F485642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 917 | 309 | 1834 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10012075|Ga0265328_100120752 |
| Length | 354 |
| Sequence | VFAMSIAPPSACSIRSPISSSAPVGPVLQTSDSGIEATVKTTRCSAPTRQIRETHHNLRAQKPRSQPLRPRLLHMALDTESAEPIEEPASEAIARMKINVPVRGNRKLRTLIERVNDDKQLKAWWHVANVNAVARMQINDHSWVHIQIVTNIALKLLRQLTKHHVEPSMVRDYGMTPEDSEIVVTLAALLHDSGMSIHRHGHEDFSLFLAERKLYPLLEGIYEDPDLTVVVSEVLQAIISHRADGEPFTVEAGIIRVADALDMAKGRSRIPFQRGRVSMHSLSAAAIEDVTISDGEERPVLIEIRMNNSSGIFQVDGLLKAKLRGSGLEPYVEVVAHIDTETEQRLVPMYRLEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 13.2 |
| Rhizosphere | 86.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265328_10012075 | 3300031239 | Bacteria | 3441 |
| 2 | JGI25404J52841_10032437 | 3300003659 | Bacteria | 1114 |
| 3 | Ga0065715_10260328 | 3300005293 | Bacteria | 1140 |
| 4 | Ga0070658_10007594 | 3300005327 | Bacteria | 8749 |
| 5 | Ga0070658_10033730 | 3300005327 | Archaea | 4119 |
| 6 | Ga0070658_10130842 | 3300005327 | Bacteria | 2091 |
| 7 | Ga0070658_10232977 | 3300005327 | Bacteria | 1559 |
| 8 | Ga0070683_100026257 | 3300005329 | Bacteria | 5241 |
| 9 | Ga0070683_100048317 | 3300005329 | Bacteria | 3934 |
| 10 | Ga0070683_100166039 | 3300005329 | Bacteria | 2094 |
| 11 | Ga0070683_100249105 | 3300005329 | Archaea | 1689 |
| 12 | Ga0070680_100003464 | 3300005336 | Bacteria | 11780 |
| 13 | Ga0070680_100016522 | 3300005336 | Bacteria | 5807 |
| 14 | Ga0070680_100384835 | 3300005336 | Viruses | 1195 |
| 15 | Ga0070682_100003755 | 3300005337 | Bacteria | 8441 |
| 16 | Ga0070682_100027129 | 3300005337 | Bacteria | 3434 |
| 17 | Ga0070682_100039992 | 3300005337 | Bacteria | 2884 |
| 18 | Ga0070660_100001630 | 3300005339 | Bacteria | 15429 |
| 19 | Ga0070660_100002731 | 3300005339 | Bacteria | 12123 |
| 20 | Ga0070660_100004707 | 3300005339 | Bacteria | 9447 |
| 21 | Ga0070660_100011736 | 3300005339 | Bacteria | 6238 |
| 22 | Ga0070660_100017945 | 3300005339 | Bacteria | 5163 |
| 23 | Ga0070660_100054295 | 3300005339 | Bacteria | 3094 |
| 24 | Ga0070660_100065707 | 3300005339 | Viruses | 2823 |
| 25 | Ga0070660_100152943 | 3300005339 | Bacteria | 1856 |
| 26 | Ga0070687_100024404 | 3300005343 | Bacteria | 2887 |
| 27 | Ga0070661_100010116 | 3300005344 | Bacteria | 6551 |
| 28 | Ga0070661_100068683 | 3300005344 | Viruses | 2604 |
| 29 | Ga0070661_100071365 | 3300005344 | Bacteria | 2555 |
| 30 | Ga0070692_10025686 | 3300005345 | Bacteria | 2905 |
| 31 | Ga0070668_100063497 | 3300005347 | Bacteria | 2863 |
| 32 | Ga0070675_100539711 | 3300005354 | Archaea | 1054 |
| 33 | Ga0070671_100030497 | 3300005355 | Bacteria | 4449 |
| 34 | Ga0070674_100022155 | 3300005356 | Bacteria | 4093 |
| 35 | Ga0070673_100245331 | 3300005364 | Bacteria | 1559 |
| 36 | Ga0070659_100025698 | 3300005366 | Bacteria | 4526 |
| 37 | Ga0070659_100072759 | 3300005366 | Bacteria | 2736 |
| 38 | Ga0070659_100295804 | 3300005366 | Bacteria | 1349 |
| 39 | Ga0070709_10005221 | 3300005434 | Bacteria | 7026 |
| 40 | Ga0070709_10017441 | 3300005434 | Bacteria | 4118 |
| 41 | Ga0070709_10154378 | 3300005434 | Bacteria | 1590 |
| 42 | Ga0070714_100002238 | 3300005435 | Bacteria | 14230 |
| 43 | Ga0070714_100009905 | 3300005435 | Bacteria | 7517 |
| 44 | Ga0070714_100064497 | 3300005435 | Bacteria | 3153 |
| 45 | Ga0070714_100094197 | 3300005435 | Bacteria | 2629 |
| 46 | Ga0070714_100101647 | 3300005435 | Unclassified | 2533 |
| 47 | Ga0070714_100500807 | 3300005435 | Bacteria | 1158 |
| 48 | Ga0070713_100012624 | 3300005436 | Bacteria | 6206 |
| 49 | Ga0070713_100390802 | 3300005436 | Bacteria | 1298 |
| 50 | Ga0070713_100508487 | 3300005436 | Archaea | 1137 |
| 51 | Ga0070710_10001230 | 3300005437 | Bacteria | 12145 |
| 52 | Ga0070710_10041441 | 3300005437 | Bacteria | 2542 |
| 53 | Ga0070711_100016549 | 3300005439 | Bacteria | 4683 |
| 54 | Ga0070711_100094929 | 3300005439 | Bacteria | 2157 |
| 55 | Ga0070705_100172104 | 3300005440 | Bacteria | 1458 |
| 56 | Ga0070694_100041336 | 3300005444 | Bacteria | 3075 |
| 57 | Ga0070708_100118648 | 3300005445 | Bacteria | 2438 |
| 58 | Ga0070708_100226564 | 3300005445 | Unclassified | 1754 |
| 59 | Ga0070663_100190762 | 3300005455 | Bacteria | 1595 |
| 60 | Ga0070678_100181069 | 3300005456 | Bacteria | 1725 |
| 61 | Ga0070662_100411418 | 3300005457 | Bacteria | 1117 |
| 62 | Ga0070681_10005097 | 3300005458 | Bacteria | 12677 |
| 63 | Ga0070681_10007940 | 3300005458 | Bacteria | 10385 |
| 64 | Ga0070681_10018395 | 3300005458 | Bacteria | 6983 |
| 65 | Ga0070681_10025692 | 3300005458 | Bacteria | 5922 |
| 66 | Ga0070681_10027395 | 3300005458 | Bacteria | 5730 |
| 67 | Ga0070681_10032944 | 3300005458 | Bacteria | 5201 |
| 68 | Ga0070681_10037883 | 3300005458 | Bacteria | 4835 |
| 69 | Ga0070681_10096500 | 3300005458 | Bacteria | 2904 |
| 70 | Ga0070681_10172085 | 3300005458 | Viruses | 2087 |
| 71 | Ga0070681_10263394 | 3300005458 | Bacteria | 1636 |
| 72 | Ga0070681_10383842 | 3300005458 | Bacteria | 1315 |
| 73 | Ga0068867_100004106 | 3300005459 | Bacteria | 10231 |
| 74 | Ga0070706_100017494 | 3300005467 | Bacteria | 6616 |
| 75 | Ga0070706_100098339 | 3300005467 | Bacteria | 2719 |
| 76 | Ga0070706_100160223 | 3300005467 | Archaea | 2101 |
| 77 | Ga0070707_100002411 | 3300005468 | Bacteria | 17834 |
| 78 | Ga0070707_100005567 | 3300005468 | Bacteria | 11766 |
| 79 | Ga0070707_100049896 | 3300005468 | Bacteria | 4012 |
| 80 | Ga0070707_100062611 | 3300005468 | Bacteria | 3569 |
| 81 | Ga0070707_100256742 | 3300005468 | Bacteria | 1701 |
| 82 | Ga0070707_100308575 | 3300005468 | Archaea | 1538 |
| 83 | Ga0070698_100035503 | 3300005471 | Bacteria | 5155 |
| 84 | Ga0070698_100101025 | 3300005471 | Bacteria | 2856 |
| 85 | Ga0070698_100382164 | 3300005471 | Archaea | 1341 |
| 86 | Ga0070698_100444143 | 3300005471 | Unclassified | 1232 |
| 87 | Ga0070699_100023039 | 3300005518 | Bacteria | 5365 |
| 88 | Ga0070679_100005688 | 3300005530 | Bacteria | 11562 |
| 89 | Ga0070679_100009583 | 3300005530 | Bacteria | 9158 |
| 90 | Ga0070679_100076580 | 3300005530 | Bacteria | 3334 |
| 91 | Ga0070679_100081984 | 3300005530 | Bacteria | 3215 |
| 92 | Ga0070679_100087347 | 3300005530 | Bacteria | 3105 |
| 93 | Ga0070679_100096791 | 3300005530 | Bacteria | 2939 |
| 94 | Ga0070679_100202080 | 3300005530 | Unclassified | 1953 |
| 95 | Ga0070679_100203953 | 3300005530 | Bacteria | 1942 |
| 96 | Ga0070679_100394789 | 3300005530 | Bacteria | 1329 |
| 97 | Ga0070684_100003268 | 3300005535 | Bacteria | 12134 |
| 98 | Ga0070684_100122344 | 3300005535 | Bacteria | 2341 |
| 99 | Ga0070684_100131177 | 3300005535 | Unclassified | 2261 |
| 100 | Ga0070684_100237807 | 3300005535 | Bacteria | 1664 |
| 101 | Ga0070697_100033386 | 3300005536 | Bacteria | 4144 |
| 102 | Ga0068853_100157183 | 3300005539 | Bacteria | 2049 |
| 103 | Ga0070686_100038067 | 3300005544 | Bacteria | 2987 |
| 104 | Ga0070686_100234538 | 3300005544 | Bacteria | 1333 |
| 105 | Ga0070695_100000510 | 3300005545 | Bacteria | 20376 |
| 106 | Ga0070695_100051706 | 3300005545 | Bacteria | 2637 |
| 107 | Ga0070696_100052935 | 3300005546 | Bacteria | 2825 |
| 108 | Ga0070696_100261392 | 3300005546 | Archaea | 1313 |
| 109 | Ga0070693_100005253 | 3300005547 | Bacteria | 6198 |
| 110 | Ga0070693_100006963 | 3300005547 | Bacteria | 5501 |
| 111 | Ga0070704_100006405 | 3300005549 | Bacteria | 6941 |
| 112 | Ga0070704_100129434 | 3300005549 | Bacteria | 1954 |
| 113 | Ga0068855_100011653 | 3300005563 | Bacteria | 10625 |
| 114 | Ga0068855_100021782 | 3300005563 | Bacteria | 7687 |
| 115 | Ga0068855_100062270 | 3300005563 | Bacteria | 4355 |
| 116 | Ga0068855_100090875 | 3300005563 | Bacteria | 3522 |
| 117 | Ga0068855_100130249 | 3300005563 | Bacteria | 2873 |
| 118 | Ga0068855_100134496 | 3300005563 | Archaea | 2821 |
| 119 | Ga0068855_100481412 | 3300005563 | Bacteria | 1351 |
| 120 | Ga0068855_100541201 | 3300005563 | Archaea | 1261 |
| 121 | Ga0068857_100014855 | 3300005577 | Bacteria | 6790 |
| 122 | Ga0068857_100066973 | 3300005577 | Bacteria | 3195 |
| 123 | Ga0068857_100327286 | 3300005577 | Bacteria | 1416 |
| 124 | Ga0068856_100037265 | 3300005614 | Bacteria | 4771 |
| 125 | Ga0068856_100051074 | 3300005614 | Bacteria | 4077 |
| 126 | Ga0068856_100308920 | 3300005614 | Bacteria | 1599 |
| 127 | Ga0068856_100333106 | 3300005614 | Bacteria | 1535 |
| 128 | Ga0070702_100257174 | 3300005615 | Bacteria | 1187 |
| 129 | Ga0068852_100157886 | 3300005616 | Bacteria | 2115 |
| 130 | Ga0068866_10021370 | 3300005718 | Bacteria | 2980 |
| 131 | Ga0068861_100185694 | 3300005719 | Bacteria | 1734 |
| 132 | Ga0068860_100066125 | 3300005843 | Bacteria | 3434 |
| 133 | Ga0081455_10002152 | 3300005937 | Bacteria | 23499 |
| 134 | Ga0081455_10059491 | 3300005937 | Bacteria | 3226 |
| 135 | Ga0081455_10112407 | 3300005937 | Bacteria | 2162 |
| 136 | Ga0081538_10133063 | 3300005981 | Bacteria | 1164 |
| 137 | Ga0081540_1002321 | 3300005983 | Bacteria | 15592 |
| 138 | Ga0081540_1031707 | 3300005983 | Bacteria | 2899 |
| 139 | Ga0070717_10003122 | 3300006028 | Bacteria | 11831 |
| 140 | Ga0070717_10026150 | 3300006028 | Bacteria | 4653 |
| 141 | Ga0070717_10032269 | 3300006028 | Bacteria | 4220 |
| 142 | Ga0070717_10119304 | 3300006028 | Bacteria | 2258 |
| 143 | Ga0070717_10232711 | 3300006028 | Bacteria | 1623 |
| 144 | Ga0075365_10131586 | 3300006038 | Bacteria | 1731 |
| 145 | Ga0070715_10004406 | 3300006163 | Bacteria | 4616 |
| 146 | Ga0070712_100036398 | 3300006175 | Bacteria | 3349 |
| 147 | Ga0070712_100050683 | 3300006175 | Bacteria | 2889 |
| 148 | Ga0070712_100213419 | 3300006175 | Bacteria | 1523 |
| 149 | Ga0097621_100089004 | 3300006237 | Bacteria | 2580 |
| 150 | Ga0097621_100443267 | 3300006237 | Bacteria | 1169 |
| 151 | Ga0068871_100037358 | 3300006358 | Bacteria | 3872 |
| 152 | Ga0075434_100002536 | 3300006871 | Bacteria | 16113 |
| 153 | Ga0075434_100016864 | 3300006871 | Bacteria | 7027 |
| 154 | Ga0075434_100055625 | 3300006871 | Bacteria | 3932 |
| 155 | Ga0075434_100593576 | 3300006871 | Bacteria | 1127 |
| 156 | Ga0075436_100269381 | 3300006914 | Unclassified | 1216 |
| 157 | Ga0075435_100002096 | 3300007076 | Bacteria | 13104 |
| 158 | Ga0105240_10034877 | 3300009093 | Bacteria | 6487 |
| 159 | Ga0105240_10141997 | 3300009093 | Archaea | 2870 |
| 160 | Ga0105240_10287164 | 3300009093 | Bacteria | 1888 |
| 161 | Ga0111539_10444035 | 3300009094 | Bacteria | 1510 |
| 162 | Ga0105247_10139942 | 3300009101 | Viruses | 1585 |
| 163 | Ga0114129_10060892 | 3300009147 | Bacteria | 5277 |
| 164 | Ga0114129_10246271 | 3300009147 | Bacteria | 2401 |
| 165 | Ga0105243_10117946 | 3300009148 | Bacteria | 2232 |
| 166 | Ga0105243_10166607 | 3300009148 | Bacteria | 1905 |
| 167 | Ga0105243_10170882 | 3300009148 | Bacteria | 1882 |
| 168 | Ga0105243_10420326 | 3300009148 | Bacteria | 1247 |
| 169 | Ga0105241_10072637 | 3300009174 | Bacteria | 2675 |
| 170 | Ga0105241_10093413 | 3300009174 | Archaea | 2377 |
| 171 | Ga0105242_10144414 | 3300009176 | Bacteria | 2068 |
