046692 | Ga0495671_0001280 | Ga0495671_0001280_12025_12678 | 207 |
| 723 | 3300046692 | Ga0495671_0001795 | Ga0495671_0001795_129_752 | 207 |
| 724 | 3300046692 | Ga0495671_0002184 | Ga0495671_0002184_11509_12255 | 207 |
| 725 | 3300046692 | Ga0495671_0002267 | Ga0495671_0002267_2272_2910 | 207 |
| 726 | 3300046692 | Ga0495671_0005418 | Ga0495671_0005418_141_770 | 207 |
| 727 | 3300046692 | Ga0495671_0010789 | Ga0495671_0010789_2666_3289 | 207 |
| 728 | 3300046692 | Ga0495671_0017599 | Ga0495671_0017599_493_1116 | 207 |
| 729 | 3300046692 | Ga0495671_0073828 | Ga0495671_0073828_668_1291 | 207 |
| 730 | 3300046692 | Ga0495671_0096241 | Ga0495671_0096241_324_950 | 207 |
| 731 | 3300046692 | Ga0495671_0109725 | Ga0495671_0109725_355_978 | 207 |
| 732 | 3300046692 | Ga0495671_0125489 | Ga0495671_0125489_49_672 | 207 |
| 733 | 3300046694 | Ga0495649_0001977 | Ga0495649_0001977_821_1444 | 207 |
| 734 | 3300046694 | Ga0495649_0002048 | Ga0495649_0002048_2233_2979 | 207 |
| 735 | 3300046694 | Ga0495649_0003123 | Ga0495649_0003123_4960_5583 | 207 |
| 736 | 3300046694 | Ga0495649_0006006 | Ga0495649_0006006_6383_7006 | 207 |
| 737 | 3300046694 | Ga0495649_0006617 | Ga0495649_0006617_2791_3444 | 207 |
| 738 | 3300046694 | Ga0495649_0009826 | Ga0495649_0009826_3191_3844 | 207 |
| 739 | 3300046694 | Ga0495649_0010758 | Ga0495649_0010758_1533_2186 | 207 |
| 740 | 3300046694 | Ga0495649_0017236 | Ga0495649_0017236_604_1257 | 207 |
| 741 | 3300046694 | Ga0495649_0019793 | Ga0495649_0019793_1019_1642 | 207 |
| 742 | 3300046694 | Ga0495649_0022012 | Ga0495649_0022012_653_1306 | 207 |
| 743 | 3300046694 | Ga0495649_0039514 | Ga0495649_0039514_838_1476 | 207 |
| 744 | 3300046694 | Ga0495649_0093850 | Ga0495649_0093850_560_1183 | 207 |
| 745 | 3300046694 | Ga0495649_0224274 | Ga0495649_0224274_238_861 | 207 |
| 746 | 3300046694 | Ga0495649_0371814 | Ga0495649_0371814_38_679 | 207 |
| 747 | 3300046794 | Ga0495589_0001080 | Ga0495589_0001080_8899_9522 | 207 |
| 748 | 3300046794 | Ga0495589_0002883 | Ga0495589_0002883_5046_5672 | 207 |
| 749 | 3300046794 | Ga0495589_0006279 | Ga0495589_0006279_5061_5684 | 207 |
| 750 | 3300046794 | Ga0495589_0054060 | Ga0495589_0054060_1087_1710 | 207 |
| 751 | 3300046809 | Ga0495600_0009474 | Ga0495600_0009474_4916_5569 | 207 |
| 752 | 3300046809 | Ga0495600_0041322 | Ga0495600_0041322_830_1453 | 207 |
| 753 | 3300046809 | Ga0495600_0261871 | Ga0495600_0261871_64_717 | 207 |
| 754 | 3300046810 | Ga0495660_0001341 | Ga0495660_0001341_9521_10174 | 207 |
| 755 | 3300046810 | Ga0495660_0001625 | Ga0495660_0001625_11666_12412 | 207 |
| 756 | 3300046810 | Ga0495660_0001699 | Ga0495660_0001699_11948_12601 | 207 |
| 757 | 3300046810 | Ga0495660_0003037 | Ga0495660_0003037_810_1439 | 207 |
