F485642

General Info

Members Datasets Scaffolds Average Seq Length
917 309 1834 293

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10012075|Ga0265328_100120752
Length 354
Sequence VFAMSIAPPSACSIRSPISSSAPVGPVLQTSDSGIEATVKTTRCSAPTRQIRETHHNLRAQKPRSQPLRPRLLHMALDTESAEPIEEPASEAIARMKINVPVRGNRKLRTLIERVNDDKQLKAWWHVANVNAVARMQINDHSWVHIQIVTNIALKLLRQLTKHHVEPSMVRDYGMTPEDSEIVVTLAALLHDSGMSIHRHGHEDFSLFLAERKLYPLLEGIYEDPDLTVVVSEVLQAIISHRADGEPFTVEAGIIRVADALDMAKGRSRIPFQRGRVSMHSLSAAAIEDVTISDGEERPVLIEIRMNNSSGIFQVDGLLKAKLRGSGLEPYVEVVAHIDTETEQRLVPMYRLEI

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 13.2
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10012075 3300031239 Bacteria 3441
2 JGI25404J52841_10032437 3300003659 Bacteria 1114
3 Ga0065715_10260328 3300005293 Bacteria 1140
4 Ga0070658_10007594 3300005327 Bacteria 8749
5 Ga0070658_10033730 3300005327 Archaea 4119
6 Ga0070658_10130842 3300005327 Bacteria 2091
7 Ga0070658_10232977 3300005327 Bacteria 1559
8 Ga0070683_100026257 3300005329 Bacteria 5241
9 Ga0070683_100048317 3300005329 Bacteria 3934
10 Ga0070683_100166039 3300005329 Bacteria 2094
11 Ga0070683_100249105 3300005329 Archaea 1689
12 Ga0070680_100003464 3300005336 Bacteria 11780
13 Ga0070680_100016522 3300005336 Bacteria 5807
14 Ga0070680_100384835 3300005336 Viruses 1195
15 Ga0070682_100003755 3300005337 Bacteria 8441
16 Ga0070682_100027129 3300005337 Bacteria 3434
17 Ga0070682_100039992 3300005337 Bacteria 2884
18 Ga0070660_100001630 3300005339 Bacteria 15429
19 Ga0070660_100002731 3300005339 Bacteria 12123
20 Ga0070660_100004707 3300005339 Bacteria 9447
21 Ga0070660_100011736 3300005339 Bacteria 6238
22 Ga0070660_100017945 3300005339 Bacteria 5163
23 Ga0070660_100054295 3300005339 Bacteria 3094
24 Ga0070660_100065707 3300005339 Viruses 2823
25 Ga0070660_100152943 3300005339 Bacteria 1856
26 Ga0070687_100024404 3300005343 Bacteria 2887
27 Ga0070661_100010116 3300005344 Bacteria 6551
28 Ga0070661_100068683 3300005344 Viruses 2604
29 Ga0070661_100071365 3300005344 Bacteria 2555
30 Ga0070692_10025686 3300005345 Bacteria 2905
31 Ga0070668_100063497 3300005347 Bacteria 2863
32 Ga0070675_100539711 3300005354 Archaea 1054
33 Ga0070671_100030497 3300005355 Bacteria 4449
34 Ga0070674_100022155 3300005356 Bacteria 4093
35 Ga0070673_100245331 3300005364 Bacteria 1559
36 Ga0070659_100025698 3300005366 Bacteria 4526
37 Ga0070659_100072759 3300005366 Bacteria 2736
38 Ga0070659_100295804 3300005366 Bacteria 1349
39 Ga0070709_10005221 3300005434 Bacteria 7026
40 Ga0070709_10017441 3300005434 Bacteria 4118
41 Ga0070709_10154378 3300005434 Bacteria 1590
42 Ga0070714_100002238 3300005435 Bacteria 14230
43 Ga0070714_100009905 3300005435 Bacteria 7517
44 Ga0070714_100064497 3300005435 Bacteria 3153
45 Ga0070714_100094197 3300005435 Bacteria 2629
46 Ga0070714_100101647 3300005435 Unclassified 2533
47 Ga0070714_100500807 3300005435 Bacteria 1158
48 Ga0070713_100012624 3300005436 Bacteria 6206
49 Ga0070713_100390802 3300005436 Bacteria 1298
50 Ga0070713_100508487 3300005436 Archaea 1137
51 Ga0070710_10001230 3300005437 Bacteria 12145
52 Ga0070710_10041441 3300005437 Bacteria 2542
53 Ga0070711_100016549 3300005439 Bacteria 4683
54 Ga0070711_100094929 3300005439 Bacteria 2157
55 Ga0070705_100172104 3300005440 Bacteria 1458
56 Ga0070694_100041336 3300005444 Bacteria 3075
57 Ga0070708_100118648 3300005445 Bacteria 2438
58 Ga0070708_100226564 3300005445 Unclassified 1754
59 Ga0070663_100190762 3300005455 Bacteria 1595
60 Ga0070678_100181069 3300005456 Bacteria 1725
61 Ga0070662_100411418 3300005457 Bacteria 1117
62 Ga0070681_10005097 3300005458 Bacteria 12677
63 Ga0070681_10007940 3300005458 Bacteria 10385
64 Ga0070681_10018395 3300005458 Bacteria 6983
65 Ga0070681_10025692 3300005458 Bacteria 5922
66 Ga0070681_10027395 3300005458 Bacteria 5730
67 Ga0070681_10032944 3300005458 Bacteria 5201
68 Ga0070681_10037883 3300005458 Bacteria 4835
69 Ga0070681_10096500 3300005458 Bacteria 2904
70 Ga0070681_10172085 3300005458 Viruses 2087
71 Ga0070681_10263394 3300005458 Bacteria 1636
72 Ga0070681_10383842 3300005458 Bacteria 1315
73 Ga0068867_100004106 3300005459 Bacteria 10231
74 Ga0070706_100017494 3300005467 Bacteria 6616
75 Ga0070706_100098339 3300005467 Bacteria 2719
76 Ga0070706_100160223 3300005467 Archaea 2101
77 Ga0070707_100002411 3300005468 Bacteria 17834
78 Ga0070707_100005567 3300005468 Bacteria 11766
79 Ga0070707_100049896 3300005468 Bacteria 4012
80 Ga0070707_100062611 3300005468 Bacteria 3569
81 Ga0070707_100256742 3300005468 Bacteria 1701
82 Ga0070707_100308575 3300005468 Archaea 1538
83 Ga0070698_100035503 3300005471 Bacteria 5155
84 Ga0070698_100101025 3300005471 Bacteria 2856
85 Ga0070698_100382164 3300005471 Archaea 1341
86 Ga0070698_100444143 3300005471 Unclassified 1232
87 Ga0070699_100023039 3300005518 Bacteria 5365
88 Ga0070679_100005688 3300005530 Bacteria 11562
89 Ga0070679_100009583 3300005530 Bacteria 9158
90 Ga0070679_100076580 3300005530 Bacteria 3334
91 Ga0070679_100081984 3300005530 Bacteria 3215
92 Ga0070679_100087347 3300005530 Bacteria 3105
93 Ga0070679_100096791 3300005530 Bacteria 2939
94 Ga0070679_100202080 3300005530 Unclassified 1953
95 Ga0070679_100203953 3300005530 Bacteria 1942
96 Ga0070679_100394789 3300005530 Bacteria 1329
97 Ga0070684_100003268 3300005535 Bacteria 12134
98 Ga0070684_100122344 3300005535 Bacteria 2341
99 Ga0070684_100131177 3300005535 Unclassified 2261
100 Ga0070684_100237807 3300005535 Bacteria 1664
101 Ga0070697_100033386 3300005536 Bacteria 4144
102 Ga0068853_100157183 3300005539 Bacteria 2049
103 Ga0070686_100038067 3300005544 Bacteria 2987
104 Ga0070686_100234538 3300005544 Bacteria 1333
105 Ga0070695_100000510 3300005545 Bacteria 20376
106 Ga0070695_100051706 3300005545 Bacteria 2637
107 Ga0070696_100052935 3300005546 Bacteria 2825
108 Ga0070696_100261392 3300005546 Archaea 1313
109 Ga0070693_100005253 3300005547 Bacteria 6198
110 Ga0070693_100006963 3300005547 Bacteria 5501
111 Ga0070704_100006405 3300005549 Bacteria 6941
112 Ga0070704_100129434 3300005549 Bacteria 1954
113 Ga0068855_100011653 3300005563 Bacteria 10625
114 Ga0068855_100021782 3300005563 Bacteria 7687
115 Ga0068855_100062270 3300005563 Bacteria 4355
116 Ga0068855_100090875 3300005563 Bacteria 3522
117 Ga0068855_100130249 3300005563 Bacteria 2873
118 Ga0068855_100134496 3300005563 Archaea 2821
119 Ga0068855_100481412 3300005563 Bacteria 1351
120 Ga0068855_100541201 3300005563 Archaea 1261
121 Ga0068857_100014855 3300005577 Bacteria 6790
122 Ga0068857_100066973 3300005577 Bacteria 3195
123 Ga0068857_100327286 3300005577 Bacteria 1416
124 Ga0068856_100037265 3300005614 Bacteria 4771
125 Ga0068856_100051074 3300005614 Bacteria 4077
126 Ga0068856_100308920 3300005614 Bacteria 1599
127 Ga0068856_100333106 3300005614 Bacteria 1535
128 Ga0070702_100257174 3300005615 Bacteria 1187
129 Ga0068852_100157886 3300005616 Bacteria 2115
130 Ga0068866_10021370 3300005718 Bacteria 2980
131 Ga0068861_100185694 3300005719 Bacteria 1734
132 Ga0068860_100066125 3300005843 Bacteria 3434
133 Ga0081455_10002152 3300005937 Bacteria 23499
134 Ga0081455_10059491 3300005937 Bacteria 3226
135 Ga0081455_10112407 3300005937 Bacteria 2162
136 Ga0081538_10133063 3300005981 Bacteria 1164
137 Ga0081540_1002321 3300005983 Bacteria 15592
138 Ga0081540_1031707 3300005983 Bacteria 2899
139 Ga0070717_10003122 3300006028 Bacteria 11831
140 Ga0070717_10026150 3300006028 Bacteria 4653
141 Ga0070717_10032269 3300006028 Bacteria 4220
142 Ga0070717_10119304 3300006028 Bacteria 2258
143 Ga0070717_10232711 3300006028 Bacteria 1623
144 Ga0075365_10131586 3300006038 Bacteria 1731
145 Ga0070715_10004406 3300006163 Bacteria 4616
146 Ga0070712_100036398 3300006175 Bacteria 3349
147 Ga0070712_100050683 3300006175 Bacteria 2889
148 Ga0070712_100213419 3300006175 Bacteria 1523
149 Ga0097621_100089004 3300006237 Bacteria 2580
150 Ga0097621_100443267 3300006237 Bacteria 1169
151 Ga0068871_100037358 3300006358 Bacteria 3872
152 Ga0075434_100002536 3300006871 Bacteria 16113
153 Ga0075434_100016864 3300006871 Bacteria 7027
154 Ga0075434_100055625 3300006871 Bacteria 3932
155 Ga0075434_100593576 3300006871 Bacteria 1127
156 Ga0075436_100269381 3300006914 Unclassified 1216
157 Ga0075435_100002096 3300007076 Bacteria 13104
158 Ga0105240_10034877 3300009093 Bacteria 6487
159 Ga0105240_10141997 3300009093 Archaea 2870
160 Ga0105240_10287164 3300009093 Bacteria 1888
161 Ga0111539_10444035 3300009094 Bacteria 1510
162 Ga0105247_10139942 3300009101 Viruses 1585