| 172 | Ga0105242_10476500 | 3300009176 | Bacteria | 1182 |
| 173 | Ga0105248_10194180 | 3300009177 | Unclassified | 2287 |
| 174 | Ga0105237_10106868 | 3300009545 | Bacteria | 2791 |
| 175 | Ga0105237_10339998 | 3300009545 | Bacteria | 1505 |
| 176 | Ga0105238_10050677 | 3300009551 | Bacteria | 4179 |
| 177 | Ga0105238_10064893 | 3300009551 | Unclassified | 3652 |
| 178 | Ga0105238_10075844 | 3300009551 | Bacteria | 3354 |
| 179 | Ga0105238_10308217 | 3300009551 | Bacteria | 1568 |
| 180 | Ga0105238_10713679 | 3300009551 | Bacteria | 1015 |
| 181 | Ga0105249_10055316 | 3300009553 | Bacteria | 3629 |
| 182 | Ga0105249_10185111 | 3300009553 | Bacteria | 2029 |
| 183 | Ga0105239_10216351 | 3300010375 | Bacteria | 2148 |
| 184 | Ga0105239_10251438 | 3300010375 | Bacteria | 1985 |
| 185 | Ga0105239_10376142 | 3300010375 | Archaea | 1606 |
| 186 | Ga0157373_10019632 | 3300013100 | Bacteria | 4916 |
| 187 | Ga0157371_10127131 | 3300013102 | Bacteria | 1813 |
| 188 | Ga0157371_10131288 | 3300013102 | Bacteria | 1782 |
| 189 | Ga0157371_10141835 | 3300013102 | Unclassified | 1711 |
| 190 | Ga0157370_10002167 | 3300013104 | Bacteria | 23946 |
| 191 | Ga0157370_10015489 | 3300013104 | Bacteria | 7752 |
| 192 | Ga0157370_10092948 | 3300013104 | Unclassified | 2831 |
| 193 | Ga0157370_10110839 | 3300013104 | Bacteria | 2565 |
| 194 | Ga0157370_10157426 | 3300013104 | Bacteria | 2114 |
| 195 | Ga0157370_10697110 | 3300013104 | Archaea | 927 |
| 196 | Ga0157369_10018636 | 3300013105 | Archaea | 7782 |
| 197 | Ga0157369_10031229 | 3300013105 | Bacteria | 5868 |
| 198 | Ga0157369_10222053 | 3300013105 | Bacteria | 1978 |
| 199 | Ga0157369_10273664 | 3300013105 | Bacteria | 1759 |
| 200 | Ga0157369_10691765 | 3300013105 | Bacteria | 1050 |
| 201 | Ga0157374_10029558 | 3300013296 | Bacteria | 4965 |
| 202 | Ga0157374_10074827 | 3300013296 | Bacteria | 3199 |
| 203 | Ga0157374_10532763 | 3300013296 | Bacteria | 1181 |
| 204 | Ga0157378_10720156 | 3300013297 | Bacteria | 1019 |
| 205 | Ga0163162_10318136 | 3300013306 | Bacteria | 1689 |
| 206 | Ga0157372_10310707 | 3300013307 | Archaea | 1835 |
| 207 | Ga0157372_10321040 | 3300013307 | Viruses | 1803 |
| 208 | Ga0157372_10430363 | 3300013307 | Bacteria | 1538 |
| 209 | Ga0157375_10018482 | 3300013308 | Bacteria | 6323 |
| 210 | Ga0157375_10369230 | 3300013308 | Bacteria | 1601 |
| 211 | Ga0163163_10079615 | 3300014325 | Bacteria | 3275 |
| 212 | Ga0163163_10474080 | 3300014325 | Bacteria | 1312 |
| 213 | Ga0157380_10595221 | 3300014326 | Bacteria | 1093 |
| 214 | Ga0182008_10002410 | 3300014497 | Bacteria | 11745 |
| 215 | Ga0182008_10094146 | 3300014497 | Bacteria | 1478 |
| 216 | Ga0157379_10351162 | 3300014968 | Bacteria | 1350 |
| 217 | Ga0157379_10563606 | 3300014968 | Bacteria | 1061 |
| 218 | Ga0157376_10172788 | 3300014969 | Bacteria | 1969 |
| 219 | Ga0182006_1011287 | 3300015261 | Bacteria | 3937 |
| 220 | Ga0197907_10431347 | 3300020069 | Bacteria | 1259 |
| 221 | Ga0206356_11771762 | 3300020070 | Bacteria | 1698 |
| 222 | Ga0206354_11091643 | 3300020081 | Unclassified | 2043 |
| 223 | Ga0206353_10675245 | 3300020082 | Bacteria | 2361 |
| 224 | Ga0206353_10803903 | 3300020082 | Unclassified | 2338 |
| 225 | Ga0206353_11572253 | 3300020082 | Bacteria | 2291 |
| 226 | Ga0206353_11851607 | 3300020082 | Archaea | 3674 |
| 227 | Ga0213871_10011936 | 3300021441 | Bacteria | 2005 |
| 228 | Ga0213871_10062398 | 3300021441 | Unclassified | 1040 |
| 229 | Ga0207692_10006533 | 3300025898 | Viruses | 4732 |
| 230 | Ga0207692_10019598 | 3300025898 | Archaea | 3060 |
| 231 | Ga0207692_10143982 | 3300025898 | Bacteria | 1358 |
| 232 | Ga0207685_10006855 | 3300025905 | Viruses | 3134 |
| 233 | Ga0207699_10014422 | 3300025906 | Bacteria | 4074 |
| 234 | Ga0207699_10034232 | 3300025906 | Viruses | 2879 |
| 235 | Ga0207705_10075470 | 3300025909 | Unclassified | 2449 |
| 236 | Ga0207684_10189848 | 3300025910 | Bacteria | 1772 |
| 237 | Ga0207684_10220297 | 3300025910 | Archaea | 1638 |
| 238 | Ga0207707_10002423 | 3300025912 | Bacteria | 16786 |
| 239 | Ga0207707_10003146 | 3300025912 | Bacteria | 14652 |
| 240 | Ga0207707_10013393 | 3300025912 | Bacteria | 7151 |
| 241 | Ga0207707_10032352 | 3300025912 | Bacteria | 4578 |
| 242 | Ga0207707_10034687 | 3300025912 | Bacteria | 4414 |
| 243 | Ga0207707_10060152 | 3300025912 | Bacteria | 3305 |
| 244 | Ga0207707_10246634 | 3300025912 | Bacteria | 1552 |
| 245 | Ga0207707_10281860 | 3300025912 | Bacteria | 1439 |
| 246 | Ga0207695_10026630 | 3300025913 | Bacteria | 6452 |
| 247 | Ga0207695_10086973 | 3300025913 | Archaea | 3150 |
| 248 | Ga0207695_10463154 | 3300025913 | Bacteria | 1151 |
| 249 | Ga0207693_10000198 | 3300025915 | Bacteria | 54576 |
| 250 | Ga0207693_10001236 | 3300025915 | Bacteria | 22780 |
| 251 | Ga0207693_10011298 | 3300025915 | Bacteria | 7229 |
| 252 | Ga0207693_10095680 | 3300025915 | Bacteria | 2328 |
| 253 | Ga0207693_10166137 | 3300025915 | Bacteria | 1737 |
| 254 | Ga0207693_10188926 | 3300025915 | Bacteria | 1621 |
| 255 | Ga0207663_10001587 | 3300025916 | Bacteria | 10677 |
| 256 | Ga0207663_10002285 | 3300025916 | Bacteria | 9179 |
| 257 | Ga0207663_10012633 | 3300025916 | Bacteria | 4571 |
| 258 | Ga0207663_10026765 | 3300025916 | Bacteria | 3352 |
| 259 | Ga0207660_10024801 | 3300025917 | Bacteria | 4062 |
| 260 | Ga0207660_10042389 | 3300025917 | Bacteria | 3195 |
| 261 | Ga0207660_10339217 | 3300025917 | Bacteria | 1203 |
| 262 | Ga0207657_10000729 | 3300025919 | Bacteria | 34956 |
| 263 | Ga0207657_10001944 | 3300025919 | Bacteria | 22302 |
| 264 | Ga0207657_10002416 | 3300025919 | Bacteria | 20175 |
| 265 | Ga0207657_10002425 | 3300025919 | Bacteria | 20137 |
| 266 | Ga0207657_10009726 | 3300025919 | Bacteria | 9642 |
| 267 | Ga0207657_10027145 | 3300025919 | Bacteria | 5248 |
| 268 | Ga0207657_10035128 | 3300025919 | Bacteria | 4498 |
| 269 | Ga0207657_10037458 | 3300025919 | Bacteria | 4330 |
| 270 | Ga0207657_10118803 | 3300025919 | Bacteria | 2176 |
| 271 | Ga0207657_10132457 | 3300025919 | Bacteria | 2042 |
| 272 | Ga0207649_10067582 | 3300025920 | Bacteria | 2270 |
| 273 | Ga0207652_10020492 | 3300025921 | Bacteria | 5446 |
| 274 | Ga0207652_10036464 | 3300025921 | Bacteria | 4157 |
| 275 | Ga0207652_10039331 | 3300025921 | Bacteria | 4014 |
| 276 | Ga0207652_10060085 | 3300025921 | Bacteria | 3278 |
| 277 | Ga0207652_10094954 | 3300025921 | Bacteria | 2626 |
| 278 | Ga0207652_10159514 | 3300025921 | Bacteria | 2022 |
| 279 | Ga0207652_10266815 | 3300025921 | Archaea | 1544 |
| 280 | Ga0207652_10357906 | 3300025921 | Archaea | 1317 |
| 281 | Ga0207646_10006773 | 3300025922 | Bacteria | 11790 |
| 282 | Ga0207646_10038974 | 3300025922 | Bacteria | 4277 |
| 283 | Ga0207646_10171619 | 3300025922 | Bacteria | 1958 |
| 284 | Ga0207687_10030229 | 3300025927 | Bacteria | 3650 |
| 285 | Ga0207687_10314486 | 3300025927 | Unclassified | 1266 |
| 286 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 287 | Ga0207700_10008204 | 3300025928 | Bacteria | 6452 |
| 288 | Ga0207700_10204248 | 3300025928 | Bacteria | 1667 |
| 289 | Ga0207700_10211520 | 3300025928 | Bacteria | 1640 |
| 290 | Ga0207700_10442565 | 3300025928 | Bacteria | 1144 |
| 291 | Ga0207664_10004871 | 3300025929 | Bacteria | 9123 |
| 292 | Ga0207664_10020692 | 3300025929 | Bacteria | 4883 |
| 293 | Ga0207664_10022769 | 3300025929 | Bacteria | 4685 |
| 294 | Ga0207664_10036073 | 3300025929 | Bacteria | 3819 |
| 295 | Ga0207664_10054474 | 3300025929 | Viruses | 3169 |
| 296 | Ga0207664_10062382 | 3300025929 | Bacteria | 2976 |
| 297 | Ga0207664_10159558 | 3300025929 | Archaea | 1922 |
| 298 | Ga0207664_10202970 | 3300025929 | Bacteria | 1712 |
| 299 | Ga0207690_10030517 | 3300025932 | Bacteria | 3439 |
| 300 | Ga0207690_10235815 | 3300025932 | Bacteria | 1407 |
| 301 | Ga0207706_10005925 | 3300025933 | Bacteria | 11366 |
| 302 | Ga0207686_10045997 | 3300025934 | Bacteria | 2689 |
| 303 | Ga0207709_10021542 | 3300025935 | Bacteria | 3650 |
| 304 | Ga0207709_10092087 | 3300025935 | Bacteria | 1984 |
| 305 | Ga0207709_10125925 | 3300025935 | Bacteria | 1738 |
| 306 | Ga0207704_10128909 | 3300025938 | Bacteria | 1747 |
| 307 | Ga0207665_10001160 | 3300025939 | Bacteria | 17714 |
| 308 | Ga0207711_10188256 | 3300025941 | Unclassified | 1880 |
| 309 | Ga0207711_10242217 | 3300025941 | Viruses | 1654 |
| 310 | Ga0207661_10011427 | 3300025944 | Bacteria | 6433 |
| 311 | Ga0207661_10061371 | 3300025944 | Bacteria | 3037 |
| 312 | Ga0207661_10120593 | 3300025944 | Bacteria | 2232 |
| 313 | Ga0207661_10153665 | 3300025944 | Bacteria | 1991 |
| 314 | Ga0207661_10178683 | 3300025944 | Archaea | 1852 |
| 315 | Ga0207661_10353747 | 3300025944 | Bacteria | 1326 |
| 316 | Ga0207667_10027332 | 3300025949 | Bacteria | 6212 |
| 317 | Ga0207667_10039109 | 3300025949 | Bacteria | 5057 |
| 318 | Ga0207667_10064993 | 3300025949 | Bacteria | 3807 |
| 319 | Ga0207667_10110636 | 3300025949 | Bacteria | 2834 |
| 320 | Ga0207667_10258340 | 3300025949 | Bacteria | 1781 |
| 321 | Ga0207667_10440796 | 3300025949 | Archaea | 1324 |
| 322 | Ga0207651_10311020 | 3300025960 | Bacteria | 1314 |
| 323 | Ga0207668_10427865 | 3300025972 | Bacteria | 1125 |
| 324 | Ga0207640_10223349 | 3300025981 | Bacteria | 1444 |
| 325 | Ga0207639_10174660 | 3300026041 | Bacteria | 1823 |
| 326 | Ga0207678_10019356 | 3300026067 | Bacteria | 5980 |
| 327 | Ga0207678_10360103 | 3300026067 | Bacteria | 1255 |
| 328 | Ga0207708_10000986 | 3300026075 | Bacteria | 21267 |
| 329 | Ga0207702_10049965 | 3300026078 | Bacteria | 3530 |
| 330 | Ga0207702_10060806 | 3300026078 | Bacteria | 3220 |
| 331 | Ga0207702_10098734 | 3300026078 | Bacteria | 2573 |
| 332 | Ga0207702_10126675 | 3300026078 | Bacteria | 2294 |
| 333 | Ga0207648_10001924 | 3300026089 | Bacteria | 22696 |
| 334 | Ga0207674_10006916 | 3300026116 | Bacteria | 13286 |
| 335 | Ga0207674_10015274 | 3300026116 | Bacteria | 8442 |
| 336 | Ga0207674_10176158 | 3300026116 | Unclassified | 2091 |
| 337 | Ga0207675_100018455 | 3300026118 | Bacteria | 6506 |
| 338 | Ga0207675_100383335 | 3300026118 | Bacteria | 1383 |
| 339 | Ga0207683_10014165 | 3300026121 | Bacteria | 6794 |
| 340 | Ga0207683_10014555 | 3300026121 | Bacteria | 6700 |
| 341 | Ga0207683_10282782 | 3300026121 | Bacteria | 1516 |
| 342 | Ga0207698_10046006 | 3300026142 | Bacteria | 3291 |
| 343 | Ga0207698_10370521 | 3300026142 | Bacteria | 1359 |
| 344 | Ga0207428_10108669 | 3300027907 | Bacteria | 2136 |
| 345 | Ga0268265_10019906 | 3300028380 | Bacteria | 4675 |
| 346 | Ga0265334_10006282 | 3300028573 | Bacteria | 5133 |
| 347 | Ga0265318_10001740 | 3300028577 | Bacteria | 12453 |
| 348 | Ga0265322_10011017 | 3300028654 | Bacteria | 2623 |
| 349 | Ga0265338_10002373 | 3300028800 | Bacteria | 28401 |
| 350 | Ga0265338_10004407 | 3300028800 | Bacteria | 19038 |
| 351 | Ga0265338_10009073 | 3300028800 | Bacteria | 11962 |
| 352 | Ga0265338_10018002 | 3300028800 | Bacteria | 7584 |
| 353 | Ga0265338_10048722 | 3300028800 | Bacteria | 3851 |
| 354 | Ga0265324_10009357 | 3300029957 | Bacteria | 3830 |