| 758 | 3300046810 | Ga0495660_0005433 | Ga0495660_0005433_5028_5651 | 207 |
| 759 | 3300046810 | Ga0495660_0009145 | Ga0495660_0009145_4717_5370 | 207 |
| 760 | 3300046810 | Ga0495660_0009717 | Ga0495660_0009717_1334_1987 | 207 |
| 761 | 3300046810 | Ga0495660_0030311 | Ga0495660_0030311_941_1564 | 207 |
| 762 | 3300046810 | Ga0495660_0043614 | Ga0495660_0043614_527_1153 | 207 |
| 763 | 3300046810 | Ga0495660_0068432 | Ga0495660_0068432_73_696 | 207 |
| 764 | 3300046810 | Ga0495660_0068649 | Ga0495660_0068649_244_867 | 207 |
| 765 | 3300046810 | Ga0495660_0250685 | Ga0495660_0250685_135_773 | 207 |
| 766 | 3300047315 | Ga0495581_0053772 | Ga0495581_0053772_964_1587 | 207 |
| 767 | 3300047317 | Ga0495604_0065354 | Ga0495604_0065354_884_1507 | 207 |
| 768 | 3300047317 | Ga0495604_0069564 | Ga0495604_0069564_1324_1977 | 207 |
| 769 | 3300047317 | Ga0495604_0074295 | Ga0495604_0074295_131_784 | 207 |
| 770 | 3300047318 | Ga0495636_0057945 | Ga0495636_0057945_593_1216 | 207 |
| 771 | 3300047318 | Ga0495636_0223636 | Ga0495636_0223636_81_704 | 207 |
| 772 | 3300047318 | Ga0495636_0248879 | Ga0495636_0248879_161_784 | 207 |
| 773 | 3300047319 | Ga0495674_0008413 | Ga0495674_0008413_3367_3990 | 207 |
| 774 | 3300047319 | Ga0495674_0366816 | Ga0495674_0366816_68_691 | 207 |
| 775 | 3300047320 | Ga0495672_0000143 | Ga0495672_0000143_11755_12384 | 207 |
| 776 | 3300047320 | Ga0495672_0000612 | Ga0495672_0000612_15100_15723 | 207 |
| 777 | 3300047320 | Ga0495672_0001326 | Ga0495672_0001326_12319_12972 | 207 |
| 778 | 3300047320 | Ga0495672_0001433 | Ga0495672_0001433_12977_13600 | 207 |
| 779 | 3300047320 | Ga0495672_0002425 | Ga0495672_0002425_13029_13652 | 207 |
| 780 | 3300047320 | Ga0495672_0005238 | Ga0495672_0005238_2825_3478 | 207 |
| 781 | 3300047320 | Ga0495672_0008205 | Ga0495672_0008205_2007_2630 | 207 |
| 782 | 3300047320 | Ga0495672_0018144 | Ga0495672_0018144_602_1225 | 207 |
| 783 | 3300047320 | Ga0495672_0025262 | Ga0495672_0025262_1063_1716 | 207 |
| 784 | 3300047320 | Ga0495672_0036794 | Ga0495672_0036794_1566_2219 | 207 |
| 785 | 3300047321 | Ga0495676_0001157 | Ga0495676_0001157_11456_12109 | 207 |
| 786 | 3300047322 | Ga0495680_0025037 | Ga0495680_0025037_1734_2357 | 207 |
| 787 | 3300047322 | Ga0495680_0084923 | Ga0495680_0084923_691_1344 | 207 |
| 788 | 3300047322 | Ga0495680_0160872 | Ga0495680_0160872_396_1049 | 207 |
| 789 | 3300047323 | Ga0495683_0000141 | Ga0495683_0000141_65184_65810 | 207 |
| 790 | 3300047323 | Ga0495683_0000788 | Ga0495683_0000788_13078_13701 | 207 |
| 791 | 3300047323 | Ga0495683_0002329 | Ga0495683_0002329_7026_7649 | 207 |
| 792 | 3300047323 | Ga0495683_0003010 | Ga0495683_0003010_2653_3276 | 207 |
| 793 | 3300047323 | Ga0495683_0014639 | Ga0495683_0014639_2479_3132 | 207 |