163 Ga0114129_10060892 3300009147 Bacteria 5277
164 Ga0114129_10246271 3300009147 Bacteria 2401
165 Ga0105243_10117946 3300009148 Bacteria 2232
166 Ga0105243_10166607 3300009148 Bacteria 1905
167 Ga0105243_10170882 3300009148 Bacteria 1882
168 Ga0105243_10420326 3300009148 Bacteria 1247
169 Ga0105241_10072637 3300009174 Bacteria 2675
170 Ga0105241_10093413 3300009174 Archaea 2377
171 Ga0105242_10144414 3300009176 Bacteria 2068
172 Ga0105242_10476500 3300009176 Bacteria 1182
173 Ga0105248_10194180 3300009177 Unclassified 2287
174 Ga0105237_10106868 3300009545 Bacteria 2791
175 Ga0105237_10339998 3300009545 Bacteria 1505
176 Ga0105238_10050677 3300009551 Bacteria 4179
177 Ga0105238_10064893 3300009551 Unclassified 3652
178 Ga0105238_10075844 3300009551 Bacteria 3354
179 Ga0105238_10308217 3300009551 Bacteria 1568
180 Ga0105238_10713679 3300009551 Bacteria 1015
181 Ga0105249_10055316 3300009553 Bacteria 3629
182 Ga0105249_10185111 3300009553 Bacteria 2029
183 Ga0105239_10216351 3300010375 Bacteria 2148
184 Ga0105239_10251438 3300010375 Bacteria 1985
185 Ga0105239_10376142 3300010375 Archaea 1606
186 Ga0157373_10019632 3300013100 Bacteria 4916
187 Ga0157371_10127131 3300013102 Bacteria 1813
188 Ga0157371_10131288 3300013102 Bacteria 1782
189 Ga0157371_10141835 3300013102 Unclassified 1711
190 Ga0157370_10002167 3300013104 Bacteria 23946
191 Ga0157370_10015489 3300013104 Bacteria 7752
192 Ga0157370_10092948 3300013104 Unclassified 2831
193 Ga0157370_10110839 3300013104 Bacteria 2565
194 Ga0157370_10157426 3300013104 Bacteria 2114
195 Ga0157370_10697110 3300013104 Archaea 927
196 Ga0157369_10018636 3300013105 Archaea 7782
197 Ga0157369_10031229 3300013105 Bacteria 5868
198 Ga0157369_10222053 3300013105 Bacteria 1978
199 Ga0157369_10273664 3300013105 Bacteria 1759
200 Ga0157369_10691765 3300013105 Bacteria 1050
201 Ga0157374_10029558 3300013296 Bacteria 4965
202 Ga0157374_10074827 3300013296 Bacteria 3199
203 Ga0157374_10532763 3300013296 Bacteria 1181
204 Ga0157378_10720156 3300013297 Bacteria 1019
205 Ga0163162_10318136 3300013306 Bacteria 1689
206 Ga0157372_10310707 3300013307 Archaea 1835
207 Ga0157372_10321040 3300013307 Viruses 1803
208 Ga0157372_10430363 3300013307 Bacteria 1538
209 Ga0157375_10018482 3300013308 Bacteria 6323
210 Ga0157375_10369230 3300013308 Bacteria 1601
211 Ga0163163_10079615 3300014325 Bacteria 3275
212 Ga0163163_10474080 3300014325 Bacteria 1312
213 Ga0157380_10595221 3300014326 Bacteria 1093
214 Ga0182008_10002410 3300014497 Bacteria 11745
215 Ga0182008_10094146 3300014497 Bacteria 1478
216 Ga0157379_10351162 3300014968 Bacteria 1350
217 Ga0157379_10563606 3300014968 Bacteria 1061
218 Ga0157376_10172788 3300014969 Bacteria 1969
219 Ga0182006_1011287 3300015261 Bacteria 3937
220 Ga0197907_10431347 3300020069 Bacteria 1259
221 Ga0206356_11771762 3300020070 Bacteria 1698
222 Ga0206354_11091643 3300020081 Unclassified 2043
223 Ga0206353_10675245 3300020082 Bacteria 2361
224 Ga0206353_10803903 3300020082 Unclassified 2338
225 Ga0206353_11572253 3300020082 Bacteria 2291
226 Ga0206353_11851607 3300020082 Archaea 3674
227 Ga0213871_10011936 3300021441 Bacteria 2005
228 Ga0213871_10062398 3300021441 Unclassified 1040
229 Ga0207692_10006533 3300025898 Viruses 4732
230 Ga0207692_10019598 3300025898 Archaea 3060
231 Ga0207692_10143982 3300025898 Bacteria 1358
232 Ga0207685_10006855 3300025905 Viruses 3134
233 Ga0207699_10014422 3300025906 Bacteria 4074
234 Ga0207699_10034232 3300025906 Viruses 2879
235 Ga0207705_10075470 3300025909 Unclassified 2449
236 Ga0207684_10189848 3300025910 Bacteria 1772
237 Ga0207684_10220297 3300025910 Archaea 1638
238 Ga0207707_10002423 3300025912 Bacteria 16786
239 Ga0207707_10003146 3300025912 Bacteria 14652
240 Ga0207707_10013393 3300025912 Bacteria 7151
241 Ga0207707_10032352 3300025912 Bacteria 4578
242 Ga0207707_10034687 3300025912 Bacteria 4414
243 Ga0207707_10060152 3300025912 Bacteria 3305
244 Ga0207707_10246634 3300025912 Bacteria 1552
245 Ga0207707_10281860 3300025912 Bacteria 1439
246 Ga0207695_10026630 3300025913 Bacteria 6452
247 Ga0207695_10086973 3300025913 Archaea 3150
248 Ga0207695_10463154 3300025913 Bacteria 1151
249 Ga0207693_10000198 3300025915 Bacteria 54576
250 Ga0207693_10001236 3300025915 Bacteria 22780
251 Ga0207693_10011298 3300025915 Bacteria 7229
252 Ga0207693_10095680 3300025915 Bacteria 2328
253 Ga0207693_10166137 3300025915 Bacteria 1737
254 Ga0207693_10188926 3300025915 Bacteria 1621
255 Ga0207663_10001587 3300025916 Bacteria 10677
256 Ga0207663_10002285 3300025916 Bacteria 9179
257 Ga0207663_10012633 3300025916 Bacteria 4571
258 Ga0207663_10026765 3300025916 Bacteria 3352
259 Ga0207660_10024801 3300025917 Bacteria 4062
260 Ga0207660_10042389 3300025917 Bacteria 3195
261 Ga0207660_10339217 3300025917 Bacteria 1203
262 Ga0207657_10000729 3300025919 Bacteria 34956
263 Ga0207657_10001944 3300025919 Bacteria 22302
264 Ga0207657_10002416 3300025919 Bacteria 20175
265 Ga0207657_10002425 3300025919 Bacteria 20137
266 Ga0207657_10009726 3300025919 Bacteria 9642
267 Ga0207657_10027145 3300025919 Bacteria 5248
268 Ga0207657_10035128 3300025919 Bacteria 4498
269 Ga0207657_10037458 3300025919 Bacteria 4330
270 Ga0207657_10118803 3300025919 Bacteria 2176
271 Ga0207657_10132457 3300025919 Bacteria 2042
272 Ga0207649_10067582 3300025920 Bacteria 2270
273 Ga0207652_10020492 3300025921 Bacteria 5446
274 Ga0207652_10036464 3300025921 Bacteria 4157
275 Ga0207652_10039331 3300025921 Bacteria 4014
276 Ga0207652_10060085 3300025921 Bacteria 3278
277 Ga0207652_10094954 3300025921 Bacteria 2626
278 Ga0207652_10159514 3300025921 Bacteria 2022
279 Ga0207652_10266815 3300025921 Archaea 1544
280 Ga0207652_10357906 3300025921 Archaea 1317
281 Ga0207646_10006773 3300025922 Bacteria 11790
282 Ga0207646_10038974 3300025922 Bacteria 4277
283 Ga0207646_10171619 3300025922 Bacteria 1958
284 Ga0207687_10030229 3300025927 Bacteria 3650
285 Ga0207687_10314486 3300025927 Unclassified 1266
286 Ga0207700_10000002 3300025928 Bacteria 775978
287 Ga0207700_10008204 3300025928 Bacteria 6452
288 Ga0207700_10204248 3300025928 Bacteria 1667
289 Ga0207700_10211520 3300025928 Bacteria 1640
290 Ga0207700_10442565 3300025928 Bacteria 1144
291 Ga0207664_10004871 3300025929 Bacteria 9123
292 Ga0207664_10020692 3300025929 Bacteria 4883
293 Ga0207664_10022769 3300025929 Bacteria 4685
294 Ga0207664_10036073 3300025929 Bacteria 3819
295 Ga0207664_10054474 3300025929 Viruses 3169
296 Ga0207664_10062382 3300025929 Bacteria 2976
297 Ga0207664_10159558 3300025929 Archaea 1922
298 Ga0207664_10202970 3300025929 Bacteria 1712
299 Ga0207690_10030517 3300025932 Bacteria 3439
300 Ga0207690_10235815 3300025932 Bacteria 1407
301 Ga0207706_10005925 3300025933 Bacteria 11366
302 Ga0207686_10045997 3300025934 Bacteria 2689
303 Ga0207709_10021542 3300025935 Bacteria 3650
304 Ga0207709_10092087 3300025935 Bacteria 1984
305 Ga0207709_10125925 3300025935 Bacteria 1738
306 Ga0207704_10128909 3300025938 Bacteria 1747
307 Ga0207665_10001160 3300025939 Bacteria 17714
308 Ga0207711_10188256 3300025941 Unclassified 1880
309 Ga0207711_10242217 3300025941 Viruses 1654
310 Ga0207661_10011427 3300025944 Bacteria 6433
311 Ga0207661_10061371 3300025944 Bacteria 3037
312 Ga0207661_10120593 3300025944 Bacteria 2232
313 Ga0207661_10153665 3300025944 Bacteria 1991
314 Ga0207661_10178683 3300025944 Archaea 1852
315 Ga0207661_10353747 3300025944 Bacteria 1326
316 Ga0207667_10027332 3300025949 Bacteria 6212
317 Ga0207667_10039109 3300025949 Bacteria 5057
318 Ga0207667_10064993 3300025949 Bacteria 3807
319 Ga0207667_10110636 3300025949 Bacteria 2834
320 Ga0207667_10258340 3300025949 Bacteria 1781
321 Ga0207667_10440796 3300025949 Archaea 1324
322 Ga0207651_10311020 3300025960 Bacteria 1314
323 Ga0207668_10427865 3300025972 Bacteria 1125
324 Ga0207640_10223349 3300025981 Bacteria 1444
325 Ga0207639_10174660 3300026041 Bacteria 1823
326 Ga0207678_10019356 3300026067 Bacteria 5980
327 Ga0207678_10360103 3300026067 Bacteria 1255
328 Ga0207708_10000986 3300026075 Bacteria 21267
329 Ga0207702_10049965 3300026078 Bacteria 3530
330 Ga0207702_10060806 3300026078 Bacteria 3220
331 Ga0207702_10098734 3300026078 Bacteria 2573
332 Ga0207702_10126675 3300026078 Bacteria 2294
333 Ga0207648_10001924 3300026089 Bacteria 22696
334 Ga0207674_10006916 3300026116 Bacteria 13286
335 Ga0207674_10015274 3300026116 Bacteria 8442
336 Ga0207674_10176158 3300026116 Unclassified 2091
337 Ga0207675_100018455 3300026118 Bacteria 6506