| 355 | Ga0265330_10017276 | 3300031235 | Bacteria | 3324 |
| 356 | Ga0265320_10094178 | 3300031240 | Bacteria | 1385 |
| 357 | Ga0265329_10013593 | 3300031242 | Bacteria | 2898 |
| 358 | Ga0265340_10052617 | 3300031247 | Bacteria | 1968 |
| 359 | Ga0265339_10046083 | 3300031249 | Bacteria | 2398 |
| 360 | Ga0265331_10030260 | 3300031250 | Unclassified | 2696 |
| 361 | Ga0265327_10011995 | 3300031251 | Bacteria | 5899 |
| 362 | Ga0265316_10034585 | 3300031344 | Bacteria | 4103 |
| 363 | Ga0307408_100091832 | 3300031548 | Bacteria | 2294 |
| 364 | Ga0265313_10008218 | 3300031595 | Bacteria | 6970 |
| 365 | Ga0265314_10032081 | 3300031711 | Bacteria | 3869 |
| 366 | Ga0265314_10035094 | 3300031711 | Bacteria | 3657 |
| 367 | Ga0265342_10010109 | 3300031712 | Bacteria | 6577 |
| 368 | Ga0307405_10162248 | 3300031731 | Bacteria | 1585 |
| 369 | Ga0307412_10117038 | 3300031911 | Bacteria | 1913 |
| 370 | Ga0307416_100304657 | 3300032002 | Bacteria | 1586 |
| 371 | Ga0307416_100824550 | 3300032002 | Bacteria | 1024 |
| 372 | Ga0307415_100257229 | 3300032126 | Bacteria | 1422 |
| 373 | Ga0373930_0019613 | 3300034816 | Bacteria | 1310 |
| 374 | Ga0373938_0033567 | 3300034957 | Bacteria | 1111 |
| 375 | Ga0373926_0097929 | 3300035083 | Bacteria | 1095 |
| 376 | Ga0373929_0031673 | 3300035085 | Unclassified | 1134 |
| 377 | Ga0373949_0009300 | 3300035090 | Bacteria | 2153 |
| 378 | Ga0373936_0003528 | 3300035113 | Bacteria | 5884 |
| 379 | Ga0373945_0012094 | 3300035116 | Bacteria | 2862 |
| 380 | Ga0373945_0038516 | 3300035116 | Bacteria | 1720 |
| 381 | Ga0373943_0008261 | 3300035170 | Bacteria | 4671 |
| 382 | Ga0373943_0010211 | 3300035170 | Bacteria | 4210 |
| 383 | Ga0373943_0079290 | 3300035170 | Bacteria | 1680 |
| 384 | Ga0373946_0116190 | 3300035171 | Archaea | 1217 |
| 385 | Ga0373955_0011626 | 3300035172 | Bacteria | 4204 |
| 386 | Ga0373931_0043647 | 3300035691 | Bacteria | 2362 |
| 387 | Ga0373931_0327906 | 3300035691 | Bacteria | 953 |
| 388 | Ga0373935_0019055 | 3300035692 | Bacteria | 4185 |
| 389 | Ga0373935_0026168 | 3300035692 | Bacteria | 3599 |
| 390 | Ga0373927_0224198 | 3300035695 | Archaea | 1235 |
| 391 | Ga0373927_0232868 | 3300035695 | Bacteria | 1210 |
| 392 | Ga0373933_0210488 | 3300035724 | Unclassified | 1246 |
| 393 | Ga0373947_0007236 | 3300035725 | Bacteria | 6432 |
| 394 | Ga0373947_0027357 | 3300035725 | Bacteria | 3337 |
| 395 | Ga0373947_0175565 | 3300035725 | Bacteria | 1392 |
| 396 | Ga0373937_0002702 | 3300036401 | Bacteria | 14815 |
| 397 | Ga0373937_0013631 | 3300036401 | Bacteria | 7162 |
| 398 | Ga0373925_0000887 | 3300037068 | Bacteria | 27335 |
| 399 | Ga0373925_0048940 | 3300037068 | Bacteria | 3150 |
| 400 | Ga0373925_0423318 | 3300037068 | Archaea | 1088 |
| 401 | Ga0395899_0006493 | 3300037312 | Bacteria | 9062 |
| 402 | Ga0395899_0027720 | 3300037312 | Bacteria | 4268 |
| 403 | Ga0395899_0038289 | 3300037312 | Bacteria | 3592 |
| 404 | Ga0395899_0065796 | 3300037312 | Archaea | 2663 |
| 405 | Ga0395899_0097873 | 3300037312 | Bacteria | 2120 |
| 406 | Ga0395899_0115847 | 3300037312 | Bacteria | 1923 |
| 407 | Ga0395899_0137982 | 3300037312 | Bacteria | 1737 |
| 408 | Ga0395899_0203010 | 3300037312 | Bacteria | 1381 |
| 409 | Ga0395900_0003003 | 3300037418 | Bacteria | 18348 |
| 410 | Ga0395900_0005192 | 3300037418 | Bacteria | 13669 |
| 411 | Ga0395900_0010314 | 3300037418 | Bacteria | 9559 |
| 412 | Ga0395900_0025691 | 3300037418 | Bacteria | 6029 |
| 413 | Ga0395900_0047346 | 3300037418 | Bacteria | 4427 |
| 414 | Ga0395900_0054811 | 3300037418 | Bacteria | 4105 |
| 415 | Ga0395900_0058822 | 3300037418 | Bacteria | 3957 |
| 416 | Ga0395900_0084378 | 3300037418 | Bacteria | 3264 |
| 417 | Ga0395900_0102560 | 3300037418 | Bacteria | 2939 |
| 418 | Ga0395900_0117441 | 3300037418 | Bacteria | 2729 |
| 419 | Ga0395900_0119574 | 3300037418 | Bacteria | 2704 |
| 420 | Ga0395900_0190422 | 3300037418 | Bacteria | 2081 |
| 421 | Ga0395900_0200708 | 3300037418 | Bacteria | 2018 |
| 422 | Ga0395900_0201288 | 3300037418 | Bacteria | 2014 |
| 423 | Ga0395900_0250774 | 3300037418 | Unclassified | 1771 |
| 424 | Ga0395900_0254807 | 3300037418 | Bacteria | 1755 |
| 425 | Ga0395900_0364211 | 3300037418 | Unclassified | 1416 |
| 426 | Ga0395900_0397301 | 3300037418 | Archaea | 1343 |
| 427 | Ga0395900_0522844 | 3300037418 | Bacteria | 1134 |
| 428 | Ga0395898_0002500 | 3300037466 | Bacteria | 21621 |
| 429 | Ga0395898_0005115 | 3300037466 | Bacteria | 14209 |
| 430 | Ga0395898_0005507 | 3300037466 | Bacteria | 13664 |
| 431 | Ga0395898_0006288 | 3300037466 | Bacteria | 12694 |
| 432 | Ga0395898_0006891 | 3300037466 | Bacteria | 12089 |
| 433 | Ga0395898_0007490 | 3300037466 | Bacteria | 11594 |
| 434 | Ga0395898_0010056 | 3300037466 | Bacteria | 9901 |
| 435 | Ga0395898_0010259 | 3300037466 | Bacteria | 9805 |
| 436 | Ga0395898_0038193 | 3300037466 | Bacteria | 4760 |
| 437 | Ga0395898_0054599 | 3300037466 | Bacteria | 3898 |
| 438 | Ga0395898_0094559 | 3300037466 | Bacteria | 2872 |
| 439 | Ga0395898_0141984 | 3300037466 | Bacteria | 2299 |
| 440 | Ga0395898_0206992 | 3300037466 | Bacteria | 1872 |
| 441 | Ga0395898_0334317 | 3300037466 | Unclassified | 1444 |
| 442 | Ga0395898_0349251 | 3300037466 | Unclassified | 1410 |
| 443 | Ga0395898_0380825 | 3300037466 | Unclassified | 1345 |
| 444 | Ga0395905_0004014 | 3300037471 | Bacteria | 15465 |
| 445 | Ga0395905_0004601 | 3300037471 | Bacteria | 14273 |
| 446 | Ga0395905_0015855 | 3300037471 | Bacteria | 7158 |
| 447 | Ga0395905_0029709 | 3300037471 | Bacteria | 5151 |
| 448 | Ga0395905_0057057 | 3300037471 | Bacteria | 3652 |
| 449 | Ga0395905_0065671 | 3300037471 | Unclassified | 3397 |
| 450 | Ga0395905_0099535 | 3300037471 | Bacteria | 2730 |
| 451 | Ga0395905_0105216 | 3300037471 | Bacteria | 2650 |
| 452 | Ga0395905_0121863 | 3300037471 | Bacteria | 2452 |
| 453 | Ga0395905_0125610 | 3300037471 | Bacteria | 2412 |
| 454 | Ga0395905_0206378 | 3300037471 | Bacteria | 1841 |
| 455 | Ga0395905_0239553 | 3300037471 | Unclassified | 1695 |
| 456 | Ga0395901_0001290 | 3300038443 | Bacteria | 26488 |
| 457 | Ga0395901_0005511 | 3300038443 | Bacteria | 12819 |
| 458 | Ga0395901_0008519 | 3300038443 | Bacteria | 10359 |
| 459 | Ga0395901_0009578 | 3300038443 | Bacteria | 9830 |
| 460 | Ga0395901_0010572 | 3300038443 | Bacteria | 9349 |
| 461 | Ga0395901_0045077 | 3300038443 | Bacteria | 4575 |
| 462 | Ga0395901_0052258 | 3300038443 | Bacteria | 4246 |
| 463 | Ga0395901_0053403 | 3300038443 | Bacteria | 4198 |
| 464 | Ga0395901_0058631 | 3300038443 | Bacteria | 4004 |
| 465 | Ga0395901_0062351 | 3300038443 | Bacteria | 3880 |
| 466 | Ga0395901_0103279 | 3300038443 | Bacteria | 2991 |
| 467 | Ga0395901_0144857 | 3300038443 | Bacteria | 2497 |
| 468 | Ga0395901_0207421 | 3300038443 | Viruses | 2052 |
| 469 | Ga0395901_0270849 | 3300038443 | Bacteria | 1766 |
| 470 | Ga0395901_0306311 | 3300038443 | Unclassified | 1646 |
| 471 | Ga0395901_0346725 | 3300038443 | Bacteria | 1533 |
| 472 | Ga0395901_0385656 | 3300038443 | Unclassified | 1441 |
| 473 | Ga0395901_0398818 | 3300038443 | Bacteria | 1413 |
| 474 | Ga0395901_0411670 | 3300038443 | Bacteria | 1388 |
| 475 | Ga0436365_1635017 | 3300039437 | Bacteria | 1387 |
| 476 | Ga0436360_0675505 | 3300039438 | Bacteria | 9468 |
| 477 | Ga0436363_1405693 | 3300039450 | Bacteria | 2236 |
| 478 | Ga0436362_0654759 | 3300039453 | Bacteria | 5854 |
| 479 | Ga0439448_0031201 | 3300042005 | Bacteria | 1692 |
| 480 | Ga0466969_0008928 | 3300044656 | Bacteria | 5317 |
| 481 | Ga0466966_0008382 | 3300044684 | Bacteria | 6846 |
| 482 | Ga0466966_0021106 | 3300044684 | Bacteria | 4277 |
| 483 | Ga0466966_0043266 | 3300044684 | Bacteria | 2888 |
| 484 | Ga0466961_0009165 | 3300044693 | Bacteria | 6302 |
| 485 | Ga0466961_0010210 | 3300044693 | Bacteria | 5981 |
| 486 | Ga0466961_0018116 | 3300044693 | Bacteria | 4528 |
| 487 | Ga0466961_0018402 | 3300044693 | Bacteria | 4493 |
| 488 | Ga0466961_0053370 | 3300044693 | Bacteria | 2579 |
| 489 | Ga0466961_0072893 | 3300044693 | Bacteria | 2178 |
| 490 | Ga0466963_0000245 | 3300044694 | Bacteria | 23656 |
| 491 | Ga0466963_0001068 | 3300044694 | Bacteria | 14284 |
| 492 | Ga0466963_0001151 | 3300044694 | Bacteria | 13860 |
| 493 | Ga0466963_0001242 | 3300044694 | Bacteria | 13478 |
| 494 | Ga0466963_0001451 | 3300044694 | Bacteria | 12777 |
| 495 | Ga0466963_0003886 | 3300044694 | Bacteria | 8629 |
| 496 | Ga0466963_0008385 | 3300044694 | Bacteria | 6193 |
| 497 | Ga0466963_0011379 | 3300044694 | Bacteria | 5417 |
| 498 | Ga0466963_0017456 | 3300044694 | Viruses | 4474 |
| 499 | Ga0466963_0029728 | 3300044694 | Bacteria | 3520 |
| 500 | Ga0466963_0042163 | 3300044694 | Bacteria | 2995 |
| 501 | Ga0466963_0042817 | 3300044694 | Bacteria | 2974 |
| 502 | Ga0466963_0045142 | 3300044694 | Bacteria | 2902 |
| 503 | Ga0466963_0057870 | 3300044694 | Bacteria | 2582 |
| 504 | Ga0466963_0059378 | 3300044694 | Bacteria | 2552 |
| 505 | Ga0466963_0066958 | 3300044694 | Unclassified | 2410 |
| 506 | Ga0466963_0082539 | 3300044694 | Bacteria | 2179 |
| 507 | Ga0466963_0094190 | 3300044694 | Bacteria | 2042 |
| 508 | Ga0466964_0001695 | 3300044706 | Bacteria | 7611 |
| 509 | Ga0466964_0004325 | 3300044706 | Bacteria | 5235 |
| 510 | Ga0466964_0010161 | 3300044706 | Bacteria | 3548 |
| 511 | Ga0466964_0012649 | 3300044706 | Bacteria | 3196 |
| 512 | Ga0466964_0062957 | 3300044706 | Bacteria | 1548 |
| 513 | Ga0466971_0005705 | 3300044719 | Bacteria | 5411 |
| 514 | Ga0466971_0010690 | 3300044719 | Bacteria | 4015 |
| 515 | Ga0466971_0034164 | 3300044719 | Bacteria | 2279 |
| 516 | Ga0466971_0081283 | 3300044719 | Viruses | 1478 |
| 517 | Ga0466968_0001438 | 3300044735 | Bacteria | 8548 |
| 518 | Ga0466968_0029908 | 3300044735 | Bacteria | 2254 |
| 519 | Ga0466968_0072405 | 3300044735 | Bacteria | 1502 |
| 520 | Ga0466970_0015231 | 3300044765 | Bacteria | 3954 |
| 521 | Ga0466957_0002511 | 3300044842 | Bacteria | 9872 |
| 522 | Ga0466957_0014263 | 3300044842 | Bacteria | 4627 |
| 523 | Ga0466957_0027826 | 3300044842 | Bacteria | 3361 |
| 524 | Ga0466957_0035546 | 3300044842 | Bacteria | 2989 |
| 525 | Ga0466957_0038111 | 3300044842 | Bacteria | 2896 |
| 526 | Ga0466957_0045409 | 3300044842 | Unclassified | 2665 |
| 527 | Ga0466957_0083971 | 3300044842 | Bacteria | 1987 |
| 528 | Ga0466957_0095459 | 3300044842 | Viruses | 1867 |
| 529 | Ga0466957_0109690 | 3300044842 | Archaea | 1749 |
| 530 | Ga0466957_0155258 | 3300044842 | Bacteria | 1483 |
| 531 | Ga0466957_0199053 | 3300044842 | Bacteria | 1315 |
| 532 | Ga0466960_0003215 | 3300044901 | Bacteria | 6264 |
| 533 | Ga0466960_0059436 | 3300044901 | Bacteria | 1870 |
| 534 | Ga0466960_0129013 | 3300044901 | Archaea | 1333 |
| 535 | Ga0466959_0001526 | 3300045049 | Bacteria | 14224 |
| 536 | Ga0466959_0002072 | 3300045049 | Bacteria | 12682 |
| 537 | Ga0466959_0008410 | 3300045049 | Bacteria | 7295 |
| 538 | Ga0466959_0018997 | 3300045049 | Bacteria | 5051 |
| 539 | Ga0466959_0063654 | 3300045049 | Bacteria | 2678 |