| 794 | 3300047323 | Ga0495683_0029470 | Ga0495683_0029470_653_1276 | 207 |
| 795 | 3300047323 | Ga0495683_0039248 | Ga0495683_0039248_1276_1899 | 207 |
| 796 | 3300047443 | Ga0495687_001742 | Ga0495687_001742_11261_11884 | 207 |
| 797 | 3300047443 | Ga0495687_003676 | Ga0495687_003676_3239_3892 | 207 |
| 798 | 3300047444 | Ga0495675_0054812 | Ga0495675_0054812_748_1401 | 207 |
| 799 | 3300047444 | Ga0495675_0096294 | Ga0495675_0096294_271_894 | 207 |
| 800 | 3300047444 | Ga0495675_0120676 | Ga0495675_0120676_677_1300 | 207 |
| 801 | 3300047445 | Ga0495677_0000776 | Ga0495677_0000776_11552_12175 | 207 |
| 802 | 3300047446 | Ga0495679_001299 | Ga0495679_001299_2220_2966 | 207 |
| 803 | 3300047446 | Ga0495679_002459 | Ga0495679_002459_4566_5192 | 207 |
| 804 | 3300047446 | Ga0495679_002686 | Ga0495679_002686_6975_7598 | 207 |
| 805 | 3300047446 | Ga0495679_003317 | Ga0495679_003317_7089_7742 | 207 |
| 806 | 3300047446 | Ga0495679_018611 | Ga0495679_018611_904_1527 | 207 |
| 807 | 3300047447 | Ga0495685_024540 | Ga0495685_024540_988_1611 | 207 |
| 808 | 3300047447 | Ga0495685_025297 | Ga0495685_025297_46_669 | 207 |
| 809 | 3300047469 | Ga0495673_0001105 | Ga0495673_0001105_5168_5791 | 207 |
| 810 | 3300047469 | Ga0495673_0001211 | Ga0495673_0001211_9031_9777 | 207 |
| 811 | 3300047469 | Ga0495673_0001953 | Ga0495673_0001953_11597_12220 | 207 |
| 812 | 3300047469 | Ga0495673_0002138 | Ga0495673_0002138_12337_12990 | 207 |
| 813 | 3300047469 | Ga0495673_0004438 | Ga0495673_0004438_7806_8432 | 207 |
| 814 | 3300047469 | Ga0495673_0004611 | Ga0495673_0004611_968_1591 | 207 |
| 815 | 3300047469 | Ga0495673_0005043 | Ga0495673_0005043_5132_5755 | 207 |
| 816 | 3300047469 | Ga0495673_0005123 | Ga0495673_0005123_5350_5973 | 207 |
| 817 | 3300047469 | Ga0495673_0009989 | Ga0495673_0009989_720_1343 | 207 |
| 818 | 3300047469 | Ga0495673_0036391 | Ga0495673_0036391_1180_1821 | 207 |
| 819 | 3300047469 | Ga0495673_0081790 | Ga0495673_0081790_420_1043 | 207 |
| 820 | 3300047470 | Ga0495681_0000949 | Ga0495681_0000949_12443_13066 | 207 |
| 821 | 3300047470 | Ga0495681_0005016 | Ga0495681_0005016_2054_2677 | 207 |
| 822 | 3300047470 | Ga0495681_0005762 | Ga0495681_0005762_3363_3989 | 207 |
| 823 | 3300047470 | Ga0495681_0007738 | Ga0495681_0007738_5977_6600 | 207 |
| 824 | 3300047470 | Ga0495681_0008488 | Ga0495681_0008488_5660_6283 | 207 |
| 825 | 3300047470 | Ga0495681_0010449 | Ga0495681_0010449_1610_2248 | 207 |
| 826 | 3300047470 | Ga0495681_0012034 | Ga0495681_0012034_1921_2550 | 207 |
| 827 | 3300047470 | Ga0495681_0013596 | Ga0495681_0013596_1671_2330 | 207 |
| 828 | 3300047470 | Ga0495681_0015051 | Ga0495681_0015051_3688_4317 | 207 |
| 829 | 3300047470 | Ga0495681_0078234 | Ga0495681_0078234_98_721 | 207 |
| 830 | 3300047472 | Ga0495686_0002212 | Ga0495686_0002212_6836_7495 | 207 |