338 Ga0207675_100383335 3300026118 Bacteria 1383
339 Ga0207683_10014165 3300026121 Bacteria 6794
340 Ga0207683_10014555 3300026121 Bacteria 6700
341 Ga0207683_10282782 3300026121 Bacteria 1516
342 Ga0207698_10046006 3300026142 Bacteria 3291
343 Ga0207698_10370521 3300026142 Bacteria 1359
344 Ga0207428_10108669 3300027907 Bacteria 2136
345 Ga0268265_10019906 3300028380 Bacteria 4675
346 Ga0265334_10006282 3300028573 Bacteria 5133
347 Ga0265318_10001740 3300028577 Bacteria 12453
348 Ga0265322_10011017 3300028654 Bacteria 2623
349 Ga0265338_10002373 3300028800 Bacteria 28401
350 Ga0265338_10004407 3300028800 Bacteria 19038
351 Ga0265338_10009073 3300028800 Bacteria 11962
352 Ga0265338_10018002 3300028800 Bacteria 7584
353 Ga0265338_10048722 3300028800 Bacteria 3851
354 Ga0265324_10009357 3300029957 Bacteria 3830
355 Ga0265330_10017276 3300031235 Bacteria 3324
356 Ga0265320_10094178 3300031240 Bacteria 1385
357 Ga0265329_10013593 3300031242 Bacteria 2898
358 Ga0265340_10052617 3300031247 Bacteria 1968
359 Ga0265339_10046083 3300031249 Bacteria 2398
360 Ga0265331_10030260 3300031250 Unclassified 2696
361 Ga0265327_10011995 3300031251 Bacteria 5899
362 Ga0265316_10034585 3300031344 Bacteria 4103
363 Ga0307408_100091832 3300031548 Bacteria 2294
364 Ga0265313_10008218 3300031595 Bacteria 6970
365 Ga0265314_10032081 3300031711 Bacteria 3869
366 Ga0265314_10035094 3300031711 Bacteria 3657
367 Ga0265342_10010109 3300031712 Bacteria 6577
368 Ga0307405_10162248 3300031731 Bacteria 1585
369 Ga0307412_10117038 3300031911 Bacteria 1913
370 Ga0307416_100304657 3300032002 Bacteria 1586
371 Ga0307416_100824550 3300032002 Bacteria 1024
372 Ga0307415_100257229 3300032126 Bacteria 1422
373 Ga0373930_0019613 3300034816 Bacteria 1310
374 Ga0373938_0033567 3300034957 Bacteria 1111
375 Ga0373926_0097929 3300035083 Bacteria 1095
376 Ga0373929_0031673 3300035085 Unclassified 1134
377 Ga0373949_0009300 3300035090 Bacteria 2153
378 Ga0373936_0003528 3300035113 Bacteria 5884
379 Ga0373945_0012094 3300035116 Bacteria 2862
380 Ga0373945_0038516 3300035116 Bacteria 1720
381 Ga0373943_0008261 3300035170 Bacteria 4671
382 Ga0373943_0010211 3300035170 Bacteria 4210
383 Ga0373943_0079290 3300035170 Bacteria 1680
384 Ga0373946_0116190 3300035171 Archaea 1217
385 Ga0373955_0011626 3300035172 Bacteria 4204
386 Ga0373931_0043647 3300035691 Bacteria 2362
387 Ga0373931_0327906 3300035691 Bacteria 953
388 Ga0373935_0019055 3300035692 Bacteria 4185
389 Ga0373935_0026168 3300035692 Bacteria 3599
390 Ga0373927_0224198 3300035695 Archaea 1235
391 Ga0373927_0232868 3300035695 Bacteria 1210
392 Ga0373933_0210488 3300035724 Unclassified 1246
393 Ga0373947_0007236 3300035725 Bacteria 6432
394 Ga0373947_0027357 3300035725 Bacteria 3337
395 Ga0373947_0175565 3300035725 Bacteria 1392
396 Ga0373937_0002702 3300036401 Bacteria 14815
397 Ga0373937_0013631 3300036401 Bacteria 7162
398 Ga0373925_0000887 3300037068 Bacteria 27335
399 Ga0373925_0048940 3300037068 Bacteria 3150
400 Ga0373925_0423318 3300037068 Archaea 1088
401 Ga0395899_0006493 3300037312 Bacteria 9062
402 Ga0395899_0027720 3300037312 Bacteria 4268
403 Ga0395899_0038289 3300037312 Bacteria 3592
404 Ga0395899_0065796 3300037312 Archaea 2663
405 Ga0395899_0097873 3300037312 Bacteria 2120
406 Ga0395899_0115847 3300037312 Bacteria 1923
407 Ga0395899_0137982 3300037312 Bacteria 1737
408 Ga0395899_0203010 3300037312 Bacteria 1381
409 Ga0395900_0003003 3300037418 Bacteria 18348
410 Ga0395900_0005192 3300037418 Bacteria 13669
411 Ga0395900_0010314 3300037418 Bacteria 9559
412 Ga0395900_0025691 3300037418 Bacteria 6029
413 Ga0395900_0047346 3300037418 Bacteria 4427
414 Ga0395900_0054811 3300037418 Bacteria 4105
415 Ga0395900_0058822 3300037418 Bacteria 3957
416 Ga0395900_0084378 3300037418 Bacteria 3264
417 Ga0395900_0102560 3300037418 Bacteria 2939
418 Ga0395900_0117441 3300037418 Bacteria 2729
419 Ga0395900_0119574 3300037418 Bacteria 2704
420 Ga0395900_0190422 3300037418 Bacteria 2081
421 Ga0395900_0200708 3300037418 Bacteria 2018
422 Ga0395900_0201288 3300037418 Bacteria 2014
423 Ga0395900_0250774 3300037418 Unclassified 1771
424 Ga0395900_0254807 3300037418 Bacteria 1755
425 Ga0395900_0364211 3300037418 Unclassified 1416
426 Ga0395900_0397301 3300037418 Archaea 1343
427 Ga0395900_0522844 3300037418 Bacteria 1134
428 Ga0395898_0002500 3300037466 Bacteria 21621
429 Ga0395898_0005115 3300037466 Bacteria 14209
430 Ga0395898_0005507 3300037466 Bacteria 13664
431 Ga0395898_0006288 3300037466 Bacteria 12694
432 Ga0395898_0006891 3300037466 Bacteria 12089
433 Ga0395898_0007490 3300037466 Bacteria 11594
434 Ga0395898_0010056 3300037466 Bacteria 9901
435 Ga0395898_0010259 3300037466 Bacteria 9805
436 Ga0395898_0038193 3300037466 Bacteria 4760
437 Ga0395898_0054599 3300037466 Bacteria 3898
438 Ga0395898_0094559 3300037466 Bacteria 2872
439 Ga0395898_0141984 3300037466 Bacteria 2299
440 Ga0395898_0206992 3300037466 Bacteria 1872
441 Ga0395898_0334317 3300037466 Unclassified 1444
442 Ga0395898_0349251 3300037466 Unclassified 1410
443 Ga0395898_0380825 3300037466 Unclassified 1345
444 Ga0395905_0004014 3300037471 Bacteria 15465
445 Ga0395905_0004601 3300037471 Bacteria 14273
446 Ga0395905_0015855 3300037471 Bacteria 7158
447 Ga0395905_0029709 3300037471 Bacteria 5151
448 Ga0395905_0057057 3300037471 Bacteria 3652
449 Ga0395905_0065671 3300037471 Unclassified 3397
450 Ga0395905_0099535 3300037471 Bacteria 2730
451 Ga0395905_0105216 3300037471 Bacteria 2650
452 Ga0395905_0121863 3300037471 Bacteria 2452
453 Ga0395905_0125610 3300037471 Bacteria 2412
454 Ga0395905_0206378 3300037471 Bacteria 1841
455 Ga0395905_0239553 3300037471 Unclassified 1695
456 Ga0395901_0001290 3300038443 Bacteria 26488
457 Ga0395901_0005511 3300038443 Bacteria 12819
458 Ga0395901_0008519 3300038443 Bacteria 10359
459 Ga0395901_0009578 3300038443 Bacteria 9830
460 Ga0395901_0010572 3300038443 Bacteria 9349
461 Ga0395901_0045077 3300038443 Bacteria 4575
462 Ga0395901_0052258 3300038443 Bacteria 4246
463 Ga0395901_0053403 3300038443 Bacteria 4198
464 Ga0395901_0058631 3300038443 Bacteria 4004
465 Ga0395901_0062351 3300038443 Bacteria 3880
466 Ga0395901_0103279 3300038443 Bacteria 2991
467 Ga0395901_0144857 3300038443 Bacteria 2497
468 Ga0395901_0207421 3300038443 Viruses 2052
469 Ga0395901_0270849 3300038443 Bacteria 1766
470 Ga0395901_0306311 3300038443 Unclassified 1646
471 Ga0395901_0346725 3300038443 Bacteria 1533
472 Ga0395901_0385656 3300038443 Unclassified 1441
473 Ga0395901_0398818 3300038443 Bacteria 1413
474 Ga0395901_0411670 3300038443 Bacteria 1388
475 Ga0436365_1635017 3300039437 Bacteria 1387
476 Ga0436360_0675505 3300039438 Bacteria 9468
477 Ga0436363_1405693 3300039450 Bacteria 2236
478 Ga0436362_0654759 3300039453 Bacteria 5854
479 Ga0439448_0031201 3300042005 Bacteria 1692
480 Ga0466969_0008928 3300044656 Bacteria 5317
481 Ga0466966_0008382 3300044684 Bacteria 6846
482 Ga0466966_0021106 3300044684 Bacteria 4277
483 Ga0466966_0043266 3300044684 Bacteria 2888
484 Ga0466961_0009165 3300044693 Bacteria 6302
485 Ga0466961_0010210 3300044693 Bacteria 5981
486 Ga0466961_0018116 3300044693 Bacteria 4528
487 Ga0466961_0018402 3300044693 Bacteria 4493
488 Ga0466961_0053370 3300044693 Bacteria 2579
489 Ga0466961_0072893 3300044693 Bacteria 2178
490 Ga0466963_0000245 3300044694 Bacteria 23656
491 Ga0466963_0001068 3300044694 Bacteria 14284
492 Ga0466963_0001151 3300044694 Bacteria 13860
493 Ga0466963_0001242 3300044694 Bacteria 13478
494 Ga0466963_0001451 3300044694 Bacteria 12777
495 Ga0466963_0003886 3300044694 Bacteria 8629
496 Ga0466963_0008385 3300044694 Bacteria 6193
497 Ga0466963_0011379 3300044694 Bacteria 5417
498 Ga0466963_0017456 3300044694 Viruses 4474
499 Ga0466963_0029728 3300044694 Bacteria 3520
500 Ga0466963_0042163 3300044694 Bacteria 2995
501 Ga0466963_0042817 3300044694 Bacteria 2974
502 Ga0466963_0045142 3300044694 Bacteria 2902
503 Ga0466963_0057870 3300044694 Bacteria 2582
504 Ga0466963_0059378 3300044694 Bacteria 2552
505 Ga0466963_0066958 3300044694 Unclassified 2410
506 Ga0466963_0082539 3300044694 Bacteria 2179
507 Ga0466963_0094190 3300044694 Bacteria 2042
508 Ga0466964_0001695 3300044706 Bacteria 7611
509 Ga0466964_0004325 3300044706 Bacteria 5235
510 Ga0466964_0010161 3300044706 Bacteria 3548
511 Ga0466964_0012649 3300044706 Bacteria 3196
512 Ga0466964_0062957 3300044706 Bacteria 1548
513 Ga0466971_0005705 3300044719 Bacteria 5411
514 Ga0466971_0010690 3300044719 Bacteria 4015
515 Ga0466971_0034164 3300044719 Bacteria 2279
516 Ga0466971_0081283 3300044719 Viruses 1478
517 Ga0466968_0001438 3300044735 Bacteria 8548
518 Ga0466968_0029908 3300044735 Bacteria 2254
519 Ga0466968_0072405 3300044735 Bacteria 1502
520 Ga0466970_0015231 3300044765 Bacteria 3954
521 Ga0466957_0002511 3300044842 Bacteria 9872
522 Ga0466957_0014263 3300044842 Bacteria 4627
523 Ga0466957_0027826 3300044842 Bacteria 3361
524 Ga0466957_0035546 3300044842 Bacteria 2989
525 Ga0466957_0038111 3300044842 Bacteria 2896
526 Ga0466957_0045409 3300044842 Unclassified 2665
527 Ga0466957_0083971 3300044842 Bacteria 1987
528 Ga0466957_0095459 3300044842 Viruses 1867
529 Ga0466957_0109690 3300044842 Archaea 1749
530 Ga0466957_0155258 3300044842 Bacteria 1483
531 Ga0466957_0199053 3300044842 Bacteria 1315
532 Ga0466960_0003215 3300044901 Bacteria 6264
533 Ga0466960_0059436 3300044901 Bacteria 1870
534 Ga0466960_0129013 3300044901 Archaea 1333
535 Ga0466959_0001526 3300045049 Bacteria 14224
536 Ga0466959_0002072 3300045049 Bacteria 12682
537 Ga0466959_0008410 3300045049 Bacteria 7295
538 Ga0466959_0018997 3300045049 Bacteria 5051
539 Ga0466959_0063654 3300045049 Bacteria 2678
540 Ga0466959_0096284 3300045049 Bacteria 2122
541 Ga0466959_0128691 3300045049 Bacteria 1795
542 Ga0466959_0199493 3300045049 Unclassified 1393
543 Ga0451576_0210932 3300045051 Archaea 2028
544 Ga0466958_0000293 3300045836 Bacteria 19554
545 Ga0466958_0001578 3300045836 Bacteria 10944
546 Ga0466958_0007797 3300045836 Bacteria 5910
547 Ga0466958_0015674 3300045836 Bacteria 4349
548 Ga0466958_0022876 3300045836 Bacteria 3664
549 Ga0466958_0032844 3300045836 Bacteria 3089
550 Ga0466958_0064173 3300045836 Bacteria 2239
551 Ga0466958_0109648 3300045836 Unclassified 1722
552 Ga0466958_0144413 3300045836 Archaea 1499
553 Ga0466967_0000437 3300045976 Bacteria 19918
554 Ga0466967_0000541 3300045976 Bacteria 18349
555 Ga0466967_0003389 3300045976 Bacteria 10387
556 Ga0466967_0004389 3300045976 Bacteria 9499
557 Ga0466967_0005119 3300045976 Bacteria 9010
558 Ga0466967_0013571 3300045976 Bacteria 6302
559 Ga0466967_0037927 3300045976 Bacteria 4129
560 Ga0466967_0039356 3300045976 Bacteria 4064
561 Ga0466967_0041592 3300045976 Bacteria 3964
562 Ga0466967_0047619 3300045976 Bacteria 3738
563 Ga0466967_0049017 3300045976 Bacteria 3692
564 Ga0466967_0049174 3300045976 Viruses 3686
565 Ga0466967_0056164 3300045976 Bacteria 3471
566 Ga0466967_0058837 3300045976 Unclassified 3398
567 Ga0466967_0060951 3300045976 Bacteria 3346
568 Ga0466967_0064542 3300045976 Bacteria 3256
569 Ga0466967_0071757 3300045976 Bacteria 3101
570 Ga0466967_0084621 3300045976 Bacteria 2870
571 Ga0466967_0087305 3300045976 Bacteria 2827
572 Ga0466967_0094002 3300045976 Unclassified 2729
573 Ga0466967_0099522 3300045976 Viruses 2656
574 Ga0466967_0134523 3300045976 Viruses 2298
575 Ga0466967_0145460 3300045976 Bacteria 2211
576 Ga0466967_0223462 3300045976 Unclassified 1790
577 Ga0466967_0234398 3300045976 Bacteria 1748
578 Ga0466967_0237964 3300045976 Viruses 1735
579 Ga0466967_0243357 3300045976 Unclassified 1716
580 Ga0466967_0264775 3300045976 Bacteria 1645
581 Ga0466967_0288331 3300045976 Bacteria 1576
582 Ga0466967_0404560 3300045976 Bacteria 1328
583 Ga0495592_0000708 3300046454 Bacteria 23320
584 Ga0495592_0026688 3300046454 Bacteria 4378
585 Ga0495592_0105501 3300046454 Bacteria 2002
586 Ga0495603_0018073 3300046455 Bacteria 4265
587 Ga0495629_0017075 3300046459 Bacteria 5206
588 Ga0495629_0017103 3300046459 Bacteria 5200
589 Ga0495641_0008385 3300046461 Bacteria 6314
590 Ga0495641_0046512 3300046461 Bacteria 1995
591 Ga0495641_0077799 3300046461 Bacteria 1487
592 Ga0495651_0000885 3300046462 Bacteria 23327
593 Ga0495651_0056069 3300046462 Unclassified 3027
594 Ga0495651_0085349 3300046462 Bacteria 2377
595 Ga0495651_0099755 3300046462 Unclassified 2165
596 Ga0495653_0013755 3300046463 Bacteria 6594
597 Ga0495653_0085691 3300046463 Unclassified 2317
598 Ga0495653_0098388 3300046463 Unclassified 2124
599 Ga0495580_0120453 3300046472 Bacteria 1822
600 Ga0495580_0238023 3300046472 Bacteria 1249
601 Ga0495582_0059207 3300046473 Archaea 2113
602 Ga0495582_0175063 3300046473 Bacteria 1222
603 Ga0495639_0000458 3300046475 Bacteria 19373
604 Ga0495662_0000722 3300046476 Bacteria 15787
605 Ga0495664_0193757 3300046477 Unclassified 1232
606 Ga0495584_0080912 3300046491 Bacteria 1635
607 Ga0495585_0142547 3300046492 Bacteria 1254
608 Ga0495596_0037409 3300046500 Bacteria 1919
609 Ga0495607_0011635 3300046501 Bacteria 5848
610 Ga0495608_0004093 3300046511 Bacteria 10458
611 Ga0495608_0005519 3300046511 Bacteria 9032
612 Ga0495608_0028281 3300046511 Bacteria 3810
613 Ga0495608_0269519 3300046511 Bacteria 1059
614 Ga0495618_0027065 3300046514 Bacteria 3569
615 Ga0495618_0074647 3300046514 Bacteria 2159
616 Ga0495618_0223125 3300046514 Bacteria 1188
617 Ga0495628_0001243 3300046516 Bacteria 23312
618 Ga0495628_0115734 3300046516 Bacteria 2059
619 Ga0495630_0011609 3300046517 Bacteria 6382
620 Ga0495630_0034757 3300046517 Bacteria 3765
621 Ga0495663_0003333 3300046525 Bacteria 4651
622 Ga0495666_0000065 3300046526 Bacteria 40921
623 Ga0495652_0010178 3300046529 Bacteria 8523
624 Ga0495652_0084219 3300046529 Unclassified 2615
625 Ga0495652_0210647 3300046529 Bacteria 1467
626 Ga0495652_0235303 3300046529 Bacteria 1367
627 Ga0495665_0005926 3300046531 Bacteria 6582
628 Ga0495665_0152516 3300046531 Bacteria 1206
629 Ga0495640_0002040 3300046533 Bacteria 16099
630 Ga0495640_0083800 3300046533 Bacteria 2115
631 Ga0495640_0100616 3300046533 Viruses 1898
632 Ga0495586_0007245 3300046535 Bacteria 5920
633 Ga0495586_0178990 3300046535 Bacteria 1199
634 Ga0495586_0205037 3300046535 Bacteria 1118
635 Ga0495587_0000675 3300046536 Bacteria 22859
636 Ga0495587_0006475 3300046536 Bacteria 7628
637 Ga0495645_0000684 3300046543 Bacteria 23313
638 Ga0495667_0004970 3300046559 Bacteria 8990
639 Ga0495667_0073259 3300046559 Viruses 2231
640 Ga0495667_0090422 3300046559 Bacteria 1983
641 Ga0495667_0138581 3300046559 Bacteria 1568
642 Ga0495667_0334725 3300046559 Bacteria 957
643 Ga0495656_0107032 3300046615 Bacteria 1302
644 Ga0495668_0144295 3300046616 Bacteria 1303
645 Ga0495634_0019011 3300046642 Bacteria 4884
646 Ga0495634_0060069 3300046642 Bacteria 2530
647 Ga0495634_0107634 3300046642 Bacteria 1795
648 Ga0495634_0157625 3300046642 Bacteria 1433
649 Ga0495635_0026093 3300046663 Bacteria 4069
650 Ga0495635_0070147 3300046663 Viruses 2402
651 Ga0495635_0091826 3300046663 Bacteria 2076
652 Ga0495635_0113655 3300046663 Bacteria 1848
653 Ga0495659_0040567 3300046664 Bacteria 1660
654 Ga0495657_0020319 3300046675 Bacteria 4775
655 Ga0495657_0067092 3300046675 Bacteria 2356
656 Ga0495657_0072893 3300046675 Bacteria 2238
657 Ga0495599_0000455 3300046678 Bacteria 23331
658 Ga0495599_0001792 3300046678 Bacteria 12462
659 Ga0495599_0136555 3300046678 Bacteria 1522
660 Ga0495599_0200681 3300046678 Viruses 1225
661 Ga0495623_0001619 3300046679 Bacteria 15128
662 Ga0495623_0099594 3300046679 Bacteria 1772
663 Ga0495646_0015915 3300046680 Bacteria 4773
664 Ga0495646_0172189 3300046680 Viruses 1192
665 Ga0495646_0195507 3300046680 Bacteria 1103
666 Ga0495647_0000075 3300046681 Bacteria 23932
667 Ga0495658_0003735 3300046683 Bacteria 7531
668 Ga0495658_0038841 3300046683 Bacteria 2637
669 Ga0495613_0013358 3300046689 Bacteria 6099
670 Ga0495613_0093119 3300046689 Bacteria 2182
671 Ga0495613_0119063 3300046689 Bacteria 1897
672 Ga0495613_0234524 3300046689 Bacteria 1284
673 Ga0495624_0014761 3300046690 Bacteria 5289
674 Ga0495624_0029796 3300046690 Bacteria 3558
675 Ga0495624_0129901 3300046690 Archaea 1545
676 Ga0495624_0131165 3300046690 Bacteria 1536
677 Ga0495670_0074045 3300046691 Bacteria 1727
678 Ga0495600_0018065 3300046809 Bacteria 4490
679 Ga0495600_0059255 3300046809 Unclassified 2501
680 Ga0495604_0001028 3300047317 Bacteria 23261
681 Ga0495604_0003434 3300047317 Bacteria 12641
682 Ga0495674_0058142 3300047319 Bacteria 3382
683 Ga0495674_0162234 3300047319 Viruses 1869
684 Ga0495674_0192570 3300047319 Bacteria 1694
685 Ga0495674_0373137 3300047319 Viruses 1155
686 Ga0495676_0044046 3300047321 Bacteria 3646
687 Ga0495676_0096118 3300047321 Unclassified 2203
688 Ga0495680_0001991 3300047322 Bacteria 21455
689 Ga0495680_0020713 3300047322 Bacteria 5523
690 Ga0495680_0023772 3300047322 Bacteria 5093
691 Ga0495680_0026531 3300047322 Bacteria 4774
692 Ga0495680_0154823 3300047322 Bacteria 1668
693 Ga0495680_0165988 3300047322 Unclassified 1601