| 540 | Ga0466959_0096284 | 3300045049 | Bacteria | 2122 |
| 541 | Ga0466959_0128691 | 3300045049 | Bacteria | 1795 |
| 542 | Ga0466959_0199493 | 3300045049 | Unclassified | 1393 |
| 543 | Ga0451576_0210932 | 3300045051 | Archaea | 2028 |
| 544 | Ga0466958_0000293 | 3300045836 | Bacteria | 19554 |
| 545 | Ga0466958_0001578 | 3300045836 | Bacteria | 10944 |
| 546 | Ga0466958_0007797 | 3300045836 | Bacteria | 5910 |
| 547 | Ga0466958_0015674 | 3300045836 | Bacteria | 4349 |
| 548 | Ga0466958_0022876 | 3300045836 | Bacteria | 3664 |
| 549 | Ga0466958_0032844 | 3300045836 | Bacteria | 3089 |
| 550 | Ga0466958_0064173 | 3300045836 | Bacteria | 2239 |
| 551 | Ga0466958_0109648 | 3300045836 | Unclassified | 1722 |
| 552 | Ga0466958_0144413 | 3300045836 | Archaea | 1499 |
| 553 | Ga0466967_0000437 | 3300045976 | Bacteria | 19918 |
| 554 | Ga0466967_0000541 | 3300045976 | Bacteria | 18349 |
| 555 | Ga0466967_0003389 | 3300045976 | Bacteria | 10387 |
| 556 | Ga0466967_0004389 | 3300045976 | Bacteria | 9499 |
| 557 | Ga0466967_0005119 | 3300045976 | Bacteria | 9010 |
| 558 | Ga0466967_0013571 | 3300045976 | Bacteria | 6302 |
| 559 | Ga0466967_0037927 | 3300045976 | Bacteria | 4129 |
| 560 | Ga0466967_0039356 | 3300045976 | Bacteria | 4064 |
| 561 | Ga0466967_0041592 | 3300045976 | Bacteria | 3964 |
| 562 | Ga0466967_0047619 | 3300045976 | Bacteria | 3738 |
| 563 | Ga0466967_0049017 | 3300045976 | Bacteria | 3692 |
| 564 | Ga0466967_0049174 | 3300045976 | Viruses | 3686 |
| 565 | Ga0466967_0056164 | 3300045976 | Bacteria | 3471 |
| 566 | Ga0466967_0058837 | 3300045976 | Unclassified | 3398 |
| 567 | Ga0466967_0060951 | 3300045976 | Bacteria | 3346 |
| 568 | Ga0466967_0064542 | 3300045976 | Bacteria | 3256 |
| 569 | Ga0466967_0071757 | 3300045976 | Bacteria | 3101 |
| 570 | Ga0466967_0084621 | 3300045976 | Bacteria | 2870 |
| 571 | Ga0466967_0087305 | 3300045976 | Bacteria | 2827 |
| 572 | Ga0466967_0094002 | 3300045976 | Unclassified | 2729 |
| 573 | Ga0466967_0099522 | 3300045976 | Viruses | 2656 |
| 574 | Ga0466967_0134523 | 3300045976 | Viruses | 2298 |
| 575 | Ga0466967_0145460 | 3300045976 | Bacteria | 2211 |
| 576 | Ga0466967_0223462 | 3300045976 | Unclassified | 1790 |
| 577 | Ga0466967_0234398 | 3300045976 | Bacteria | 1748 |
| 578 | Ga0466967_0237964 | 3300045976 | Viruses | 1735 |
| 579 | Ga0466967_0243357 | 3300045976 | Unclassified | 1716 |
| 580 | Ga0466967_0264775 | 3300045976 | Bacteria | 1645 |
| 581 | Ga0466967_0288331 | 3300045976 | Bacteria | 1576 |
| 582 | Ga0466967_0404560 | 3300045976 | Bacteria | 1328 |
| 583 | Ga0495592_0000708 | 3300046454 | Bacteria | 23320 |
| 584 | Ga0495592_0026688 | 3300046454 | Bacteria | 4378 |
| 585 | Ga0495592_0105501 | 3300046454 | Bacteria | 2002 |
| 586 | Ga0495603_0018073 | 3300046455 | Bacteria | 4265 |
| 587 | Ga0495629_0017075 | 3300046459 | Bacteria | 5206 |
| 588 | Ga0495629_0017103 | 3300046459 | Bacteria | 5200 |
| 589 | Ga0495641_0008385 | 3300046461 | Bacteria | 6314 |
| 590 | Ga0495641_0046512 | 3300046461 | Bacteria | 1995 |
| 591 | Ga0495641_0077799 | 3300046461 | Bacteria | 1487 |
| 592 | Ga0495651_0000885 | 3300046462 | Bacteria | 23327 |
| 593 | Ga0495651_0056069 | 3300046462 | Unclassified | 3027 |
| 594 | Ga0495651_0085349 | 3300046462 | Bacteria | 2377 |
| 595 | Ga0495651_0099755 | 3300046462 | Unclassified | 2165 |
| 596 | Ga0495653_0013755 | 3300046463 | Bacteria | 6594 |
| 597 | Ga0495653_0085691 | 3300046463 | Unclassified | 2317 |
| 598 | Ga0495653_0098388 | 3300046463 | Unclassified | 2124 |
| 599 | Ga0495580_0120453 | 3300046472 | Bacteria | 1822 |
| 600 | Ga0495580_0238023 | 3300046472 | Bacteria | 1249 |
| 601 | Ga0495582_0059207 | 3300046473 | Archaea | 2113 |
| 602 | Ga0495582_0175063 | 3300046473 | Bacteria | 1222 |
| 603 | Ga0495639_0000458 | 3300046475 | Bacteria | 19373 |
| 604 | Ga0495662_0000722 | 3300046476 | Bacteria | 15787 |
| 605 | Ga0495664_0193757 | 3300046477 | Unclassified | 1232 |
| 606 | Ga0495584_0080912 | 3300046491 | Bacteria | 1635 |
| 607 | Ga0495585_0142547 | 3300046492 | Bacteria | 1254 |
| 608 | Ga0495596_0037409 | 3300046500 | Bacteria | 1919 |
| 609 | Ga0495607_0011635 | 3300046501 | Bacteria | 5848 |
| 610 | Ga0495608_0004093 | 3300046511 | Bacteria | 10458 |
| 611 | Ga0495608_0005519 | 3300046511 | Bacteria | 9032 |
| 612 | Ga0495608_0028281 | 3300046511 | Bacteria | 3810 |
| 613 | Ga0495608_0269519 | 3300046511 | Bacteria | 1059 |
| 614 | Ga0495618_0027065 | 3300046514 | Bacteria | 3569 |
| 615 | Ga0495618_0074647 | 3300046514 | Bacteria | 2159 |
| 616 | Ga0495618_0223125 | 3300046514 | Bacteria | 1188 |
| 617 | Ga0495628_0001243 | 3300046516 | Bacteria | 23312 |
| 618 | Ga0495628_0115734 | 3300046516 | Bacteria | 2059 |
| 619 | Ga0495630_0011609 | 3300046517 | Bacteria | 6382 |
| 620 | Ga0495630_0034757 | 3300046517 | Bacteria | 3765 |
| 621 | Ga0495663_0003333 | 3300046525 | Bacteria | 4651 |
| 622 | Ga0495666_0000065 | 3300046526 | Bacteria | 40921 |
| 623 | Ga0495652_0010178 | 3300046529 | Bacteria | 8523 |
| 624 | Ga0495652_0084219 | 3300046529 | Unclassified | 2615 |
| 625 | Ga0495652_0210647 | 3300046529 | Bacteria | 1467 |
| 626 | Ga0495652_0235303 | 3300046529 | Bacteria | 1367 |
| 627 | Ga0495665_0005926 | 3300046531 | Bacteria | 6582 |
| 628 | Ga0495665_0152516 | 3300046531 | Bacteria | 1206 |
| 629 | Ga0495640_0002040 | 3300046533 | Bacteria | 16099 |
| 630 | Ga0495640_0083800 | 3300046533 | Bacteria | 2115 |
| 631 | Ga0495640_0100616 | 3300046533 | Viruses | 1898 |
| 632 | Ga0495586_0007245 | 3300046535 | Bacteria | 5920 |
| 633 | Ga0495586_0178990 | 3300046535 | Bacteria | 1199 |
| 634 | Ga0495586_0205037 | 3300046535 | Bacteria | 1118 |
| 635 | Ga0495587_0000675 | 3300046536 | Bacteria | 22859 |
| 636 | Ga0495587_0006475 | 3300046536 | Bacteria | 7628 |
| 637 | Ga0495645_0000684 | 3300046543 | Bacteria | 23313 |
| 638 | Ga0495667_0004970 | 3300046559 | Bacteria | 8990 |
| 639 | Ga0495667_0073259 | 3300046559 | Viruses | 2231 |
| 640 | Ga0495667_0090422 | 3300046559 | Bacteria | 1983 |
| 641 | Ga0495667_0138581 | 3300046559 | Bacteria | 1568 |
| 642 | Ga0495667_0334725 | 3300046559 | Bacteria | 957 |
| 643 | Ga0495656_0107032 | 3300046615 | Bacteria | 1302 |
| 644 | Ga0495668_0144295 | 3300046616 | Bacteria | 1303 |
| 645 | Ga0495634_0019011 | 3300046642 | Bacteria | 4884 |
| 646 | Ga0495634_0060069 | 3300046642 | Bacteria | 2530 |
| 647 | Ga0495634_0107634 | 3300046642 | Bacteria | 1795 |
| 648 | Ga0495634_0157625 | 3300046642 | Bacteria | 1433 |
| 649 | Ga0495635_0026093 | 3300046663 | Bacteria | 4069 |
| 650 | Ga0495635_0070147 | 3300046663 | Viruses | 2402 |
| 651 | Ga0495635_0091826 | 3300046663 | Bacteria | 2076 |
| 652 | Ga0495635_0113655 | 3300046663 | Bacteria | 1848 |
| 653 | Ga0495659_0040567 | 3300046664 | Bacteria | 1660 |
| 654 | Ga0495657_0020319 | 3300046675 | Bacteria | 4775 |
| 655 | Ga0495657_0067092 | 3300046675 | Bacteria | 2356 |
| 656 | Ga0495657_0072893 | 3300046675 | Bacteria | 2238 |
| 657 | Ga0495599_0000455 | 3300046678 | Bacteria | 23331 |
| 658 | Ga0495599_0001792 | 3300046678 | Bacteria | 12462 |
| 659 | Ga0495599_0136555 | 3300046678 | Bacteria | 1522 |
| 660 | Ga0495599_0200681 | 3300046678 | Viruses | 1225 |
| 661 | Ga0495623_0001619 | 3300046679 | Bacteria | 15128 |
| 662 | Ga0495623_0099594 | 3300046679 | Bacteria | 1772 |
| 663 | Ga0495646_0015915 | 3300046680 | Bacteria | 4773 |
| 664 | Ga0495646_0172189 | 3300046680 | Viruses | 1192 |
| 665 | Ga0495646_0195507 | 3300046680 | Bacteria | 1103 |
| 666 | Ga0495647_0000075 | 3300046681 | Bacteria | 23932 |
| 667 | Ga0495658_0003735 | 3300046683 | Bacteria | 7531 |
| 668 | Ga0495658_0038841 | 3300046683 | Bacteria | 2637 |
| 669 | Ga0495613_0013358 | 3300046689 | Bacteria | 6099 |
| 670 | Ga0495613_0093119 | 3300046689 | Bacteria | 2182 |
| 671 | Ga0495613_0119063 | 3300046689 | Bacteria | 1897 |
| 672 | Ga0495613_0234524 | 3300046689 | Bacteria | 1284 |
| 673 | Ga0495624_0014761 | 3300046690 | Bacteria | 5289 |
| 674 | Ga0495624_0029796 | 3300046690 | Bacteria | 3558 |
| 675 | Ga0495624_0129901 | 3300046690 | Archaea | 1545 |
| 676 | Ga0495624_0131165 | 3300046690 | Bacteria | 1536 |
| 677 | Ga0495670_0074045 | 3300046691 | Bacteria | 1727 |
| 678 | Ga0495600_0018065 | 3300046809 | Bacteria | 4490 |
| 679 | Ga0495600_0059255 | 3300046809 | Unclassified | 2501 |
| 680 | Ga0495604_0001028 | 3300047317 | Bacteria | 23261 |
| 681 | Ga0495604_0003434 | 3300047317 | Bacteria | 12641 |
| 682 | Ga0495674_0058142 | 3300047319 | Bacteria | 3382 |
| 683 | Ga0495674_0162234 | 3300047319 | Viruses | 1869 |
| 684 | Ga0495674_0192570 | 3300047319 | Bacteria | 1694 |
| 685 | Ga0495674_0373137 | 3300047319 | Viruses | 1155 |
| 686 | Ga0495676_0044046 | 3300047321 | Bacteria | 3646 |
| 687 | Ga0495676_0096118 | 3300047321 | Unclassified | 2203 |
| 688 | Ga0495680_0001991 | 3300047322 | Bacteria | 21455 |
| 689 | Ga0495680_0020713 | 3300047322 | Bacteria | 5523 |
| 690 | Ga0495680_0023772 | 3300047322 | Bacteria | 5093 |
| 691 | Ga0495680_0026531 | 3300047322 | Bacteria | 4774 |
| 692 | Ga0495680_0154823 | 3300047322 | Bacteria | 1668 |
| 693 | Ga0495680_0165988 | 3300047322 | Unclassified | 1601 |
| 694 | Ga0495675_0000592 | 3300047444 | Bacteria | 23327 |
| 695 | Ga0495675_0065278 | 3300047444 | Bacteria | 2302 |
| 696 | Ga0495685_061193 | 3300047447 | Bacteria | 1269 |
| 697 | Ga0495684_0018793 | 3300047471 | Bacteria | 5325 |
| 698 | Ga0495684_0050383 | 3300047471 | Bacteria | 3180 |
| 699 | Ga0495593_0000573 | 3300047673 | Bacteria | 20898 |
| 700 | Ga0495602_0001484 | 3300048088 | Bacteria | 23328 |
| 701 | Ga0495602_0092325 | 3300048088 | Unclassified | 2508 |
| 702 | Ga0495602_0248430 | 3300048088 | Viruses | 1327 |
| 703 | Ga0495602_0250110 | 3300048088 | Bacteria | 1321 |
| 704 | Ga0495614_0028764 | 3300048089 | Bacteria | 2392 |
| 705 | Ga0495614_0038884 | 3300048089 | Bacteria | 2042 |
| 706 | Ga0496100_0011890 | 3300048903 | Bacteria | 4970 |
| 707 | Ga0496100_0032173 | 3300048903 | Bacteria | 3267 |
| 708 | Ga0496100_0040168 | 3300048903 | Bacteria | 2975 |
| 709 | Ga0496100_0310071 | 3300048903 | Bacteria | 1183 |
| 710 | Ga0496100_0356743 | 3300048903 | Bacteria | 1105 |
| 711 | Ga0496100_0375180 | 3300048903 | Bacteria | 1079 |
| 712 | Ga0496101_0004111 | 3300048904 | Bacteria | 9108 |
| 713 | Ga0496101_0035348 | 3300048904 | Viruses | 3534 |
| 714 | Ga0496101_0040080 | 3300048904 | Bacteria | 3335 |
| 715 | Ga0496101_0046867 | 3300048904 | Bacteria | 3101 |
| 716 | Ga0496101_0051260 | 3300048904 | Bacteria | 2973 |
| 717 | Ga0496101_0051470 | 3300048904 | Bacteria | 2968 |
| 718 | Ga0496101_0083944 | 3300048904 | Bacteria | 2358 |
| 719 | Ga0496101_0098855 | 3300048904 | Archaea | 2181 |
| 720 | Ga0496101_0231828 | 3300048904 | Bacteria | 1435 |
| 721 | Ga0496101_0247516 | 3300048904 | Archaea | 1388 |
| 722 | Ga0496102_0004397 | 3300048905 | Bacteria | 11907 |
| 723 | Ga0496102_0009170 | 3300048905 | Bacteria | 8490 |
| 724 | Ga0496102_0215117 | 3300048905 | Bacteria | 1811 |