| 831 | 3300047472 | Ga0495686_0003437 | Ga0495686_0003437_2222_2875 | 207 |
| 832 | 3300047472 | Ga0495686_0018619 | Ga0495686_0018619_3045_3668 | 207 |
| 833 | 3300047472 | Ga0495686_0046695 | Ga0495686_0046695_1095_1718 | 207 |
| 834 | 3300047472 | Ga0495686_0170888 | Ga0495686_0170888_150_773 | 207 |
| 835 | 3300047673 | Ga0495593_0001903 | Ga0495593_0001903_5318_5971 | 207 |
| 836 | 3300047673 | Ga0495593_0122550 | Ga0495593_0122550_477_1100 | 207 |
| 837 | 3300047673 | Ga0495593_0127412 | Ga0495593_0127412_194_817 | 207 |
| 838 | 3300047673 | Ga0495593_0196094 | Ga0495593_0196094_56_679 | 207 |
| 839 | 3300048088 | Ga0495602_0002882 | Ga0495602_0002882_5368_6021 | 207 |
| 840 | 3300048089 | Ga0495614_0062619 | Ga0495614_0062619_145_768 | 207 |
| 841 | 3300048089 | Ga0495614_0148146 | Ga0495614_0148146_284_907 | 207 |
| 842 | 3300048091 | Ga0495626_0000437 | Ga0495626_0000437_1083_1736 | 207 |
| 843 | 3300048091 | Ga0495626_0000824 | Ga0495626_0000824_21474_22133 | 207 |
| 844 | 3300048091 | Ga0495626_0001145 | Ga0495626_0001145_9588_10334 | 207 |
| 845 | 3300048091 | Ga0495626_0001360 | Ga0495626_0001360_2094_2747 | 207 |
| 846 | 3300048091 | Ga0495626_0002102 | Ga0495626_0002102_10728_11351 | 207 |
| 847 | 3300048091 | Ga0495626_0002796 | Ga0495626_0002796_9536_10189 | 207 |
| 848 | 3300048091 | Ga0495626_0003391 | Ga0495626_0003391_2792_3445 | 207 |
| 849 | 3300048091 | Ga0495626_0010816 | Ga0495626_0010816_2277_2900 | 207 |
| 850 | 3300048091 | Ga0495626_0014335 | Ga0495626_0014335_703_1326 | 207 |
| 851 | 3300048905 | Ga0496102_0001122 | Ga0496102_0001122_11549_12172 | 207 |
| 852 | 3300048906 | Ga0496103_0001780 | Ga0496103_0001780_6896_7519 | 207 |
| 853 | 3300048913 | Ga0496110_0120856 | Ga0496110_0120856_1414_2037 | 207 |
| 854 | 3300048913 | Ga0496110_0189484 | Ga0496110_0189484_1029_1652 | 207 |
| 855 | 3300048918 | Ga0496115_0204197 | Ga0496115_0204197_902_1525 | 207 |
| 856 | 3300048919 | Ga0496116_0000295 | Ga0496116_0000295_12709_13332 | 207 |
| 857 | 3300048919 | Ga0496116_0001666 | Ga0496116_0001666_10895_11548 | 207 |
| 858 | 3300048919 | Ga0496116_0004219 | Ga0496116_0004219_6468_7091 | 207 |
| 859 | 3300048919 | Ga0496116_0007393 | Ga0496116_0007393_2116_2769 | 207 |
| 860 | 3300048919 | Ga0496116_0243322 | Ga0496116_0243322_25_648 | 207 |
| 861 | 3300048920 | Ga0496117_0004224 | Ga0496117_0004224_8281_8904 | 207 |
| 862 | 3300048920 | Ga0496117_0007026 | Ga0496117_0007026_2146_2799 | 207 |
| 863 | 3300048920 | Ga0496117_0077854 | Ga0496117_0077854_926_1561 | 207 |
| 864 | 3300048920 | Ga0496117_0144314 | Ga0496117_0144314_111_734 | 207 |
| 865 | 3300048921 | Ga0496118_0005826 | Ga0496118_0005826_6716_7339 | 207 |
| 866 | 3300048921 | Ga0496118_0009592 | Ga0496118_0009592_2115_2768 | 207 |