694 Ga0495675_0000592 3300047444 Bacteria 23327
695 Ga0495675_0065278 3300047444 Bacteria 2302
696 Ga0495685_061193 3300047447 Bacteria 1269
697 Ga0495684_0018793 3300047471 Bacteria 5325
698 Ga0495684_0050383 3300047471 Bacteria 3180
699 Ga0495593_0000573 3300047673 Bacteria 20898
700 Ga0495602_0001484 3300048088 Bacteria 23328
701 Ga0495602_0092325 3300048088 Unclassified 2508
702 Ga0495602_0248430 3300048088 Viruses 1327
703 Ga0495602_0250110 3300048088 Bacteria 1321
704 Ga0495614_0028764 3300048089 Bacteria 2392
705 Ga0495614_0038884 3300048089 Bacteria 2042
706 Ga0496100_0011890 3300048903 Bacteria 4970
707 Ga0496100_0032173 3300048903 Bacteria 3267
708 Ga0496100_0040168 3300048903 Bacteria 2975
709 Ga0496100_0310071 3300048903 Bacteria 1183
710 Ga0496100_0356743 3300048903 Bacteria 1105
711 Ga0496100_0375180 3300048903 Bacteria 1079
712 Ga0496101_0004111 3300048904 Bacteria 9108
713 Ga0496101_0035348 3300048904 Viruses 3534
714 Ga0496101_0040080 3300048904 Bacteria 3335
715 Ga0496101_0046867 3300048904 Bacteria 3101
716 Ga0496101_0051260 3300048904 Bacteria 2973
717 Ga0496101_0051470 3300048904 Bacteria 2968
718 Ga0496101_0083944 3300048904 Bacteria 2358
719 Ga0496101_0098855 3300048904 Archaea 2181
720 Ga0496101_0231828 3300048904 Bacteria 1435
721 Ga0496101_0247516 3300048904 Archaea 1388
722 Ga0496102_0004397 3300048905 Bacteria 11907
723 Ga0496102_0009170 3300048905 Bacteria 8490
724 Ga0496102_0215117 3300048905 Bacteria 1811
725 Ga0496102_0293871 3300048905 Archaea 1531
726 Ga0496103_0010455 3300048906 Bacteria 5492
727 Ga0496103_0015473 3300048906 Bacteria 4540
728 Ga0496103_0022703 3300048906 Bacteria 3779
729 Ga0496103_0023647 3300048906 Bacteria 3706
730 Ga0496103_0111509 3300048906 Bacteria 1738
731 Ga0496104_0000381 3300048907 Bacteria 38927
732 Ga0496104_0000722 3300048907 Bacteria 28422
733 Ga0496104_0002589 3300048907 Bacteria 15603
734 Ga0496104_0037068 3300048907 Bacteria 4560
735 Ga0496104_0046796 3300048907 Bacteria 4075
736 Ga0496104_0057993 3300048907 Bacteria 3664
737 Ga0496104_0067819 3300048907 Bacteria 3390
738 Ga0496104_0158407 3300048907 Bacteria 2172
739 Ga0496104_0176978 3300048907 Viruses 2043
740 Ga0496104_0286997 3300048907 Bacteria 1558
741 Ga0496105_0000228 3300048908 Bacteria 37935
742 Ga0496105_0005243 3300048908 Bacteria 9824
743 Ga0496105_0005493 3300048908 Bacteria 9619
744 Ga0496105_0007188 3300048908 Bacteria 8592
745 Ga0496105_0025873 3300048908 Bacteria 4780
746 Ga0496105_0055436 3300048908 Bacteria 3273
747 Ga0496105_0162095 3300048908 Bacteria 1836
748 Ga0496105_0201563 3300048908 Archaea 1624
749 Ga0496105_0207726 3300048908 Bacteria 1597
750 Ga0496105_0225793 3300048908 Bacteria 1523
751 Ga0496105_0275250 3300048908 Viruses 1358
752 Ga0496106_0003519 3300048909 Bacteria 11674
753 Ga0496106_0003660 3300048909 Bacteria 11460
754 Ga0496106_0041243 3300048909 Bacteria 3458
755 Ga0496106_0050114 3300048909 Bacteria 3146
756 Ga0496106_0089874 3300048909 Bacteria 2369
757 Ga0496107_0011320 3300048910 Bacteria 6208
758 Ga0496107_0013331 3300048910 Bacteria 5743
759 Ga0496107_0016895 3300048910 Bacteria 5129
760 Ga0496107_0025420 3300048910 Bacteria 4192
761 Ga0496107_0074306 3300048910 Bacteria 2473
762 Ga0496107_0087889 3300048910 Bacteria 2269
763 Ga0496107_0143941 3300048910 Archaea 1762
764 Ga0496107_0194943 3300048910 Bacteria 1505
765 Ga0496108_0000826 3300048911 Bacteria 24092
766 Ga0496108_0001569 3300048911 Bacteria 18097
767 Ga0496108_0036246 3300048911 Bacteria 4104
768 Ga0496108_0069368 3300048911 Bacteria 2974
769 Ga0496108_0160501 3300048911 Bacteria 1942
770 Ga0496108_0190278 3300048911 Viruses 1778
771 Ga0496108_0271931 3300048911 Bacteria 1475
772 Ga0496109_0001686 3300048912 Bacteria 18402
773 Ga0496109_0001801 3300048912 Bacteria 17822
774 Ga0496109_0002311 3300048912 Bacteria 15871
775 Ga0496109_0007129 3300048912 Bacteria 9442
776 Ga0496109_0013766 3300048912 Bacteria 7028
777 Ga0496109_0018825 3300048912 Bacteria 6075
778 Ga0496109_0027355 3300048912 Bacteria 5091
779 Ga0496109_0083459 3300048912 Bacteria 2946
780 Ga0496109_0182796 3300048912 Bacteria 1969
781 Ga0496109_0453360 3300048912 Bacteria 1211
782 Ga0496110_0000439 3300048913 Bacteria 28278
783 Ga0496110_0000890 3300048913 Bacteria 21075
784 Ga0496110_0001269 3300048913 Bacteria 18061
785 Ga0496110_0002029 3300048913 Bacteria 15083
786 Ga0496110_0058772 3300048913 Bacteria 3387
787 Ga0496110_0064743 3300048913 Bacteria 3231
788 Ga0496110_0125060 3300048913 Bacteria 2320
789 Ga0496110_0262255 3300048913 Bacteria 1573
790 Ga0496110_0401579 3300048913 Bacteria 1249
791 Ga0496110_0539308 3300048913 Bacteria 1061
792 Ga0496111_0000025 3300048914 Bacteria 62100
793 Ga0496111_0000043 3300048914 Bacteria 49176
794 Ga0496111_0000159 3300048914 Bacteria 30273
795 Ga0496111_0013019 3300048914 Bacteria 5647
796 Ga0496111_0014358 3300048914 Bacteria 5409
797 Ga0496111_0069103 3300048914 Bacteria 2568
798 Ga0496111_0086215 3300048914 Bacteria 2297
799 Ga0496111_0302209 3300048914 Bacteria 1186
800 Ga0496112_0000145 3300048915 Bacteria 44395
801 Ga0496112_0000825 3300048915 Bacteria 21994
802 Ga0496112_0001618 3300048915 Bacteria 17434
803 Ga0496112_0007822 3300048915 Bacteria 9513
804 Ga0496112_0009374 3300048915 Bacteria 8816
805 Ga0496112_0015565 3300048915 Bacteria 7104
806 Ga0496112_0017377 3300048915 Bacteria 6758
807 Ga0496112_0022054 3300048915 Bacteria 6064
808 Ga0496112_0101603 3300048915 Bacteria 2845
809 Ga0496112_0335355 3300048915 Bacteria 1456
810 Ga0496113_0000298 3300048916 Bacteria 23527
811 Ga0496113_0013338 3300048916 Bacteria 5563
812 Ga0496113_0073161 3300048916 Bacteria 2610
813 Ga0496113_0264190 3300048916 Bacteria 1375
814 Ga0496113_0288847 3300048916 Unclassified 1312
815 Ga0496114_0001276 3300048917 Bacteria 19032
816 Ga0496114_0002346 3300048917 Bacteria 14408
817 Ga0496114_0010426 3300048917 Bacteria 7393
818 Ga0496114_0037095 3300048917 Bacteria 4031
819 Ga0496114_0053314 3300048917 Bacteria 3371
820 Ga0496114_0207061 3300048917 Archaea 1719
821 Ga0496114_0389303 3300048917 Bacteria 1234
822 Ga0496115_0005166 3300048918 Bacteria 9497
823 Ga0496115_0005749 3300048918 Bacteria 9031
824 Ga0496115_0172165 3300048918 Bacteria 1790
825 Ga0496115_0299259 3300048918 Bacteria 1318
826 Ga0496115_0535828 3300048918 Bacteria 937
827 Ga0501033_0179141 3300049570 Unclassified 1520
828 Ga0501034_0011736 3300049571 Bacteria 9065
829 Ga0501036_0010229 3300049572 Bacteria 7736
830 Ga0501037_0107111 3300049573 Bacteria 2014
831 Ga0501038_0022876 3300049574 Bacteria 5595
832 Ga0501039_0043719 3300049575 Bacteria 3459
833 Ga0501040_0012914 3300049576 Bacteria 5487
834 Ga0501041_0006507 3300049577 Bacteria 6839
835 Ga0501042_0004105 3300049578 Bacteria 9248
836 Ga0501042_0101254 3300049578 Bacteria 2072
837 Ga0501043_0047930 3300049579 Bacteria 3359
838 Ga0501046_0005156 3300049580 Bacteria 11712
839 Ga0501047_0104525 3300049581 Bacteria 2712
840 Ga0501047_0234706 3300049581 Bacteria 1686
841 Ga0501047_0380622 3300049581 Unclassified 1246
842 Ga0501048_0012667 3300049582 Bacteria 6270
843 Ga0501067_0000285 3300049583 Bacteria 27590
844 Ga0501067_0010527 3300049583 Bacteria 5122
845 Ga0501067_0031828 3300049583 Bacteria 2927
846 Ga0501067_0074360 3300049583 Bacteria 1883
847 Ga0501067_0273179 3300049583 Bacteria 941
848 Ga0501069_0009378 3300049585 Bacteria 5167
849 Ga0501069_0033759 3300049585 Bacteria 2819
850 Ga0501069_0112638 3300049585 Archaea 1550
851 Ga0501070_0006704 3300049586 Bacteria 9810
852 Ga0501070_0041894 3300049586 Bacteria 3813
853 Ga0501070_0046318 3300049586 Bacteria 3616
854 Ga0501070_0148339 3300049586 Bacteria 1936
855 Ga0501070_0419773 3300049586 Unclassified 1080
856 Ga0501071_0005995 3300049587 Bacteria 7874
857 Ga0501072_0018183 3300049588 Bacteria 5407
858 Ga0501072_0221044 3300049588 Unclassified 1509
859 Ga0501073_0065524 3300049589 Bacteria 2533
860 Ga0501073_0190285 3300049589 Bacteria 1420
861 Ga0501073_0319373 3300049589 Bacteria 1072
862 Ga0501074_0004989 3300049590 Bacteria 9522
863 Ga0501074_0023227 3300049590 Bacteria 4510
864 Ga0501074_0034929 3300049590 Bacteria 3643
865 Ga0501074_0046880 3300049590 Bacteria 3124
866 Ga0501076_0008422 3300049592 Bacteria 7556
867 Ga0501077_0003802 3300049593 Bacteria 9091
868 Ga0501079_0008442 3300049741 Bacteria 7808
869 Ga0501079_0115519 3300049741 Bacteria 2086
870 Ga0501080_0013478 3300049742 Bacteria 7521
871 Ga0501080_0025256 3300049742 Bacteria 5513
872 Ga0501080_0047747 3300049742 Bacteria 3986
873 Ga0501081_0086423 3300049743 Bacteria 2202
874 Ga0501083_0000145 3300049744 Bacteria 48483
875 Ga0501035_0004588 3300049822 Bacteria 13099
876 nmdc:mga0yw44_3385_c1 3300050492 Bacteria 6037
877 nmdc:mga05p37_56108_c1 3300050507 Bacteria 4849
878 nmdc:mga05p37_91944_c1 3300050507 Bacteria 3738
879 nmdc:mga08y16_103182_c1 3300050511 Bacteria 2969
880 nmdc:mga08y16_435177_c1 3300050511 Bacteria 1339
881 nmdc:mga0n895_131012_c1 3300050512 Bacteria 2533
882 nmdc:mga0n895_18140_c1 3300050512 Bacteria 6506
883 nmdc:mga0n895_25545_c1 3300050512 Bacteria 5582
884 nmdc:mga0n895_515029_c1 3300050512 Bacteria 1204
885 nmdc:mga0rr50_2136_c1 3300050513 Bacteria 11049
886 nmdc:mga08x19_67862_c1 3300050514 Bacteria 2320
887 nmdc:mga0a205_10114_c1 3300050515 Bacteria 8658
888 nmdc:mga0a205_135178_c1 3300050515 Bacteria 2366
889 nmdc:mga0a205_660_c1 3300050515 Bacteria 27450
890 nmdc:mga0a205_77257_c1 3300050515 Bacteria 3217
891 Ga0495601_0002343 3300053077 Bacteria 10719
892 Ga0495601_0030145 3300053077 Bacteria 3367
893 Ga0495601_0159790 3300053077 Unclassified 1472
894 Ga0495655_0004954 3300053083 Bacteria 2318
895 Ga0495595_0020754 3300053084 Unclassified 2861
896 Ga0495595_0030260 3300053084 Bacteria 2427
897 Ga0495619_0006146 3300053085 Bacteria 7606
898 Ga0495619_0007501 3300053085 Bacteria 6908
899 Ga0495619_0007751 3300053085 Bacteria 6795
900 Ga0495619_0020923 3300053085 Unclassified 4172
901 Ga0495619_0058399 3300053085 Viruses 2561
902 Ga0495619_0067716 3300053085 Bacteria 2384
903 Ga0500566_0038615 3300053094 Bacteria 2762
904 Ga0501084_0048891 3300054114 Bacteria 3540
905 Ga0501084_0154495 3300054114 Unclassified 1935
906 Ga0501082_0001530 3300060353 Bacteria 20348
907 Ga0466962_0000941 3300061719 Bacteria 13185
908 Ga0466962_0003162 3300061719 Bacteria 7823
909 Ga0466962_0004548 3300061719 Bacteria 6653
910 Ga0466962_0009512 3300061719 Bacteria 4661
911 Ga0466962_0023118 3300061719 Bacteria 2988
912 Ga0466962_0066112 3300061719 Viruses 1726
913 Ga0466962_0083379 3300061719 Bacteria 1529
914 Ga0530510_0002901 3300061734 Bacteria 11755
915 Ga0530510_0025866 3300061734 Bacteria 4198
916 Ga0530510_0252610 3300061734 Unclassified 1314
917 Ga0530510_0287132 3300061734 Bacteria 1230
918 Ga0265328_10012075
919 JGI25404J52841_10032437
920 Ga0065715_10260328
921 Ga0070658_10007594
922 Ga0070658_10033730
923 Ga0070658_10130842
924 Ga0070658_10232977
925 Ga0070683_100026257
926 Ga0070683_100048317
927 Ga0070683_100166039
928 Ga0070683_100249105
929 Ga0070680_100003464
930 Ga0070680_100016522
931 Ga0070680_100384835
932 Ga0070682_100003755
933 Ga0070682_100027129
934 Ga0070682_100039992
935 Ga0070660_100001630
936 Ga0070660_100002731
937 Ga0070660_100004707
938 Ga0070660_100011736
939 Ga0070660_100017945
940 Ga0070660_100054295
941 Ga0070660_100065707
942 Ga0070660_100152943
943 Ga0070687_100024404
944 Ga0070661_100010116
945 Ga0070661_100068683
946 Ga0070661_100071365
947 Ga0070692_10025686
948 Ga0070668_100063497
949 Ga0070675_100539711
950 Ga0070671_100030497
951 Ga0070674_100022155
952 Ga0070673_100245331
953 Ga0070659_100025698
954 Ga0070659_100072759
955 Ga0070659_100295804
956 Ga0070709_10005221
957 Ga0070709_10017441
958 Ga0070709_10154378
959 Ga0070714_100002238
960 Ga0070714_100009905
961 Ga0070714_100064497
962 Ga0070714_100094197
963 Ga0070714_100101647
964 Ga0070714_100500807
965 Ga0070713_100012624
966 Ga0070713_100390802
967 Ga0070713_100508487
968 Ga0070710_10001230
969 Ga0070710_10041441
970 Ga0070711_100016549
971 Ga0070711_100094929
972 Ga0070705_100172104
973 Ga0070694_100041336
974 Ga0070708_100118648
975 Ga0070708_100226564
976 Ga0070663_100190762
977 Ga0070678_100181069
978 Ga0070662_100411418
979 Ga0070681_10005097
980 Ga0070681_10007940
981 Ga0070681_10018395
982 Ga0070681_10025692
983 Ga0070681_10027395
984 Ga0070681_10032944
985 Ga0070681_10037883
986 Ga0070681_10096500
987 Ga0070681_10172085
988 Ga0070681_10263394
989 Ga0070681_10383842
990 Ga0068867_100004106
991 Ga0070706_100017494
992 Ga0070706_100098339
993 Ga0070706_100160223
994 Ga0070707_100002411
995 Ga0070707_100005567
996 Ga0070707_100049896
997 Ga0070707_100062611
998 Ga0070707_100256742
999 Ga0070707_100308575
1000 Ga0070698_100035503
1001 Ga0070698_100101025
1002 Ga0070698_100382164
1003 Ga0070698_100444143
1004 Ga0070699_100023039
1005 Ga0070679_100005688
1006 Ga0070679_100009583
1007 Ga0070679_100076580
1008 Ga0070679_100081984
1009 Ga0070679_100087347
1010 Ga0070679_100096791
1011 Ga0070679_100202080
1012 Ga0070679_100203953
1013 Ga0070679_100394789
1014 Ga0070684_100003268
1015 Ga0070684_100122344
1016 Ga0070684_100131177
1017 Ga0070684_100237807
1018 Ga0070697_100033386
1019 Ga0068853_100157183
1020 Ga0070686_100038067
1021 Ga0070686_100234538
1022 Ga0070695_100000510
1023 Ga0070695_100051706
1024 Ga0070696_100052935
1025 Ga0070696_100261392
1026 Ga0070693_100005253
1027 Ga0070693_100006963
1028 Ga0070704_100006405
1029 Ga0070704_100129434
1030 Ga0068855_100011653
1031 Ga0068855_100021782
1032 Ga0068855_100062270
1033 Ga0068855_100090875
1034 Ga0068855_100130249
1035 Ga0068855_100134496
1036 Ga0068855_100481412
1037 Ga0068855_100541201
1038 Ga0068857_100014855
1039 Ga0068857_100066973
1040 Ga0068857_100327286
1041 Ga0068856_100037265
1042 Ga0068856_100051074
1043 Ga0068856_100308920
1044 Ga0068856_100333106
1045 Ga0070702_100257174
1046 Ga0068852_100157886
1047 Ga0068866_10021370
1048 Ga0068861_100185694
1049 Ga0068860_100066125
1050 Ga0081455_10002152
1051 Ga0081455_10059491
1052 Ga0081455_10112407
1053 Ga0081538_10133063
1054 Ga0081540_1002321
1055 Ga0081540_1031707
1056 Ga0070717_10003122
1057 Ga0070717_10026150
1058 Ga0070717_10032269
1059 Ga0070717_10119304
1060 Ga0070717_10232711
1061 Ga0075365_10131586
1062 Ga0070715_10004406
1063 Ga0070712_100036398
1064 Ga0070712_100050683
1065 Ga0070712_100213419
1066 Ga0097621_100089004
1067 Ga0097621_100443267
1068 Ga0068871_100037358
1069 Ga0075434_100002536
1070 Ga0075434_100016864
1071 Ga0075434_100055625
1072 Ga0075434_100593576
1073 Ga0075436_100269381
1074 Ga0075435_100002096
1075 Ga0105240_10034877
1076 Ga0105240_10141997
1077 Ga0105240_10287164
1078 Ga0111539_10444035
1079 Ga0105247_10139942
1080 Ga0114129_10060892
1081 Ga0114129_10246271
1082 Ga0105243_10117946
1083 Ga0105243_10166607
1084 Ga0105243_10170882
1085 Ga0105243_10420326
1086 Ga0105241_10072637
1087 Ga0105241_10093413
1088 Ga0105242_10144414
1089 Ga0105242_10476500
1090 Ga0105248_10194180
1091 Ga0105237_10106868
1092 Ga0105237_10339998
1093 Ga0105238_10050677
1094 Ga0105238_10064893
1095 Ga0105238_10075844
1096 Ga0105238_10308217
1097 Ga0105238_10713679
1098 Ga0105249_10055316
1099 Ga0105249_10185111
1100 Ga0105239_10216351
1101 Ga0105239_10251438
1102 Ga0105239_10376142
1103 Ga0157373_10019632
1104 Ga0157371_10127131
1105 Ga0157371_10131288
1106 Ga0157371_10141835
1107 Ga0157370_10002167
1108 Ga0157370_10015489
1109 Ga0157370_10092948
1110 Ga0157370_10110839
1111 Ga0157370_10157426
1112 Ga0157370_10697110
1113 Ga0157369_10018636
1114 Ga0157369_10031229
1115 Ga0157369_10222053
1116 Ga0157369_10273664
1117 Ga0157369_10691765
1118 Ga0157374_10029558
1119 Ga0157374_10074827
1120 Ga0157374_10532763
1121 Ga0157378_10720156
1122 Ga0163162_10318136
1123 Ga0157372_10310707
1124 Ga0157372_10321040
1125 Ga0157372_10430363
1126 Ga0157375_10018482
1127 Ga0157375_10369230
1128 Ga0163163_10079615
1129 Ga0163163_10474080
1130 Ga0157380_10595221
1131 Ga0182008_10002410
1132 Ga0182008_10094146
1133 Ga0157379_10351162
1134 Ga0157379_10563606
1135 Ga0157376_10172788
1136 Ga0182006_1011287
1137 Ga0197907_10431347
1138 Ga0206356_11771762
1139 Ga0206354_11091643
1140 Ga0206353_10675245
1141 Ga0206353_10803903
1142 Ga0206353_11572253
1143 Ga0206353_11851607
1144 Ga0213871_10011936
1145 Ga0213871_10062398
1146 Ga0207692_10006533
1147 Ga0207692_10019598
1148 Ga0207692_10143982
1149 Ga0207685_10006855
1150 Ga0207699_10014422
1151 Ga0207699_10034232
1152 Ga0207705_10075470
1153 Ga0207684_10189848
1154 Ga0207684_10220297
1155 Ga0207707_10002423
1156 Ga0207707_10003146
1157 Ga0207707_10013393
1158 Ga0207707_10032352
1159 Ga0207707_10034687
1160 Ga0207707_10060152
1161 Ga0207707_10246634
1162 Ga0207707_10281860
1163 Ga0207695_10026630
1164 Ga0207695_10086973
1165 Ga0207695_10463154
1166 Ga0207693_10000198
1167 Ga0207693_10001236
1168 Ga0207693_10011298
1169 Ga0207693_10095680
1170 Ga0207693_10166137
1171 Ga0207693_10188926
1172 Ga0207663_10001587
1173 Ga0207663_10002285
1174 Ga0207663_10012633
1175 Ga0207663_10026765
1176 Ga0207660_10024801
1177 Ga0207660_10042389
1178 Ga0207660_10339217
1179 Ga0207657_10000729
1180 Ga0207657_10001944
1181 Ga0207657_10002416
1182 Ga0207657_10002425
1183 Ga0207657_10009726
1184 Ga0207657_10027145
1185 Ga0207657_10035128
1186 Ga0207657_10037458
1187 Ga0207657_10118803
1188 Ga0207657_10132457
1189 Ga0207649_10067582
1190 Ga0207652_10020492
1191 Ga0207652_10036464
1192 Ga0207652_10039331
1193 Ga0207652_10060085
1194 Ga0207652_10094954
1195 Ga0207652_10159514
1196 Ga0207652_10266815
1197 Ga0207652_10357906
1198 Ga0207646_10006773
1199 Ga0207646_10038974
1200 Ga0207646_10171619
1201 Ga0207687_10030229
1202 Ga0207687_10314486
1203 Ga0207700_10000002
1204 Ga0207700_10008204
1205 Ga0207700_10204248
1206 Ga0207700_10211520
1207 Ga0207700_10442565
1208 Ga0207664_10004871
1209 Ga0207664_10020692
1210 Ga0207664_10022769
1211 Ga0207664_10036073
1212 Ga0207664_10054474
1213 Ga0207664_10062382
1214 Ga0207664_10159558
1215 Ga0207664_10202970
1216 Ga0207690_10030517
1217 Ga0207690_10235815
1218 Ga0207706_10005925
1219 Ga0207686_10045997
1220 Ga0207709_10021542
1221 Ga0207709_10092087
1222 Ga0207709_10125925
1223 Ga0207704_10128909
1224 Ga0207665_10001160
1225 Ga0207711_10188256
1226 Ga0207711_10242217
1227 Ga0207661_10011427
1228 Ga0207661_10061371
1229 Ga0207661_10120593
1230 Ga0207661_10153665
1231 Ga0207661_10178683
1232 Ga0207661_10353747
1233 Ga0207667_10027332
1234 Ga0207667_10039109
1235 Ga0207667_10064993
1236 Ga0207667_10110636
1237 Ga0207667_10258340
1238 Ga0207667_10440796
1239 Ga0207651_10311020
1240 Ga0207668_10427865
1241 Ga0207640_10223349
1242 Ga0207639_10174660
1243 Ga0207678_10019356
1244 Ga0207678_10360103
1245 Ga0207708_10000986
1246 Ga0207702_10049965
1247 Ga0207702_10060806
1248 Ga0207702_10098734
1249 Ga0207702_10126675
1250 Ga0207648_10001924
1251 Ga0207674_10006916
1252 Ga0207674_10015274
1253 Ga0207674_10176158
1254 Ga0207675_100018455
1255 Ga0207675_100383335
1256 Ga0207683_10014165
1257 Ga0207683_10014555
1258 Ga0207683_10282782
1259 Ga0207698_10046006
1260 Ga0207698_10370521
1261 Ga0207428_10108669
1262 Ga0268265_10019906
1263 Ga0265334_10006282
1264 Ga0265318_10001740
1265 Ga0265322_10011017
1266 Ga0265338_10002373
1267 Ga0265338_10004407
1268 Ga0265338_10009073
1269 Ga0265338_10018002
1270 Ga0265338_10048722
1271 Ga0265324_10009357
1272 Ga0265330_10017276
1273 Ga0265320_10094178
1274 Ga0265329_10013593
1275 Ga0265340_10052617
1276 Ga0265339_10046083
1277 Ga0265331_10030260
1278 Ga0265327_10011995
1279 Ga0265316_10034585
1280 Ga0307408_100091832
1281 Ga0265313_10008218
1282 Ga0265314_10032081
1283 Ga0265314_10035094
1284 Ga0265342_10010109
1285 Ga0307405_10162248
1286 Ga0307412_10117038
1287 Ga0307416_100304657
1288 Ga0307416_100824550
1289 Ga0307415_100257229
1290 Ga0373930_0019613
1291 Ga0373938_0033567
1292 Ga0373926_0097929
1293 Ga0373929_0031673
1294 Ga0373949_0009300
1295 Ga0373936_0003528
1296 Ga0373945_0012094
1297 Ga0373945_0038516
1298 Ga0373943_0008261
1299 Ga0373943_0010211
1300 Ga0373943_0079290
1301 Ga0373946_0116190
1302 Ga0373955_0011626
1303 Ga0373931_0043647
1304 Ga0373931_0327906
1305 Ga0373935_0019055
1306 Ga0373935_0026168
1307 Ga0373927_0224198
1308 Ga0373927_0232868
1309 Ga0373933_0210488
1310 Ga0373947_0007236
1311 Ga0373947_0027357
1312 Ga0373947_0175565
1313 Ga0373937_0002702
1314 Ga0373937_0013631
1315 Ga0373925_0000887
1316 Ga0373925_0048940
1317 Ga0373925_0423318
1318 Ga0395899_0006493
1319 Ga0395899_0027720
1320 Ga0395899_0038289
1321 Ga0395899_0065796
1322 Ga0395899_0097873
1323 Ga0395899_0115847
1324 Ga0395899_0137982
1325 Ga0395899_0203010
1326 Ga0395900_0003003
1327 Ga0395900_0005192
1328 Ga0395900_0010314
1329 Ga0395900_0025691
1330 Ga0395900_0047346
1331 Ga0395900_0054811
1332 Ga0395900_0058822
1333 Ga0395900_0084378
1334 Ga0395900_0102560
1335 Ga0395900_0117441
1336 Ga0395900_0119574
1337 Ga0395900_0190422
1338 Ga0395900_0200708
1339 Ga0395900_0201288
1340 Ga0395900_0250774
1341 Ga0395900_0254807
1342 Ga0395900_0364211
1343 Ga0395900_0397301
1344 Ga0395900_0522844
1345 Ga0395898_0002500
1346 Ga0395898_0005115
1347 Ga0395898_0005507
1348 Ga0395898_0006288
1349 Ga0395898_0006891
1350 Ga0395898_0007490
1351 Ga0395898_0010056
1352 Ga0395898_0010259
1353 Ga0395898_0038193
1354 Ga0395898_0054599
1355 Ga0395898_0094559
1356 Ga0395898_0141984
1357 Ga0395898_0206992
1358 Ga0395898_0334317
1359 Ga0395898_0349251
1360 Ga0395898_0380825
1361 Ga0395905_0004014
1362 Ga0395905_0004601
1363 Ga0395905_0015855
1364 Ga0395905_0029709
1365 Ga0395905_0057057
1366 Ga0395905_0065671
1367 Ga0395905_0099535
1368 Ga0395905_0105216
1369 Ga0395905_0121863
1370 Ga0395905_0125610
1371 Ga0395905_0206378
1372 Ga0395905_0239553
1373 Ga0395901_0001290
1374 Ga0395901_0005511
1375 Ga0395901_0008519
1376 Ga0395901_0009578
1377 Ga0395901_0010572
1378 Ga0395901_0045077
1379 Ga0395901_0052258
1380 Ga0395901_0053403
1381 Ga0395901_0058631
1382 Ga0395901_0062351
1383 Ga0395901_0103279
1384 Ga0395901_0144857
1385 Ga0395901_0207421
1386 Ga0395901_0270849
1387 Ga0395901_0306311
1388 Ga0395901_0346725
1389 Ga0395901_0385656
1390 Ga0395901_0398818
1391 Ga0395901_0411670
1392 Ga0436365_1635017
1393 Ga0436360_0675505
1394 Ga0436363_1405693
1395 Ga0436362_0654759
1396 Ga0439448_0031201
1397 Ga0466969_0008928
1398 Ga0466966_0008382
1399 Ga0466966_0021106
1400 Ga0466966_0043266
1401 Ga0466961_0009165
1402 Ga0466961_0010210
1403 Ga0466961_0018116
1404 Ga0466961_0018402
1405 Ga0466961_0053370
1406 Ga0466961_0072893
1407 Ga0466963_0000245
1408 Ga0466963_0001068
1409 Ga0466963_0001151
1410 Ga0466963_0001242
1411 Ga0466963_0001451
1412 Ga0466963_0003886
1413 Ga0466963_0008385
1414 Ga0466963_0011379
1415 Ga0466963_0017456
1416 Ga0466963_0029728
1417 Ga0466963_0042163
1418 Ga0466963_0042817
1419 Ga0466963_0045142
1420 Ga0466963_0057870
1421 Ga0466963_0059378
1422 Ga0466963_0066958
1423 Ga0466963_0082539
1424 Ga0466963_0094190
1425 Ga0466964_0001695
1426 Ga0466964_0004325
1427 Ga0466964_0010161
1428 Ga0466964_0012649
1429 Ga0466964_0062957
1430 Ga0466971_0005705
1431 Ga0466971_0010690
1432 Ga0466971_0034164
1433 Ga0466971_0081283
1434 Ga0466968_0001438
1435 Ga0466968_0029908
1436 Ga0466968_0072405
1437 Ga0466970_0015231
1438 Ga0466957_0002511
1439 Ga0466957_0014263
1440 Ga0466957_0027826
1441 Ga0466957_0035546
1442 Ga0466957_0038111
1443 Ga0466957_0045409
1444 Ga0466957_0083971
1445 Ga0466957_0095459
1446 Ga0466957_0109690
1447 Ga0466957_0155258
1448 Ga0466957_0199053
1449 Ga0466960_0003215
1450 Ga0466960_0059436
1451 Ga0466960_0129013
1452 Ga0466959_0001526
1453 Ga0466959_0002072
1454 Ga0466959_0008410
1455 Ga0466959_0018997
1456 Ga0466959_0063654
1457 Ga0466959_0096284
1458 Ga0466959_0128691
1459 Ga0466959_0199493
1460 Ga0451576_0210932
1461 Ga0466958_0000293
1462 Ga0466958_0001578
1463 Ga0466958_0007797
1464 Ga0466958_0015674
1465 Ga0466958_0022876
1466 Ga0466958_0032844
1467 Ga0466958_0064173
1468 Ga0466958_0109648
1469 Ga0466958_0144413
1470 Ga0466967_0000437
1471 Ga0466967_0000541
1472 Ga0466967_0003389
1473 Ga0466967_0004389
1474 Ga0466967_0005119
1475 Ga0466967_0013571
1476 Ga0466967_0037927
1477 Ga0466967_0039356
1478 Ga0466967_0041592
1479 Ga0466967_0047619
1480 Ga0466967_0049017
1481 Ga0466967_0049174
1482 Ga0466967_0056164
1483 Ga0466967_0058837
1484 Ga0466967_0060951
1485 Ga0466967_0064542
1486 Ga0466967_0071757
1487 Ga0466967_0084621
1488 Ga0466967_0087305
1489 Ga0466967_0094002
1490 Ga0466967_0099522
1491 Ga0466967_0134523
1492 Ga0466967_0145460
1493 Ga0466967_0223462
1494 Ga0466967_0234398
1495 Ga0466967_0237964
1496 Ga0466967_0243357
1497 Ga0466967_0264775
1498 Ga0466967_0288331
1499 Ga0466967_0404560
1500 Ga0495592_0000708
1501 Ga0495592_0026688
1502 Ga0495592_0105501
1503 Ga0495603_0018073
1504 Ga0495629_0017075
1505 Ga0495629_0017103
1506 Ga0495641_0008385
1507 Ga0495641_0046512
1508 Ga0495641_0077799
1509 Ga0495651_0000885
1510 Ga0495651_0056069
1511 Ga0495651_0085349
1512 Ga0495651_0099755
1513 Ga0495653_0013755
1514 Ga0495653_0085691
1515 Ga0495653_0098388
1516 Ga0495580_0120453
1517 Ga0495580_0238023
1518 Ga0495582_0059207
1519 Ga0495582_0175063
1520 Ga0495639_0000458
1521 Ga0495662_0000722
1522 Ga0495664_0193757
1523 Ga0495584_0080912
1524 Ga0495585_0142547
1525 Ga0495596_0037409
1526 Ga0495607_0011635
1527 Ga0495608_0004093
1528 Ga0495608_0005519
1529 Ga0495608_0028281
1530 Ga0495608_0269519
1531 Ga0495618_0027065
1532 Ga0495618_0074647
1533 Ga0495618_0223125
1534 Ga0495628_0001243
1535 Ga0495628_0115734
1536 Ga0495630_0011609
1537 Ga0495630_0034757
1538 Ga0495663_0003333
1539 Ga0495666_0000065
1540 Ga0495652_0010178
1541 Ga0495652_0084219
1542 Ga0495652_0210647
1543 Ga0495652_0235303
1544 Ga0495665_0005926
1545 Ga0495665_0152516
1546 Ga0495640_0002040
1547 Ga0495640_0083800
1548 Ga0495640_0100616
1549 Ga0495586_0007245
1550 Ga0495586_0178990
1551 Ga0495586_0205037
1552 Ga0495587_0000675
1553 Ga0495587_0006475
1554 Ga0495645_0000684
1555 Ga0495667_0004970
1556 Ga0495667_0073259
1557 Ga0495667_0090422
1558 Ga0495667_0138581
1559 Ga0495667_0334725
1560 Ga0495656_0107032
1561 Ga0495668_0144295
1562 Ga0495634_0019011
1563 Ga0495634_0060069
1564 Ga0495634_0107634
1565 Ga0495634_0157625
1566 Ga0495635_0026093
1567 Ga0495635_0070147
1568 Ga0495635_0091826
1569 Ga0495635_0113655
1570 Ga0495659_0040567
1571 Ga0495657_0020319
1572 Ga0495657_0067092
1573 Ga0495657_0072893
1574 Ga0495599_0000455
1575 Ga0495599_0001792
1576 Ga0495599_0136555
1577 Ga0495599_0200681
1578 Ga0495623_0001619
1579 Ga0495623_0099594
1580 Ga0495646_0015915
1581 Ga0495646_0172189
1582 Ga0495646_0195507
1583 Ga0495647_0000075
1584 Ga0495658_0003735
1585 Ga0495658_0038841
1586 Ga0495613_0013358
1587 Ga0495613_0093119
1588 Ga0495613_0119063
1589 Ga0495613_0234524
1590 Ga0495624_0014761
1591 Ga0495624_0029796
1592 Ga0495624_0129901
1593 Ga0495624_0131165
1594 Ga0495670_0074045
1595 Ga0495600_0018065
1596 Ga0495600_0059255
1597 Ga0495604_0001028
1598 Ga0495604_0003434
1599 Ga0495674_0058142
1600 Ga0495674_0162234
1601 Ga0495674_0192570
1602 Ga0495674_0373137
1603 Ga0495676_0044046
1604 Ga0495676_0096118
1605 Ga0495680_0001991
1606 Ga0495680_0020713
1607 Ga0495680_0023772
1608 Ga0495680_0026531
1609 Ga0495680_0154823
1610 Ga0495680_0165988
1611 Ga0495675_0000592
1612 Ga0495675_0065278
1613 Ga0495685_061193
1614 Ga0495684_0018793
1615 Ga0495684_0050383
1616 Ga0495593_0000573
1617 Ga0495602_0001484
1618 Ga0495602_0092325
1619 Ga0495602_0248430
1620 Ga0495602_0250110
1621 Ga0495614_0028764
1622 Ga0495614_0038884
1623 Ga0496100_0011890
1624 Ga0496100_0032173
1625 Ga0496100_0040168
1626 Ga0496100_0310071
1627 Ga0496100_0356743
1628 Ga0496100_0375180
1629 Ga0496101_0004111
1630 Ga0496101_0035348
1631 Ga0496101_0040080
1632 Ga0496101_0046867
1633 Ga0496101_0051260
1634 Ga0496101_0051470
1635 Ga0496101_0083944
1636 Ga0496101_0098855
1637 Ga0496101_0231828
1638 Ga0496101_0247516
1639 Ga0496102_0004397
1640 Ga0496102_0009170
1641 Ga0496102_0215117
1642 Ga0496102_0293871
1643 Ga0496103_0010455
1644 Ga0496103_0015473
1645 Ga0496103_0022703
1646 Ga0496103_0023647
1647 Ga0496103_0111509
1648 Ga0496104_0000381
1649 Ga0496104_0000722
1650 Ga0496104_0002589
1651 Ga0496104_0037068
1652 Ga0496104_0046796
1653 Ga0496104_0057993
1654 Ga0496104_0067819
1655 Ga0496104_0158407
1656 Ga0496104_0176978
1657 Ga0496104_0286997
1658 Ga0496105_0000228
1659 Ga0496105_0005243
1660 Ga0496105_0005493
1661 Ga0496105_0007188
1662 Ga0496105_0025873
1663 Ga0496105_0055436
1664 Ga0496105_0162095
1665 Ga0496105_0201563
1666 Ga0496105_0207726
1667 Ga0496105_0225793
1668 Ga0496105_0275250
1669 Ga0496106_0003519
1670 Ga0496106_0003660
1671 Ga0496106_0041243
1672 Ga0496106_0050114
1673 Ga0496106_0089874
1674 Ga0496107_0011320
1675 Ga0496107_0013331
1676 Ga0496107_0016895
1677 Ga0496107_0025420
1678 Ga0496107_0074306
1679 Ga0496107_0087889
1680 Ga0496107_0143941
1681 Ga0496107_0194943
1682 Ga0496108_0000826
1683 Ga0496108_0001569
1684 Ga0496108_0036246
1685 Ga0496108_0069368
1686 Ga0496108_0160501
1687 Ga0496108_0190278
1688 Ga0496108_0271931
1689 Ga0496109_0001686
1690 Ga0496109_0001801
1691 Ga0496109_0002311
1692 Ga0496109_0007129
1693 Ga0496109_0013766
1694 Ga0496109_0018825
1695 Ga0496109_0027355
1696 Ga0496109_0083459
1697 Ga0496109_0182796
1698 Ga0496109_0453360
1699 Ga0496110_0000439
1700 Ga0496110_0000890
1701 Ga0496110_0001269
1702 Ga0496110_0002029
1703 Ga0496110_0058772
1704 Ga0496110_0064743
1705 Ga0496110_0125060
1706 Ga0496110_0262255
1707 Ga0496110_0401579
1708 Ga0496110_0539308
1709 Ga0496111_0000025
1710 Ga0496111_0000043
1711 Ga0496111_0000159
1712 Ga0496111_0013019
1713 Ga0496111_0014358
1714 Ga0496111_0069103
1715 Ga0496111_0086215
1716 Ga0496111_0302209
1717 Ga0496112_0000145
1718 Ga0496112_0000825
1719 Ga0496112_0001618
1720 Ga0496112_0007822
1721 Ga0496112_0009374
1722 Ga0496112_0015565
1723 Ga0496112_0017377
1724 Ga0496112_0022054
1725 Ga0496112_0101603
1726 Ga0496112_0335355
1727 Ga0496113_0000298
1728 Ga0496113_0013338
1729 Ga0496113_0073161
1730 Ga0496113_0264190
1731 Ga0496113_0288847
1732 Ga0496114_0001276
1733 Ga0496114_0002346
1734 Ga0496114_0010426
1735 Ga0496114_0037095
1736 Ga0496114_0053314
1737 Ga0496114_0207061
1738 Ga0496114_0389303
1739 Ga0496115_0005166
1740 Ga0496115_0005749
1741 Ga0496115_0172165
1742 Ga0496115_0299259
1743 Ga0496115_0535828
1744 Ga0501033_0179141
1745 Ga0501034_0011736
1746 Ga0501036_0010229
1747 Ga0501037_0107111
1748 Ga0501038_0022876
1749 Ga0501039_0043719
1750 Ga0501040_0012914
1751 Ga0501041_0006507
1752 Ga0501042_0004105
1753 Ga0501042_0101254
1754 Ga0501043_0047930
1755 Ga0501046_0005156
1756 Ga0501047_0104525
1757 Ga0501047_0234706
1758 Ga0501047_0380622
1759 Ga0501048_0012667
1760 Ga0501067_0000285
1761 Ga0501067_0010527
1762 Ga0501067_0031828
1763 Ga0501067_0074360
1764 Ga0501067_0273179
1765 Ga0501069_0009378
1766 Ga0501069_0033759
1767 Ga0501069_0112638
1768 Ga0501070_0006704
1769 Ga0501070_0041894
1770 Ga0501070_0046318
1771 Ga0501070_0148339
1772 Ga0501070_0419773
1773 Ga0501071_0005995
1774 Ga0501072_0018183
1775 Ga0501072_0221044
1776 Ga0501073_0065524
1777 Ga0501073_0190285
1778 Ga0501073_0319373
1779 Ga0501074_0004989
1780 Ga0501074_0023227
1781 Ga0501074_0034929
1782 Ga0501074_0046880
1783 Ga0501076_0008422
1784 Ga0501077_0003802
1785 Ga0501079_0008442
1786 Ga0501079_0115519
1787 Ga0501080_0013478
1788 Ga0501080_0025256
1789 Ga0501080_0047747
1790 Ga0501081_0086423
1791 Ga0501083_0000145
1792 Ga0501035_0004588
1793 nmdc:mga0yw44_3385_c1
1794 nmdc:mga05p37_56108_c1
1795 nmdc:mga05p37_91944_c1
1796 nmdc:mga08y16_103182_c1
1797 nmdc:mga08y16_435177_c1
1798 nmdc:mga0n895_131012_c1
1799 nmdc:mga0n895_18140_c1
1800 nmdc:mga0n895_25545_c1
1801 nmdc:mga0n895_515029_c1
1802 nmdc:mga0rr50_2136_c1
1803 nmdc:mga08x19_67862_c1
1804 nmdc:mga0a205_10114_c1
1805 nmdc:mga0a205_135178_c1
1806 nmdc:mga0a205_660_c1
1807 nmdc:mga0a205_77257_c1
1808 Ga0495601_0002343
1809 Ga0495601_0030145
1810 Ga0495601_0159790
1811 Ga0495655_0004954
1812 Ga0495595_0020754
1813 Ga0495595_0030260
1814 Ga0495619_0006146
1815 Ga0495619_0007501
1816 Ga0495619_0007751
1817 Ga0495619_0020923
1818 Ga0495619_0058399
1819 Ga0495619_0067716
1820 Ga0500566_0038615
1821 Ga0501084_0048891
1822 Ga0501084_0154495
1823 Ga0501082_0001530
1824 Ga0466962_0000941
1825 Ga0466962_0003162
1826 Ga0466962_0004548
1827 Ga0466962_0009512
1828 Ga0466962_0023118
1829 Ga0466962_0066112
1830 Ga0466962_0083379
1831 Ga0530510_0002901
1832 Ga0530510_0025866
1833 Ga0530510_0252610
1834 Ga0530510_0287132

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

141

264

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7p-assembly1.cif.gz_A crystal structure of legionella effector sded (lpg2509) 0.6012 80 209
6ryb-assembly1.cif.gz_A structure of deubiquitinase for pr-ubiquitination 1 -dup1 0.5993 80 214
1vla-assembly1.cif.gz_A crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution 0.5436 228 276
5up0-assembly1.cif.gz_A crystal structure of human pde1b catalytic domain in complex with inhibitor 3 (6-(4-chlorobenzyl)-8,9,10,11-tetrahydrobenzo[4,5]thieno[3,2-e][1,2,4]triazolo[1,5-c]pyrimidin-5(6h)-one) 0.5423 46 204
6pbz-assembly1.cif.gz_B crystal structure of escherichia coli gppa 0.5411 66 273
ID Description Score Start End Superfamily
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9253 60 218 1.10.3210.10
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9086 60 218 1.10.3210.10
af_P23003_45_186_2.40.50.1070 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.5659 193 292 2.40.50.1070
af_Q2FWA9_216_326_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.5476 239 280 3.30.70.1350
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5323 60 273 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1W9THA4-F1-model_v4 HD domain-containing protein 0.9824 34 202
AF-A0A382XCN4-F1-model_v4 HD domain-containing protein 0.9818 34 191
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9763 35 180 GO:0016787
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9698 35 180 GO:0016787
AF-A0A7J3MYU3-F1-model_v4 HD domain-containing protein 0.9601 42 174

Map