| 725 | Ga0496102_0293871 | 3300048905 | Archaea | 1531 |
| 726 | Ga0496103_0010455 | 3300048906 | Bacteria | 5492 |
| 727 | Ga0496103_0015473 | 3300048906 | Bacteria | 4540 |
| 728 | Ga0496103_0022703 | 3300048906 | Bacteria | 3779 |
| 729 | Ga0496103_0023647 | 3300048906 | Bacteria | 3706 |
| 730 | Ga0496103_0111509 | 3300048906 | Bacteria | 1738 |
| 731 | Ga0496104_0000381 | 3300048907 | Bacteria | 38927 |
| 732 | Ga0496104_0000722 | 3300048907 | Bacteria | 28422 |
| 733 | Ga0496104_0002589 | 3300048907 | Bacteria | 15603 |
| 734 | Ga0496104_0037068 | 3300048907 | Bacteria | 4560 |
| 735 | Ga0496104_0046796 | 3300048907 | Bacteria | 4075 |
| 736 | Ga0496104_0057993 | 3300048907 | Bacteria | 3664 |
| 737 | Ga0496104_0067819 | 3300048907 | Bacteria | 3390 |
| 738 | Ga0496104_0158407 | 3300048907 | Bacteria | 2172 |
| 739 | Ga0496104_0176978 | 3300048907 | Viruses | 2043 |
| 740 | Ga0496104_0286997 | 3300048907 | Bacteria | 1558 |
| 741 | Ga0496105_0000228 | 3300048908 | Bacteria | 37935 |
| 742 | Ga0496105_0005243 | 3300048908 | Bacteria | 9824 |
| 743 | Ga0496105_0005493 | 3300048908 | Bacteria | 9619 |
| 744 | Ga0496105_0007188 | 3300048908 | Bacteria | 8592 |
| 745 | Ga0496105_0025873 | 3300048908 | Bacteria | 4780 |
| 746 | Ga0496105_0055436 | 3300048908 | Bacteria | 3273 |
| 747 | Ga0496105_0162095 | 3300048908 | Bacteria | 1836 |
| 748 | Ga0496105_0201563 | 3300048908 | Archaea | 1624 |
| 749 | Ga0496105_0207726 | 3300048908 | Bacteria | 1597 |
| 750 | Ga0496105_0225793 | 3300048908 | Bacteria | 1523 |
| 751 | Ga0496105_0275250 | 3300048908 | Viruses | 1358 |
| 752 | Ga0496106_0003519 | 3300048909 | Bacteria | 11674 |
| 753 | Ga0496106_0003660 | 3300048909 | Bacteria | 11460 |
| 754 | Ga0496106_0041243 | 3300048909 | Bacteria | 3458 |
| 755 | Ga0496106_0050114 | 3300048909 | Bacteria | 3146 |
| 756 | Ga0496106_0089874 | 3300048909 | Bacteria | 2369 |
| 757 | Ga0496107_0011320 | 3300048910 | Bacteria | 6208 |
| 758 | Ga0496107_0013331 | 3300048910 | Bacteria | 5743 |
| 759 | Ga0496107_0016895 | 3300048910 | Bacteria | 5129 |
| 760 | Ga0496107_0025420 | 3300048910 | Bacteria | 4192 |
| 761 | Ga0496107_0074306 | 3300048910 | Bacteria | 2473 |
| 762 | Ga0496107_0087889 | 3300048910 | Bacteria | 2269 |
| 763 | Ga0496107_0143941 | 3300048910 | Archaea | 1762 |
| 764 | Ga0496107_0194943 | 3300048910 | Bacteria | 1505 |
| 765 | Ga0496108_0000826 | 3300048911 | Bacteria | 24092 |
| 766 | Ga0496108_0001569 | 3300048911 | Bacteria | 18097 |
| 767 | Ga0496108_0036246 | 3300048911 | Bacteria | 4104 |
| 768 | Ga0496108_0069368 | 3300048911 | Bacteria | 2974 |
| 769 | Ga0496108_0160501 | 3300048911 | Bacteria | 1942 |
| 770 | Ga0496108_0190278 | 3300048911 | Viruses | 1778 |
| 771 | Ga0496108_0271931 | 3300048911 | Bacteria | 1475 |
| 772 | Ga0496109_0001686 | 3300048912 | Bacteria | 18402 |
| 773 | Ga0496109_0001801 | 3300048912 | Bacteria | 17822 |
| 774 | Ga0496109_0002311 | 3300048912 | Bacteria | 15871 |
| 775 | Ga0496109_0007129 | 3300048912 | Bacteria | 9442 |
| 776 | Ga0496109_0013766 | 3300048912 | Bacteria | 7028 |
| 777 | Ga0496109_0018825 | 3300048912 | Bacteria | 6075 |
| 778 | Ga0496109_0027355 | 3300048912 | Bacteria | 5091 |
| 779 | Ga0496109_0083459 | 3300048912 | Bacteria | 2946 |
| 780 | Ga0496109_0182796 | 3300048912 | Bacteria | 1969 |
| 781 | Ga0496109_0453360 | 3300048912 | Bacteria | 1211 |
| 782 | Ga0496110_0000439 | 3300048913 | Bacteria | 28278 |
| 783 | Ga0496110_0000890 | 3300048913 | Bacteria | 21075 |
| 784 | Ga0496110_0001269 | 3300048913 | Bacteria | 18061 |
| 785 | Ga0496110_0002029 | 3300048913 | Bacteria | 15083 |
| 786 | Ga0496110_0058772 | 3300048913 | Bacteria | 3387 |
| 787 | Ga0496110_0064743 | 3300048913 | Bacteria | 3231 |
| 788 | Ga0496110_0125060 | 3300048913 | Bacteria | 2320 |
| 789 | Ga0496110_0262255 | 3300048913 | Bacteria | 1573 |
| 790 | Ga0496110_0401579 | 3300048913 | Bacteria | 1249 |
| 791 | Ga0496110_0539308 | 3300048913 | Bacteria | 1061 |
| 792 | Ga0496111_0000025 | 3300048914 | Bacteria | 62100 |
| 793 | Ga0496111_0000043 | 3300048914 | Bacteria | 49176 |
| 794 | Ga0496111_0000159 | 3300048914 | Bacteria | 30273 |
| 795 | Ga0496111_0013019 | 3300048914 | Bacteria | 5647 |
| 796 | Ga0496111_0014358 | 3300048914 | Bacteria | 5409 |
| 797 | Ga0496111_0069103 | 3300048914 | Bacteria | 2568 |
| 798 | Ga0496111_0086215 | 3300048914 | Bacteria | 2297 |
| 799 | Ga0496111_0302209 | 3300048914 | Bacteria | 1186 |
| 800 | Ga0496112_0000145 | 3300048915 | Bacteria | 44395 |
| 801 | Ga0496112_0000825 | 3300048915 | Bacteria | 21994 |
| 802 | Ga0496112_0001618 | 3300048915 | Bacteria | 17434 |
| 803 | Ga0496112_0007822 | 3300048915 | Bacteria | 9513 |
| 804 | Ga0496112_0009374 | 3300048915 | Bacteria | 8816 |
| 805 | Ga0496112_0015565 | 3300048915 | Bacteria | 7104 |
| 806 | Ga0496112_0017377 | 3300048915 | Bacteria | 6758 |
| 807 | Ga0496112_0022054 | 3300048915 | Bacteria | 6064 |
| 808 | Ga0496112_0101603 | 3300048915 | Bacteria | 2845 |
| 809 | Ga0496112_0335355 | 3300048915 | Bacteria | 1456 |
| 810 | Ga0496113_0000298 | 3300048916 | Bacteria | 23527 |
| 811 | Ga0496113_0013338 | 3300048916 | Bacteria | 5563 |
| 812 | Ga0496113_0073161 | 3300048916 | Bacteria | 2610 |
| 813 | Ga0496113_0264190 | 3300048916 | Bacteria | 1375 |
| 814 | Ga0496113_0288847 | 3300048916 | Unclassified | 1312 |
| 815 | Ga0496114_0001276 | 3300048917 | Bacteria | 19032 |
| 816 | Ga0496114_0002346 | 3300048917 | Bacteria | 14408 |
| 817 | Ga0496114_0010426 | 3300048917 | Bacteria | 7393 |
| 818 | Ga0496114_0037095 | 3300048917 | Bacteria | 4031 |
| 819 | Ga0496114_0053314 | 3300048917 | Bacteria | 3371 |
| 820 | Ga0496114_0207061 | 3300048917 | Archaea | 1719 |
| 821 | Ga0496114_0389303 | 3300048917 | Bacteria | 1234 |
| 822 | Ga0496115_0005166 | 3300048918 | Bacteria | 9497 |
| 823 | Ga0496115_0005749 | 3300048918 | Bacteria | 9031 |
| 824 | Ga0496115_0172165 | 3300048918 | Bacteria | 1790 |
| 825 | Ga0496115_0299259 | 3300048918 | Bacteria | 1318 |
| 826 | Ga0496115_0535828 | 3300048918 | Bacteria | 937 |
| 827 | Ga0501033_0179141 | 3300049570 | Unclassified | 1520 |
| 828 | Ga0501034_0011736 | 3300049571 | Bacteria | 9065 |
| 829 | Ga0501036_0010229 | 3300049572 | Bacteria | 7736 |
| 830 | Ga0501037_0107111 | 3300049573 | Bacteria | 2014 |
| 831 | Ga0501038_0022876 | 3300049574 | Bacteria | 5595 |
| 832 | Ga0501039_0043719 | 3300049575 | Bacteria | 3459 |
| 833 | Ga0501040_0012914 | 3300049576 | Bacteria | 5487 |
| 834 | Ga0501041_0006507 | 3300049577 | Bacteria | 6839 |
| 835 | Ga0501042_0004105 | 3300049578 | Bacteria | 9248 |
| 836 | Ga0501042_0101254 | 3300049578 | Bacteria | 2072 |
| 837 | Ga0501043_0047930 | 3300049579 | Bacteria | 3359 |
| 838 | Ga0501046_0005156 | 3300049580 | Bacteria | 11712 |
| 839 | Ga0501047_0104525 | 3300049581 | Bacteria | 2712 |
| 840 | Ga0501047_0234706 | 3300049581 | Bacteria | 1686 |
| 841 | Ga0501047_0380622 | 3300049581 | Unclassified | 1246 |
| 842 | Ga0501048_0012667 | 3300049582 | Bacteria | 6270 |
| 843 | Ga0501067_0000285 | 3300049583 | Bacteria | 27590 |
| 844 | Ga0501067_0010527 | 3300049583 | Bacteria | 5122 |
| 845 | Ga0501067_0031828 | 3300049583 | Bacteria | 2927 |
| 846 | Ga0501067_0074360 | 3300049583 | Bacteria | 1883 |
| 847 | Ga0501067_0273179 | 3300049583 | Bacteria | 941 |
| 848 | Ga0501069_0009378 | 3300049585 | Bacteria | 5167 |
| 849 | Ga0501069_0033759 | 3300049585 | Bacteria | 2819 |
| 850 | Ga0501069_0112638 | 3300049585 | Archaea | 1550 |
| 851 | Ga0501070_0006704 | 3300049586 | Bacteria | 9810 |
| 852 | Ga0501070_0041894 | 3300049586 | Bacteria | 3813 |
| 853 | Ga0501070_0046318 | 3300049586 | Bacteria | 3616 |
| 854 | Ga0501070_0148339 | 3300049586 | Bacteria | 1936 |
| 855 | Ga0501070_0419773 | 3300049586 | Unclassified | 1080 |
| 856 | Ga0501071_0005995 | 3300049587 | Bacteria | 7874 |
| 857 | Ga0501072_0018183 | 3300049588 | Bacteria | 5407 |
| 858 | Ga0501072_0221044 | 3300049588 | Unclassified | 1509 |
| 859 | Ga0501073_0065524 | 3300049589 | Bacteria | 2533 |
| 860 | Ga0501073_0190285 | 3300049589 | Bacteria | 1420 |
| 861 | Ga0501073_0319373 | 3300049589 | Bacteria | 1072 |
| 862 | Ga0501074_0004989 | 3300049590 | Bacteria | 9522 |
| 863 | Ga0501074_0023227 | 3300049590 | Bacteria | 4510 |
| 864 | Ga0501074_0034929 | 3300049590 | Bacteria | 3643 |
| 865 | Ga0501074_0046880 | 3300049590 | Bacteria | 3124 |
| 866 | Ga0501076_0008422 | 3300049592 | Bacteria | 7556 |
| 867 | Ga0501077_0003802 | 3300049593 | Bacteria | 9091 |
| 868 | Ga0501079_0008442 | 3300049741 | Bacteria | 7808 |
| 869 | Ga0501079_0115519 | 3300049741 | Bacteria | 2086 |
| 870 | Ga0501080_0013478 | 3300049742 | Bacteria | 7521 |
| 871 | Ga0501080_0025256 | 3300049742 | Bacteria | 5513 |
| 872 | Ga0501080_0047747 | 3300049742 | Bacteria | 3986 |
| 873 | Ga0501081_0086423 | 3300049743 | Bacteria | 2202 |
| 874 | Ga0501083_0000145 | 3300049744 | Bacteria | 48483 |
| 875 | Ga0501035_0004588 | 3300049822 | Bacteria | 13099 |
| 876 | nmdc:mga0yw44_3385_c1 | 3300050492 | Bacteria | 6037 |
| 877 | nmdc:mga05p37_56108_c1 | 3300050507 | Bacteria | 4849 |
| 878 | nmdc:mga05p37_91944_c1 | 3300050507 | Bacteria | 3738 |
| 879 | nmdc:mga08y16_103182_c1 | 3300050511 | Bacteria | 2969 |
| 880 | nmdc:mga08y16_435177_c1 | 3300050511 | Bacteria | 1339 |
| 881 | nmdc:mga0n895_131012_c1 | 3300050512 | Bacteria | 2533 |
| 882 | nmdc:mga0n895_18140_c1 | 3300050512 | Bacteria | 6506 |
| 883 | nmdc:mga0n895_25545_c1 | 3300050512 | Bacteria | 5582 |
| 884 | nmdc:mga0n895_515029_c1 | 3300050512 | Bacteria | 1204 |
| 885 | nmdc:mga0rr50_2136_c1 | 3300050513 | Bacteria | 11049 |
| 886 | nmdc:mga08x19_67862_c1 | 3300050514 | Bacteria | 2320 |
| 887 | nmdc:mga0a205_10114_c1 | 3300050515 | Bacteria | 8658 |
| 888 | nmdc:mga0a205_135178_c1 | 3300050515 | Bacteria | 2366 |
| 889 | nmdc:mga0a205_660_c1 | 3300050515 | Bacteria | 27450 |
| 890 | nmdc:mga0a205_77257_c1 | 3300050515 | Bacteria | 3217 |
| 891 | Ga0495601_0002343 | 3300053077 | Bacteria | 10719 |
| 892 | Ga0495601_0030145 | 3300053077 | Bacteria | 3367 |
| 893 | Ga0495601_0159790 | 3300053077 | Unclassified | 1472 |
| 894 | Ga0495655_0004954 | 3300053083 | Bacteria | 2318 |
| 895 | Ga0495595_0020754 | 3300053084 | Unclassified | 2861 |
| 896 | Ga0495595_0030260 | 3300053084 | Bacteria | 2427 |
| 897 | Ga0495619_0006146 | 3300053085 | Bacteria | 7606 |
| 898 | Ga0495619_0007501 | 3300053085 | Bacteria | 6908 |
| 899 | Ga0495619_0007751 | 3300053085 | Bacteria | 6795 |
| 900 | Ga0495619_0020923 | 3300053085 | Unclassified | 4172 |
| 901 | Ga0495619_0058399 | 3300053085 | Viruses | 2561 |
| 902 | Ga0495619_0067716 | 3300053085 | Bacteria | 2384 |
| 903 | Ga0500566_0038615 | 3300053094 | Bacteria | 2762 |
| 904 | Ga0501084_0048891 | 3300054114 | Bacteria | 3540 |
| 905 | Ga0501084_0154495 | 3300054114 | Unclassified | 1935 |
| 906 | Ga0501082_0001530 | 3300060353 | Bacteria | 20348 |
| 907 | Ga0466962_0000941 | 3300061719 | Bacteria | 13185 |
| 908 | Ga0466962_0003162 | 3300061719 | Bacteria | 7823 |
| 909 | Ga0466962_0004548 | 3300061719 | Bacteria | 6653 |
| 910 | Ga0466962_0009512 | 3300061719 | Bacteria | 4661 |
| 911 | Ga0466962_0023118 | 3300061719 | Bacteria | 2988 |
| 912 | Ga0466962_0066112 | 3300061719 | Viruses | 1726 |
| 913 | Ga0466962_0083379 | 3300061719 | Bacteria | 1529 |
| 914 | Ga0530510_0002901 | 3300061734 | Bacteria | 11755 |
| 915 | Ga0530510_0025866 | 3300061734 | Bacteria | 4198 |
| 916 | Ga0530510_0252610 | 3300061734 | Unclassified | 1314 |
| 917 | Ga0530510_0287132 | 3300061734 | Bacteria | 1230 |
| 918 | Ga0265328_10012075 | |||
| 919 | JGI25404J52841_10032437 | |||
| 920 | Ga0065715_10260328 | |||
| 921 | Ga0070658_10007594 | |||
| 922 | Ga0070658_10033730 | |||
| 923 | Ga0070658_10130842 | |||
| 924 | Ga0070658_10232977 | |||
| 925 | Ga0070683_100026257 | |||
| 926 | Ga0070683_100048317 | |||
| 927 | Ga0070683_100166039 | |||
| 928 | Ga0070683_100249105 | |||
| 929 | Ga0070680_100003464 | |||
| 930 | Ga0070680_100016522 | |||
| 931 | Ga0070680_100384835 | |||
| 932 | Ga0070682_100003755 | |||
| 933 | Ga0070682_100027129 | |||
| 934 | Ga0070682_100039992 | |||
| 935 | Ga0070660_100001630 | |||
| 936 | Ga0070660_100002731 | |||
| 937 | Ga0070660_100004707 | |||
| 938 | Ga0070660_100011736 | |||
| 939 | Ga0070660_100017945 | |||
| 940 | Ga0070660_100054295 | |||
| 941 | Ga0070660_100065707 | |||
| 942 | Ga0070660_100152943 | |||
| 943 | Ga0070687_100024404 | |||
| 944 | Ga0070661_100010116 | |||
| 945 | Ga0070661_100068683 | |||
| 946 | Ga0070661_100071365 | |||
| 947 | Ga0070692_10025686 | |||
| 948 | Ga0070668_100063497 | |||
| 949 | Ga0070675_100539711 | |||
| 950 | Ga0070671_100030497 | |||
| 951 | Ga0070674_100022155 | |||
| 952 | Ga0070673_100245331 | |||
| 953 | Ga0070659_100025698 | |||
| 954 | Ga0070659_100072759 | |||
| 955 | Ga0070659_100295804 | |||
| 956 | Ga0070709_10005221 | |||
| 957 | Ga0070709_10017441 | |||
| 958 | Ga0070709_10154378 | |||
| 959 | Ga0070714_100002238 | |||
| 960 | Ga0070714_100009905 | |||
| 961 | Ga0070714_100064497 | |||
| 962 | Ga0070714_100094197 | |||
| 963 | Ga0070714_100101647 | |||
| 964 | Ga0070714_100500807 | |||
| 965 | Ga0070713_100012624 | |||
| 966 | Ga0070713_100390802 | |||
| 967 | Ga0070713_100508487 | |||
| 968 | Ga0070710_10001230 | |||
| 969 | Ga0070710_10041441 | |||
| 970 | Ga0070711_100016549 | |||
| 971 | Ga0070711_100094929 | |||
| 972 | Ga0070705_100172104 | |||
| 973 | Ga0070694_100041336 | |||
| 974 | Ga0070708_100118648 | |||
| 975 | Ga0070708_100226564 | |||
| 976 | Ga0070663_100190762 | |||
| 977 | Ga0070678_100181069 | |||
| 978 | Ga0070662_100411418 | |||
| 979 | Ga0070681_10005097 | |||
| 980 | Ga0070681_10007940 | |||
| 981 | Ga0070681_10018395 | |||
| 982 | Ga0070681_10025692 | |||
| 983 | Ga0070681_10027395 | |||
| 984 | Ga0070681_10032944 | |||
| 985 | Ga0070681_10037883 | |||
| 986 | Ga0070681_10096500 | |||
| 987 | Ga0070681_10172085 | |||
| 988 | Ga0070681_10263394 | |||
| 989 | Ga0070681_10383842 | |||
| 990 | Ga0068867_100004106 | |||
| 991 | Ga0070706_100017494 | |||
| 992 | Ga0070706_100098339 | |||
| 993 | Ga0070706_100160223 | |||
| 994 | Ga0070707_100002411 | |||
| 995 | Ga0070707_100005567 | |||
| 996 | Ga0070707_100049896 | |||
| 997 | Ga0070707_100062611 | |||
| 998 | Ga0070707_100256742 | |||
| 999 | Ga0070707_100308575 | |||
| 1000 | Ga0070698_100035503 | |||
| 1001 | Ga0070698_100101025 | |||
| 1002 | Ga0070698_100382164 | |||
| 1003 | Ga0070698_100444143 | |||
| 1004 | Ga0070699_100023039 | |||
| 1005 | Ga0070679_100005688 | |||
| 1006 | Ga0070679_100009583 | |||
| 1007 | Ga0070679_100076580 | |||
| 1008 | Ga0070679_100081984 | |||
| 1009 | Ga0070679_100087347 | |||
| 1010 | Ga0070679_100096791 | |||
| 1011 | Ga0070679_100202080 | |||
| 1012 | Ga0070679_100203953 | |||
| 1013 | Ga0070679_100394789 | |||
| 1014 | Ga0070684_100003268 | |||
| 1015 | Ga0070684_100122344 | |||
| 1016 | Ga0070684_100131177 | |||
| 1017 | Ga0070684_100237807 | |||
| 1018 | Ga0070697_100033386 | |||
| 1019 | Ga0068853_100157183 | |||
| 1020 | Ga0070686_100038067 | |||
| 1021 | Ga0070686_100234538 | |||
| 1022 | Ga0070695_100000510 | |||
| 1023 | Ga0070695_100051706 | |||
| 1024 | Ga0070696_100052935 | |||
| 1025 | Ga0070696_100261392 | |||
| 1026 | Ga0070693_100005253 | |||
| 1027 | Ga0070693_100006963 | |||
| 1028 | Ga0070704_100006405 | |||
| 1029 | Ga0070704_100129434 | |||
| 1030 | Ga0068855_100011653 | |||
| 1031 | Ga0068855_100021782 | |||
| 1032 | Ga0068855_100062270 | |||
| 1033 | Ga0068855_100090875 | |||
| 1034 | Ga0068855_100130249 | |||
| 1035 | Ga0068855_100134496 | |||
| 1036 | Ga0068855_100481412 | |||
| 1037 | Ga0068855_100541201 | |||
| 1038 | Ga0068857_100014855 | |||
| 1039 | Ga0068857_100066973 | |||
| 1040 | Ga0068857_100327286 | |||
| 1041 | Ga0068856_100037265 | |||
| 1042 | Ga0068856_100051074 | |||
| 1043 | Ga0068856_100308920 | |||
| 1044 | Ga0068856_100333106 | |||
| 1045 | Ga0070702_100257174 | |||
| 1046 | Ga0068852_100157886 | |||
| 1047 | Ga0068866_10021370 | |||
| 1048 | Ga0068861_100185694 | |||
| 1049 | Ga0068860_100066125 | |||
| 1050 | Ga0081455_10002152 | |||
| 1051 | Ga0081455_10059491 | |||
| 1052 | Ga0081455_10112407 | |||
| 1053 | Ga0081538_10133063 | |||
| 1054 | Ga0081540_1002321 | |||
| 1055 | Ga0081540_1031707 | |||
| 1056 | Ga0070717_10003122 | |||
| 1057 | Ga0070717_10026150 | |||
| 1058 | Ga0070717_10032269 | |||
| 1059 | Ga0070717_10119304 | |||
| 1060 | Ga0070717_10232711 | |||
| 1061 | Ga0075365_10131586 | |||
| 1062 | Ga0070715_10004406 | |||
| 1063 | Ga0070712_100036398 | |||
| 1064 | Ga0070712_100050683 | |||
| 1065 | Ga0070712_100213419 | |||
| 1066 | Ga0097621_100089004 | |||
| 1067 | Ga0097621_100443267 | |||
| 1068 | Ga0068871_100037358 | |||
| 1069 | Ga0075434_100002536 | |||
| 1070 | Ga0075434_100016864 | |||
| 1071 | Ga0075434_100055625 | |||
| 1072 | Ga0075434_100593576 | |||
| 1073 | Ga0075436_100269381 | |||
| 1074 | Ga0075435_100002096 | |||
| 1075 | Ga0105240_10034877 | |||
| 1076 | Ga0105240_10141997 | |||
| 1077 | Ga0105240_10287164 | |||
| 1078 | Ga0111539_10444035 | |||
| 1079 | Ga0105247_10139942 | |||
| 1080 | Ga0114129_10060892 | |||
| 1081 | Ga0114129_10246271 | |||
| 1082 | Ga0105243_10117946 | |||
| 1083 | Ga0105243_10166607 | |||
| 1084 | Ga0105243_10170882 | |||
| 1085 | Ga0105243_10420326 | |||
| 1086 | Ga0105241_10072637 | |||
| 1087 | Ga0105241_10093413 | |||
| 1088 | Ga0105242_10144414 | |||
| 1089 | Ga0105242_10476500 | |||
| 1090 | Ga0105248_10194180 | |||
| 1091 | Ga0105237_10106868 | |||
| 1092 | Ga0105237_10339998 | |||
| 1093 | Ga0105238_10050677 | |||
| 1094 | Ga0105238_10064893 | |||
| 1095 | Ga0105238_10075844 | |||
| 1096 | Ga0105238_10308217 | |||
| 1097 | Ga0105238_10713679 | |||
| 1098 | Ga0105249_10055316 | |||
| 1099 | Ga0105249_10185111 | |||
| 1100 | Ga0105239_10216351 | |||
| 1101 | Ga0105239_10251438 | |||
| 1102 | Ga0105239_10376142 | |||
| 1103 | Ga0157373_10019632 | |||
| 1104 | Ga0157371_10127131 | |||
| 1105 | Ga0157371_10131288 | |||
| 1106 | Ga0157371_10141835 | |||
| 1107 | Ga0157370_10002167 | |||
| 1108 | Ga0157370_10015489 | |||
| 1109 | Ga0157370_10092948 | |||
| 1110 | Ga0157370_10110839 | |||
| 1111 | Ga0157370_10157426 | |||
| 1112 | Ga0157370_10697110 | |||
| 1113 | Ga0157369_10018636 | |||
| 1114 | Ga0157369_10031229 | |||
| 1115 | Ga0157369_10222053 | |||
| 1116 | Ga0157369_10273664 | |||
| 1117 | Ga0157369_10691765 | |||
| 1118 | Ga0157374_10029558 | |||
| 1119 | Ga0157374_10074827 | |||
| 1120 | Ga0157374_10532763 | |||
| 1121 | Ga0157378_10720156 | |||
| 1122 | Ga0163162_10318136 | |||
| 1123 | Ga0157372_10310707 | |||
| 1124 | Ga0157372_10321040 | |||
| 1125 | Ga0157372_10430363 | |||
| 1126 | Ga0157375_10018482 | |||
| 1127 | Ga0157375_10369230 | |||
| 1128 | Ga0163163_10079615 | |||
| 1129 | Ga0163163_10474080 | |||
| 1130 | Ga0157380_10595221 | |||
| 1131 | Ga0182008_10002410 | |||
| 1132 | Ga0182008_10094146 | |||
| 1133 | Ga0157379_10351162 | |||
| 1134 | Ga0157379_10563606 | |||
| 1135 | Ga0157376_10172788 | |||
| 1136 | Ga0182006_1011287 | |||
| 1137 | Ga0197907_10431347 | |||
| 1138 | Ga0206356_11771762 | |||
| 1139 | Ga0206354_11091643 | |||
| 1140 | Ga0206353_10675245 | |||
| 1141 | Ga0206353_10803903 | |||
| 1142 | Ga0206353_11572253 | |||
| 1143 | Ga0206353_11851607 | |||
| 1144 | Ga0213871_10011936 | |||
| 1145 | Ga0213871_10062398 | |||
| 1146 | Ga0207692_10006533 | |||
| 1147 | Ga0207692_10019598 | |||
| 1148 | Ga0207692_10143982 | |||
| 1149 | Ga0207685_10006855 | |||
| 1150 | Ga0207699_10014422 | |||
| 1151 | Ga0207699_10034232 | |||
| 1152 | Ga0207705_10075470 | |||
| 1153 | Ga0207684_10189848 | |||
| 1154 | Ga0207684_10220297 | |||
| 1155 | Ga0207707_10002423 | |||
| 1156 | Ga0207707_10003146 | |||
| 1157 | Ga0207707_10013393 | |||
| 1158 | Ga0207707_10032352 | |||
| 1159 | Ga0207707_10034687 | |||
| 1160 | Ga0207707_10060152 | |||
| 1161 | Ga0207707_10246634 | |||
| 1162 | Ga0207707_10281860 | |||
| 1163 | Ga0207695_10026630 | |||
| 1164 | Ga0207695_10086973 | |||
| 1165 | Ga0207695_10463154 | |||
| 1166 | Ga0207693_10000198 | |||
| 1167 | Ga0207693_10001236 | |||
| 1168 | Ga0207693_10011298 | |||
| 1169 | Ga0207693_10095680 | |||
| 1170 | Ga0207693_10166137 | |||
| 1171 | Ga0207693_10188926 | |||
| 1172 | Ga0207663_10001587 | |||
| 1173 | Ga0207663_10002285 | |||
| 1174 | Ga0207663_10012633 | |||
| 1175 | Ga0207663_10026765 | |||
| 1176 | Ga0207660_10024801 | |||
| 1177 | Ga0207660_10042389 | |||
| 1178 | Ga0207660_10339217 | |||
| 1179 | Ga0207657_10000729 | |||
| 1180 | Ga0207657_10001944 | |||
| 1181 | Ga0207657_10002416 | |||
| 1182 | Ga0207657_10002425 | |||
| 1183 | Ga0207657_10009726 | |||
| 1184 | Ga0207657_10027145 | |||
| 1185 | Ga0207657_10035128 | |||
| 1186 | Ga0207657_10037458 | |||
| 1187 | Ga0207657_10118803 | |||
| 1188 | Ga0207657_10132457 | |||
| 1189 | Ga0207649_10067582 | |||
| 1190 | Ga0207652_10020492 | |||
| 1191 | Ga0207652_10036464 | |||
| 1192 | Ga0207652_10039331 | |||
| 1193 | Ga0207652_10060085 | |||
| 1194 | Ga0207652_10094954 | |||
| 1195 | Ga0207652_10159514 | |||
| 1196 | Ga0207652_10266815 | |||
| 1197 | Ga0207652_10357906 | |||
| 1198 | Ga0207646_10006773 | |||
| 1199 | Ga0207646_10038974 | |||
| 1200 | Ga0207646_10171619 | |||
| 1201 | Ga0207687_10030229 | |||
| 1202 | Ga0207687_10314486 | |||
| 1203 | Ga0207700_10000002 | |||
| 1204 | Ga0207700_10008204 | |||
| 1205 | Ga0207700_10204248 | |||
| 1206 | Ga0207700_10211520 | |||
| 1207 | Ga0207700_10442565 | |||
| 1208 | Ga0207664_10004871 | |||
| 1209 | Ga0207664_10020692 | |||
| 1210 | Ga0207664_10022769 | |||
| 1211 | Ga0207664_10036073 | |||
| 1212 | Ga0207664_10054474 | |||
| 1213 | Ga0207664_10062382 | |||
| 1214 | Ga0207664_10159558 | |||
| 1215 | Ga0207664_10202970 | |||
| 1216 | Ga0207690_10030517 | |||
| 1217 | Ga0207690_10235815 | |||
| 1218 | Ga0207706_10005925 | |||
| 1219 | Ga0207686_10045997 | |||
| 1220 | Ga0207709_10021542 | |||
| 1221 | Ga0207709_10092087 | |||
| 1222 | Ga0207709_10125925 | |||
| 1223 | Ga0207704_10128909 | |||
| 1224 | Ga0207665_10001160 | |||
| 1225 | Ga0207711_10188256 | |||
| 1226 | Ga0207711_10242217 | |||
| 1227 | Ga0207661_10011427 | |||
| 1228 | Ga0207661_10061371 | |||
| 1229 | Ga0207661_10120593 | |||
| 1230 | Ga0207661_10153665 | |||
| 1231 | Ga0207661_10178683 | |||
| 1232 | Ga0207661_10353747 | |||
| 1233 | Ga0207667_10027332 | |||
| 1234 | Ga0207667_10039109 | |||
| 1235 | Ga0207667_10064993 | |||
| 1236 | Ga0207667_10110636 | |||
| 1237 | Ga0207667_10258340 | |||
| 1238 | Ga0207667_10440796 | |||
| 1239 | Ga0207651_10311020 | |||
| 1240 | Ga0207668_10427865 | |||
| 1241 | Ga0207640_10223349 | |||
| 1242 | Ga0207639_10174660 | |||
| 1243 | Ga0207678_10019356 | |||
| 1244 | Ga0207678_10360103 | |||
| 1245 | Ga0207708_10000986 | |||
| 1246 | Ga0207702_10049965 | |||
| 1247 | Ga0207702_10060806 | |||
| 1248 | Ga0207702_10098734 | |||
| 1249 | Ga0207702_10126675 | |||
| 1250 | Ga0207648_10001924 | |||
| 1251 | Ga0207674_10006916 | |||
| 1252 | Ga0207674_10015274 | |||
| 1253 | Ga0207674_10176158 | |||
| 1254 | Ga0207675_100018455 | |||
| 1255 | Ga0207675_100383335 | |||
| 1256 | Ga0207683_10014165 | |||
| 1257 | Ga0207683_10014555 | |||
| 1258 | Ga0207683_10282782 | |||
| 1259 | Ga0207698_10046006 | |||
| 1260 | Ga0207698_10370521 | |||
| 1261 | Ga0207428_10108669 | |||
| 1262 | Ga0268265_10019906 | |||
| 1263 | Ga0265334_10006282 | |||
| 1264 | Ga0265318_10001740 | |||
| 1265 | Ga0265322_10011017 | |||
| 1266 | Ga0265338_10002373 | |||
| 1267 | Ga0265338_10004407 | |||
| 1268 | Ga0265338_10009073 | |||
| 1269 | Ga0265338_10018002 | |||
| 1270 | Ga0265338_10048722 | |||
| 1271 | Ga0265324_10009357 | |||
| 1272 | Ga0265330_10017276 | |||
| 1273 | Ga0265320_10094178 | |||
| 1274 | Ga0265329_10013593 | |||
| 1275 | Ga0265340_10052617 | |||
| 1276 | Ga0265339_10046083 | |||
| 1277 | Ga0265331_10030260 | |||
| 1278 | Ga0265327_10011995 | |||
| 1279 | Ga0265316_10034585 | |||
| 1280 | Ga0307408_100091832 | |||
| 1281 | Ga0265313_10008218 | |||
| 1282 | Ga0265314_10032081 | |||
| 1283 | Ga0265314_10035094 | |||
| 1284 | Ga0265342_10010109 | |||
| 1285 | Ga0307405_10162248 | |||
| 1286 | Ga0307412_10117038 | |||
| 1287 | Ga0307416_100304657 | |||
| 1288 | Ga0307416_100824550 | |||
| 1289 | Ga0307415_100257229 | |||
| 1290 | Ga0373930_0019613 | |||
| 1291 | Ga0373938_0033567 | |||
| 1292 | Ga0373926_0097929 | |||
| 1293 | Ga0373929_0031673 | |||
| 1294 | Ga0373949_0009300 | |||
| 1295 | Ga0373936_0003528 | |||
| 1296 | Ga0373945_0012094 | |||
| 1297 | Ga0373945_0038516 | |||
| 1298 | Ga0373943_0008261 | |||
| 1299 | Ga0373943_0010211 | |||
| 1300 | Ga0373943_0079290 | |||
| 1301 | Ga0373946_0116190 | |||
| 1302 | Ga0373955_0011626 | |||
| 1303 | Ga0373931_0043647 | |||
| 1304 | Ga0373931_0327906 | |||
| 1305 | Ga0373935_0019055 | |||
| 1306 | Ga0373935_0026168 | |||
| 1307 | Ga0373927_0224198 | |||
| 1308 | Ga0373927_0232868 | |||
| 1309 | Ga0373933_0210488 | |||
| 1310 | Ga0373947_0007236 | |||
| 1311 | Ga0373947_0027357 | |||
| 1312 | Ga0373947_0175565 | |||
| 1313 | Ga0373937_0002702 | |||
| 1314 | Ga0373937_0013631 | |||
| 1315 | Ga0373925_0000887 | |||
| 1316 | Ga0373925_0048940 | |||
| 1317 | Ga0373925_0423318 | |||
| 1318 | Ga0395899_0006493 | |||
| 1319 | Ga0395899_0027720 | |||
| 1320 | Ga0395899_0038289 | |||
| 1321 | Ga0395899_0065796 | |||
| 1322 | Ga0395899_0097873 | |||
| 1323 | Ga0395899_0115847 | |||
| 1324 | Ga0395899_0137982 | |||
| 1325 | Ga0395899_0203010 | |||
| 1326 | Ga0395900_0003003 | |||
| 1327 | Ga0395900_0005192 | |||
| 1328 | Ga0395900_0010314 | |||
| 1329 | Ga0395900_0025691 | |||
| 1330 | Ga0395900_0047346 | |||
| 1331 | Ga0395900_0054811 | |||
| 1332 | Ga0395900_0058822 | |||
| 1333 | Ga0395900_0084378 | |||
| 1334 | Ga0395900_0102560 | |||
| 1335 | Ga0395900_0117441 | |||
| 1336 | Ga0395900_0119574 | |||
| 1337 | Ga0395900_0190422 | |||
| 1338 | Ga0395900_0200708 | |||
| 1339 | Ga0395900_0201288 | |||
| 1340 | Ga0395900_0250774 | |||
| 1341 | Ga0395900_0254807 | |||
| 1342 | Ga0395900_0364211 | |||
| 1343 | Ga0395900_0397301 | |||
| 1344 | Ga0395900_0522844 | |||
| 1345 | Ga0395898_0002500 | |||
| 1346 | Ga0395898_0005115 | |||
| 1347 | Ga0395898_0005507 | |||
| 1348 | Ga0395898_0006288 | |||
| 1349 | Ga0395898_0006891 | |||
| 1350 | Ga0395898_0007490 | |||
| 1351 | Ga0395898_0010056 | |||
| 1352 | Ga0395898_0010259 | |||
| 1353 | Ga0395898_0038193 | |||
| 1354 | Ga0395898_0054599 | |||
| 1355 | Ga0395898_0094559 | |||
| 1356 | Ga0395898_0141984 | |||
| 1357 | Ga0395898_0206992 | |||
| 1358 | Ga0395898_0334317 | |||
| 1359 | Ga0395898_0349251 | |||
| 1360 | Ga0395898_0380825 | |||
| 1361 | Ga0395905_0004014 | |||
| 1362 | Ga0395905_0004601 | |||
| 1363 | Ga0395905_0015855 | |||
| 1364 | Ga0395905_0029709 | |||
| 1365 | Ga0395905_0057057 | |||
| 1366 | Ga0395905_0065671 | |||
| 1367 | Ga0395905_0099535 | |||
| 1368 | Ga0395905_0105216 | |||
| 1369 | Ga0395905_0121863 | |||
| 1370 | Ga0395905_0125610 | |||
| 1371 | Ga0395905_0206378 | |||
| 1372 | Ga0395905_0239553 | |||
| 1373 | Ga0395901_0001290 | |||
| 1374 | Ga0395901_0005511 | |||
| 1375 | Ga0395901_0008519 | |||
| 1376 | Ga0395901_0009578 | |||
| 1377 | Ga0395901_0010572 | |||
| 1378 | Ga0395901_0045077 | |||
| 1379 | Ga0395901_0052258 | |||
| 1380 | Ga0395901_0053403 | |||
| 1381 | Ga0395901_0058631 | |||
| 1382 | Ga0395901_0062351 | |||
| 1383 | Ga0395901_0103279 | |||
| 1384 | Ga0395901_0144857 | |||
| 1385 | Ga0395901_0207421 | |||
| 1386 | Ga0395901_0270849 | |||
| 1387 | Ga0395901_0306311 | |||
| 1388 | Ga0395901_0346725 | |||
| 1389 | Ga0395901_0385656 | |||
| 1390 | Ga0395901_0398818 | |||
| 1391 | Ga0395901_0411670 | |||
| 1392 | Ga0436365_1635017 | |||
| 1393 | Ga0436360_0675505 | |||
| 1394 | Ga0436363_1405693 | |||
| 1395 | Ga0436362_0654759 | |||
| 1396 | Ga0439448_0031201 | |||
| 1397 | Ga0466969_0008928 | |||
| 1398 | Ga0466966_0008382 | |||
| 1399 | Ga0466966_0021106 | |||
| 1400 | Ga0466966_0043266 | |||
| 1401 | Ga0466961_0009165 | |||
| 1402 | Ga0466961_0010210 | |||
| 1403 | Ga0466961_0018116 | |||
| 1404 | Ga0466961_0018402 | |||
| 1405 | Ga0466961_0053370 | |||
| 1406 | Ga0466961_0072893 | |||
| 1407 | Ga0466963_0000245 | |||
| 1408 | Ga0466963_0001068 | |||
| 1409 | Ga0466963_0001151 | |||
| 1410 | Ga0466963_0001242 | |||
| 1411 | Ga0466963_0001451 | |||
| 1412 | Ga0466963_0003886 | |||
| 1413 | Ga0466963_0008385 | |||
| 1414 | Ga0466963_0011379 | |||
| 1415 | Ga0466963_0017456 | |||
| 1416 | Ga0466963_0029728 | |||
| 1417 | Ga0466963_0042163 | |||
| 1418 | Ga0466963_0042817 | |||
| 1419 | Ga0466963_0045142 | |||
| 1420 | Ga0466963_0057870 | |||
| 1421 | Ga0466963_0059378 | |||
| 1422 | Ga0466963_0066958 | |||
| 1423 | Ga0466963_0082539 | |||
| 1424 | Ga0466963_0094190 | |||
| 1425 | Ga0466964_0001695 | |||
| 1426 | Ga0466964_0004325 | |||
| 1427 | Ga0466964_0010161 | |||
| 1428 | Ga0466964_0012649 | |||
| 1429 | Ga0466964_0062957 | |||
| 1430 | Ga0466971_0005705 | |||
| 1431 | Ga0466971_0010690 | |||
| 1432 | Ga0466971_0034164 | |||
| 1433 | Ga0466971_0081283 | |||
| 1434 | Ga0466968_0001438 | |||
| 1435 | Ga0466968_0029908 | |||
| 1436 | Ga0466968_0072405 | |||
| 1437 | Ga0466970_0015231 | |||
| 1438 | Ga0466957_0002511 | |||
| 1439 | Ga0466957_0014263 | |||
| 1440 | Ga0466957_0027826 | |||
| 1441 | Ga0466957_0035546 | |||
| 1442 | Ga0466957_0038111 | |||
| 1443 | Ga0466957_0045409 | |||
| 1444 | Ga0466957_0083971 | |||
| 1445 | Ga0466957_0095459 | |||
| 1446 | Ga0466957_0109690 | |||
| 1447 | Ga0466957_0155258 | |||
| 1448 | Ga0466957_0199053 | |||
| 1449 | Ga0466960_0003215 | |||
| 1450 | Ga0466960_0059436 | |||
| 1451 | Ga0466960_0129013 | |||
| 1452 | Ga0466959_0001526 | |||
| 1453 | Ga0466959_0002072 | |||
| 1454 | Ga0466959_0008410 | |||
| 1455 | Ga0466959_0018997 | |||
| 1456 | Ga0466959_0063654 | |||
| 1457 | Ga0466959_0096284 | |||
| 1458 | Ga0466959_0128691 | |||
| 1459 | Ga0466959_0199493 | |||
| 1460 | Ga0451576_0210932 | |||
| 1461 | Ga0466958_0000293 | |||
| 1462 | Ga0466958_0001578 | |||
| 1463 | Ga0466958_0007797 | |||
| 1464 | Ga0466958_0015674 | |||
| 1465 | Ga0466958_0022876 | |||
| 1466 | Ga0466958_0032844 | |||
| 1467 | Ga0466958_0064173 | |||
| 1468 | Ga0466958_0109648 | |||
| 1469 | Ga0466958_0144413 | |||
| 1470 | Ga0466967_0000437 | |||
| 1471 | Ga0466967_0000541 | |||
| 1472 | Ga0466967_0003389 | |||
| 1473 | Ga0466967_0004389 | |||
| 1474 | Ga0466967_0005119 | |||
| 1475 | Ga0466967_0013571 | |||
| 1476 | Ga0466967_0037927 | |||
| 1477 | Ga0466967_0039356 | |||
| 1478 | Ga0466967_0041592 | |||
| 1479 | Ga0466967_0047619 | |||
| 1480 | Ga0466967_0049017 | |||
| 1481 | Ga0466967_0049174 | |||
| 1482 | Ga0466967_0056164 | |||
| 1483 | Ga0466967_0058837 | |||
| 1484 | Ga0466967_0060951 | |||
| 1485 | Ga0466967_0064542 | |||
| 1486 | Ga0466967_0071757 | |||
| 1487 | Ga0466967_0084621 | |||
| 1488 | Ga0466967_0087305 | |||
| 1489 | Ga0466967_0094002 | |||
| 1490 | Ga0466967_0099522 | |||
| 1491 | Ga0466967_0134523 | |||
| 1492 | Ga0466967_0145460 | |||
| 1493 | Ga0466967_0223462 | |||
| 1494 | Ga0466967_0234398 | |||
| 1495 | Ga0466967_0237964 | |||
| 1496 | Ga0466967_0243357 | |||
| 1497 | Ga0466967_0264775 | |||
| 1498 | Ga0466967_0288331 | |||
| 1499 | Ga0466967_0404560 | |||
| 1500 | Ga0495592_0000708 | |||
| 1501 | Ga0495592_0026688 | |||
| 1502 | Ga0495592_0105501 | |||
| 1503 | Ga0495603_0018073 | |||
| 1504 | Ga0495629_0017075 | |||
| 1505 | Ga0495629_0017103 | |||
| 1506 | Ga0495641_0008385 | |||
| 1507 | Ga0495641_0046512 | |||
| 1508 | Ga0495641_0077799 | |||
| 1509 | Ga0495651_0000885 | |||
| 1510 | Ga0495651_0056069 | |||
| 1511 | Ga0495651_0085349 | |||
| 1512 | Ga0495651_0099755 | |||
| 1513 | Ga0495653_0013755 | |||
| 1514 | Ga0495653_0085691 | |||
| 1515 | Ga0495653_0098388 | |||
| 1516 | Ga0495580_0120453 | |||
| 1517 | Ga0495580_0238023 | |||
| 1518 | Ga0495582_0059207 | |||
| 1519 | Ga0495582_0175063 | |||
| 1520 | Ga0495639_0000458 | |||
| 1521 | Ga0495662_0000722 | |||
| 1522 | Ga0495664_0193757 | |||
| 1523 | Ga0495584_0080912 | |||
| 1524 | Ga0495585_0142547 | |||
| 1525 | Ga0495596_0037409 | |||
| 1526 | Ga0495607_0011635 | |||
| 1527 | Ga0495608_0004093 | |||
| 1528 | Ga0495608_0005519 | |||
| 1529 | Ga0495608_0028281 | |||
| 1530 | Ga0495608_0269519 | |||
| 1531 | Ga0495618_0027065 | |||
| 1532 | Ga0495618_0074647 | |||
| 1533 | Ga0495618_0223125 | |||
| 1534 | Ga0495628_0001243 | |||
| 1535 | Ga0495628_0115734 | |||
| 1536 | Ga0495630_0011609 | |||
| 1537 | Ga0495630_0034757 | |||
| 1538 | Ga0495663_0003333 | |||
| 1539 | Ga0495666_0000065 | |||
| 1540 | Ga0495652_0010178 | |||
| 1541 | Ga0495652_0084219 | |||
| 1542 | Ga0495652_0210647 | |||
| 1543 | Ga0495652_0235303 | |||
| 1544 | Ga0495665_0005926 | |||
| 1545 | Ga0495665_0152516 | |||
| 1546 | Ga0495640_0002040 | |||
| 1547 | Ga0495640_0083800 | |||
| 1548 | Ga0495640_0100616 | |||
| 1549 | Ga0495586_0007245 | |||
| 1550 | Ga0495586_0178990 | |||
| 1551 | Ga0495586_0205037 | |||
| 1552 | Ga0495587_0000675 | |||
| 1553 | Ga0495587_0006475 | |||
| 1554 | Ga0495645_0000684 | |||
| 1555 | Ga0495667_0004970 | |||
| 1556 | Ga0495667_0073259 | |||
| 1557 | Ga0495667_0090422 | |||
| 1558 | Ga0495667_0138581 | |||
| 1559 | Ga0495667_0334725 | |||
| 1560 | Ga0495656_0107032 | |||
| 1561 | Ga0495668_0144295 | |||
| 1562 | Ga0495634_0019011 | |||
| 1563 | Ga0495634_0060069 | |||
| 1564 | Ga0495634_0107634 | |||
| 1565 | Ga0495634_0157625 | |||
| 1566 | Ga0495635_0026093 | |||
| 1567 | Ga0495635_0070147 | |||
| 1568 | Ga0495635_0091826 | |||
| 1569 | Ga0495635_0113655 | |||
| 1570 | Ga0495659_0040567 | |||
| 1571 | Ga0495657_0020319 | |||
| 1572 | Ga0495657_0067092 | |||
| 1573 | Ga0495657_0072893 | |||
| 1574 | Ga0495599_0000455 | |||
| 1575 | Ga0495599_0001792 | |||
| 1576 | Ga0495599_0136555 | |||
| 1577 | Ga0495599_0200681 | |||
| 1578 | Ga0495623_0001619 | |||
| 1579 | Ga0495623_0099594 | |||
| 1580 | Ga0495646_0015915 | |||
| 1581 | Ga0495646_0172189 | |||
| 1582 | Ga0495646_0195507 | |||
| 1583 | Ga0495647_0000075 | |||
| 1584 | Ga0495658_0003735 | |||
| 1585 | Ga0495658_0038841 | |||
| 1586 | Ga0495613_0013358 | |||
| 1587 | Ga0495613_0093119 | |||
| 1588 | Ga0495613_0119063 | |||
| 1589 | Ga0495613_0234524 | |||
| 1590 | Ga0495624_0014761 | |||
| 1591 | Ga0495624_0029796 | |||
| 1592 | Ga0495624_0129901 | |||
| 1593 | Ga0495624_0131165 | |||
| 1594 | Ga0495670_0074045 | |||
| 1595 | Ga0495600_0018065 | |||
| 1596 | Ga0495600_0059255 | |||
| 1597 | Ga0495604_0001028 | |||
| 1598 | Ga0495604_0003434 | |||
| 1599 | Ga0495674_0058142 | |||
| 1600 | Ga0495674_0162234 | |||
| 1601 | Ga0495674_0192570 | |||
| 1602 | Ga0495674_0373137 | |||
| 1603 | Ga0495676_0044046 | |||
| 1604 | Ga0495676_0096118 | |||
| 1605 | Ga0495680_0001991 | |||
| 1606 | Ga0495680_0020713 | |||
| 1607 | Ga0495680_0023772 | |||
| 1608 | Ga0495680_0026531 | |||
| 1609 | Ga0495680_0154823 | |||
| 1610 | Ga0495680_0165988 | |||
| 1611 | Ga0495675_0000592 | |||
| 1612 | Ga0495675_0065278 | |||
| 1613 | Ga0495685_061193 | |||
| 1614 | Ga0495684_0018793 | |||
| 1615 | Ga0495684_0050383 | |||
| 1616 | Ga0495593_0000573 | |||
| 1617 | Ga0495602_0001484 | |||
| 1618 | Ga0495602_0092325 | |||
| 1619 | Ga0495602_0248430 | |||
| 1620 | Ga0495602_0250110 | |||
| 1621 | Ga0495614_0028764 | |||
| 1622 | Ga0495614_0038884 | |||
| 1623 | Ga0496100_0011890 | |||
| 1624 | Ga0496100_0032173 | |||
| 1625 | Ga0496100_0040168 | |||
| 1626 | Ga0496100_0310071 | |||
| 1627 | Ga0496100_0356743 | |||
| 1628 | Ga0496100_0375180 | |||
| 1629 | Ga0496101_0004111 | |||
| 1630 | Ga0496101_0035348 | |||
| 1631 | Ga0496101_0040080 | |||
| 1632 | Ga0496101_0046867 | |||
| 1633 | Ga0496101_0051260 | |||
| 1634 | Ga0496101_0051470 | |||
| 1635 | Ga0496101_0083944 | |||
| 1636 | Ga0496101_0098855 | |||
| 1637 | Ga0496101_0231828 | |||
| 1638 | Ga0496101_0247516 | |||
| 1639 | Ga0496102_0004397 | |||
| 1640 | Ga0496102_0009170 | |||
| 1641 | Ga0496102_0215117 | |||
| 1642 | Ga0496102_0293871 | |||
| 1643 | Ga0496103_0010455 | |||
| 1644 | Ga0496103_0015473 | |||
| 1645 | Ga0496103_0022703 | |||
| 1646 | Ga0496103_0023647 | |||
| 1647 | Ga0496103_0111509 | |||
| 1648 | Ga0496104_0000381 | |||
| 1649 | Ga0496104_0000722 | |||
| 1650 | Ga0496104_0002589 | |||
| 1651 | Ga0496104_0037068 | |||
| 1652 | Ga0496104_0046796 | |||
| 1653 | Ga0496104_0057993 | |||
| 1654 | Ga0496104_0067819 | |||
| 1655 | Ga0496104_0158407 | |||
| 1656 | Ga0496104_0176978 | |||
| 1657 | Ga0496104_0286997 | |||
| 1658 | Ga0496105_0000228 | |||
| 1659 | Ga0496105_0005243 | |||
| 1660 | Ga0496105_0005493 | |||
| 1661 | Ga0496105_0007188 | |||
| 1662 | Ga0496105_0025873 | |||
| 1663 | Ga0496105_0055436 | |||
| 1664 | Ga0496105_0162095 | |||
| 1665 | Ga0496105_0201563 | |||
| 1666 | Ga0496105_0207726 | |||
| 1667 | Ga0496105_0225793 | |||
| 1668 | Ga0496105_0275250 | |||
| 1669 | Ga0496106_0003519 | |||
| 1670 | Ga0496106_0003660 | |||
| 1671 | Ga0496106_0041243 | |||
| 1672 | Ga0496106_0050114 | |||
| 1673 | Ga0496106_0089874 | |||
| 1674 | Ga0496107_0011320 | |||
| 1675 | Ga0496107_0013331 | |||
| 1676 | Ga0496107_0016895 | |||
| 1677 | Ga0496107_0025420 | |||
| 1678 | Ga0496107_0074306 | |||
| 1679 | Ga0496107_0087889 | |||
| 1680 | Ga0496107_0143941 | |||
| 1681 | Ga0496107_0194943 | |||
| 1682 | Ga0496108_0000826 | |||
| 1683 | Ga0496108_0001569 | |||
| 1684 | Ga0496108_0036246 | |||
| 1685 | Ga0496108_0069368 | |||
| 1686 | Ga0496108_0160501 | |||
| 1687 | Ga0496108_0190278 | |||
| 1688 | Ga0496108_0271931 | |||
| 1689 | Ga0496109_0001686 | |||
| 1690 | Ga0496109_0001801 | |||
| 1691 | Ga0496109_0002311 | |||
| 1692 | Ga0496109_0007129 | |||
| 1693 | Ga0496109_0013766 | |||
| 1694 | Ga0496109_0018825 | |||
| 1695 | Ga0496109_0027355 | |||
| 1696 | Ga0496109_0083459 | |||
| 1697 | Ga0496109_0182796 | |||
| 1698 | Ga0496109_0453360 | |||
| 1699 | Ga0496110_0000439 | |||
| 1700 | Ga0496110_0000890 | |||
| 1701 | Ga0496110_0001269 | |||
| 1702 | Ga0496110_0002029 | |||
| 1703 | Ga0496110_0058772 | |||
| 1704 | Ga0496110_0064743 | |||
| 1705 | Ga0496110_0125060 | |||
| 1706 | Ga0496110_0262255 | |||
| 1707 | Ga0496110_0401579 | |||
| 1708 | Ga0496110_0539308 | |||
| 1709 | Ga0496111_0000025 | |||
| 1710 | Ga0496111_0000043 | |||
| 1711 | Ga0496111_0000159 | |||
| 1712 | Ga0496111_0013019 | |||
| 1713 | Ga0496111_0014358 | |||
| 1714 | Ga0496111_0069103 | |||
| 1715 | Ga0496111_0086215 | |||
| 1716 | Ga0496111_0302209 | |||
| 1717 | Ga0496112_0000145 | |||
| 1718 | Ga0496112_0000825 | |||
| 1719 | Ga0496112_0001618 | |||
| 1720 | Ga0496112_0007822 | |||
| 1721 | Ga0496112_0009374 | |||
| 1722 | Ga0496112_0015565 | |||
| 1723 | Ga0496112_0017377 | |||
| 1724 | Ga0496112_0022054 | |||
| 1725 | Ga0496112_0101603 | |||
| 1726 | Ga0496112_0335355 | |||
| 1727 | Ga0496113_0000298 | |||
| 1728 | Ga0496113_0013338 | |||
| 1729 | Ga0496113_0073161 | |||
| 1730 | Ga0496113_0264190 | |||
| 1731 | Ga0496113_0288847 | |||
| 1732 | Ga0496114_0001276 | |||
| 1733 | Ga0496114_0002346 | |||
| 1734 | Ga0496114_0010426 | |||
| 1735 | Ga0496114_0037095 | |||
| 1736 | Ga0496114_0053314 | |||
| 1737 | Ga0496114_0207061 | |||
| 1738 | Ga0496114_0389303 | |||
| 1739 | Ga0496115_0005166 | |||
| 1740 | Ga0496115_0005749 | |||
| 1741 | Ga0496115_0172165 | |||
| 1742 | Ga0496115_0299259 | |||
| 1743 | Ga0496115_0535828 | |||
| 1744 | Ga0501033_0179141 | |||
| 1745 | Ga0501034_0011736 | |||
| 1746 | Ga0501036_0010229 | |||
| 1747 | Ga0501037_0107111 | |||
| 1748 | Ga0501038_0022876 | |||
| 1749 | Ga0501039_0043719 | |||
| 1750 | Ga0501040_0012914 | |||
| 1751 | Ga0501041_0006507 | |||
| 1752 | Ga0501042_0004105 | |||
| 1753 | Ga0501042_0101254 | |||
| 1754 | Ga0501043_0047930 | |||
| 1755 | Ga0501046_0005156 | |||
| 1756 | Ga0501047_0104525 | |||
| 1757 | Ga0501047_0234706 | |||
| 1758 | Ga0501047_0380622 | |||
| 1759 | Ga0501048_0012667 | |||
| 1760 | Ga0501067_0000285 | |||
| 1761 | Ga0501067_0010527 | |||
| 1762 | Ga0501067_0031828 | |||
| 1763 | Ga0501067_0074360 | |||
| 1764 | Ga0501067_0273179 | |||
| 1765 | Ga0501069_0009378 | |||
| 1766 | Ga0501069_0033759 | |||
| 1767 | Ga0501069_0112638 | |||
| 1768 | Ga0501070_0006704 | |||
| 1769 | Ga0501070_0041894 | |||
| 1770 | Ga0501070_0046318 | |||
| 1771 | Ga0501070_0148339 | |||
| 1772 | Ga0501070_0419773 | |||
| 1773 | Ga0501071_0005995 | |||
| 1774 | Ga0501072_0018183 | |||
| 1775 | Ga0501072_0221044 | |||
| 1776 | Ga0501073_0065524 | |||
| 1777 | Ga0501073_0190285 | |||
| 1778 | Ga0501073_0319373 | |||
| 1779 | Ga0501074_0004989 | |||
| 1780 | Ga0501074_0023227 | |||
| 1781 | Ga0501074_0034929 | |||
| 1782 | Ga0501074_0046880 | |||
| 1783 | Ga0501076_0008422 | |||
| 1784 | Ga0501077_0003802 | |||
| 1785 | Ga0501079_0008442 | |||
| 1786 | Ga0501079_0115519 | |||
| 1787 | Ga0501080_0013478 | |||
| 1788 | Ga0501080_0025256 | |||
| 1789 | Ga0501080_0047747 | |||
| 1790 | Ga0501081_0086423 | |||
| 1791 | Ga0501083_0000145 | |||
| 1792 | Ga0501035_0004588 | |||
| 1793 | nmdc:mga0yw44_3385_c1 | |||
| 1794 | nmdc:mga05p37_56108_c1 | |||
| 1795 | nmdc:mga05p37_91944_c1 | |||
| 1796 | nmdc:mga08y16_103182_c1 | |||
| 1797 | nmdc:mga08y16_435177_c1 | |||
| 1798 | nmdc:mga0n895_131012_c1 | |||
| 1799 | nmdc:mga0n895_18140_c1 | |||
| 1800 | nmdc:mga0n895_25545_c1 | |||
| 1801 | nmdc:mga0n895_515029_c1 | |||
| 1802 | nmdc:mga0rr50_2136_c1 | |||
| 1803 | nmdc:mga08x19_67862_c1 | |||
| 1804 | nmdc:mga0a205_10114_c1 | |||
| 1805 | nmdc:mga0a205_135178_c1 | |||
| 1806 | nmdc:mga0a205_660_c1 | |||
| 1807 | nmdc:mga0a205_77257_c1 | |||
| 1808 | Ga0495601_0002343 | |||
| 1809 | Ga0495601_0030145 | |||
| 1810 | Ga0495601_0159790 | |||
| 1811 | Ga0495655_0004954 | |||
| 1812 | Ga0495595_0020754 | |||
| 1813 | Ga0495595_0030260 | |||
| 1814 | Ga0495619_0006146 | |||
| 1815 | Ga0495619_0007501 | |||
| 1816 | Ga0495619_0007751 | |||
| 1817 | Ga0495619_0020923 | |||
| 1818 | Ga0495619_0058399 | |||
| 1819 | Ga0495619_0067716 | |||
| 1820 | Ga0500566_0038615 | |||
| 1821 | Ga0501084_0048891 | |||
| 1822 | Ga0501084_0154495 | |||
| 1823 | Ga0501082_0001530 | |||
| 1824 | Ga0466962_0000941 | |||
| 1825 | Ga0466962_0003162 | |||
| 1826 | Ga0466962_0004548 | |||
| 1827 | Ga0466962_0009512 | |||
| 1828 | Ga0466962_0023118 | |||
| 1829 | Ga0466962_0066112 | |||
| 1830 | Ga0466962_0083379 | |||
| 1831 | Ga0530510_0002901 | |||
| 1832 | Ga0530510_0025866 | |||
| 1833 | Ga0530510_0252610 | |||
| 1834 | Ga0530510_0287132 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b7p-assembly1.cif.gz_A | crystal structure of legionella effector sded (lpg2509) | 0.6012 | 80 | 209 |
| 6ryb-assembly1.cif.gz_A | structure of deubiquitinase for pr-ubiquitination 1 -dup1 | 0.5993 | 80 | 214 |
| 1vla-assembly1.cif.gz_A | crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution | 0.5436 | 228 | 276 |
| 5up0-assembly1.cif.gz_A | crystal structure of human pde1b catalytic domain in complex with inhibitor 3 (6-(4-chlorobenzyl)-8,9,10,11-tetrahydrobenzo[4,5]thieno[3,2-e][1,2,4]triazolo[1,5-c]pyrimidin-5(6h)-one) | 0.5423 | 46 | 204 |
| 6pbz-assembly1.cif.gz_B | crystal structure of escherichia coli gppa | 0.5411 | 66 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58426_28_188_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9253 | 60 | 218 | 1.10.3210.10 |
| af_Q58426_28_188_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9086 | 60 | 218 | 1.10.3210.10 |
| af_P23003_45_186_2.40.50.1070 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.5659 | 193 | 292 | 2.40.50.1070 |
| af_Q2FWA9_216_326_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.5476 | 239 | 280 | 3.30.70.1350 |
| af_F4HZF4_333_543_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5323 | 60 | 273 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9THA4-F1-model_v4 | HD domain-containing protein | 0.9824 | 34 | 202 |
|
| AF-A0A382XCN4-F1-model_v4 | HD domain-containing protein | 0.9818 | 34 | 191 |
|
| AF-A0A2H9NVM2-F1-model_v4 | Phosphohydrolase | 0.9763 | 35 | 180 |
GO:0016787
|
| AF-A0A2H9NVM2-F1-model_v4 | Phosphohydrolase | 0.9698 | 35 | 180 |
GO:0016787
|
| AF-A0A7J3MYU3-F1-model_v4 | HD domain-containing protein | 0.9601 | 42 | 174 |
|