| 867 | 3300048921 | Ga0496118_0054722 | Ga0496118_0054722_1610_2233 | 207 |
| 868 | 3300048921 | Ga0496118_0313689 | Ga0496118_0313689_105_728 | 207 |
| 869 | 3300048922 | Ga0496119_0127776 | Ga0496119_0127776_585_1208 | 207 |
| 870 | 3300048924 | Ga0496121_0003721 | Ga0496121_0003721_8110_8733 | 207 |
| 871 | 3300048924 | Ga0496121_0029975 | Ga0496121_0029975_69_692 | 207 |
| 872 | 3300048924 | Ga0496121_0037966 | Ga0496121_0037966_303_926 | 207 |
| 873 | 3300048924 | Ga0496121_0154434 | Ga0496121_0154434_602_1225 | 207 |
| 874 | 3300048925 | Ga0496122_0015065 | Ga0496122_0015065_1032_1658 | 207 |
| 875 | 3300048925 | Ga0496122_0021525 | Ga0496122_0021525_3536_4159 | 207 |
| 876 | 3300048925 | Ga0496122_0046399 | Ga0496122_0046399_800_1453 | 207 |
| 877 | 3300048926 | Ga0496123_0006939 | Ga0496123_0006939_6762_7385 | 207 |
| 878 | 3300048926 | Ga0496123_0008089 | Ga0496123_0008089_6983_7636 | 207 |
| 879 | 3300048926 | Ga0496123_0019015 | Ga0496123_0019015_3141_3794 | 207 |
| 880 | 3300048927 | Ga0496124_0005235 | Ga0496124_0005235_2681_3304 | 207 |
| 881 | 3300048927 | Ga0496124_0011129 | Ga0496124_0011129_8300_8923 | 207 |
| 882 | 3300048927 | Ga0496124_0025409 | Ga0496124_0025409_3362_4015 | 207 |
| 883 | 3300048927 | Ga0496124_0069700 | Ga0496124_0069700_1695_2333 | 207 |
| 884 | 3300048928 | Ga0496125_0004168 | Ga0496125_0004168_7890_8513 | 207 |
| 885 | 3300048928 | Ga0496125_0007935 | Ga0496125_0007935_8400_9023 | 207 |
| 886 | 3300048928 | Ga0496125_0117753 | Ga0496125_0117753_1165_1788 | 207 |
| 887 | 3300049459 | Ga0495678_000054 | Ga0495678_000054_53723_54349 | 207 |
| 888 | 3300049459 | Ga0495678_000909 | Ga0495678_000909_13004_13657 | 207 |
| 889 | 3300049459 | Ga0495678_001455 | Ga0495678_001455_6299_6922 | 207 |
| 890 | 3300049459 | Ga0495678_001993 | Ga0495678_001993_2214_2960 | 207 |
| 891 | 3300049459 | Ga0495678_002476 | Ga0495678_002476_4942_5565 | 207 |
| 892 | 3300049459 | Ga0495678_003280 | Ga0495678_003280_2247_2870 | 207 |
| 893 | 3300049459 | Ga0495678_003799 | Ga0495678_003799_7553_8176 | 207 |
| 894 | 3300049459 | Ga0495678_009422 | Ga0495678_009422_3473_4096 | 207 |
| 895 | 3300049459 | Ga0495678_012866 | Ga0495678_012866_2049_2678 | 207 |
| 896 | 3300049459 | Ga0495678_013356 | Ga0495678_013356_633_1286 | 207 |
| 897 | 3300049459 | Ga0495678_022320 | Ga0495678_022320_1509_2132 | 207 |
| 898 | 3300049459 | Ga0495678_031595 | Ga0495678_031595_492_1130 | 207 |
| 899 | 3300049459 | Ga0495678_085903 | Ga0495678_085903_297_926 | 207 |
| 900 | 3300049460 | Ga0495682_0000898 | Ga0495682_0000898_10405_11058 | 207 |
| 901 | 3300049460 | Ga0495682_0001298 | Ga0495682_0001298_11972_12595 | 207 |
| 902 | 3300049460 | Ga0495682_0001917 | Ga0495682_0001917_2323_2949 | 207 |
| 903 | 3300049460 | Ga0495682_0014363 | Ga0495682_0014363_136_789 | 207 |
| 904 | 3300049460 | Ga0495682_0032577 | Ga0495682_0032577_498_1121 | 207 |
| 905 | 3300049460 | Ga0495682_0042966 | Ga0495682_0042966_452_1075 | 207 |
| 906 | 3300049460 | Ga0495682_0044990 | Ga0495682_0044990_489_1112 | 207 |
| 907 | 3300049460 | Ga0495682_0172872 | Ga0495682_0172872_120_743 | 207 |
| 908 | 3300049758 | Ga0501241_000068 | Ga0501241_000068_12715_13338 | 207 |
| 909 | 3300049853 | Ga0501226_000008 | Ga0501226_000008_190800_191432 | 207 |
| 910 | 3300050514 | nmdc:mga08x19_33464_c1 | nmdc:mga08x19_33464_c1_198_851 | 207 |
| 911 | 3300053111 | Ga0500572_000576 | Ga0500572_000576_5000_5653 | 207 |
| 912 | 3300053140 | Ga0500573_0004190 | Ga0500573_0004190_2344_2967 | 207 |
| 913 | iso_pu_bacteria | 2511231023 | 2511367446 | 207 |
| 914 | iso_pu_bacteria | 2713897148 | 2715749614 | 207 |
| 915 | iso_pu_bacteria | 2974289157 | 2974293862 | 207 |
| 916 | iso_pu_bacteria | 2998139840 | 2998139965 | 207 |
| 917 | iso_pu_bacteria | 3007855910 | 3007859410 | 207 |
| 918 | iso_pu_bacteria | 8029995093 | 8029995288 | 207 |
| 919 | iso_pu_bacteria | 8056166840 | 8056171086 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ol5-assembly1.cif.gz_A | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.9354 | 9 | 206 |
| 2ol5-assembly1.cif.gz_B | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.9314 | 10 | 207 |
| 2ol5-assembly1.cif.gz_B | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.9266 | 10 | 207 |
| 2ol5-assembly1.cif.gz_A | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.9208 | 9 | 206 |
| 6eci-assembly4.cif.gz_G | structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis | 0.839 | 11 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PQI8_1_209_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9393 | 1 | 207 | 2.30.110.10 |
| af_A0A1D8PQI8_1_209_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.935 | 1 | 207 | 2.30.110.10 |
| 2ol5A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9216 | 9 | 207 | 2.30.110.10 |
| 2ol5A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9167 | 9 | 207 | 2.30.110.10 |
| 6eciG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.839 | 11 | 174 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J3HC60-F1-model_v4 | Transcriptional regulator | 0.9816 | 1 | 207 |
|
| AF-A0A3M5KQI1-F1-model_v4 | Negative transcriptional regulator | 0.9807 | 1 | 206 |
|
| AF-Q4K3H6-F1-model_v4 | Putative negative regulatory protein | 0.9778 | 1 | 207 |
|
| AF-A0A380SU06-F1-model_v4 | Protease synthase and sporulation protein PAI 2 | 0.9776 | 1 | 206 |
GO:0006508
GO:0008233 |
| AF-A0A0P9YDE5-F1-model_v4 | Negative transcriptional regulator | 0.9764 | 1 | 207 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar