F485636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 917 | 286 | 914 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100064393|Ga0070670_1000643934 |
| Length | 382 |
| Sequence | VLLATVFRFVPHLYPRPMSTFLGWGRRVRGLFADTKGPWGPSGAGDDGGDPPSDDGHSXPWGETPPRRRRAGSGVSGNVTSLDEFLRRGRARFGGGDGGGFPGRPDRSLIFWAFLAFIVLWLLITSVHVISPGQRGVVTRFGRYSSTLGPGVSITLPSPVDRVTKLDVENIRTIDLGSAEANDLMLTGDQNLLDIAYSVRWNIRTPELYLFQLAQPDETIRQVAESAMRAVVSRVSLNDAMGDKRAEIETQVAETMQRILDSYRSGVQVQGIAIKQADPPDAVNDAFKEVTAAQQDAQSYVNQARAYALQLTAKAQGEATAFDKVYEQYKLAPDVTRRRMYYETMEQVLSKVDKTIIEAPGVTPYLPLPEVKKAQPVREPQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 214 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 215 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 216 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 217 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 269 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 281 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 282 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 285 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.25 |
| Nodule | 0 |
| Rhizoplane | 3.82 |
| Rhizosphere | 90.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002747 | 3300001979 | Bacteria | 7868 |
| 2 | JGI24739J22299_10000306 | 3300001989 | Bacteria | 16642 |
| 3 | JGI24737J22298_10000049 | 3300001990 | Bacteria | 34488 |
| 4 | JGI24737J22298_10003952 | 3300001990 | Bacteria | 5191 |
| 5 | JGI24737J22298_10013375 | 3300001990 | Bacteria | 2671 |
| 6 | JGI24743J22301_10013314 | 3300001991 | Bacteria | 1505 |
| 7 | JGI24735J21928_10026800 | 3300002067 | Bacteria | 1730 |
| 8 | JGI24745J21846_1001888 | 3300002073 | Bacteria | 2081 |
| 9 | JGI24738J21930_10000024 | 3300002075 | Bacteria | 28601 |
| 10 | JGI24738J21930_10006708 | 3300002075 | Bacteria | 2680 |
| 11 | JGI24742J22300_10020299 | 3300002244 | Bacteria | 1132 |
| 12 | JGI25150J39212_1000520 | 3300002774 | Bacteria | 15782 |
| 13 | JGI25151J46595_10017622 | 3300003187 | Bacteria | 3091 |
| 14 | JGI25153J46596_10000027 | 3300003215 | Bacteria | 210760 |
| 15 | JGI25153J46596_10003772 | 3300003215 | Bacteria | 8366 |
| 16 | Ga0055526_1001967 | 3300003771 | Bacteria | 14195 |
| 17 | Ga0055537_1000924 | 3300003773 | Bacteria | 13735 |
| 18 | Ga0055537_1003360 | 3300003773 | Bacteria | 4949 |
| 19 | Ga0055524_1000730 | 3300003775 | Bacteria | 22562 |
| 20 | Ga0055530_10000938 | 3300003791 | Bacteria | 23853 |
| 21 | Ga0055530_10001352 | 3300003791 | Bacteria | 18259 |
| 22 | Ga0055540_1001409 | 3300003792 | Bacteria | 14359 |
| 23 | Ga0055531_10000812 | 3300003794 | Bacteria | 25877 |
| 24 | Ga0065165_1017140 | 3300005262 | Bacteria | 2682 |
| 25 | Ga0065715_10001517 | 3300005293 | Bacteria | 8896 |
| 26 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 27 | Ga0070658_10008389 | 3300005327 | Bacteria | 8305 |
| 28 | Ga0070658_10025349 | 3300005327 | Bacteria | 4755 |
| 29 | Ga0070658_10042543 | 3300005327 | Bacteria | 3669 |
| 30 | Ga0070658_10046588 | 3300005327 | Bacteria | 3508 |
| 31 | Ga0070658_10228926 | 3300005327 | Bacteria | 1573 |
| 32 | Ga0070676_10010686 | 3300005328 | Bacteria | 4981 |
| 33 | Ga0070676_10083446 | 3300005328 | Bacteria | 1943 |
| 34 | Ga0070683_100002224 | 3300005329 | Bacteria | 15369 |
| 35 | Ga0070683_100089230 | 3300005329 | Bacteria | 2893 |
| 36 | Ga0070683_100104437 | 3300005329 | Bacteria | 2670 |
| 37 | Ga0070670_100001116 | 3300005331 | Bacteria | 21345 |
| 38 | Ga0070670_100004640 | 3300005331 | Bacteria | 11521 |
| 39 | Ga0070670_100018115 | 3300005331 | Bacteria | 6045 |
| 40 | Ga0070670_100020135 | 3300005331 | Bacteria | 5731 |
| 41 | Ga0070670_100030537 | 3300005331 | Bacteria | 4640 |
| 42 | Ga0070670_100064393 | 3300005331 | Bacteria | 3145 |
| 43 | Ga0070677_10001174 | 3300005333 | Bacteria | 8393 |
| 44 | Ga0070677_10012208 | 3300005333 | Bacteria | 2979 |
| 45 | Ga0068869_100000033 | 3300005334 | Bacteria | 57379 |
| 46 | Ga0070666_10003130 | 3300005335 | Bacteria | 10051 |
| 47 | Ga0070666_10007590 | 3300005335 | Bacteria | 6691 |
| 48 | Ga0070666_10027748 | 3300005335 | Bacteria | 3710 |
| 49 | Ga0070666_10040687 | 3300005335 | Bacteria | 3103 |
| 50 | Ga0070666_10183949 | 3300005335 | Bacteria | 1466 |
| 51 | Ga0070680_100002432 | 3300005336 | Bacteria | 13797 |
| 52 | Ga0070680_100005513 | 3300005336 | Bacteria | 9579 |
| 53 | Ga0070680_100023975 | 3300005336 | Bacteria | 4871 |
| 54 | Ga0070680_100031065 | 3300005336 | Bacteria | 4293 |
| 55 | Ga0068868_100000099 | 3300005338 | Bacteria | 53289 |
| 56 | Ga0068868_100036723 | 3300005338 | Bacteria | 3795 |
| 57 | Ga0070660_100002675 | 3300005339 | Bacteria | 12243 |
| 58 | Ga0070660_100002925 | 3300005339 | Bacteria | 11753 |
| 59 | Ga0070660_100021913 | 3300005339 | Bacteria | 4719 |
| 60 | Ga0070660_100036166 | 3300005339 | Bacteria | 3739 |
| 61 | Ga0070660_100046066 | 3300005339 | Bacteria | 3341 |
| 62 | Ga0070660_100052955 | 3300005339 | Bacteria | 3130 |
| 63 | Ga0070660_100091585 | 3300005339 | Bacteria | 2398 |
| 64 | Ga0070689_100003667 | 3300005340 | Bacteria | 10248 |
| 65 | Ga0070687_100070145 | 3300005343 | Bacteria | 1879 |
| 66 | Ga0070687_100075266 | 3300005343 | Bacteria | 1825 |
| 67 | Ga0070661_100000014 | 3300005344 | Bacteria | 158652 |
| 68 | Ga0070661_100003253 | 3300005344 | Bacteria | 11203 |
| 69 | Ga0070661_100015402 | 3300005344 | Bacteria | 5397 |
| 70 | Ga0070661_100034524 | 3300005344 | Bacteria | 3668 |
| 71 | Ga0070661_100088307 | 3300005344 | Bacteria | 2294 |
| 72 | Ga0070661_100132896 | 3300005344 | Bacteria | 1870 |
| 73 | Ga0070661_100147270 | 3300005344 | Bacteria | 1778 |
| 74 | Ga0070692_10001731 | 3300005345 | Bacteria | 8124 |
| 75 | Ga0070692_10010375 | 3300005345 | Bacteria | 4235 |
| 76 | Ga0070668_100000037 | 3300005347 | Bacteria | 80771 |
| 77 | Ga0070668_100013195 | 3300005347 | Bacteria | 6162 |
| 78 | Ga0070668_100018180 | 3300005347 | Bacteria | 5274 |
| 79 | Ga0070668_100029234 | 3300005347 | Bacteria | 4184 |
| 80 | Ga0070669_100000414 | 3300005353 | Bacteria | 32705 |
| 81 | Ga0070669_100009121 | 3300005353 | Bacteria | 7070 |
| 82 | Ga0070669_100072860 | 3300005353 | Bacteria | 2544 |
| 83 | Ga0070669_100164225 | 3300005353 | Bacteria | 1728 |
| 84 | Ga0070675_100002420 | 3300005354 | Bacteria | 13918 |
| 85 | Ga0070675_100005923 | 3300005354 | Bacteria | 9363 |
| 86 | Ga0070675_100024999 | 3300005354 | Bacteria | 4787 |
| 87 | Ga0070675_100082521 | 3300005354 | Bacteria | 2682 |
| 88 | Ga0070671_100002642 | 3300005355 | Bacteria | 13871 |
| 89 | Ga0070671_100005857 | 3300005355 | Bacteria | 9792 |
| 90 | Ga0070671_100006684 | 3300005355 | Bacteria | 9221 |
| 91 | Ga0070671_100011540 | 3300005355 | Bacteria | 7105 |
| 92 | Ga0070671_100022964 | 3300005355 | Bacteria | 5097 |
| 93 | Ga0070671_100028055 | 3300005355 | Bacteria | 4635 |
| 94 | Ga0070671_100031460 | 3300005355 | Bacteria | 4383 |
| 95 | Ga0070671_100039726 | 3300005355 | Bacteria | 3906 |
| 96 | Ga0070671_100087402 | 3300005355 | Bacteria | 2609 |
| 97 | Ga0070671_100107702 | 3300005355 | Bacteria | 2340 |
| 98 | Ga0070671_100182807 | 3300005355 | Bacteria | 1775 |
| 99 | Ga0070674_100003684 | 3300005356 | Bacteria | 8637 |
| 100 | Ga0070674_100048967 | 3300005356 | Bacteria | 2903 |
| 101 | Ga0070674_100086316 | 3300005356 | Bacteria | 2254 |
| 102 | Ga0070673_100000136 | 3300005364 | Bacteria | 35063 |
| 103 | Ga0070673_100003426 | 3300005364 | Bacteria | 9882 |
| 104 | Ga0070673_100003616 | 3300005364 | Bacteria | 9673 |
| 105 | Ga0070673_100013563 | 3300005364 | Bacteria | 5646 |
| 106 | Ga0070673_100015478 | 3300005364 | Bacteria | 5358 |
| 107 | Ga0070673_100081757 | 3300005364 | Bacteria | 2620 |
| 108 | Ga0070673_100125943 | 3300005364 | Bacteria | 2143 |
| 109 | Ga0070659_100000058 | 3300005366 | Bacteria | 88306 |
| 110 | Ga0070659_100001334 | 3300005366 | Bacteria | 17794 |
| 111 | Ga0070659_100005814 | 3300005366 | Bacteria | 8883 |
| 112 | Ga0070659_100006079 | 3300005366 | Bacteria | 8707 |
| 113 | Ga0070659_100012039 | 3300005366 | Bacteria | 6404 |
| 114 | Ga0070659_100029683 | 3300005366 | Bacteria | 4227 |
| 115 | Ga0070659_100031921 | 3300005366 | Bacteria | 4082 |
| 116 | Ga0070659_100204312 | 3300005366 | Bacteria | 1627 |
| 117 | Ga0070667_100000512 | 3300005367 | Bacteria | 39082 |
| 118 | Ga0070667_100003828 | 3300005367 | Bacteria | 12785 |
| 119 | Ga0070667_100003948 | 3300005367 | Bacteria | 12589 |
| 120 | Ga0070667_100006209 | 3300005367 | Bacteria | 9938 |
| 121 | Ga0070667_100013181 | 3300005367 | Bacteria | 6833 |
| 122 | Ga0070667_100026665 | 3300005367 | Bacteria | 4807 |
| 123 | Ga0070667_100035221 | 3300005367 | Bacteria | 4193 |
| 124 | Ga0070667_100035278 | 3300005367 | Bacteria | 4189 |
| 125 | Ga0070667_100063727 | 3300005367 | Bacteria | 3125 |
| 126 | Ga0070667_100104381 | 3300005367 | Bacteria | 2451 |
| 127 | Ga0070714_100095655 | 3300005435 | Bacteria | 2608 |
| 128 | Ga0070714_100130542 | 3300005435 | Bacteria | 2245 |
| 129 | Ga0070713_100005100 | 3300005436 | Bacteria | 8935 |
| 130 | Ga0070663_100049456 | 3300005455 | Bacteria | 2986 |
| 131 | Ga0070678_100007589 | 3300005456 | Bacteria | 6442 |
| 132 | Ga0070678_100015993 | 3300005456 | Bacteria | 4783 |
| 133 | Ga0070678_100141912 | 3300005456 | Bacteria | 1923 |
| 134 | Ga0070678_100168690 | 3300005456 | Bacteria | 1780 |
| 135 | Ga0070662_100000571 | 3300005457 | Bacteria | 22489 |
| 136 | Ga0070662_100004200 | 3300005457 | Bacteria | 9075 |
| 137 | Ga0070662_100006400 | 3300005457 | Bacteria | 7587 |
| 138 | Ga0070662_100055374 | 3300005457 | Bacteria | 2877 |
| 139 | Ga0070662_100056426 | 3300005457 | Bacteria | 2851 |
| 140 | Ga0070662_100065479 | 3300005457 | Bacteria | 2664 |
| 141 | Ga0070662_100069807 | 3300005457 | Bacteria | 2588 |
| 142 | Ga0070662_100240155 | 3300005457 | Bacteria | 1453 |
| 143 | Ga0070681_10026384 | 3300005458 | Bacteria | 5839 |
| 144 | Ga0070681_10074320 | 3300005458 | Bacteria | 3360 |
| 145 | Ga0068867_100000243 | 3300005459 | Bacteria | 35880 |
| 146 | Ga0068867_100021024 | 3300005459 | Bacteria | 4655 |
| 147 | Ga0068867_100039626 | 3300005459 | Bacteria | 3435 |
| 148 | Ga0068867_100049328 | 3300005459 | Bacteria | 3099 |
| 149 | Ga0068867_100051766 | 3300005459 | Bacteria | 3029 |
| 150 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 151 | Ga0070679_100097863 | 3300005530 | Bacteria | 2921 |
| 152 | Ga0070684_100003490 | 3300005535 | Bacteria | 11808 |
| 153 | Ga0070684_100150438 | 3300005535 | Bacteria | 2108 |
| 154 | Ga0070684_100241989 | 3300005535 | Bacteria | 1649 |
| 155 | Ga0068853_100001263 | 3300005539 | Bacteria | 18104 |
| 156 | Ga0068853_100010905 | 3300005539 | Bacteria | 7364 |
| 157 | Ga0068853_100048599 | 3300005539 | Bacteria | 3645 |
| 158 | Ga0068853_100086204 | 3300005539 | Bacteria | 2753 |
| 159 | Ga0068853_100126778 | 3300005539 | Bacteria | 2281 |
| 160 | Ga0068853_100216904 | 3300005539 | Bacteria | 1746 |
| 161 | Ga0070672_100001197 | 3300005543 | Bacteria | 15866 |
| 162 | Ga0070672_100001681 | 3300005543 | Bacteria | 13793 |
| 163 | Ga0070672_100006628 | 3300005543 | Bacteria | 7801 |
| 164 | Ga0070672_100006817 | 3300005543 | Bacteria | 7714 |
| 165 | Ga0070672_100119051 | 3300005543 | Bacteria | 2160 |
| 166 | Ga0070672_100185635 | 3300005543 | Bacteria | 1734 |
| 167 | Ga0070672_100245731 | 3300005543 | Bacteria | 1506 |
| 168 | Ga0070672_100283600 | 3300005543 | Bacteria | 1401 |
| 169 | Ga0070686_100106866 | 3300005544 | Bacteria | 1900 |
| 170 | Ga0070695_100102079 | 3300005545 | Bacteria | 1933 |
| 171 | Ga0070696_100037866 | 3300005546 | Bacteria | 3327 |
| 172 | Ga0070696_100048160 | 3300005546 | Bacteria | 2958 |
| 173 | Ga0070693_100085512 | 3300005547 | Bacteria | 1890 |
| 174 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 175 | Ga0070665_100023846 | 3300005548 | Bacteria | 6165 |
| 176 | Ga0070665_100026044 | 3300005548 | Bacteria | 5890 |
| 177 | Ga0070665_100032634 | 3300005548 | Bacteria | 5240 |
| 178 | Ga0070665_100064330 | 3300005548 | Bacteria | 3678 |
| 179 | Ga0070704_100033792 | 3300005549 | Bacteria | 3462 |
| 180 | Ga0068855_100002389 | 3300005563 | Bacteria | 23147 |
| 181 | Ga0068855_100017157 | 3300005563 | Bacteria | 8709 |
| 182 | Ga0068855_100020473 | 3300005563 | Bacteria | 7931 |
| 183 | Ga0068855_100078867 | 3300005563 | Bacteria | 3820 |
| 184 | Ga0068855_100080553 | 3300005563 | Bacteria | 3775 |
| 185 | Ga0068855_100353734 | 3300005563 | Bacteria | 1618 |
| 186 | Ga0070664_100002014 | 3300005564 | Bacteria | 16292 |
| 187 | Ga0070664_100005566 | 3300005564 | Bacteria | 10120 |
| 188 | Ga0070664_100013138 | 3300005564 | Bacteria | 6740 |
| 189 | Ga0070664_100044210 | 3300005564 | Bacteria | 3761 |
| 190 | Ga0070664_100052286 | 3300005564 | Bacteria | 3460 |
| 191 | Ga0070664_100054466 | 3300005564 | Bacteria | 3394 |
| 192 | Ga0070664_100115048 | 3300005564 | Bacteria | 2350 |
| 193 | Ga0068857_100000527 | 3300005577 | Bacteria | 27617 |
| 194 | Ga0068857_100003804 | 3300005577 | Bacteria | 12707 |
| 195 | Ga0068857_100098067 | 3300005577 | Bacteria | 2628 |
| 196 | Ga0068857_100264807 | 3300005577 | Bacteria | 1578 |
| 197 | Ga0068854_100000214 | 3300005578 | Bacteria | 38938 |
| 198 | Ga0068854_100006294 | 3300005578 | Bacteria | 7549 |
| 199 | Ga0068854_100009459 | 3300005578 | Bacteria | 6292 |
| 200 | Ga0068854_100015373 | 3300005578 | Bacteria | 5068 |
| 201 | Ga0068854_100057685 | 3300005578 | Bacteria | 2801 |
| 202 | Ga0068854_100169984 | 3300005578 | Bacteria | 1695 |
| 203 | Ga0068856_100034980 | 3300005614 | Bacteria | 4922 |
| 204 | Ga0068856_100083414 | 3300005614 | Bacteria | 3173 |
| 205 | Ga0068856_100090091 | 3300005614 | Bacteria | 3051 |
| 206 | Ga0068856_100127679 | 3300005614 | Bacteria | 2546 |
| 207 | Ga0068856_100277098 | 3300005614 | Bacteria | 1694 |
| 208 | Ga0068856_100293460 | 3300005614 | Bacteria | 1643 |
| 209 | Ga0070702_100083792 | 3300005615 | Bacteria | 1916 |
| 210 | Ga0068852_100000235 | 3300005616 | Bacteria | 37404 |
| 211 | Ga0068852_100001069 | 3300005616 | Bacteria | 18099 |
| 212 | Ga0068852_100041457 | 3300005616 | Bacteria | 3891 |
| 213 | Ga0068852_100046399 | 3300005616 | Bacteria | 3702 |
| 214 | Ga0068852_100093268 | 3300005616 | Bacteria | 2698 |
| 215 | Ga0068852_100416214 | 3300005616 | Bacteria | 1325 |
| 216 | Ga0068859_100000487 | 3300005617 | Bacteria | 39249 |
| 217 | Ga0068859_100004952 | 3300005617 | Bacteria | 13526 |
| 218 | Ga0068859_100008392 | 3300005617 | Bacteria | 10469 |
| 219 | Ga0068859_100017035 | 3300005617 | Bacteria | 7296 |
| 220 | Ga0068859_100043349 | 3300005617 | Bacteria | 4521 |
| 221 | Ga0068859_100064626 | 3300005617 | Bacteria | 3692 |
| 222 | Ga0068859_100083794 | 3300005617 | Bacteria | 3232 |
| 223 | Ga0068859_100252352 | 3300005617 | Bacteria | 1854 |
| 224 | Ga0068864_100000156 | 3300005618 | Bacteria | 63083 |
| 225 | Ga0068864_100000920 | 3300005618 | Bacteria | 24708 |
| 226 | Ga0068864_100037639 | 3300005618 | Bacteria | 4130 |
| 227 | Ga0068864_100067060 | 3300005618 | Bacteria | 3115 |
| 228 | Ga0068861_100008562 | 3300005719 | Bacteria | 7039 |
| 229 | Ga0068861_100056447 | 3300005719 | Bacteria | 2998 |
| 230 | Ga0068851_10023967 | 3300005834 | Bacteria | 2985 |
| 231 | Ga0068851_10031150 | 3300005834 | Bacteria | 2647 |
| 232 | Ga0068851_10053309 | 3300005834 | Bacteria | 2059 |
| 233 | Ga0068870_10110614 | 3300005840 | Bacteria | 1568 |
| 234 | Ga0068863_100000145 | 3300005841 | Bacteria | 74845 |
| 235 | Ga0068863_100000728 | 3300005841 | Bacteria | 32991 |
| 236 | Ga0068863_100005224 | 3300005841 | Bacteria | 12814 |
| 237 | Ga0068863_100028419 | 3300005841 | Bacteria | 5340 |
| 238 | Ga0068863_100062887 | 3300005841 | Bacteria | 3510 |
| 239 | Ga0068863_100064005 | 3300005841 | Bacteria | 3478 |
| 240 | Ga0068863_100064602 | 3300005841 | Bacteria | 3461 |
| 241 | Ga0068863_100197821 | 3300005841 | Bacteria | 1932 |
| 242 | Ga0068863_100209643 | 3300005841 | Bacteria | 1876 |
| 243 | Ga0068858_100000731 | 3300005842 | Bacteria | 34405 |
| 244 | Ga0068858_100002211 | 3300005842 | Bacteria | 19692 |
| 245 | Ga0068858_100003268 | 3300005842 | Bacteria | 16149 |
| 246 | Ga0068858_100015728 | 3300005842 | Bacteria | 7116 |
| 247 | Ga0068860_100000516 | 3300005843 | Bacteria | 47373 |
| 248 | Ga0068860_100000609 | 3300005843 | Bacteria | 42459 |
| 249 | Ga0068860_100031544 | 3300005843 | Bacteria | 5094 |
| 250 | Ga0068860_100058733 | 3300005843 | Bacteria | 3657 |
| 251 | Ga0068860_100081288 | 3300005843 | Bacteria | 3081 |
| 252 | Ga0068860_100086625 | 3300005843 | Bacteria | 2981 |
| 253 | Ga0068862_100000099 | 3300005844 | Bacteria | 103870 |
| 254 | Ga0068862_100011052 | 3300005844 | Bacteria | 7457 |
| 255 | Ga0068862_100011601 | 3300005844 | Bacteria | 7271 |
| 256 | Ga0068862_100028077 | 3300005844 | Bacteria | 4739 |
| 257 | Ga0068862_100078290 | 3300005844 | Bacteria | 2864 |
| 258 | Ga0068862_100306373 | 3300005844 | Bacteria | 1463 |
| 259 | Ga0081539_10007522 | 3300005985 | Bacteria | 9881 |
| 260 | Ga0081539_10017301 | 3300005985 | Bacteria | 5070 |
| 261 | Ga0070712_100013626 | 3300006175 | Bacteria | 5199 |
| 262 | Ga0068871_100014165 | 3300006358 | Bacteria | 5935 |
| 263 | Ga0075428_100355861 | 3300006844 | Bacteria | 1571 |
| 264 | Ga0075430_100022234 | 3300006846 | Bacteria | 5393 |
| 265 | Ga0075431_100011843 | 3300006847 | Bacteria | 8800 |
| 266 | Ga0068865_100000518 | 3300006881 | Bacteria | 21573 |
| 267 | Ga0097620_100000487 | 3300006931 | Bacteria | 39249 |
| 268 | Ga0097620_100004952 | 3300006931 | Bacteria | 13526 |
| 269 | Ga0097620_100008392 | 3300006931 | Bacteria | 10469 |
| 270 | Ga0097620_100017035 | 3300006931 | Bacteria | 7296 |
| 271 | Ga0097620_100043349 | 3300006931 | Bacteria | 4521 |
| 272 | Ga0097620_100064622 | 3300006931 | Bacteria | 3692 |
| 273 | Ga0097620_100083793 | 3300006931 | Bacteria | 3232 |
| 274 | Ga0097620_100252350 | 3300006931 | Bacteria | 1854 |
| 275 | Ga0105250_10002933 | 3300009092 | Bacteria | 8324 |
| 276 | Ga0105240_10010666 | 3300009093 | Bacteria | 12894 |
| 277 | Ga0105240_10030247 | 3300009093 | Bacteria | 7039 |
| 278 | Ga0105240_10105591 | 3300009093 | Bacteria | 3419 |
| 279 | Ga0111539_10008340 | 3300009094 | Bacteria | 13184 |
| 280 | Ga0111539_10176165 | 3300009094 | Bacteria | 2498 |
| 281 | Ga0105245_10000068 | 3300009098 | Bacteria | 106973 |
| 282 | Ga0105245_10039003 | 3300009098 | Bacteria | 4227 |
| 283 | Ga0105245_10132030 | 3300009098 | Bacteria | 2343 |
| 284 | Ga0105247_10003834 | 3300009101 | Bacteria | 9729 |
| 285 | Ga0105243_10012496 | 3300009148 | Bacteria | 6420 |
| 286 | Ga0105248_10002329 | 3300009177 | Bacteria | 21075 |
| 287 | Ga0105248_10003826 | 3300009177 | Bacteria | 16684 |
| 288 | Ga0105248_10004234 | 3300009177 | Bacteria | 15871 |
| 289 | Ga0105248_10048946 | 3300009177 | Bacteria | 4741 |
| 290 | Ga0105248_10061948 | 3300009177 | Bacteria | 4201 |
| 291 | Ga0105248_10108402 | 3300009177 | Bacteria | 3131 |
| 292 | Ga0105248_10129959 | 3300009177 | Bacteria | 2841 |
| 293 | Ga0105248_10412866 | 3300009177 | Bacteria | 1520 |
| 294 | Ga0105238_10125411 | 3300009551 | Bacteria | 2547 |
| 295 | Ga0105238_10127732 | 3300009551 | Bacteria | 2521 |
| 296 | Ga0105238_10325688 | 3300009551 | Bacteria | 1523 |
| 297 | Ga0105249_10000086 | 3300009553 | Bacteria | 132132 |
| 298 | Ga0105249_10010109 | 3300009553 | Bacteria | 8284 |
| 299 | Ga0105249_10011408 | 3300009553 | Bacteria | 7803 |
| 300 | Ga0105249_10030644 | 3300009553 | Bacteria | 4864 |
| 301 | Ga0105249_10348498 | 3300009553 | Bacteria | 1499 |
| 302 | Ga0105239_10076264 | 3300010375 | Bacteria | 3687 |
| 303 | Ga0105246_10018628 | 3300011119 | Bacteria | 4427 |
| 304 | Ga0105246_10126932 | 3300011119 | Bacteria | 1899 |
| 305 | Ga0157373_10019319 | 3300013100 | Bacteria | 4963 |
| 306 | Ga0157373_10071726 | 3300013100 | Bacteria | 2446 |
| 307 | Ga0157371_10003433 | 3300013102 | Bacteria | 14380 |
| 308 | Ga0157371_10010189 | 3300013102 | Bacteria | 7342 |
| 309 | Ga0157371_10015031 | 3300013102 | Bacteria | 5818 |
| 310 | Ga0157371_10026783 | 3300013102 | Bacteria | 4187 |
| 311 | Ga0157370_10027662 | 3300013104 | Bacteria | 5590 |
| 312 | Ga0157370_10109373 | 3300013104 | Bacteria | 2584 |
| 313 | Ga0157370_10192485 | 3300013104 | Bacteria | 1893 |
| 314 | Ga0157370_10222457 | 3300013104 | Bacteria | 1748 |
| 315 | Ga0157369_10007383 | 3300013105 | Bacteria | 12652 |
| 316 | Ga0157369_10007856 | 3300013105 | Bacteria | 12269 |
| 317 | Ga0157369_10013190 | 3300013105 | Bacteria | 9353 |
| 318 | Ga0157369_10053230 | 3300013105 | Bacteria | 4376 |
| 319 | Ga0157369_10077017 | 3300013105 | Bacteria | 3574 |
| 320 | Ga0157369_10171362 | 3300013105 | Bacteria | 2287 |
| 321 | Ga0157374_10002929 | 3300013296 | Bacteria | 14299 |
| 322 | Ga0157378_10002566 | 3300013297 | Bacteria | 16157 |
| 323 | Ga0157378_10027821 | 3300013297 | Bacteria | 4986 |
| 324 | Ga0163162_10001881 | 3300013306 | Bacteria | 19778 |
| 325 | Ga0163162_10006429 | 3300013306 | Bacteria | 11380 |
| 326 | Ga0163162_10026182 | 3300013306 | Bacteria | 5764 |
| 327 | Ga0157372_10008752 | 3300013307 | Bacteria | 10748 |
| 328 | Ga0157372_10028944 | 3300013307 | Bacteria | 6045 |
| 329 | Ga0157372_10106485 | 3300013307 | Bacteria | 3207 |
| 330 | Ga0157372_10195152 | 3300013307 | Bacteria | 2345 |
| 331 | Ga0157372_10241343 | 3300013307 | Bacteria | 2097 |
| 332 | Ga0157372_10255256 | 3300013307 | Bacteria | 2035 |
| 333 | Ga0157372_10283641 | 3300013307 | Bacteria | 1926 |
| 334 | Ga0157372_10406401 | 3300013307 | Bacteria | 1586 |
| 335 | Ga0157375_10001389 | 3300013308 | Bacteria | 20906 |
| 336 | Ga0157375_10039078 | 3300013308 | Bacteria | 4563 |
| 337 | Ga0157375_10107506 | 3300013308 | Bacteria | 2883 |
| 338 | Ga0157375_10327537 | 3300013308 | Bacteria | 1697 |
| 339 | Ga0157375_10368055 | 3300013308 | Bacteria | 1603 |
| 340 | Ga0157375_10404840 | 3300013308 | Bacteria | 1531 |
| 341 | Ga0163163_10000282 | 3300014325 | Bacteria | 50623 |
| 342 | Ga0163163_10084744 | 3300014325 | Bacteria | 3176 |
| 343 | Ga0157380_10029046 | 3300014326 | Bacteria | 4224 |
| 344 | Ga0157380_10583858 | 3300014326 | Bacteria | 1102 |
| 345 | Ga0157377_10002887 | 3300014745 | Bacteria | 7681 |
| 346 | Ga0157379_10017232 | 3300014968 | Bacteria | 6363 |
| 347 | Ga0157379_10092136 | 3300014968 | Bacteria | 2719 |
| 348 | Ga0163161_10006309 | 3300017792 | Bacteria | 8207 |
| 349 | Ga0206353_10738842 | 3300020082 | Bacteria | 7517 |
| 350 | Ga0206353_11795267 | 3300020082 | Bacteria | 3121 |
| 351 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 352 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 353 | Ga0213876_10000178 | 3300021384 | Bacteria | 65721 |
| 354 | Ga0213875_10000657 | 3300021388 | Bacteria | 27401 |
| 355 | Ga0213875_10002530 | 3300021388 | Bacteria | 10907 |
| 356 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 357 | Ga0207425_1004074 | 3300025245 | Bacteria | 4475 |
| 358 | Ga0209129_1001570 | 3300025258 | Bacteria | 12546 |
| 359 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 360 | Ga0209565_1000215 | 3300025263 | Bacteria | 66331 |
| 361 | Ga0207666_1002613 | 3300025271 | Bacteria | 2176 |
| 362 | Ga0209673_1005404 | 3300025273 | Bacteria | 6437 |
| 363 | Ga0209675_1019289 | 3300025291 | Bacteria | 1882 |
| 364 | Ga0209025_1000763 | 3300025294 | Bacteria | 53526 |
| 365 | Ga0209564_1001029 | 3300025295 | Bacteria | 34324 |
| 366 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 367 | Ga0209758_1004364 | 3300025297 | Bacteria | 11831 |
| 368 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 369 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 370 | Ga0209050_1001664 | 3300025298 | Bacteria | 22448 |
| 371 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 372 | Ga0209051_1000518 | 3300025303 | Bacteria | 48528 |
| 373 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 374 | Ga0209257_1000855 | 3300025304 | Bacteria | 43394 |
| 375 | Ga0207697_10000100 | 3300025315 | Bacteria | 39272 |
| 376 | Ga0207697_10001125 | 3300025315 | Bacteria | 14731 |
| 377 | Ga0207656_10010223 | 3300025321 | Bacteria | 3508 |
| 378 | Ga0207656_10017929 | 3300025321 | Bacteria | 2780 |
| 379 | Ga0207682_10000234 | 3300025893 | Bacteria | 24978 |
| 380 | Ga0207682_10000674 | 3300025893 | Bacteria | 15925 |
| 381 | Ga0207682_10001342 | 3300025893 | Bacteria | 11341 |
| 382 | Ga0207682_10010773 | 3300025893 | Bacteria | 3580 |
| 383 | Ga0207710_10002163 | 3300025900 | Bacteria | 9233 |
| 384 | Ga0207688_10004766 | 3300025901 | Bacteria | 7387 |
| 385 | Ga0207688_10016187 | 3300025901 | Bacteria | 4043 |
| 386 | Ga0207680_10002290 | 3300025903 | Bacteria | 8919 |
| 387 | Ga0207680_10021427 | 3300025903 | Bacteria | 3496 |
| 388 | Ga0207680_10128223 | 3300025903 | Bacteria | 1669 |
| 389 | Ga0207680_10160460 | 3300025903 | Bacteria | 1507 |
| 390 | Ga0207647_10000369 | 3300025904 | Bacteria | 36710 |
| 391 | Ga0207647_10000786 | 3300025904 | Bacteria | 24627 |
| 392 | Ga0207647_10001596 | 3300025904 | Bacteria | 17404 |
| 393 | Ga0207647_10002688 | 3300025904 | Bacteria | 13418 |
| 394 | Ga0207647_10045096 | 3300025904 | Bacteria | 2752 |
| 395 | Ga0207647_10139530 | 3300025904 | Bacteria | 1421 |
| 396 | Ga0207645_10015453 | 3300025907 | Bacteria | 5069 |
| 397 | Ga0207645_10026109 | 3300025907 | Bacteria | 3776 |
| 398 | Ga0207645_10055236 | 3300025907 | Bacteria | 2535 |
| 399 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 400 | Ga0207705_10001718 | 3300025909 | Bacteria | 17370 |
| 401 | Ga0207705_10015172 | 3300025909 | Bacteria | 5537 |
| 402 | Ga0207705_10020884 | 3300025909 | Bacteria | 4673 |
| 403 | Ga0207705_10049718 | 3300025909 | Bacteria | 3018 |
| 404 | Ga0207705_10052867 | 3300025909 | Bacteria | 2925 |
| 405 | Ga0207705_10124247 | 3300025909 | Bacteria | 1917 |
| 406 | Ga0207705_10158301 | 3300025909 | Bacteria | 1700 |
| 407 | Ga0207707_10026928 | 3300025912 | Bacteria | 5025 |
| 408 | Ga0207707_10049860 | 3300025912 | Bacteria | 3648 |
| 409 | Ga0207707_10081646 | 3300025912 | Bacteria | 2822 |
| 410 | Ga0207707_10199577 | 3300025912 | Bacteria | 1744 |
| 411 | Ga0207671_10012102 | 3300025914 | Bacteria | 6966 |
| 412 | Ga0207693_10058018 | 3300025915 | Bacteria | 3033 |
| 413 | Ga0207660_10000059 | 3300025917 | Bacteria | 56766 |
| 414 | Ga0207660_10001202 | 3300025917 | Bacteria | 17345 |
| 415 | Ga0207660_10009838 | 3300025917 | Bacteria | 6191 |
| 416 | Ga0207660_10162016 | 3300025917 | Bacteria | 1726 |
| 417 | Ga0207662_10047846 | 3300025918 | Bacteria | 2533 |
| 418 | Ga0207657_10000975 | 3300025919 | Bacteria | 30375 |
| 419 | Ga0207657_10003294 | 3300025919 | Bacteria | 17261 |
| 420 | Ga0207657_10003473 | 3300025919 | Bacteria | 16814 |
| 421 | Ga0207657_10004246 | 3300025919 | Bacteria | 15178 |
| 422 | Ga0207657_10022239 | 3300025919 | Bacteria | 5942 |
| 423 | Ga0207657_10030373 | 3300025919 | Bacteria | 4905 |
| 424 | Ga0207657_10038499 | 3300025919 | Bacteria | 4256 |
| 425 | Ga0207657_10057875 | 3300025919 | Bacteria | 3338 |
| 426 | Ga0207657_10075582 | 3300025919 | Bacteria | 2842 |
| 427 | Ga0207657_10098143 | 3300025919 | Bacteria | 2435 |
| 428 | Ga0207657_10121598 | 3300025919 | Bacteria | 2148 |
| 429 | Ga0207657_10137451 | 3300025919 | Bacteria | 1998 |
| 430 | Ga0207649_10000393 | 3300025920 | Bacteria | 32808 |
| 431 | Ga0207649_10004548 | 3300025920 | Bacteria | 7531 |
| 432 | Ga0207649_10033740 | 3300025920 | Bacteria | 3061 |
| 433 | Ga0207649_10042197 | 3300025920 | Bacteria | 2782 |
| 434 | Ga0207649_10043021 | 3300025920 | Bacteria | 2759 |
| 435 | Ga0207649_10060836 | 3300025920 | Bacteria | 2375 |
| 436 | Ga0207649_10065639 | 3300025920 | Bacteria | 2298 |
| 437 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 438 | Ga0207652_10210806 | 3300025921 | Bacteria | 1749 |
| 439 | Ga0207681_10000720 | 3300025923 | Bacteria | 21714 |
| 440 | Ga0207681_10058505 | 3300025923 | Bacteria | 2639 |
| 441 | Ga0207681_10060067 | 3300025923 | Bacteria | 2608 |
| 442 | Ga0207694_10000966 | 3300025924 | Bacteria | 25308 |
| 443 | Ga0207694_10038749 | 3300025924 | Bacteria | 3665 |
| 444 | Ga0207694_10078174 | 3300025924 | Bacteria | 2593 |
| 445 | Ga0207694_10106869 | 3300025924 | Bacteria | 2223 |
| 446 | Ga0207694_10136881 | 3300025924 | Bacteria | 1968 |
| 447 | Ga0207650_10006112 | 3300025925 | Bacteria | 8202 |
| 448 | Ga0207650_10013604 | 3300025925 | Bacteria | 5638 |
| 449 | Ga0207650_10017500 | 3300025925 | Bacteria | 5020 |
| 450 | Ga0207650_10030515 | 3300025925 | Bacteria | 3884 |
| 451 | Ga0207650_10065528 | 3300025925 | Bacteria | 2723 |
| 452 | Ga0207659_10008560 | 3300025926 | Bacteria | 6360 |
| 453 | Ga0207659_10055966 | 3300025926 | Bacteria | 2823 |
| 454 | Ga0207659_10114038 | 3300025926 | Bacteria | 2059 |
| 455 | Ga0207687_10000257 | 3300025927 | Bacteria | 36112 |
| 456 | Ga0207687_10124263 | 3300025927 | Bacteria | 1934 |
| 457 | Ga0207700_10017679 | 3300025928 | Bacteria | 4768 |
| 458 | Ga0207664_10026596 | 3300025929 | Bacteria | 4376 |
| 459 | Ga0207664_10079381 | 3300025929 | Bacteria | 2664 |
| 460 | Ga0207664_10190100 | 3300025929 | Bacteria | 1767 |
| 461 | Ga0207644_10000039 | 3300025931 | Bacteria | 121348 |
| 462 | Ga0207644_10000461 | 3300025931 | Bacteria | 26322 |
| 463 | Ga0207644_10006853 | 3300025931 | Bacteria | 7422 |
| 464 | Ga0207644_10016213 | 3300025931 | Bacteria | 5013 |
| 465 | Ga0207644_10018081 | 3300025931 | Bacteria | 4766 |
| 466 | Ga0207644_10030881 | 3300025931 | Bacteria | 3729 |
| 467 | Ga0207644_10037495 | 3300025931 | Bacteria | 3410 |
| 468 | Ga0207644_10076175 | 3300025931 | Bacteria | 2467 |
| 469 | Ga0207644_10101050 | 3300025931 | Bacteria | 2166 |
| 470 | Ga0207644_10124998 | 3300025931 | Bacteria | 1962 |
| 471 | Ga0207644_10159069 | 3300025931 | Bacteria | 1754 |
| 472 | Ga0207644_10270873 | 3300025931 | Bacteria | 1360 |
| 473 | Ga0207690_10000070 | 3300025932 | Bacteria | 88786 |
| 474 | Ga0207690_10000589 | 3300025932 | Bacteria | 23493 |
| 475 | Ga0207690_10001712 | 3300025932 | Bacteria | 13484 |
| 476 | Ga0207690_10004126 | 3300025932 | Bacteria | 8580 |
| 477 | Ga0207690_10008045 | 3300025932 | Bacteria | 6260 |
| 478 | Ga0207690_10010422 | 3300025932 | Bacteria | 5523 |
| 479 | Ga0207690_10018743 | 3300025932 | Bacteria | 4248 |
| 480 | Ga0207690_10146802 | 3300025932 | Bacteria | 1744 |
| 481 | Ga0207706_10000812 | 3300025933 | Bacteria | 32408 |
| 482 | Ga0207706_10000822 | 3300025933 | Bacteria | 32219 |
| 483 | Ga0207706_10000932 | 3300025933 | Bacteria | 29932 |
| 484 | Ga0207706_10004770 | 3300025933 | Bacteria | 12696 |
| 485 | Ga0207706_10009899 | 3300025933 | Bacteria | 8741 |
| 486 | Ga0207706_10012790 | 3300025933 | Bacteria | 7637 |
| 487 | Ga0207706_10017293 | 3300025933 | Bacteria | 6497 |
| 488 | Ga0207706_10081556 | 3300025933 | Bacteria | 2842 |
| 489 | Ga0207706_10126893 | 3300025933 | Bacteria | 2244 |
| 490 | Ga0207706_10348468 | 3300025933 | Bacteria | 1288 |
| 491 | Ga0207709_10079737 | 3300025935 | Bacteria | 2106 |
| 492 | Ga0207669_10011766 | 3300025937 | Bacteria | 4274 |
| 493 | Ga0207669_10028092 | 3300025937 | Bacteria | 3090 |
| 494 | Ga0207669_10030002 | 3300025937 | Bacteria | 3016 |
| 495 | Ga0207669_10034091 | 3300025937 | Bacteria | 2881 |
| 496 | Ga0207669_10083795 | 3300025937 | Bacteria | 2052 |
| 497 | Ga0207669_10245710 | 3300025937 | Bacteria | 1329 |
| 498 | Ga0207704_10006836 | 3300025938 | Bacteria | 5346 |
| 499 | Ga0207704_10020304 | 3300025938 | Bacteria | 3511 |
| 500 | Ga0207704_10111636 | 3300025938 | Bacteria | 1849 |
| 501 | Ga0207691_10000355 | 3300025940 | Bacteria | 46166 |
| 502 | Ga0207691_10001576 | 3300025940 | Bacteria | 22626 |
| 503 | Ga0207691_10003706 | 3300025940 | Bacteria | 14820 |
| 504 | Ga0207691_10006074 | 3300025940 | Bacteria | 11669 |
| 505 | Ga0207691_10052907 | 3300025940 | Bacteria | 3708 |
| 506 | Ga0207691_10082266 | 3300025940 | Bacteria | 2892 |
| 507 | Ga0207691_10089856 | 3300025940 | Bacteria | 2754 |
| 508 | Ga0207691_10204200 | 3300025940 | Bacteria | 1719 |
| 509 | Ga0207691_10220021 | 3300025940 | Bacteria | 1647 |
| 510 | Ga0207691_10224851 | 3300025940 | Bacteria | 1627 |
| 511 | Ga0207691_10290908 | 3300025940 | Bacteria | 1405 |
| 512 | Ga0207711_10001361 | 3300025941 | Bacteria | 23065 |
| 513 | Ga0207711_10002091 | 3300025941 | Bacteria | 18030 |
| 514 | Ga0207711_10004575 | 3300025941 | Bacteria | 11763 |
| 515 | Ga0207711_10009784 | 3300025941 | Bacteria | 7973 |
| 516 | Ga0207711_10063054 | 3300025941 | Bacteria | 3199 |
| 517 | Ga0207711_10074092 | 3300025941 | Bacteria | 2960 |
| 518 | Ga0207711_10094166 | 3300025941 | Bacteria | 2639 |
| 519 | Ga0207711_10116360 | 3300025941 | Bacteria | 2383 |
| 520 | Ga0207711_10359957 | 3300025941 | Bacteria | 1348 |
| 521 | Ga0207689_10000131 | 3300025942 | Bacteria | 63353 |
| 522 | Ga0207689_10015623 | 3300025942 | Bacteria | 6430 |
| 523 | Ga0207661_10243805 | 3300025944 | Bacteria | 1595 |
| 524 | Ga0207679_10023093 | 3300025945 | Bacteria | 4247 |
| 525 | Ga0207679_10042322 | 3300025945 | Bacteria | 3273 |
| 526 | Ga0207679_10043955 | 3300025945 | Bacteria | 3220 |
| 527 | Ga0207679_10047738 | 3300025945 | Bacteria | 3113 |
| 528 | Ga0207679_10066590 | 3300025945 | Bacteria | 2699 |
| 529 | Ga0207679_10095794 | 3300025945 | Bacteria | 2308 |
| 530 | Ga0207679_10271226 | 3300025945 | Bacteria | 1451 |
| 531 | Ga0207667_10005262 | 3300025949 | Bacteria | 15787 |
| 532 | Ga0207667_10012623 | 3300025949 | Bacteria | 9713 |
| 533 | Ga0207667_10044308 | 3300025949 | Bacteria | 4715 |
| 534 | Ga0207667_10072965 | 3300025949 | Bacteria | 3567 |
| 535 | Ga0207667_10089870 | 3300025949 | Bacteria | 3174 |
| 536 | Ga0207667_10418995 | 3300025949 | Bacteria | 1362 |
| 537 | Ga0207651_10000065 | 3300025960 | Bacteria | 47455 |
| 538 | Ga0207651_10000682 | 3300025960 | Bacteria | 14497 |
| 539 | Ga0207651_10001114 | 3300025960 | Bacteria | 11960 |
| 540 | Ga0207651_10002938 | 3300025960 | Bacteria | 8240 |
| 541 | Ga0207651_10080599 | 3300025960 | Bacteria | 2343 |
| 542 | Ga0207651_10140133 | 3300025960 | Bacteria | 1867 |
| 543 | Ga0207651_10144874 | 3300025960 | Bacteria | 1840 |
| 544 | Ga0207651_10194657 | 3300025960 | Bacteria | 1620 |
| 545 | Ga0207712_10000026 | 3300025961 | Bacteria | 271237 |
| 546 | Ga0207712_10011051 | 3300025961 | Bacteria | 5747 |
| 547 | Ga0207712_10018954 | 3300025961 | Bacteria | 4489 |
| 548 | Ga0207668_10000029 | 3300025972 | Bacteria | 123784 |
| 549 | Ga0207668_10004462 | 3300025972 | Bacteria | 8227 |
| 550 | Ga0207668_10009397 | 3300025972 | Bacteria | 5858 |
| 551 | Ga0207668_10024798 | 3300025972 | Bacteria | 3875 |
| 552 | Ga0207668_10031352 | 3300025972 | Bacteria | 3501 |
| 553 | Ga0207668_10190124 | 3300025972 | Bacteria | 1626 |
| 554 | Ga0207640_10000462 | 3300025981 | Bacteria | 24805 |
| 555 | Ga0207640_10076006 | 3300025981 | Bacteria | 2278 |
| 556 | Ga0207640_10138492 | 3300025981 | Bacteria | 1770 |
| 557 | Ga0207640_10152368 | 3300025981 | Bacteria | 1700 |
| 558 | Ga0207640_10221207 | 3300025981 | Bacteria | 1450 |
| 559 | Ga0207658_10006366 | 3300025986 | Bacteria | 8061 |
| 560 | Ga0207658_10009023 | 3300025986 | Bacteria | 6762 |
| 561 | Ga0207658_10011629 | 3300025986 | Bacteria | 5992 |
| 562 | Ga0207658_10015960 | 3300025986 | Bacteria | 5159 |
| 563 | Ga0207658_10016216 | 3300025986 | Bacteria | 5121 |
| 564 | Ga0207658_10016915 | 3300025986 | Bacteria | 5019 |
| 565 | Ga0207658_10024751 | 3300025986 | Bacteria | 4201 |
| 566 | Ga0207658_10030562 | 3300025986 | Bacteria | 3815 |
| 567 | Ga0207658_10039167 | 3300025986 | Bacteria | 3419 |
| 568 | Ga0207658_10064991 | 3300025986 | Bacteria | 2738 |
| 569 | Ga0207658_10140163 | 3300025986 | Bacteria | 1955 |
| 570 | Ga0207677_10000306 | 3300026023 | Bacteria | 36020 |
| 571 | Ga0207677_10003055 | 3300026023 | Bacteria | 8849 |
| 572 | Ga0207703_10001023 | 3300026035 | Bacteria | 26811 |
| 573 | Ga0207703_10007375 | 3300026035 | Bacteria | 8737 |
| 574 | Ga0207703_10088471 | 3300026035 | Bacteria | 2599 |
| 575 | Ga0207703_10267873 | 3300026035 | Bacteria | 1546 |
| 576 | Ga0207639_10000744 | 3300026041 | Bacteria | 22249 |
| 577 | Ga0207639_10004853 | 3300026041 | Bacteria | 9059 |
| 578 | Ga0207639_10051496 | 3300026041 | Bacteria | 3132 |
| 579 | Ga0207639_10225688 | 3300026041 | Bacteria | 1620 |
| 580 | Ga0207678_10000879 | 3300026067 | Bacteria | 27621 |
| 581 | Ga0207678_10044737 | 3300026067 | Bacteria | 3829 |
| 582 | Ga0207708_10041422 | 3300026075 | Bacteria | 3512 |
| 583 | Ga0207702_10041646 | 3300026078 | Bacteria | 3851 |
| 584 | Ga0207702_10127849 | 3300026078 | Bacteria | 2283 |
| 585 | Ga0207702_10130508 | 3300026078 | Bacteria | 2261 |
| 586 | Ga0207641_10000214 | 3300026088 | Bacteria | 74908 |
| 587 | Ga0207641_10000330 | 3300026088 | Bacteria | 58123 |
| 588 | Ga0207641_10002702 | 3300026088 | Bacteria | 16187 |
| 589 | Ga0207641_10004528 | 3300026088 | Bacteria | 12019 |
| 590 | Ga0207641_10017142 | 3300026088 | Bacteria | 5926 |
| 591 | Ga0207641_10019325 | 3300026088 | Bacteria | 5591 |
| 592 | Ga0207641_10051480 | 3300026088 | Bacteria | 3487 |
| 593 | Ga0207641_10073671 | 3300026088 | Bacteria | 2943 |
| 594 | Ga0207641_10123948 | 3300026088 | Bacteria | 2310 |
| 595 | Ga0207648_10001272 | 3300026089 | Bacteria | 28163 |
| 596 | Ga0207648_10052659 | 3300026089 | Bacteria | 3559 |
| 597 | Ga0207648_10055815 | 3300026089 | Bacteria | 3447 |
| 598 | Ga0207648_10065845 | 3300026089 | Bacteria | 3159 |
| 599 | Ga0207648_10102294 | 3300026089 | Bacteria | 2511 |
| 600 | Ga0207648_10355808 | 3300026089 | Bacteria | 1320 |
| 601 | Ga0207676_10000519 | 3300026095 | Bacteria | 32410 |
| 602 | Ga0207676_10000766 | 3300026095 | Bacteria | 25125 |
| 603 | Ga0207676_10003091 | 3300026095 | Bacteria | 11875 |
| 604 | Ga0207674_10000065 | 3300026116 | Bacteria | 109485 |
| 605 | Ga0207674_10001456 | 3300026116 | Bacteria | 30588 |
| 606 | Ga0207674_10001471 | 3300026116 | Bacteria | 30430 |
| 607 | Ga0207674_10003128 | 3300026116 | Bacteria | 20417 |
| 608 | Ga0207674_10003445 | 3300026116 | Bacteria | 19357 |
| 609 | Ga0207674_10021126 | 3300026116 | Bacteria | 7017 |
| 610 | Ga0207674_10049792 | 3300026116 | Bacteria | 4282 |
| 611 | Ga0207674_10054949 | 3300026116 | Bacteria | 4051 |
| 612 | Ga0207675_100004354 | 3300026118 | Bacteria | 13686 |
| 613 | Ga0207675_100079482 | 3300026118 | Bacteria | 3073 |
| 614 | Ga0207683_10012349 | 3300026121 | Bacteria | 7286 |
| 615 | Ga0207683_10046220 | 3300026121 | Bacteria | 3809 |
| 616 | Ga0207683_10078010 | 3300026121 | Bacteria | 2934 |
| 617 | Ga0207698_10001922 | 3300026142 | Bacteria | 12182 |
| 618 | Ga0207698_10005605 | 3300026142 | Bacteria | 7772 |
| 619 | Ga0207698_10022095 | 3300026142 | Bacteria | 4413 |
| 620 | Ga0207698_10029725 | 3300026142 | Bacteria | 3917 |
| 621 | Ga0207698_10034037 | 3300026142 | Bacteria | 3709 |
| 622 | Ga0207698_10071065 | 3300026142 | Bacteria | 2760 |
| 623 | Ga0207698_10202002 | 3300026142 | Bacteria | 1780 |
| 624 | Ga0207698_10269654 | 3300026142 | Bacteria | 1568 |
| 625 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 626 | Ga0268266_10001577 | 3300028379 | Bacteria | 26652 |
| 627 | Ga0268266_10037907 | 3300028379 | Bacteria | 4104 |
| 628 | Ga0268266_10077616 | 3300028379 | Bacteria | 2888 |
| 629 | Ga0268266_10134810 | 3300028379 | Bacteria | 2211 |
| 630 | Ga0268265_10000084 | 3300028380 | Bacteria | 119522 |
| 631 | Ga0268265_10005886 | 3300028380 | Bacteria | 8354 |
| 632 | Ga0268265_10015059 | 3300028380 | Bacteria | 5282 |
| 633 | Ga0268265_10016066 | 3300028380 | Bacteria | 5136 |
| 634 | Ga0268265_10018905 | 3300028380 | Bacteria | 4783 |
| 635 | Ga0268265_10068622 | 3300028380 | Bacteria | 2750 |
| 636 | Ga0268265_10260129 | 3300028380 | Bacteria | 1542 |
| 637 | Ga0268265_10334613 | 3300028380 | Bacteria | 1376 |
| 638 | Ga0268264_10001177 | 3300028381 | Bacteria | 25374 |
| 639 | Ga0268264_10002820 | 3300028381 | Bacteria | 15170 |
| 640 | Ga0268264_10003029 | 3300028381 | Bacteria | 14572 |
| 641 | Ga0268264_10017924 | 3300028381 | Bacteria | 5792 |
| 642 | Ga0268264_10060717 | 3300028381 | Bacteria | 3169 |
| 643 | Ga0307408_100005733 | 3300031548 | Bacteria | 8275 |
| 644 | Ga0307408_100009467 | 3300031548 | Bacteria | 6427 |
| 645 | Ga0307408_100129971 | 3300031548 | Bacteria | 1963 |
| 646 | Ga0307405_10135370 | 3300031731 | Bacteria | 1709 |
| 647 | Ga0307413_10000374 | 3300031824 | Bacteria | 14373 |
| 648 | Ga0307413_10002779 | 3300031824 | Bacteria | 7214 |
| 649 | Ga0307413_10013931 | 3300031824 | Bacteria | 4065 |
| 650 | Ga0307413_10018108 | 3300031824 | Bacteria | 3687 |
| 651 | Ga0307413_10042830 | 3300031824 | Bacteria | 2663 |
| 652 | Ga0307413_10064851 | 3300031824 | Bacteria | 2271 |
| 653 | Ga0307413_10072322 | 3300031824 | Bacteria | 2176 |
| 654 | Ga0307413_10150824 | 3300031824 | Bacteria | 1619 |
| 655 | Ga0307413_10180524 | 3300031824 | Bacteria | 1504 |
| 656 | Ga0307410_10000330 | 3300031852 | Bacteria | 18486 |
| 657 | Ga0307410_10003938 | 3300031852 | Bacteria | 7559 |
| 658 | Ga0307410_10013584 | 3300031852 | Bacteria | 4758 |
| 659 | Ga0307410_10045930 | 3300031852 | Bacteria | 2911 |
| 660 | Ga0307410_10065000 | 3300031852 | Bacteria | 2508 |
| 661 | Ga0307410_10067449 | 3300031852 | Bacteria | 2468 |
| 662 | Ga0307410_10089472 | 3300031852 | Bacteria | 2181 |
| 663 | Ga0307410_10113700 | 3300031852 | Bacteria | 1963 |
| 664 | Ga0307406_10028172 | 3300031901 | Bacteria | 3392 |
| 665 | Ga0307406_10028344 | 3300031901 | Bacteria | 3383 |
| 666 | Ga0307406_10078109 | 3300031901 | Bacteria | 2191 |
| 667 | Ga0307406_10218645 | 3300031901 | Bacteria | 1414 |
| 668 | Ga0307407_10006616 | 3300031903 | Bacteria | 5174 |
| 669 | Ga0307407_10025052 | 3300031903 | Bacteria | 3139 |
| 670 | Ga0307407_10111934 | 3300031903 | Bacteria | 1715 |
| 671 | Ga0307412_10015128 | 3300031911 | Bacteria | 4566 |
| 672 | Ga0307412_10027986 | 3300031911 | Bacteria | 3522 |
| 673 | Ga0307412_10055893 | 3300031911 | Bacteria | 2628 |
| 674 | Ga0307412_10062484 | 3300031911 | Bacteria | 2508 |
| 675 | Ga0307412_10082769 | 3300031911 | Bacteria | 2223 |
| 676 | Ga0307409_100004347 | 3300031995 | Bacteria | 7943 |
| 677 | Ga0307409_100012395 | 3300031995 | Bacteria | 5432 |
| 678 | Ga0307409_100069016 | 3300031995 | Bacteria | 2798 |
| 679 | Ga0307409_100131509 | 3300031995 | Bacteria | 2139 |
| 680 | Ga0307409_100218706 | 3300031995 | Bacteria | 1718 |
| 681 | Ga0307416_100010727 | 3300032002 | Bacteria | 6070 |
| 682 | Ga0307416_100067626 | 3300032002 | Bacteria | 2948 |
| 683 | Ga0307416_100104386 | 3300032002 | Bacteria | 2477 |
| 684 | Ga0307414_10003552 | 3300032004 | Bacteria | 8347 |
| 685 | Ga0307414_10004525 | 3300032004 | Bacteria | 7562 |
| 686 | Ga0307414_10020831 | 3300032004 | Bacteria | 4095 |
| 687 | Ga0307414_10031677 | 3300032004 | Bacteria | 3472 |
| 688 | Ga0307414_10047777 | 3300032004 | Bacteria | 2948 |
| 689 | Ga0307414_10123475 | 3300032004 | Bacteria | 1995 |
| 690 | Ga0307414_10139044 | 3300032004 | Bacteria | 1898 |
| 691 | Ga0307411_10008143 | 3300032005 | Bacteria | 5407 |
| 692 | Ga0307411_10016686 | 3300032005 | Bacteria | 4161 |
| 693 | Ga0307411_10017056 | 3300032005 | Bacteria | 4125 |
| 694 | Ga0307411_10025189 | 3300032005 | Bacteria | 3560 |
| 695 | Ga0307411_10033754 | 3300032005 | Bacteria | 3176 |
| 696 | Ga0307411_10111172 | 3300032005 | Bacteria | 1961 |
| 697 | Ga0307415_100003554 | 3300032126 | Bacteria | 7954 |
| 698 | Ga0307415_100065897 | 3300032126 | Bacteria | 2525 |
| 699 | Ga0307415_100148515 | 3300032126 | Bacteria | 1801 |
| 700 | Ga0307415_100316558 | 3300032126 | Bacteria | 1299 |
| 701 | Ga0373923_0000465 | 3300035111 | Bacteria | 9624 |
| 702 | Ga0373955_0000926 | 3300035172 | Bacteria | 12596 |
| 703 | Ga0373935_0006536 | 3300035692 | Bacteria | 6964 |
| 704 | Ga0373937_0001611 | 3300036401 | Bacteria | 18965 |
| 705 | Ga0395899_0000113 | 3300037312 | Bacteria | 136163 |
| 706 | Ga0395899_0000863 | 3300037312 | Bacteria | 28863 |
| 707 | Ga0395899_0011585 | 3300037312 | Bacteria | 6751 |
| 708 | Ga0395899_0013449 | 3300037312 | Bacteria | 6260 |
| 709 | Ga0395899_0013565 | 3300037312 | Bacteria | 6229 |
| 710 | Ga0395899_0020590 | 3300037312 | Bacteria | 5000 |
| 711 | Ga0395899_0029864 | 3300037312 | Bacteria | 4101 |
| 712 | Ga0395899_0127872 | 3300037312 | Bacteria | 1816 |
| 713 | Ga0395899_0181086 | 3300037312 | Bacteria | 1479 |
| 714 | Ga0395900_0000365 | 3300037418 | Bacteria | 65054 |
| 715 | Ga0395900_0001813 | 3300037418 | Bacteria | 24442 |
| 716 | Ga0395900_0003475 | 3300037418 | Bacteria | 17008 |
| 717 | Ga0395900_0005399 | 3300037418 | Bacteria | 13387 |
| 718 | Ga0395900_0014179 | 3300037418 | Bacteria | 8139 |
| 719 | Ga0395900_0019037 | 3300037418 | Bacteria | 6999 |
| 720 | Ga0395900_0024613 | 3300037418 | Bacteria | 6161 |
| 721 | Ga0395900_0031802 | 3300037418 | Bacteria | 5424 |
| 722 | Ga0395900_0054317 | 3300037418 | Bacteria | 4124 |
| 723 | Ga0395900_0081887 | 3300037418 | Bacteria | 3316 |
| 724 | Ga0395900_0086406 | 3300037418 | Bacteria | 3223 |
| 725 | Ga0395900_0125756 | 3300037418 | Bacteria | 2629 |
| 726 | Ga0395900_0136865 | 3300037418 | Bacteria | 2509 |
| 727 | Ga0395900_0192071 | 3300037418 | Bacteria | 2070 |
| 728 | Ga0395900_0194802 | 3300037418 | Bacteria | 2054 |
| 729 | Ga0395900_0270908 | 3300037418 | Bacteria | 1692 |
| 730 | Ga0395898_0000306 | 3300037466 | Bacteria | 115940 |
| 731 | Ga0395898_0008363 | 3300037466 | Bacteria | 10939 |
| 732 | Ga0395898_0032049 | 3300037466 | Bacteria | 5246 |
| 733 | Ga0395898_0060861 | 3300037466 | Bacteria | 3668 |
| 734 | Ga0395898_0085523 | 3300037466 | Bacteria | 3039 |
| 735 | Ga0395898_0117782 | 3300037466 | Bacteria | 2544 |
| 736 | Ga0395898_0123787 | 3300037466 | Bacteria | 2477 |
| 737 | Ga0395898_0126312 | 3300037466 | Bacteria | 2450 |
| 738 | Ga0395898_0173879 | 3300037466 | Bacteria | 2058 |
| 739 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 740 | Ga0395905_0000559 | 3300037471 | Bacteria | 50796 |
| 741 | Ga0395905_0001994 | 3300037471 | Bacteria | 23323 |
| 742 | Ga0395905_0002386 | 3300037471 | Bacteria | 20908 |
| 743 | Ga0395905_0004872 | 3300037471 | Bacteria | 13831 |
| 744 | Ga0395905_0008189 | 3300037471 | Bacteria | 10323 |
| 745 | Ga0395905_0011078 | 3300037471 | Bacteria | 8728 |
| 746 | Ga0395905_0017211 | 3300037471 | Bacteria | 6866 |
| 747 | Ga0395905_0023867 | 3300037471 | Bacteria | 5774 |
| 748 | Ga0395905_0025498 | 3300037471 | Bacteria | 5576 |
| 749 | Ga0395905_0030264 | 3300037471 | Bacteria | 5102 |
| 750 | Ga0395905_0032743 | 3300037471 | Bacteria | 4886 |
| 751 | Ga0395905_0044532 | 3300037471 | Bacteria | 4165 |
| 752 | Ga0395905_0082003 | 3300037471 | Bacteria | 3022 |
| 753 | Ga0395905_0090170 | 3300037471 | Bacteria | 2874 |
| 754 | Ga0395905_0102311 | 3300037471 | Bacteria | 2689 |
| 755 | Ga0395905_0127168 | 3300037471 | Bacteria | 2396 |
| 756 | Ga0395905_0146763 | 3300037471 | Bacteria | 2219 |
| 757 | Ga0395905_0198813 | 3300037471 | Bacteria | 1879 |
| 758 | Ga0436364_0354297 | 3300037853 | Bacteria | 35362 |
| 759 | Ga0436364_1265123 | 3300037853 | Bacteria | 88807 |
| 760 | Ga0395901_0000310 | 3300038443 | Bacteria | 59928 |
| 761 | Ga0395901_0002629 | 3300038443 | Bacteria | 18161 |
| 762 | Ga0395901_0005488 | 3300038443 | Bacteria | 12849 |
| 763 | Ga0395901_0011926 | 3300038443 | Bacteria | 8814 |
| 764 | Ga0395901_0012896 | 3300038443 | Bacteria | 8476 |
| 765 | Ga0395901_0015390 | 3300038443 | Bacteria | 7787 |
| 766 | Ga0395901_0020064 | 3300038443 | Bacteria | 6839 |
| 767 | Ga0395901_0031351 | 3300038443 | Bacteria | 5482 |
| 768 | Ga0395901_0035339 | 3300038443 | Bacteria | 5161 |
| 769 | Ga0395901_0040351 | 3300038443 | Bacteria | 4834 |
| 770 | Ga0395901_0049272 | 3300038443 | Bacteria | 4376 |
| 771 | Ga0395901_0050500 | 3300038443 | Bacteria | 4320 |
| 772 | Ga0395901_0053070 | 3300038443 | Bacteria | 4212 |
| 773 | Ga0395901_0073866 | 3300038443 | Bacteria | 3557 |
| 774 | Ga0395901_0181632 | 3300038443 | Bacteria | 2207 |
| 775 | Ga0395901_0197258 | 3300038443 | Bacteria | 2110 |
| 776 | Ga0395901_0240391 | 3300038443 | Bacteria | 1889 |
| 777 | Ga0395901_0403270 | 3300038443 | Bacteria | 1404 |
| 778 | Ga0436365_0176211 | 3300039437 | Bacteria | 57194 |
| 779 | Ga0436365_1679154 | 3300039437 | Bacteria | 73730 |
| 780 | Ga0436362_0976836 | 3300039453 | Bacteria | 135942 |
| 781 | Ga0439447_013311 | 3300041407 | Bacteria | 2338 |
| 782 | Ga0439461_0000036 | 3300041410 | Bacteria | 16388 |
| 783 | Ga0439461_0003134 | 3300041410 | Bacteria | 2698 |
| 784 | Ga0439466_0055198 | 3300041411 | Bacteria | 1292 |
| 785 | Ga0439465_0001350 | 3300041413 | Bacteria | 7891 |
| 786 | Ga0451841_1394347 | 3300041498 | Bacteria | 1379 |
| 787 | Ga0439431_0000119 | 3300041997 | Bacteria | 13754 |
| 788 | Ga0439431_0011182 | 3300041997 | Bacteria | 2046 |
| 789 | Ga0439445_0011496 | 3300042004 | Bacteria | 2112 |
| 790 | Ga0439448_0005308 | 3300042005 | Bacteria | 3674 |
| 791 | Ga0439432_000282 | 3300042006 | Bacteria | 18360 |
| 792 | Ga0439432_009123 | 3300042006 | Bacteria | 3465 |
| 793 | Ga0439449_0026102 | 3300042007 | Bacteria | 2181 |
| 794 | Ga0439455_0007045 | 3300042012 | Bacteria | 2364 |
| 795 | Ga0439455_0034101 | 3300042012 | Bacteria | 1279 |
| 796 | Ga0439457_003868 | 3300042014 | Bacteria | 4012 |
| 797 | Ga0439462_0000311 | 3300042015 | Bacteria | 9079 |
| 798 | Ga0439462_0005301 | 3300042015 | Bacteria | 3175 |
| 799 | Ga0439434_0000055 | 3300042435 | Bacteria | 27855 |
| 800 | Ga0450918_012757 | 3300042531 | Bacteria | 1464 |
| 801 | Ga0466969_0073819 | 3300044656 | Bacteria | 1637 |
| 802 | Ga0466972_0007995 | 3300044658 | Bacteria | 5303 |
| 803 | Ga0466965_0024251 | 3300044683 | Bacteria | 2933 |
| 804 | Ga0466965_0076255 | 3300044683 | Bacteria | 1692 |
| 805 | Ga0466966_0094455 | 3300044684 | Bacteria | 1853 |
| 806 | Ga0466961_0008389 | 3300044693 | Bacteria | 6581 |
| 807 | Ga0466961_0012712 | 3300044693 | Bacteria | 5393 |
| 808 | Ga0466961_0014128 | 3300044693 | Bacteria | 5122 |
| 809 | Ga0466961_0020768 | 3300044693 | Bacteria | 4227 |
| 810 | Ga0466961_0051646 | 3300044693 | Bacteria | 2625 |
| 811 | Ga0466963_0000979 | 3300044694 | Bacteria | 14703 |
| 812 | Ga0466963_0015252 | 3300044694 | Bacteria | 4753 |
| 813 | Ga0466964_0004254 | 3300044706 | Bacteria | 5273 |
| 814 | Ga0466971_0008303 | 3300044719 | Bacteria | 4529 |
| 815 | Ga0466971_0059081 | 3300044719 | Bacteria | 1732 |
| 816 | Ga0466968_0006372 | 3300044735 | Bacteria | 4444 |
| 817 | Ga0466970_0010890 | 3300044765 | Bacteria | 4625 |
| 818 | Ga0466970_0027354 | 3300044765 | Bacteria | 2993 |
| 819 | Ga0466957_0003900 | 3300044842 | Bacteria | 8245 |
| 820 | Ga0466957_0018798 | 3300044842 | Bacteria | 4062 |
| 821 | Ga0466957_0022471 | 3300044842 | Bacteria | 3721 |
| 822 | Ga0466957_0022885 | 3300044842 | Bacteria | 3689 |
| 823 | Ga0466957_0104013 | 3300044842 | Bacteria | 1793 |
| 824 | Ga0466960_0027236 | 3300044901 | Bacteria | 2604 |
| 825 | Ga0466959_0049984 | 3300045049 | Bacteria | 3071 |
| 826 | Ga0466959_0096811 | 3300045049 | Bacteria | 2115 |
| 827 | Ga0466959_0103313 | 3300045049 | Bacteria | 2039 |
| 828 | Ga0466958_0013478 | 3300045836 | Bacteria | 4655 |
| 829 | Ga0466958_0023134 | 3300045836 | Bacteria | 3644 |
| 830 | Ga0466958_0079156 | 3300045836 | Bacteria | 2021 |
| 831 | Ga0466967_0000572 | 3300045976 | Bacteria | 18128 |
| 832 | Ga0466967_0047448 | 3300045976 | Bacteria | 3744 |
| 833 | Ga0466967_0068550 | 3300045976 | Bacteria | 3168 |
| 834 | Ga0466967_0107595 | 3300045976 | Bacteria | 2558 |
| 835 | Ga0466967_0189648 | 3300045976 | Bacteria | 1942 |
| 836 | Ga0466967_0196353 | 3300045976 | Bacteria | 1909 |
| 837 | Ga0466967_0250886 | 3300045976 | Bacteria | 1690 |
| 838 | Ga0495663_0005980 | 3300046525 | Bacteria | 3369 |
| 839 | Ga0495663_0055378 | 3300046525 | Bacteria | 1237 |
| 840 | Ga0495598_0006720 | 3300046537 | Bacteria | 2609 |
| 841 | Ga0495621_0000028 | 3300046539 | Bacteria | 27731 |
| 842 | Ga0495621_0000060 | 3300046539 | Bacteria | 21095 |
| 843 | Ga0495621_0000752 | 3300046539 | Bacteria | 8197 |
| 844 | Ga0495621_0039011 | 3300046539 | Bacteria | 1659 |
| 845 | Ga0495625_0048066 | 3300046660 | Bacteria | 3074 |
| 846 | Ga0495669_0000249 | 3300046684 | Bacteria | 31437 |
| 847 | Ga0495669_0002086 | 3300046684 | Bacteria | 8189 |
| 848 | Ga0495670_0000649 | 3300046691 | Bacteria | 16588 |
| 849 | Ga0495670_0050866 | 3300046691 | Bacteria | 2074 |
| 850 | Ga0495687_078802 | 3300047443 | Bacteria | 1297 |
| 851 | Ga0495681_0076744 | 3300047470 | Bacteria | 1501 |
| 852 | Ga0495686_0017925 | 3300047472 | Bacteria | 4761 |
| 853 | Ga0495602_0024757 | 3300048088 | Bacteria | 5820 |
| 854 | Ga0496100_0028868 | 3300048903 | Bacteria | 3426 |
| 855 | Ga0496101_0132500 | 3300048904 | Bacteria | 1894 |
| 856 | Ga0496102_0022885 | 3300048905 | Bacteria | 5542 |
| 857 | Ga0496102_0146888 | 3300048905 | Bacteria | 2213 |
| 858 | Ga0496104_0077176 | 3300048907 | Bacteria | 3174 |
| 859 | Ga0496106_0003270 | 3300048909 | Bacteria | 12115 |
| 860 | Ga0496107_0039067 | 3300048910 | Bacteria | 3404 |
| 861 | Ga0496107_0150147 | 3300048910 | Bacteria | 1723 |
| 862 | Ga0496107_0170431 | 3300048910 | Bacteria | 1615 |
| 863 | Ga0496108_0000498 | 3300048911 | Bacteria | 31214 |
| 864 | Ga0496108_0001972 | 3300048911 | Bacteria | 16429 |
| 865 | Ga0496108_0005497 | 3300048911 | Bacteria | 10255 |
| 866 | Ga0496108_0010291 | 3300048911 | Bacteria | 7593 |
| 867 | Ga0496109_0003092 | 3300048912 | Bacteria | 13874 |
| 868 | Ga0496109_0229700 | 3300048912 | Bacteria | 1745 |
| 869 | Ga0496110_0025309 | 3300048913 | Bacteria | 5070 |
| 870 | Ga0496110_0073493 | 3300048913 | Bacteria | 3034 |
| 871 | Ga0496110_0118288 | 3300048913 | Bacteria | 2386 |
| 872 | Ga0496111_0020457 | 3300048914 | Bacteria | 4607 |
| 873 | Ga0496111_0036441 | 3300048914 | Bacteria | 3517 |
| 874 | Ga0496111_0036678 | 3300048914 | Bacteria | 3506 |
| 875 | Ga0496112_0012362 | 3300048915 | Bacteria | 7843 |
| 876 | Ga0496112_0030698 | 3300048915 | Bacteria | 5204 |
| 877 | Ga0496112_0054657 | 3300048915 | Bacteria | 3924 |
| 878 | Ga0496112_0067829 | 3300048915 | Bacteria | 3521 |
| 879 | Ga0496112_0221390 | 3300048915 | Bacteria | 1848 |
| 880 | Ga0496112_0238037 | 3300048915 | Bacteria | 1774 |
| 881 | Ga0496113_0003738 | 3300048916 | Bacteria | 9174 |
| 882 | Ga0496113_0017009 | 3300048916 | Bacteria | 5037 |
| 883 | Ga0496113_0031803 | 3300048916 | Bacteria | 3832 |
| 884 | Ga0496113_0044196 | 3300048916 | Bacteria | 3299 |
| 885 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 886 | Ga0496114_0044906 | 3300048917 | Bacteria | 3668 |
| 887 | Ga0496115_0000419 | 3300048918 | Bacteria | 34639 |
| 888 | Ga0496115_0001066 | 3300048918 | Bacteria | 19849 |
| 889 | Ga0496125_0096967 | 3300048928 | Bacteria | 2187 |
| 890 | Ga0501067_0008761 | 3300049583 | Bacteria | 5604 |
| 891 | Ga0501067_0121777 | 3300049583 | Bacteria | 1452 |
| 892 | Ga0501068_0106968 | 3300049584 | Bacteria | 1737 |
| 893 | Ga0501227_020990 | 3300049665 | Bacteria | 1503 |
| 894 | Ga0501235_019723 | 3300049669 | Bacteria | 1496 |
| 895 | Ga0501257_025792 | 3300049686 | Bacteria | 1400 |
| 896 | Ga0501225_0012311 | 3300049705 | Bacteria | 2403 |
| 897 | Ga0501225_0032982 | 3300049705 | Bacteria | 1424 |
| 898 | Ga0501080_0041816 | 3300049742 | Bacteria | 4269 |
| 899 | Ga0501241_004815 | 3300049758 | Bacteria | 2521 |
| 900 | Ga0501268_005195 | 3300049765 | Bacteria | 1863 |
| 901 | Ga0501270_006134 | 3300049767 | Bacteria | 1429 |
| 902 | nmdc:mga0qj67_17871_c1 | 3300050509 | Bacteria | 5397 |
| 903 | nmdc:mga08y16_9520_c1 | 3300050511 | Bacteria | 10195 |
| 904 | nmdc:mga0a205_871_c1 | 3300050515 | Bacteria | 24762 |
| 905 | nmdc:mga0sz30_62273_c1 | 3300050516 | Bacteria | 1595 |
| 906 | Ga0495655_0012687 | 3300053083 | Bacteria | 1724 |
| 907 | Ga0500643_007513 | 3300053087 | Bacteria | 4380 |
| 908 | Ga0500566_0001818 | 3300053094 | Bacteria | 12542 |
| 909 | Ga0500592_001260 | 3300053116 | Bacteria | 4119 |
| 910 | Ga0500658_0000107 | 3300053134 | Bacteria | 38715 |
| 911 | Ga0500568_0021404 | 3300053139 | Bacteria | 2782 |
| 912 | Ga0500624_000004 | 3300053157 | Bacteria | 196921 |
| 913 | Ga0500637_0000006 | 3300053178 | Bacteria | 99157 |
| 914 | Ga0466962_0004307 | 3300061719 | Bacteria | 6825 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042005 | Ga0439448_0005308 | Ga0439448_0005308_1175_2272 | 279 |
| 2 | 3300042012 | Ga0439455_0034101 | Ga0439455_0034101_13_1110 | 279 |
| 3 | 3300048918 | Ga0496115_0000419 | Ga0496115_0000419_8449_9582 | 283 |
| 4 | 3300002774 | JGI25150J39212_1000520 | JGI25150J39212_10005204 | 284 |
| 5 | 3300003187 | JGI25151J46595_10017622 | JGI25151J46595_100176222 | 284 |
| 6 | 3300003215 | JGI25153J46596_10000027 | JGI25153J46596_10000027103 | 284 |
| 7 | 3300003792 | Ga0055540_1001409 | Ga0055540_10014097 | 284 |
| 8 | 3300005578 | Ga0068854_100057685 | Ga0068854_1000576854 | 284 |
| 9 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005301 | 284 |
| 10 | 3300025258 | Ga0209129_1001570 | Ga0209129_100157011 | 284 |
| 11 | 3300025294 | Ga0209025_1000763 | Ga0209025_100076330 | 284 |
| 12 | 3300025297 | Ga0209758_1000002 | Ga0209758_10000021043 | 284 |
| 13 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011027 | 284 |
| 14 | 3300025303 | Ga0209051_1000518 | Ga0209051_100051823 | 284 |
| 15 | 3300037471 | Ga0395905_0127168 | Ga0395905_0127168_414_1508 | 284 |
| 16 | 3300048928 | Ga0496125_0096967 | Ga0496125_0096967_970_2082 | 284 |
| 17 | 3300003771 | Ga0055526_1001967 | Ga0055526_10019674 | 285 |
| 18 | 3300025295 | Ga0209564_1001029 | Ga0209564_100102919 | 285 |
| 19 | 3300048910 | Ga0496107_0170431 | Ga0496107_0170431_357_1436 | 285 |
| 20 | 3300037466 | Ga0395898_0032049 | Ga0395898_0032049_856_1950 | 286 |
| 21 | 3300038443 | Ga0395901_0035339 | Ga0395901_0035339_816_1910 | 286 |
| 22 | 3300005457 | Ga0070662_100240155 | Ga0070662_1002401552 | 287 |
| 23 | 3300009551 | Ga0105238_10125411 | Ga0105238_101254113 | 287 |
| 24 | 3300025901 | Ga0207688_10016187 | Ga0207688_100161874 | 287 |
| 25 | 3300025924 | Ga0207694_10136881 | Ga0207694_101368812 | 287 |
| 26 | 3300025981 | Ga0207640_10138492 | Ga0207640_101384922 | 287 |
| 27 | 3300026089 | Ga0207648_10355808 | Ga0207648_103558082 | 287 |
| 28 | 3300039437 | Ga0436365_1679154 | Ga0436365_1679154_46214_47275 | 288 |
| 29 | 3300003773 | Ga0055537_1003360 | Ga0055537_10033603 | 289 |
| 30 | 3300025263 | Ga0209565_1000215 | Ga0209565_100021535 | 289 |
| 31 | 3300025273 | Ga0209673_1005404 | Ga0209673_10054045 | 289 |
| 32 | 3300026089 | Ga0207648_10102294 | Ga0207648_101022942 | 289 |
| 33 | 3300025919 | Ga0207657_10004246 | Ga0207657_100042466 | 290 |
| 34 | 3300005530 | Ga0070679_100097863 | Ga0070679_1000978632 | 291 |
| 35 | 3300025909 | Ga0207705_10015172 | Ga0207705_100151725 | 291 |
| 36 | 3300025909 | Ga0207705_10020884 | Ga0207705_100208843 | 291 |
| 37 | 3300025917 | Ga0207660_10162016 | Ga0207660_101620162 | 291 |
| 38 | 3300026041 | Ga0207639_10225688 | Ga0207639_102256882 | 291 |
| 39 | 3300005336 | Ga0070680_100023975 | Ga0070680_1000239754 | 293 |
| 40 | 3300005458 | Ga0070681_10074320 | Ga0070681_100743204 | 293 |
| 41 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003246 | 293 |
| 42 | 3300021388 | Ga0213875_10000657 | Ga0213875_100006578 | 293 |
| 43 | 3300025912 | Ga0207707_10026928 | Ga0207707_100269287 | 293 |
| 44 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004247 | 293 |
| 45 | 3300025937 | Ga0207669_10030002 | Ga0207669_100300021 | 293 |
| 46 | 3300037418 | Ga0395900_0125756 | Ga0395900_0125756_629_1711 | 293 |
| 47 | 3300037466 | Ga0395898_0173879 | Ga0395898_0173879_791_1873 | 293 |
| 48 | 3300037471 | Ga0395905_0030264 | Ga0395905_0030264_2241_3323 | 293 |
| 49 | 3300037853 | Ga0436364_1265123 | Ga0436364_1265123_58540_59619 | 293 |
| 50 | 3300038443 | Ga0395901_0050500 | Ga0395901_0050500_1638_2720 | 293 |
| 51 | 3300005344 | Ga0070661_100000014 | Ga0070661_10000001474 | 294 |
| 52 | 3300025920 | Ga0207649_10000393 | Ga0207649_1000039327 | 294 |
| 53 | 3300028380 | Ga0268265_10015059 | Ga0268265_100150593 | 294 |
| 54 | 3300037418 | Ga0395900_0192071 | Ga0395900_0192071_882_1961 | 294 |
| 55 | 3300037466 | Ga0395898_0085523 | Ga0395898_0085523_1557_2636 | 294 |
| 56 | 3300038443 | Ga0395901_0020064 | Ga0395901_0020064_23_1111 | 294 |
| 57 | 3300038443 | Ga0395901_0197258 | Ga0395901_0197258_467_1546 | 294 |
| 58 | 3300005329 | Ga0070683_100089230 | Ga0070683_1000892302 | 295 |
| 59 | 3300005344 | Ga0070661_100147270 | Ga0070661_1001472702 | 295 |
| 60 | 3300005535 | Ga0070684_100150438 | Ga0070684_1001504382 | 295 |
| 61 | 3300013104 | Ga0157370_10192485 | Ga0157370_101924852 | 295 |
| 62 | 3300037312 | Ga0395899_0020590 | Ga0395899_0020590_150_1244 | 295 |
| 63 | 3300037466 | Ga0395898_0117782 | Ga0395898_0117782_936_2030 | 295 |
| 64 | 3300037471 | Ga0395905_0011078 | Ga0395905_0011078_643_1737 | 295 |
| 65 | 3300038443 | Ga0395901_0011926 | Ga0395901_0011926_160_1254 | 295 |
| 66 | 3300005339 | Ga0070660_100052955 | Ga0070660_1000529552 | 296 |
| 67 | 3300013105 | Ga0157369_10007856 | Ga0157369_100078568 | 296 |
| 68 | 3300025904 | Ga0207647_10002688 | Ga0207647_100026886 | 296 |
| 69 | 3300025919 | Ga0207657_10057875 | Ga0207657_100578752 | 296 |
| 70 | 3300026116 | Ga0207674_10021126 | Ga0207674_100211267 | 296 |
| 71 | 3300037418 | Ga0395900_0194802 | Ga0395900_0194802_905_2002 | 296 |
| 72 | 3300001990 | JGI24737J22298_10003952 | JGI24737J22298_100039524 | 297 |
| 73 | 3300001990 | JGI24737J22298_10013375 | JGI24737J22298_100133753 | 297 |
| 74 | 3300005331 | Ga0070670_100030537 | Ga0070670_1000305373 | 297 |
| 75 | 3300005841 | Ga0068863_100005224 | Ga0068863_1000052242 | 297 |
| 76 | 3300021358 | Ga0213873_10000007 | Ga0213873_10000007276 | 297 |
| 77 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005312 | 297 |
| 78 | 3300025904 | Ga0207647_10045096 | Ga0207647_100450962 | 297 |
| 79 | 3300025904 | Ga0207647_10139530 | Ga0207647_101395302 | 297 |
| 80 | 3300025932 | Ga0207690_10004126 | Ga0207690_100041269 | 297 |
| 81 | 3300025932 | Ga0207690_10018743 | Ga0207690_100187433 | 297 |
| 82 | 3300026088 | Ga0207641_10073671 | Ga0207641_100736712 | 297 |
| 83 | 3300026116 | Ga0207674_10000065 | Ga0207674_1000006524 | 297 |
| 84 | 3300037418 | Ga0395900_0270908 | Ga0395900_0270908_556_1629 | 297 |
| 85 | 3300037471 | Ga0395905_0044532 | Ga0395905_0044532_697_1770 | 297 |
| 86 | 3300039437 | Ga0436365_0176211 | Ga0436365_0176211_24882_26006 | 297 |
| 87 | 3300039453 | Ga0436362_0976836 | Ga0436362_0976836_102768_103892 | 297 |
| 88 | 3300042012 | Ga0439455_0007045 | Ga0439455_0007045_231_1322 | 297 |
| 89 | 3300047443 | Ga0495687_078802 | Ga0495687_078802_29_1120 | 297 |
| 90 | 3300047472 | Ga0495686_0017925 | Ga0495686_0017925_432_1520 | 297 |
| 91 | 3300048911 | Ga0496108_0000498 | Ga0496108_0000498_12940_14016 | 297 |
| 92 | 3300020082 | Ga0206353_11795267 | Ga0206353_117952673 | 298 |
| 93 | 3300005327 | Ga0070658_10000002 | Ga0070658_10000002158 | 299 |
| 94 | 3300005339 | Ga0070660_100002675 | Ga0070660_1000026759 | 299 |
| 95 | 3300005366 | Ga0070659_100006079 | Ga0070659_1000060793 | 299 |
| 96 | 3300014326 | Ga0157380_10583858 | Ga0157380_105838582 | 299 |
| 97 | 3300025909 | Ga0207705_10000005 | Ga0207705_10000005604 | 299 |
| 98 | 3300025932 | Ga0207690_10001712 | Ga0207690_100017123 | 299 |
| 99 | 3300037418 | Ga0395900_0081887 | Ga0395900_0081887_1427_2515 | 299 |
| 100 | 3300037471 | Ga0395905_0017211 | Ga0395905_0017211_2824_3912 | 299 |
| 101 | 3300038443 | Ga0395901_0073866 | Ga0395901_0073866_426_1514 | 299 |
| 102 | 3300049765 | Ga0501268_005195 | Ga0501268_005195_439_1533 | 299 |
| 103 | 3300005327 | Ga0070658_10046588 | Ga0070658_100465882 | 300 |
| 104 | 3300005344 | Ga0070661_100088307 | Ga0070661_1000883072 | 300 |
| 105 | 3300005539 | Ga0068853_100216904 | Ga0068853_1002169042 | 300 |
| 106 | 3300005614 | Ga0068856_100293460 | Ga0068856_1002934602 | 300 |
| 107 | 3300013105 | Ga0157369_10007383 | Ga0157369_1000738314 | 300 |
| 108 | 3300025909 | Ga0207705_10049718 | Ga0207705_100497182 | 300 |
| 109 | 3300025920 | Ga0207649_10042197 | Ga0207649_100421972 | 300 |
| 110 | 3300025924 | Ga0207694_10078174 | Ga0207694_100781743 | 300 |
| 111 | 3300026078 | Ga0207702_10130508 | Ga0207702_101305082 | 300 |
| 112 | 3300046537 | Ga0495598_0006720 | Ga0495598_0006720_516_1601 | 300 |
| 113 | 3300046539 | Ga0495621_0000060 | Ga0495621_0000060_10265_11350 | 300 |
| 114 | 3300046691 | Ga0495670_0000649 | Ga0495670_0000649_5758_6843 | 300 |
| 115 | 3300003791 | Ga0055530_10000938 | Ga0055530_1000093819 | 301 |
| 116 | 3300003791 | Ga0055530_10001352 | Ga0055530_100013527 | 301 |
| 117 | 3300003794 | Ga0055531_10000812 | Ga0055531_100008127 | 301 |
| 118 | 3300005329 | Ga0070683_100104437 | Ga0070683_1001044374 | 301 |
| 119 | 3300005366 | Ga0070659_100005814 | Ga0070659_1000058147 | 301 |
| 120 | 3300005435 | Ga0070714_100095655 | Ga0070714_1000956552 | 301 |
| 121 | 3300005844 | Ga0068862_100306373 | Ga0068862_1003063732 | 301 |
| 122 | 3300021384 | Ga0213876_10000178 | Ga0213876_1000017827 | 301 |
| 123 | 3300025298 | Ga0209050_1000051 | Ga0209050_1000051243 | 301 |
| 124 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028125 | 301 |
| 125 | 3300025932 | Ga0207690_10008045 | Ga0207690_100080453 | 301 |
| 126 | 3300037312 | Ga0395899_0011585 | Ga0395899_0011585_3713_4792 | 301 |
| 127 | 3300037466 | Ga0395898_0060861 | Ga0395898_0060861_853_1932 | 301 |
| 128 | 3300038443 | Ga0395901_0005488 | Ga0395901_0005488_8844_9923 | 301 |
| 129 | 3300005355 | Ga0070671_100039726 | Ga0070671_1000397262 | 302 |
| 130 | 3300025929 | Ga0207664_10079381 | Ga0207664_100793812 | 302 |
| 131 | 3300025938 | Ga0207704_10111636 | Ga0207704_101116362 | 302 |
| 132 | 3300025940 | Ga0207691_10089856 | Ga0207691_100898563 | 302 |
| 133 | 3300032126 | Ga0307415_100148515 | Ga0307415_1001485152 | 302 |
| 134 | 3300035692 | Ga0373935_0006536 | Ga0373935_0006536_1631_2722 | 302 |
| 135 | 3300049686 | Ga0501257_025792 | Ga0501257_025792_282_1376 | 302 |
| 136 | 3300049705 | Ga0501225_0032982 | Ga0501225_0032982_236_1327 | 302 |
| 137 | 3300005293 | Ga0065715_10001517 | Ga0065715_100015176 | 303 |
| 138 | 3300005331 | Ga0070670_100018115 | Ga0070670_1000181152 | 303 |
| 139 | 3300005333 | Ga0070677_10001174 | Ga0070677_100011747 | 303 |
| 140 | 3300005336 | Ga0070680_100005513 | Ga0070680_1000055138 | 303 |
| 141 | 3300005355 | Ga0070671_100006684 | Ga0070671_1000066849 | 303 |
| 142 | 3300005367 | Ga0070667_100026665 | Ga0070667_1000266653 | 303 |
| 143 | 3300005458 | Ga0070681_10026384 | Ga0070681_100263844 | 303 |
| 144 | 3300005459 | Ga0068867_100021024 | Ga0068867_1000210243 | 303 |
| 145 | 3300005539 | Ga0068853_100126778 | Ga0068853_1001267782 | 303 |
| 146 | 3300005543 | Ga0070672_100006628 | Ga0070672_1000066282 | 303 |
| 147 | 3300005548 | Ga0070665_100026044 | Ga0070665_1000260442 | 303 |
| 148 | 3300005564 | Ga0070664_100052286 | Ga0070664_1000522863 | 303 |
| 149 | 3300005578 | Ga0068854_100015373 | Ga0068854_1000153732 | 303 |
| 150 | 3300005614 | Ga0068856_100034980 | Ga0068856_1000349805 | 303 |
| 151 | 3300005616 | Ga0068852_100046399 | Ga0068852_1000463994 | 303 |
| 152 | 3300005617 | Ga0068859_100004952 | Ga0068859_1000049524 | 303 |
| 153 | 3300005719 | Ga0068861_100008562 | Ga0068861_1000085622 | 303 |
| 154 | 3300005843 | Ga0068860_100081288 | Ga0068860_1000812883 | 303 |
| 155 | 3300006931 | Ga0097620_100004952 | Ga0097620_1000049524 | 303 |
| 156 | 3300009093 | Ga0105240_10010666 | Ga0105240_1001066611 | 303 |
| 157 | 3300009094 | Ga0111539_10008340 | Ga0111539_100083407 | 303 |
| 158 | 3300009553 | Ga0105249_10011408 | Ga0105249_100114086 | 303 |
| 159 | 3300013307 | Ga0157372_10283641 | Ga0157372_102836412 | 303 |
| 160 | 3300017792 | Ga0163161_10006309 | Ga0163161_100063093 | 303 |
| 161 | 3300025271 | Ga0207666_1002613 | Ga0207666_10026132 | 303 |
| 162 | 3300025315 | Ga0207697_10001125 | Ga0207697_1000112516 | 303 |
| 163 | 3300025893 | Ga0207682_10000674 | Ga0207682_100006748 | 303 |
| 164 | 3300025904 | Ga0207647_10000786 | Ga0207647_100007862 | 303 |
| 165 | 3300025915 | Ga0207693_10058018 | Ga0207693_100580184 | 303 |
| 166 | 3300025925 | Ga0207650_10006112 | Ga0207650_100061122 | 303 |
| 167 | 3300025931 | Ga0207644_10018081 | Ga0207644_100180814 | 303 |
| 168 | 3300025933 | Ga0207706_10000812 | Ga0207706_1000081223 | 303 |
| 169 | 3300025940 | Ga0207691_10000355 | Ga0207691_1000035527 | 303 |
| 170 | 3300025945 | Ga0207679_10047738 | Ga0207679_100477383 | 303 |
| 171 | 3300025960 | Ga0207651_10001114 | Ga0207651_100011148 | 303 |
| 172 | 3300025961 | Ga0207712_10011051 | Ga0207712_100110514 | 303 |
| 173 | 3300025972 | Ga0207668_10004462 | Ga0207668_100044624 | 303 |
| 174 | 3300025986 | Ga0207658_10030562 | Ga0207658_100305623 | 303 |
| 175 | 3300026075 | Ga0207708_10041422 | Ga0207708_100414224 | 303 |
| 176 | 3300026089 | Ga0207648_10055815 | Ga0207648_100558153 | 303 |
| 177 | 3300026118 | Ga0207675_100004354 | Ga0207675_1000043547 | 303 |
| 178 | 3300031548 | Ga0307408_100005733 | Ga0307408_1000057338 | 303 |
| 179 | 3300031852 | Ga0307410_10065000 | Ga0307410_100650002 | 303 |
| 180 | 3300031901 | Ga0307406_10028344 | Ga0307406_100283444 | 303 |
| 181 | 3300031995 | Ga0307409_100131509 | Ga0307409_1001315092 | 303 |
| 182 | 3300042007 | Ga0439449_0026102 | Ga0439449_0026102_265_1371 | 303 |
| 183 | 3300045049 | Ga0466959_0103313 | Ga0466959_0103313_402_1514 | 303 |
| 184 | 3300049665 | Ga0501227_020990 | Ga0501227_020990_270_1376 | 303 |
| 185 | 3300049669 | Ga0501235_019723 | Ga0501235_019723_232_1338 | 303 |
| 186 | 3300049705 | Ga0501225_0012311 | Ga0501225_0012311_1134_2240 | 303 |
| 187 | 3300049767 | Ga0501270_006134 | Ga0501270_006134_99_1205 | 303 |
| 188 | 3300050511 | nmdc:mga08y16_9520_c1 | nmdc:mga08y16_9520_c1_5663_6709 | 303 |
| 189 | 3300005339 | Ga0070660_100091585 | Ga0070660_1000915852 | 304 |
| 190 | 3300005355 | Ga0070671_100005857 | Ga0070671_1000058575 | 304 |
| 191 | 3300021388 | Ga0213875_10002530 | Ga0213875_100025304 | 304 |
| 192 | 3300025912 | Ga0207707_10049860 | Ga0207707_100498602 | 304 |
| 193 | 3300025917 | Ga0207660_10009838 | Ga0207660_100098385 | 304 |
| 194 | 3300025924 | Ga0207694_10038749 | Ga0207694_100387492 | 304 |
| 195 | 3300025931 | Ga0207644_10000039 | Ga0207644_10000039100 | 304 |
| 196 | 3300025949 | Ga0207667_10005262 | Ga0207667_1000526211 | 304 |
| 197 | 3300025981 | Ga0207640_10076006 | Ga0207640_100760062 | 304 |
| 198 | 3300026142 | Ga0207698_10034037 | Ga0207698_100340373 | 304 |
| 199 | 3300037853 | Ga0436364_0354297 | Ga0436364_0354297_20155_21261 | 304 |
| 200 | 3300045976 | Ga0466967_0107595 | Ga0466967_0107595_1248_2315 | 304 |
| 201 | 3300053139 | Ga0500568_0021404 | Ga0500568_0021404_722_1837 | 304 |
| 202 | 3300028380 | Ga0268265_10334613 | Ga0268265_103346132 | 305 |
| 203 | 3300031852 | Ga0307410_10113700 | Ga0307410_101137002 | 305 |
| 204 | 3300044719 | Ga0466971_0059081 | Ga0466971_0059081_626_1714 | 305 |
| 205 | 3300045836 | Ga0466958_0079156 | Ga0466958_0079156_168_1256 | 305 |
| 206 | 3300005336 | Ga0070680_100002432 | Ga0070680_1000024325 | 306 |
| 207 | 3300005347 | Ga0070668_100000037 | Ga0070668_10000003737 | 306 |
| 208 | 3300005617 | Ga0068859_100064626 | Ga0068859_1000646263 | 306 |
| 209 | 3300005841 | Ga0068863_100000145 | Ga0068863_10000014532 | 306 |
| 210 | 3300005843 | Ga0068860_100086625 | Ga0068860_1000866252 | 306 |
| 211 | 3300005844 | Ga0068862_100011052 | Ga0068862_1000110526 | 306 |
| 212 | 3300006175 | Ga0070712_100013626 | Ga0070712_1000136263 | 306 |
| 213 | 3300006931 | Ga0097620_100064622 | Ga0097620_1000646222 | 306 |
| 214 | 3300009553 | Ga0105249_10010109 | Ga0105249_100101096 | 306 |
| 215 | 3300025917 | Ga0207660_10001202 | Ga0207660_1000120211 | 306 |
| 216 | 3300025929 | Ga0207664_10190100 | Ga0207664_101901002 | 306 |
| 217 | 3300025961 | Ga0207712_10018954 | Ga0207712_100189543 | 306 |
| 218 | 3300025972 | Ga0207668_10000029 | Ga0207668_10000029135 | 306 |
| 219 | 3300026078 | Ga0207702_10127849 | Ga0207702_101278492 | 306 |
| 220 | 3300026088 | Ga0207641_10000214 | Ga0207641_1000021432 | 306 |
| 221 | 3300028380 | Ga0268265_10260129 | Ga0268265_102601292 | 306 |
| 222 | 3300028381 | Ga0268264_10002820 | Ga0268264_1000282015 | 306 |
| 223 | 3300047470 | Ga0495681_0076744 | Ga0495681_0076744_285_1403 | 306 |
| 224 | 3300049583 | Ga0501067_0121777 | Ga0501067_0121777_237_1343 | 306 |
| 225 | 3300053087 | Ga0500643_007513 | Ga0500643_007513_3166_4284 | 306 |
| 226 | 3300005336 | Ga0070680_100031065 | Ga0070680_1000310652 | 307 |
| 227 | 3300005343 | Ga0070687_100070145 | Ga0070687_1000701452 | 307 |
| 228 | 3300005563 | Ga0068855_100017157 | Ga0068855_1000171573 | 307 |
| 229 | 3300025917 | Ga0207660_10000059 | Ga0207660_1000005952 | 307 |
| 230 | 3300025921 | Ga0207652_10210806 | Ga0207652_102108062 | 307 |
| 231 | 3300025949 | Ga0207667_10089870 | Ga0207667_100898702 | 307 |
| 232 | 3300026142 | Ga0207698_10269654 | Ga0207698_102696542 | 307 |
| 233 | 3300044901 | Ga0466960_0027236 | Ga0466960_0027236_1398_2480 | 307 |
| 234 | 3300005335 | Ga0070666_10027748 | Ga0070666_100277483 | 308 |
| 235 | 3300005338 | Ga0068868_100036723 | Ga0068868_1000367232 | 308 |
| 236 | 3300005347 | Ga0070668_100029234 | Ga0070668_1000292343 | 308 |
| 237 | 3300005356 | Ga0070674_100003684 | Ga0070674_1000036842 | 308 |
| 238 | 3300005364 | Ga0070673_100003616 | Ga0070673_10000361610 | 308 |
| 239 | 3300005367 | Ga0070667_100000512 | Ga0070667_10000051238 | 308 |
| 240 | 3300005459 | Ga0068867_100049328 | Ga0068867_1000493284 | 308 |
| 241 | 3300005459 | Ga0068867_100051766 | Ga0068867_1000517663 | 308 |
| 242 | 3300005543 | Ga0070672_100245731 | Ga0070672_1002457312 | 308 |
| 243 | 3300005544 | Ga0070686_100106866 | Ga0070686_1001068662 | 308 |
| 244 | 3300005614 | Ga0068856_100127679 | Ga0068856_1001276792 | 308 |
| 245 | 3300005617 | Ga0068859_100043349 | Ga0068859_1000433493 | 308 |
| 246 | 3300005719 | Ga0068861_100056447 | Ga0068861_1000564473 | 308 |
| 247 | 3300005841 | Ga0068863_100064602 | Ga0068863_1000646024 | 308 |
| 248 | 3300005842 | Ga0068858_100003268 | Ga0068858_10000326810 | 308 |
| 249 | 3300005844 | Ga0068862_100078290 | Ga0068862_1000782903 | 308 |
| 250 | 3300006931 | Ga0097620_100043349 | Ga0097620_1000433493 | 308 |
| 251 | 3300009098 | Ga0105245_10132030 | Ga0105245_101320303 | 308 |
| 252 | 3300009148 | Ga0105243_10012496 | Ga0105243_100124966 | 308 |
| 253 | 3300009177 | Ga0105248_10002329 | Ga0105248_100023292 | 308 |
| 254 | 3300013308 | Ga0157375_10404840 | Ga0157375_104048402 | 308 |
| 255 | 3300014326 | Ga0157380_10029046 | Ga0157380_100290462 | 308 |
| 256 | 3300014968 | Ga0157379_10092136 | Ga0157379_100921363 | 308 |
| 257 | 3300025903 | Ga0207680_10002290 | Ga0207680_100022907 | 308 |
| 258 | 3300025907 | Ga0207645_10026109 | Ga0207645_100261093 | 308 |
| 259 | 3300025919 | Ga0207657_10121598 | Ga0207657_101215982 | 308 |
| 260 | 3300025927 | Ga0207687_10124263 | Ga0207687_101242632 | 308 |
| 261 | 3300025931 | Ga0207644_10124998 | Ga0207644_101249982 | 308 |
| 262 | 3300025935 | Ga0207709_10079737 | Ga0207709_100797372 | 308 |
| 263 | 3300025937 | Ga0207669_10028092 | Ga0207669_100280922 | 308 |
| 264 | 3300025940 | Ga0207691_10224851 | Ga0207691_102248512 | 308 |
| 265 | 3300025941 | Ga0207711_10009784 | Ga0207711_100097847 | 308 |
| 266 | 3300025960 | Ga0207651_10000682 | Ga0207651_100006827 | 308 |
| 267 | 3300025972 | Ga0207668_10031352 | Ga0207668_100313523 | 308 |
| 268 | 3300025986 | Ga0207658_10006366 | Ga0207658_100063663 | 308 |
| 269 | 3300026023 | Ga0207677_10003055 | Ga0207677_100030559 | 308 |
| 270 | 3300026035 | Ga0207703_10001023 | Ga0207703_1000102317 | 308 |
| 271 | 3300026088 | Ga0207641_10017142 | Ga0207641_100171424 | 308 |
| 272 | 3300026089 | Ga0207648_10065845 | Ga0207648_100658454 | 308 |
| 273 | 3300026118 | Ga0207675_100079482 | Ga0207675_1000794823 | 308 |
| 274 | 3300028380 | Ga0268265_10068622 | Ga0268265_100686222 | 308 |
| 275 | 3300048915 | Ga0496112_0238037 | Ga0496112_0238037_301_1386 | 308 |
| 276 | 3300031548 | Ga0307408_100129971 | Ga0307408_1001299711 | 309 |
| 277 | 3300031901 | Ga0307406_10028172 | Ga0307406_100281723 | 309 |
| 278 | 3300035111 | Ga0373923_0000465 | Ga0373923_0000465_2280_3368 | 309 |
| 279 | 3300035172 | Ga0373955_0000926 | Ga0373955_0000926_528_1616 | 309 |
| 280 | 3300036401 | Ga0373937_0001611 | Ga0373937_0001611_13606_14694 | 309 |
| 281 | 3300046525 | Ga0495663_0055378 | Ga0495663_0055378_46_1167 | 309 |
| 282 | 3300048088 | Ga0495602_0024757 | Ga0495602_0024757_2248_3336 | 309 |
| 283 | 3300005367 | Ga0070667_100104381 | Ga0070667_1001043812 | 310 |
| 284 | 3300005456 | Ga0070678_100168690 | Ga0070678_1001686902 | 310 |
| 285 | 3300025933 | Ga0207706_10348468 | Ga0207706_103484681 | 310 |
| 286 | 3300037471 | Ga0395905_0023867 | Ga0395905_0023867_652_1740 | 310 |
| 287 | 3300053116 | Ga0500592_001260 | Ga0500592_001260_1245_2303 | 310 |
| 288 | 3300005563 | Ga0068855_100353734 | Ga0068855_1003537342 | 311 |
| 289 | 3300005564 | Ga0070664_100054466 | Ga0070664_1000544662 | 311 |
| 290 | 3300013297 | Ga0157378_10027821 | Ga0157378_100278215 | 311 |
| 291 | 3300013308 | Ga0157375_10327537 | Ga0157375_103275372 | 311 |
| 292 | 3300025893 | Ga0207682_10001342 | Ga0207682_100013424 | 311 |
| 293 | 3300025919 | Ga0207657_10137451 | Ga0207657_101374512 | 311 |
| 294 | 3300025945 | Ga0207679_10095794 | Ga0207679_100957942 | 311 |
| 295 | 3300025949 | Ga0207667_10418995 | Ga0207667_104189951 | 311 |
| 296 | 3300026142 | Ga0207698_10202002 | Ga0207698_102020022 | 311 |
| 297 | 3300037312 | Ga0395899_0000863 | Ga0395899_0000863_26014_27126 | 311 |
| 298 | 3300037418 | Ga0395900_0136865 | Ga0395900_0136865_616_1728 | 311 |
| 299 | 3300037466 | Ga0395898_0008363 | Ga0395898_0008363_8832_9944 | 311 |
| 300 | 3300037471 | Ga0395905_0004872 | Ga0395905_0004872_2323_3435 | 311 |
| 301 | 3300037471 | Ga0395905_0090170 | Ga0395905_0090170_1178_2284 | 311 |
| 302 | 3300038443 | Ga0395901_0012896 | Ga0395901_0012896_5169_6281 | 311 |
| 303 | 3300038443 | Ga0395901_0015390 | Ga0395901_0015390_937_2028 | 311 |
| 304 | 3300044683 | Ga0466965_0024251 | Ga0466965_0024251_858_2066 | 311 |
| 305 | 3300048915 | Ga0496112_0012362 | Ga0496112_0012362_6094_7206 | 311 |
| 306 | 3300048916 | Ga0496113_0003738 | Ga0496113_0003738_5235_6347 | 311 |
| 307 | 3300053094 | Ga0500566_0001818 | Ga0500566_0001818_1264_2409 | 311 |
| 308 | 3300005355 | Ga0070671_100087402 | Ga0070671_1000874022 | 312 |
| 309 | 3300005364 | Ga0070673_100081757 | Ga0070673_1000817572 | 312 |
| 310 | 3300005548 | Ga0070665_100000011 | Ga0070665_100000011260 | 312 |
| 311 | 3300005614 | Ga0068856_100277098 | Ga0068856_1002770982 | 312 |
| 312 | 3300005616 | Ga0068852_100416214 | Ga0068852_1004162141 | 312 |
| 313 | 3300005834 | Ga0068851_10031150 | Ga0068851_100311502 | 312 |
| 314 | 3300006846 | Ga0075430_100022234 | Ga0075430_1000222345 | 312 |
| 315 | 3300025933 | Ga0207706_10017293 | Ga0207706_100172935 | 312 |
| 316 | 3300025938 | Ga0207704_10020304 | Ga0207704_100203044 | 312 |
| 317 | 3300025940 | Ga0207691_10082266 | Ga0207691_100822663 | 312 |
| 318 | 3300025941 | Ga0207711_10074092 | Ga0207711_100740922 | 312 |
| 319 | 3300026121 | Ga0207683_10078010 | Ga0207683_100780102 | 312 |
| 320 | 3300028379 | Ga0268266_10000063 | Ga0268266_10000063258 | 312 |
| 321 | 3300037312 | Ga0395899_0000113 | Ga0395899_0000113_80279_81388 | 312 |
| 322 | 3300037418 | Ga0395900_0000365 | Ga0395900_0000365_58161_59270 | 312 |
| 323 | 3300037466 | Ga0395898_0000306 | Ga0395898_0000306_34553_35662 | 312 |
| 324 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_279514_280623 | 312 |
| 325 | 3300038443 | Ga0395901_0053070 | Ga0395901_0053070_137_1246 | 312 |
| 326 | 3300044683 | Ga0466965_0076255 | Ga0466965_0076255_113_1216 | 312 |
| 327 | 3300044684 | Ga0466966_0094455 | Ga0466966_0094455_740_1843 | 312 |
| 328 | 3300044693 | Ga0466961_0008389 | Ga0466961_0008389_2889_3992 | 312 |
| 329 | 3300044765 | Ga0466970_0027354 | Ga0466970_0027354_885_1988 | 312 |
| 330 | 3300044842 | Ga0466957_0022471 | Ga0466957_0022471_1139_2242 | 312 |
| 331 | 3300050509 | nmdc:mga0qj67_17871_c1 | nmdc:mga0qj67_17871_c1_1950_3014 | 312 |
| 332 | 3300005329 | Ga0070683_100002224 | Ga0070683_1000022242 | 313 |
| 333 | 3300005353 | Ga0070669_100164225 | Ga0070669_1001642252 | 313 |
| 334 | 3300005355 | Ga0070671_100022964 | Ga0070671_1000229641 | 313 |
| 335 | 3300005367 | Ga0070667_100003828 | Ga0070667_1000038285 | 313 |
| 336 | 3300005543 | Ga0070672_100283600 | Ga0070672_1002836002 | 313 |
| 337 | 3300005617 | Ga0068859_100000487 | Ga0068859_10000048710 | 313 |
| 338 | 3300005618 | Ga0068864_100000920 | Ga0068864_10000092016 | 313 |
| 339 | 3300005841 | Ga0068863_100000728 | Ga0068863_10000072825 | 313 |
| 340 | 3300005842 | Ga0068858_100000731 | Ga0068858_1000007315 | 313 |
| 341 | 3300005843 | Ga0068860_100031544 | Ga0068860_1000315445 | 313 |
| 342 | 3300006931 | Ga0097620_100000487 | Ga0097620_10000048728 | 313 |
| 343 | 3300009092 | Ga0105250_10002933 | Ga0105250_100029334 | 313 |
| 344 | 3300013306 | Ga0163162_10006429 | Ga0163162_100064293 | 313 |
| 345 | 3300014325 | Ga0163163_10000282 | Ga0163163_100002824 | 313 |
| 346 | 3300014968 | Ga0157379_10017232 | Ga0157379_100172325 | 313 |
| 347 | 3300025321 | Ga0207656_10017929 | Ga0207656_100179293 | 313 |
| 348 | 3300025893 | Ga0207682_10000234 | Ga0207682_1000023425 | 313 |
| 349 | 3300025909 | Ga0207705_10052867 | Ga0207705_100528672 | 313 |
| 350 | 3300025923 | Ga0207681_10058505 | Ga0207681_100585053 | 313 |
| 351 | 3300025931 | Ga0207644_10006853 | Ga0207644_100068533 | 313 |
| 352 | 3300025931 | Ga0207644_10016213 | Ga0207644_100162135 | 313 |
| 353 | 3300025940 | Ga0207691_10290908 | Ga0207691_102909082 | 313 |
| 354 | 3300025981 | Ga0207640_10221207 | Ga0207640_102212072 | 313 |
| 355 | 3300025986 | Ga0207658_10016915 | Ga0207658_100169154 | 313 |
| 356 | 3300025986 | Ga0207658_10140163 | Ga0207658_101401632 | 313 |
| 357 | 3300026078 | Ga0207702_10041646 | Ga0207702_100416464 | 313 |
| 358 | 3300026088 | Ga0207641_10000330 | Ga0207641_100003308 | 313 |
| 359 | 3300026095 | Ga0207676_10000766 | Ga0207676_100007662 | 313 |
| 360 | 3300028381 | Ga0268264_10001177 | Ga0268264_100011775 | 313 |
| 361 | 3300031852 | Ga0307410_10067449 | Ga0307410_100674493 | 313 |
| 362 | 3300032005 | Ga0307411_10111172 | Ga0307411_101111722 | 313 |
| 363 | 3300041498 | Ga0451841_1394347 | Ga0451841_1394347_26_1069 | 313 |
| 364 | 3300048911 | Ga0496108_0010291 | Ga0496108_0010291_501_1616 | 313 |
| 365 | 3300048912 | Ga0496109_0003092 | Ga0496109_0003092_796_1911 | 313 |
| 366 | 3300048913 | Ga0496110_0073493 | Ga0496110_0073493_49_1164 | 313 |
| 367 | 3300048914 | Ga0496111_0036678 | Ga0496111_0036678_179_1294 | 313 |
| 368 | 3300048915 | Ga0496112_0067829 | Ga0496112_0067829_1016_2131 | 313 |
| 369 | 3300048916 | Ga0496113_0044196 | Ga0496113_0044196_796_1911 | 313 |
| 370 | 3300005617 | Ga0068859_100252352 | Ga0068859_1002523522 | 314 |
| 371 | 3300006931 | Ga0097620_100252350 | Ga0097620_1002523502 | 314 |
| 372 | 3300009101 | Ga0105247_10003834 | Ga0105247_100038348 | 314 |
| 373 | 3300009551 | Ga0105238_10325688 | Ga0105238_103256882 | 314 |
| 374 | 3300025941 | Ga0207711_10001361 | Ga0207711_100013615 | 314 |
| 375 | 3300025986 | Ga0207658_10009023 | Ga0207658_100090237 | 314 |
| 376 | 3300031824 | Ga0307413_10150824 | Ga0307413_101508242 | 314 |
| 377 | 3300031852 | Ga0307410_10089472 | Ga0307410_100894722 | 314 |
| 378 | 3300032005 | Ga0307411_10016686 | Ga0307411_100166863 | 314 |
| 379 | 3300003215 | JGI25153J46596_10003772 | JGI25153J46596_100037724 | 315 |
| 380 | 3300003773 | Ga0055537_1000924 | Ga0055537_100092414 | 315 |
| 381 | 3300003775 | Ga0055524_1000730 | Ga0055524_100073017 | 315 |
| 382 | 3300005262 | Ga0065165_1017140 | Ga0065165_10171403 | 315 |
| 383 | 3300005327 | Ga0070658_10025349 | Ga0070658_100253495 | 315 |
| 384 | 3300005614 | Ga0068856_100083414 | Ga0068856_1000834142 | 315 |
| 385 | 3300013102 | Ga0157371_10015031 | Ga0157371_100150312 | 315 |
| 386 | 3300013306 | Ga0163162_10026182 | Ga0163162_100261824 | 315 |
| 387 | 3300013307 | Ga0157372_10255256 | Ga0157372_102552562 | 315 |
| 388 | 3300013307 | Ga0157372_10406401 | Ga0157372_104064012 | 315 |
| 389 | 3300025245 | Ga0207425_1004074 | Ga0207425_10040742 | 315 |
| 390 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011287 | 315 |
| 391 | 3300025291 | Ga0209675_1019289 | Ga0209675_10192892 | 315 |
| 392 | 3300025297 | Ga0209758_1004364 | Ga0209758_10043646 | 315 |
| 393 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016312 | 315 |
| 394 | 3300025304 | Ga0209257_1000855 | Ga0209257_10008559 | 315 |
| 395 | 3300025929 | Ga0207664_10026596 | Ga0207664_100265963 | 315 |
| 396 | 3300037312 | Ga0395899_0029864 | Ga0395899_0029864_1390_2451 | 315 |
| 397 | 3300037418 | Ga0395900_0054317 | Ga0395900_0054317_1368_2429 | 315 |
| 398 | 3300037471 | Ga0395905_0032743 | Ga0395905_0032743_230_1291 | 315 |
| 399 | 3300048905 | Ga0496102_0022885 | Ga0496102_0022885_1443_2582 | 315 |
| 400 | 3300049758 | Ga0501241_004815 | Ga0501241_004815_468_1586 | 315 |
| 401 | 3300005328 | Ga0070676_10083446 | Ga0070676_100834462 | 316 |
| 402 | 3300005364 | Ga0070673_100003426 | Ga0070673_1000034261 | 316 |
| 403 | 3300005366 | Ga0070659_100029683 | Ga0070659_1000296832 | 316 |
| 404 | 3300005615 | Ga0070702_100083792 | Ga0070702_1000837922 | 316 |
| 405 | 3300005617 | Ga0068859_100083794 | Ga0068859_1000837944 | 316 |
| 406 | 3300006931 | Ga0097620_100083793 | Ga0097620_1000837934 | 316 |
| 407 | 3300041410 | Ga0439461_0000036 | Ga0439461_0000036_6286_7410 | 316 |
| 408 | 3300041411 | Ga0439466_0055198 | Ga0439466_0055198_95_1219 | 316 |
| 409 | 3300041413 | Ga0439465_0001350 | Ga0439465_0001350_5446_6570 | 316 |
| 410 | 3300041997 | Ga0439431_0000119 | Ga0439431_0000119_10355_11479 | 316 |
| 411 | 3300042004 | Ga0439445_0011496 | Ga0439445_0011496_638_1762 | 316 |
| 412 | 3300042006 | Ga0439432_000282 | Ga0439432_000282_11002_12126 | 316 |
| 413 | 3300042015 | Ga0439462_0000311 | Ga0439462_0000311_2408_3532 | 316 |
| 414 | 3300042435 | Ga0439434_0000055 | Ga0439434_0000055_20504_21628 | 316 |
| 415 | 3300045049 | Ga0466959_0096811 | Ga0466959_0096811_38_1147 | 316 |
| 416 | 3300005355 | Ga0070671_100011540 | Ga0070671_1000115407 | 317 |
| 417 | 3300005985 | Ga0081539_10017301 | Ga0081539_100173014 | 317 |
| 418 | 3300044693 | Ga0466961_0051646 | Ga0466961_0051646_366_1487 | 317 |
| 419 | 3300044694 | Ga0466963_0000979 | Ga0466963_0000979_3072_4151 | 317 |
| 420 | 3300044842 | Ga0466957_0003900 | Ga0466957_0003900_977_2056 | 317 |
| 421 | 3300045976 | Ga0466967_0000572 | Ga0466967_0000572_7003_8082 | 317 |
| 422 | 3300045976 | Ga0466967_0068550 | Ga0466967_0068550_847_1935 | 317 |
| 423 | 3300046539 | Ga0495621_0000028 | Ga0495621_0000028_10694_11779 | 317 |
| 424 | 3300046691 | Ga0495670_0050866 | Ga0495670_0050866_68_1153 | 317 |
| 425 | 3300048918 | Ga0496115_0001066 | Ga0496115_0001066_18689_19798 | 317 |
| 426 | iso_pu_bacteria | 2643221622 | 2644127868 | 317 |
| 427 | 3300005985 | Ga0081539_10007522 | Ga0081539_100075224 | 318 |
| 428 | 3300046525 | Ga0495663_0005980 | Ga0495663_0005980_793_1863 | 318 |
| 429 | 3300046660 | Ga0495625_0048066 | Ga0495625_0048066_363_1433 | 318 |
| 430 | 3300048915 | Ga0496112_0054657 | Ga0496112_0054657_2386_3495 | 318 |
| 431 | 3300005457 | Ga0070662_100065479 | Ga0070662_1000654792 | 319 |
| 432 | 3300009177 | Ga0105248_10061948 | Ga0105248_100619483 | 319 |
| 433 | 3300025298 | Ga0209050_1001664 | Ga0209050_100166411 | 319 |
| 434 | 3300025931 | Ga0207644_10270873 | Ga0207644_102708731 | 319 |
| 435 | 3300025933 | Ga0207706_10081556 | Ga0207706_100815562 | 319 |
| 436 | 3300025940 | Ga0207691_10220021 | Ga0207691_102200212 | 319 |
| 437 | 3300025941 | Ga0207711_10063054 | Ga0207711_100630543 | 319 |
| 438 | 3300041410 | Ga0439461_0003134 | Ga0439461_0003134_939_2069 | 319 |
| 439 | 3300041997 | Ga0439431_0011182 | Ga0439431_0011182_819_1949 | 319 |
| 440 | 3300042014 | Ga0439457_003868 | Ga0439457_003868_1857_2987 | 319 |
| 441 | 3300044693 | Ga0466961_0012712 | Ga0466961_0012712_1107_2207 | 319 |
| 442 | 3300044694 | Ga0466963_0015252 | Ga0466963_0015252_3452_4552 | 319 |
| 443 | 3300044719 | Ga0466971_0008303 | Ga0466971_0008303_132_1232 | 319 |
| 444 | 3300044842 | Ga0466957_0022885 | Ga0466957_0022885_1737_2837 | 319 |
| 445 | 3300045836 | Ga0466958_0013478 | Ga0466958_0013478_71_1171 | 319 |
| 446 | 3300045976 | Ga0466967_0189648 | Ga0466967_0189648_143_1243 | 319 |
| 447 | 3300046539 | Ga0495621_0000752 | Ga0495621_0000752_6786_7874 | 319 |
| 448 | 3300046539 | Ga0495621_0039011 | Ga0495621_0039011_396_1487 | 319 |
| 449 | 3300048911 | Ga0496108_0001972 | Ga0496108_0001972_12166_13263 | 319 |
| 450 | 3300048915 | Ga0496112_0030698 | Ga0496112_0030698_3449_4549 | 319 |
| 451 | 3300061719 | Ga0466962_0004307 | Ga0466962_0004307_3292_4392 | 319 |
| 452 | 3300005577 | Ga0068857_100098067 | Ga0068857_1000980672 | 320 |
| 453 | 3300009177 | Ga0105248_10412866 | Ga0105248_104128662 | 320 |
| 454 | 3300009553 | Ga0105249_10030644 | Ga0105249_100306444 | 320 |
| 455 | 3300013308 | Ga0157375_10107506 | Ga0157375_101075062 | 320 |
| 456 | 3300025912 | Ga0207707_10081646 | Ga0207707_100816461 | 320 |
| 457 | 3300025920 | Ga0207649_10004548 | Ga0207649_100045483 | 320 |
| 458 | 3300025924 | Ga0207694_10000966 | Ga0207694_1000096610 | 320 |
| 459 | 3300025932 | Ga0207690_10010422 | Ga0207690_100104224 | 320 |
| 460 | 3300025941 | Ga0207711_10116360 | Ga0207711_101163602 | 320 |
| 461 | 3300026041 | Ga0207639_10000744 | Ga0207639_1000074413 | 320 |
| 462 | 3300026116 | Ga0207674_10003445 | Ga0207674_100034459 | 320 |
| 463 | 3300041407 | Ga0439447_013311 | Ga0439447_013311_1106_2239 | 320 |
| 464 | 3300042006 | Ga0439432_009123 | Ga0439432_009123_1582_2715 | 320 |
| 465 | 3300042015 | Ga0439462_0005301 | Ga0439462_0005301_1327_2460 | 320 |
| 466 | 3300042531 | Ga0450918_012757 | Ga0450918_012757_22_1155 | 320 |
| 467 | 3300048910 | Ga0496107_0150147 | Ga0496107_0150147_177_1262 | 320 |
| 468 | 3300048917 | Ga0496114_0044906 | Ga0496114_0044906_1680_2765 | 320 |
| 469 | iso_pu_bacteria | 2818991466 | 2819715716 | 320 |
| 470 | iso_pu_bacteria | 2928526807 | 2928529731 | 320 |
| 471 | 3300005327 | Ga0070658_10042543 | Ga0070658_100425432 | 321 |
| 472 | 3300005535 | Ga0070684_100003490 | Ga0070684_10000349010 | 321 |
| 473 | 3300005543 | Ga0070672_100185635 | Ga0070672_1001856352 | 321 |
| 474 | 3300005617 | Ga0068859_100008392 | Ga0068859_10000839210 | 321 |
| 475 | 3300005841 | Ga0068863_100062887 | Ga0068863_1000628872 | 321 |
| 476 | 3300005843 | Ga0068860_100000609 | Ga0068860_10000060929 | 321 |
| 477 | 3300005844 | Ga0068862_100000099 | Ga0068862_10000009933 | 321 |
| 478 | 3300006931 | Ga0097620_100008392 | Ga0097620_10000839210 | 321 |
| 479 | 3300009553 | Ga0105249_10000086 | Ga0105249_1000008697 | 321 |
| 480 | 3300013105 | Ga0157369_10053230 | Ga0157369_100532304 | 321 |
| 481 | 3300025900 | Ga0207710_10002163 | Ga0207710_100021638 | 321 |
| 482 | 3300025931 | Ga0207644_10076175 | Ga0207644_100761752 | 321 |
| 483 | 3300025944 | Ga0207661_10243805 | Ga0207661_102438051 | 321 |
| 484 | 3300025961 | Ga0207712_10000026 | Ga0207712_1000002637 | 321 |
| 485 | 3300026088 | Ga0207641_10004528 | Ga0207641_100045286 | 321 |
| 486 | 3300028380 | Ga0268265_10000084 | Ga0268265_10000084102 | 321 |
| 487 | 3300028381 | Ga0268264_10017924 | Ga0268264_100179245 | 321 |
| 488 | 3300031548 | Ga0307408_100009467 | Ga0307408_1000094675 | 321 |
| 489 | 3300031731 | Ga0307405_10135370 | Ga0307405_101353702 | 321 |
| 490 | 3300031824 | Ga0307413_10072322 | Ga0307413_100723222 | 321 |
| 491 | 3300031901 | Ga0307406_10078109 | Ga0307406_100781092 | 321 |
| 492 | 3300031901 | Ga0307406_10218645 | Ga0307406_102186452 | 321 |
| 493 | 3300031911 | Ga0307412_10055893 | Ga0307412_100558933 | 321 |
| 494 | 3300037418 | Ga0395900_0005399 | Ga0395900_0005399_4046_5128 | 321 |
| 495 | 3300037466 | Ga0395898_0123787 | Ga0395898_0123787_843_1925 | 321 |
| 496 | 3300037471 | Ga0395905_0198813 | Ga0395905_0198813_618_1700 | 321 |
| 497 | 3300038443 | Ga0395901_0031351 | Ga0395901_0031351_3263_4345 | 321 |
| 498 | 3300045976 | Ga0466967_0250886 | Ga0466967_0250886_18_1115 | 321 |
| 499 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_306607_307701 | 321 |
| 500 | 3300005355 | Ga0070671_100002642 | Ga0070671_10000264215 | 322 |
| 501 | 3300005356 | Ga0070674_100048967 | Ga0070674_1000489672 | 322 |
| 502 | 3300005456 | Ga0070678_100007589 | Ga0070678_1000075892 | 322 |
| 503 | 3300005457 | Ga0070662_100069807 | Ga0070662_1000698072 | 322 |
| 504 | 3300005563 | Ga0068855_100078867 | Ga0068855_1000788672 | 322 |
| 505 | 3300005616 | Ga0068852_100001069 | Ga0068852_10000106910 | 322 |
| 506 | 3300013102 | Ga0157371_10010189 | Ga0157371_100101894 | 322 |
| 507 | 3300013104 | Ga0157370_10222457 | Ga0157370_102224572 | 322 |
| 508 | 3300013307 | Ga0157372_10195152 | Ga0157372_101951522 | 322 |
| 509 | 3300020082 | Ga0206353_10738842 | Ga0206353_107388424 | 322 |
| 510 | 3300025919 | Ga0207657_10075582 | Ga0207657_100755823 | 322 |
| 511 | 3300025931 | Ga0207644_10037495 | Ga0207644_100374953 | 322 |
| 512 | 3300025933 | Ga0207706_10009899 | Ga0207706_100098998 | 322 |
| 513 | 3300025937 | Ga0207669_10034091 | Ga0207669_100340913 | 322 |
| 514 | 3300025949 | Ga0207667_10044308 | Ga0207667_100443082 | 322 |
| 515 | 3300026121 | Ga0207683_10046220 | Ga0207683_100462204 | 322 |
| 516 | 3300026142 | Ga0207698_10001922 | Ga0207698_100019222 | 322 |
| 517 | 3300031824 | Ga0307413_10013931 | Ga0307413_100139313 | 322 |
| 518 | 3300031903 | Ga0307407_10025052 | Ga0307407_100250523 | 322 |
| 519 | 3300031911 | Ga0307412_10062484 | Ga0307412_100624843 | 322 |
| 520 | 3300032002 | Ga0307416_100010727 | Ga0307416_1000107274 | 322 |
| 521 | 3300032002 | Ga0307416_100104386 | Ga0307416_1001043862 | 322 |
| 522 | 3300032004 | Ga0307414_10031677 | Ga0307414_100316773 | 322 |
| 523 | 3300032126 | Ga0307415_100065897 | Ga0307415_1000658972 | 322 |
| 524 | 3300037471 | Ga0395905_0008189 | Ga0395905_0008189_3859_4938 | 322 |
| 525 | 3300038443 | Ga0395901_0040351 | Ga0395901_0040351_1312_2391 | 322 |
| 526 | 3300046684 | Ga0495669_0000249 | Ga0495669_0000249_26132_27202 | 322 |
| 527 | 3300005339 | Ga0070660_100002925 | Ga0070660_1000029252 | 323 |
| 528 | 3300005339 | Ga0070660_100036166 | Ga0070660_1000361663 | 323 |
| 529 | 3300005353 | Ga0070669_100009121 | Ga0070669_1000091211 | 323 |
| 530 | 3300005353 | Ga0070669_100072860 | Ga0070669_1000728602 | 323 |
| 531 | 3300005354 | Ga0070675_100005923 | Ga0070675_1000059233 | 323 |
| 532 | 3300005356 | Ga0070674_100086316 | Ga0070674_1000863162 | 323 |
| 533 | 3300005366 | Ga0070659_100000058 | Ga0070659_10000005865 | 323 |
| 534 | 3300005366 | Ga0070659_100031921 | Ga0070659_1000319213 | 323 |
| 535 | 3300005457 | Ga0070662_100006400 | Ga0070662_1000064003 | 323 |
| 536 | 3300025919 | Ga0207657_10003294 | Ga0207657_100032942 | 323 |
| 537 | 3300025919 | Ga0207657_10098143 | Ga0207657_100981433 | 323 |
| 538 | 3300025923 | Ga0207681_10060067 | Ga0207681_100600672 | 323 |
| 539 | 3300025932 | Ga0207690_10000070 | Ga0207690_1000007019 | 323 |
| 540 | 3300025932 | Ga0207690_10146802 | Ga0207690_101468021 | 323 |
| 541 | 3300025960 | Ga0207651_10140133 | Ga0207651_101401332 | 323 |
| 542 | 3300026035 | Ga0207703_10088471 | Ga0207703_100884712 | 323 |
| 543 | 3300031995 | Ga0307409_100218706 | Ga0307409_1002187062 | 323 |
| 544 | 3300037312 | Ga0395899_0181086 | Ga0395899_0181086_24_1085 | 323 |
| 545 | 3300038443 | Ga0395901_0240391 | Ga0395901_0240391_65_1150 | 323 |
| 546 | 3300044656 | Ga0466969_0073819 | Ga0466969_0073819_266_1372 | 323 |
| 547 | 3300044693 | Ga0466961_0014128 | Ga0466961_0014128_1927_3033 | 323 |
| 548 | 3300045049 | Ga0466959_0049984 | Ga0466959_0049984_1916_3022 | 323 |
| 549 | 3300053134 | Ga0500658_0000107 | Ga0500658_0000107_25594_26670 | 323 |
| 550 | 3300005331 | Ga0070670_100001116 | Ga0070670_10000111617 | 324 |
| 551 | 3300005335 | Ga0070666_10003130 | Ga0070666_100031305 | 324 |
| 552 | 3300005339 | Ga0070660_100046066 | Ga0070660_1000460664 | 324 |
| 553 | 3300005344 | Ga0070661_100003253 | Ga0070661_1000032539 | 324 |
| 554 | 3300005354 | Ga0070675_100024999 | Ga0070675_1000249992 | 324 |
| 555 | 3300005355 | Ga0070671_100182807 | Ga0070671_1001828072 | 324 |
| 556 | 3300005366 | Ga0070659_100012039 | Ga0070659_1000120395 | 324 |
| 557 | 3300005367 | Ga0070667_100013181 | Ga0070667_1000131812 | 324 |
| 558 | 3300005456 | Ga0070678_100015993 | Ga0070678_1000159935 | 324 |
| 559 | 3300005457 | Ga0070662_100004200 | Ga0070662_1000042007 | 324 |
| 560 | 3300005539 | Ga0068853_100010905 | Ga0068853_1000109054 | 324 |
| 561 | 3300005543 | Ga0070672_100001197 | Ga0070672_10000119710 | 324 |
| 562 | 3300005548 | Ga0070665_100023846 | Ga0070665_1000238463 | 324 |
| 563 | 3300005563 | Ga0068855_100080553 | Ga0068855_1000805534 | 324 |
| 564 | 3300005564 | Ga0070664_100005566 | Ga0070664_1000055664 | 324 |
| 565 | 3300005578 | Ga0068854_100009459 | Ga0068854_1000094595 | 324 |
| 566 | 3300005616 | Ga0068852_100041457 | Ga0068852_1000414573 | 324 |
| 567 | 3300005834 | Ga0068851_10053309 | Ga0068851_100533092 | 324 |
| 568 | 3300005842 | Ga0068858_100002211 | Ga0068858_1000022117 | 324 |
| 569 | 3300006358 | Ga0068871_100014165 | Ga0068871_1000141653 | 324 |
| 570 | 3300009093 | Ga0105240_10030247 | Ga0105240_100302472 | 324 |
| 571 | 3300009177 | Ga0105248_10004234 | Ga0105248_100042348 | 324 |
| 572 | 3300010375 | Ga0105239_10076264 | Ga0105239_100762644 | 324 |
| 573 | 3300013104 | Ga0157370_10027662 | Ga0157370_100276625 | 324 |
| 574 | 3300013105 | Ga0157369_10077017 | Ga0157369_100770171 | 324 |
| 575 | 3300013105 | Ga0157369_10171362 | Ga0157369_101713622 | 324 |
| 576 | 3300013296 | Ga0157374_10002929 | Ga0157374_100029292 | 324 |
| 577 | 3300013306 | Ga0163162_10001881 | Ga0163162_1000188112 | 324 |
| 578 | 3300013307 | Ga0157372_10008752 | Ga0157372_100087526 | 324 |
| 579 | 3300013308 | Ga0157375_10001389 | Ga0157375_100013895 | 324 |
| 580 | 3300013308 | Ga0157375_10368055 | Ga0157375_103680552 | 324 |
| 581 | 3300025893 | Ga0207682_10010773 | Ga0207682_100107732 | 324 |
| 582 | 3300025903 | Ga0207680_10021427 | Ga0207680_100214272 | 324 |
| 583 | 3300025912 | Ga0207707_10199577 | Ga0207707_101995771 | 324 |
| 584 | 3300025919 | Ga0207657_10038499 | Ga0207657_100384992 | 324 |
| 585 | 3300025920 | Ga0207649_10033740 | Ga0207649_100337403 | 324 |
| 586 | 3300025925 | Ga0207650_10013604 | Ga0207650_100136044 | 324 |
| 587 | 3300025925 | Ga0207650_10030515 | Ga0207650_100305153 | 324 |
| 588 | 3300025926 | Ga0207659_10008560 | Ga0207659_100085603 | 324 |
| 589 | 3300025926 | Ga0207659_10114038 | Ga0207659_101140382 | 324 |
| 590 | 3300025931 | Ga0207644_10000461 | Ga0207644_1000046125 | 324 |
| 591 | 3300025933 | Ga0207706_10000822 | Ga0207706_1000082216 | 324 |
| 592 | 3300025933 | Ga0207706_10012790 | Ga0207706_100127906 | 324 |
| 593 | 3300025937 | Ga0207669_10011766 | Ga0207669_100117663 | 324 |
| 594 | 3300025937 | Ga0207669_10083795 | Ga0207669_100837952 | 324 |
| 595 | 3300025937 | Ga0207669_10245710 | Ga0207669_102457101 | 324 |
| 596 | 3300025940 | Ga0207691_10001576 | Ga0207691_1000157610 | 324 |
| 597 | 3300025941 | Ga0207711_10004575 | Ga0207711_100045753 | 324 |
| 598 | 3300025945 | Ga0207679_10042322 | Ga0207679_100423224 | 324 |
| 599 | 3300025960 | Ga0207651_10002938 | Ga0207651_100029385 | 324 |
| 600 | 3300025986 | Ga0207658_10016216 | Ga0207658_100162165 | 324 |
| 601 | 3300026035 | Ga0207703_10007375 | Ga0207703_100073758 | 324 |
| 602 | 3300026088 | Ga0207641_10019325 | Ga0207641_100193254 | 324 |
| 603 | 3300026095 | Ga0207676_10003091 | Ga0207676_100030918 | 324 |
| 604 | 3300026121 | Ga0207683_10012349 | Ga0207683_100123494 | 324 |
| 605 | 3300026142 | Ga0207698_10022095 | Ga0207698_100220955 | 324 |
| 606 | 3300026142 | Ga0207698_10029725 | Ga0207698_100297251 | 324 |
| 607 | 3300028379 | Ga0268266_10077616 | Ga0268266_100776163 | 324 |
| 608 | 3300032004 | Ga0307414_10139044 | Ga0307414_101390442 | 324 |
| 609 | 3300037418 | Ga0395900_0031802 | Ga0395900_0031802_803_1891 | 324 |
| 610 | 3300037471 | Ga0395905_0002386 | Ga0395905_0002386_18538_19626 | 324 |
| 611 | 3300044842 | Ga0466957_0104013 | Ga0466957_0104013_157_1269 | 324 |
| 612 | 3300045976 | Ga0466967_0047448 | Ga0466967_0047448_2093_3175 | 324 |
| 613 | 3300048911 | Ga0496108_0005497 | Ga0496108_0005497_4075_5154 | 324 |
| 614 | 3300048912 | Ga0496109_0229700 | Ga0496109_0229700_82_1161 | 324 |
| 615 | 3300048913 | Ga0496110_0118288 | Ga0496110_0118288_1269_2348 | 324 |
| 616 | 3300048915 | Ga0496112_0221390 | Ga0496112_0221390_586_1665 | 324 |
| 617 | 3300048916 | Ga0496113_0031803 | Ga0496113_0031803_690_1769 | 324 |
| 618 | 3300053157 | Ga0500624_000004 | Ga0500624_000004_182668_183753 | 324 |
| 619 | 3300053178 | Ga0500637_0000006 | Ga0500637_0000006_88375_89460 | 324 |
| 620 | 3300005577 | Ga0068857_100264807 | Ga0068857_1002648071 | 325 |
| 621 | 3300005844 | Ga0068862_100011601 | Ga0068862_1000116016 | 325 |
| 622 | 3300009177 | Ga0105248_10048946 | Ga0105248_100489466 | 325 |
| 623 | 3300013104 | Ga0157370_10109373 | Ga0157370_101093731 | 325 |
| 624 | 3300013105 | Ga0157369_10013190 | Ga0157369_100131908 | 325 |
| 625 | 3300025919 | Ga0207657_10030373 | Ga0207657_100303735 | 325 |
| 626 | 3300025920 | Ga0207649_10065639 | Ga0207649_100656392 | 325 |
| 627 | 3300025941 | Ga0207711_10359957 | Ga0207711_103599572 | 325 |
| 628 | 3300026116 | Ga0207674_10054949 | Ga0207674_100549493 | 325 |
| 629 | 3300028380 | Ga0268265_10018905 | Ga0268265_100189052 | 325 |
| 630 | 3300031824 | Ga0307413_10000374 | Ga0307413_1000037413 | 325 |
| 631 | 3300031852 | Ga0307410_10045930 | Ga0307410_100459302 | 325 |
| 632 | 3300031911 | Ga0307412_10027986 | Ga0307412_100279863 | 325 |
| 633 | 3300031995 | Ga0307409_100004347 | Ga0307409_1000043475 | 325 |
| 634 | 3300032002 | Ga0307416_100067626 | Ga0307416_1000676262 | 325 |
| 635 | 3300032005 | Ga0307411_10033754 | Ga0307411_100337543 | 325 |
| 636 | 3300032126 | Ga0307415_100003554 | Ga0307415_1000035544 | 325 |
| 637 | 3300037312 | Ga0395899_0127872 | Ga0395899_0127872_645_1736 | 325 |
| 638 | 3300037418 | Ga0395900_0003475 | Ga0395900_0003475_8094_9185 | 325 |
| 639 | 3300037471 | Ga0395905_0001994 | Ga0395905_0001994_6948_8039 | 325 |
| 640 | 3300038443 | Ga0395901_0002629 | Ga0395901_0002629_353_1444 | 325 |
| 641 | 3300044842 | Ga0466957_0018798 | Ga0466957_0018798_1123_2220 | 325 |
| 642 | 3300045976 | Ga0466967_0196353 | Ga0466967_0196353_276_1370 | 325 |
| 643 | 3300001991 | JGI24743J22301_10013314 | JGI24743J22301_100133142 | 326 |
| 644 | 3300005335 | Ga0070666_10007590 | Ga0070666_100075902 | 326 |
| 645 | 3300005345 | Ga0070692_10010375 | Ga0070692_100103752 | 326 |
| 646 | 3300005364 | Ga0070673_100125943 | Ga0070673_1001259432 | 326 |
| 647 | 3300005539 | Ga0068853_100086204 | Ga0068853_1000862043 | 326 |
| 648 | 3300005545 | Ga0070695_100102079 | Ga0070695_1001020792 | 326 |
| 649 | 3300005548 | Ga0070665_100032634 | Ga0070665_1000326345 | 326 |
| 650 | 3300005549 | Ga0070704_100033792 | Ga0070704_1000337922 | 326 |
| 651 | 3300005578 | Ga0068854_100169984 | Ga0068854_1001699842 | 326 |
| 652 | 3300005842 | Ga0068858_100015728 | Ga0068858_1000157287 | 326 |
| 653 | 3300005843 | Ga0068860_100058733 | Ga0068860_1000587333 | 326 |
| 654 | 3300006844 | Ga0075428_100355861 | Ga0075428_1003558612 | 326 |
| 655 | 3300009093 | Ga0105240_10105591 | Ga0105240_101055913 | 326 |
| 656 | 3300009094 | Ga0111539_10176165 | Ga0111539_101761653 | 326 |
| 657 | 3300009098 | Ga0105245_10039003 | Ga0105245_100390034 | 326 |
| 658 | 3300009553 | Ga0105249_10348498 | Ga0105249_103484982 | 326 |
| 659 | 3300013100 | Ga0157373_10071726 | Ga0157373_100717263 | 326 |
| 660 | 3300013307 | Ga0157372_10241343 | Ga0157372_102413432 | 326 |
| 661 | 3300013308 | Ga0157375_10039078 | Ga0157375_100390782 | 326 |
| 662 | 3300025903 | Ga0207680_10160460 | Ga0207680_101604602 | 326 |
| 663 | 3300025904 | Ga0207647_10001596 | Ga0207647_100015965 | 326 |
| 664 | 3300025919 | Ga0207657_10022239 | Ga0207657_100222394 | 326 |
| 665 | 3300025933 | Ga0207706_10126893 | Ga0207706_101268932 | 326 |
| 666 | 3300025940 | Ga0207691_10052907 | Ga0207691_100529072 | 326 |
| 667 | 3300025942 | Ga0207689_10015623 | Ga0207689_100156235 | 326 |
| 668 | 3300025960 | Ga0207651_10194657 | Ga0207651_101946572 | 326 |
| 669 | 3300025972 | Ga0207668_10190124 | Ga0207668_101901242 | 326 |
| 670 | 3300025986 | Ga0207658_10015960 | Ga0207658_100159604 | 326 |
| 671 | 3300026116 | Ga0207674_10049792 | Ga0207674_100497923 | 326 |
| 672 | 3300028379 | Ga0268266_10001577 | Ga0268266_1000157710 | 326 |
| 673 | 3300028380 | Ga0268265_10005886 | Ga0268265_100058862 | 326 |
| 674 | 3300028381 | Ga0268264_10003029 | Ga0268264_100030294 | 326 |
| 675 | 3300028381 | Ga0268264_10060717 | Ga0268264_100607173 | 326 |
| 676 | 3300031824 | Ga0307413_10002779 | Ga0307413_100027793 | 326 |
| 677 | 3300031852 | Ga0307410_10003938 | Ga0307410_100039384 | 326 |
| 678 | 3300031911 | Ga0307412_10082769 | Ga0307412_100827692 | 326 |
| 679 | 3300031995 | Ga0307409_100012395 | Ga0307409_1000123952 | 326 |
| 680 | 3300032004 | Ga0307414_10003552 | Ga0307414_100035525 | 326 |
| 681 | 3300032005 | Ga0307411_10008143 | Ga0307411_100081434 | 326 |
| 682 | 3300037312 | Ga0395899_0013449 | Ga0395899_0013449_3742_4812 | 326 |
| 683 | 3300037418 | Ga0395900_0019037 | Ga0395900_0019037_4740_5849 | 326 |
| 684 | 3300037418 | Ga0395900_0086406 | Ga0395900_0086406_434_1504 | 326 |
| 685 | 3300037466 | Ga0395898_0126312 | Ga0395898_0126312_217_1326 | 326 |
| 686 | 3300037471 | Ga0395905_0146763 | Ga0395905_0146763_756_1865 | 326 |
| 687 | 3300038443 | Ga0395901_0403270 | Ga0395901_0403270_224_1333 | 326 |
| 688 | 3300044693 | Ga0466961_0020768 | Ga0466961_0020768_485_1585 | 326 |
| 689 | 3300044706 | Ga0466964_0004254 | Ga0466964_0004254_1573_2673 | 326 |
| 690 | 3300044735 | Ga0466968_0006372 | Ga0466968_0006372_362_1462 | 326 |
| 691 | 3300044765 | Ga0466970_0010890 | Ga0466970_0010890_964_2064 | 326 |
| 692 | 3300045836 | Ga0466958_0023134 | Ga0466958_0023134_20_1120 | 326 |
| 693 | 3300050515 | nmdc:mga0a205_871_c1 | nmdc:mga0a205_871_c1_18013_19086 | 326 |
| 694 | 3300050516 | nmdc:mga0sz30_62273_c1 | nmdc:mga0sz30_62273_c1_287_1369 | 326 |
| 695 | 3300002075 | JGI24738J21930_10006708 | JGI24738J21930_100067083 | 327 |
| 696 | 3300005331 | Ga0070670_100004640 | Ga0070670_1000046408 | 327 |
| 697 | 3300005335 | Ga0070666_10183949 | Ga0070666_101839492 | 327 |
| 698 | 3300005339 | Ga0070660_100021913 | Ga0070660_1000219133 | 327 |
| 699 | 3300005345 | Ga0070692_10001731 | Ga0070692_100017316 | 327 |
| 700 | 3300005364 | Ga0070673_100013563 | Ga0070673_1000135634 | 327 |
| 701 | 3300005367 | Ga0070667_100006209 | Ga0070667_1000062092 | 327 |
| 702 | 3300005367 | Ga0070667_100063727 | Ga0070667_1000637272 | 327 |
| 703 | 3300005457 | Ga0070662_100056426 | Ga0070662_1000564261 | 327 |
| 704 | 3300005841 | Ga0068863_100197821 | Ga0068863_1001978212 | 327 |
| 705 | 3300013102 | Ga0157371_10026783 | Ga0157371_100267833 | 327 |
| 706 | 3300013307 | Ga0157372_10028944 | Ga0157372_100289442 | 327 |
| 707 | 3300025909 | Ga0207705_10158301 | Ga0207705_101583012 | 327 |
| 708 | 3300025933 | Ga0207706_10004770 | Ga0207706_100047702 | 327 |
| 709 | 3300025960 | Ga0207651_10144874 | Ga0207651_101448742 | 327 |
| 710 | 3300025986 | Ga0207658_10024751 | Ga0207658_100247512 | 327 |
| 711 | 3300026088 | Ga0207641_10123948 | Ga0207641_101239482 | 327 |
| 712 | 3300026116 | Ga0207674_10003128 | Ga0207674_1000312825 | 327 |
| 713 | 3300031824 | Ga0307413_10042830 | Ga0307413_100428302 | 327 |
| 714 | 3300031852 | Ga0307410_10000330 | Ga0307410_1000033011 | 327 |
| 715 | 3300031903 | Ga0307407_10111934 | Ga0307407_101119342 | 327 |
| 716 | 3300032004 | Ga0307414_10004525 | Ga0307414_100045258 | 327 |
| 717 | 3300032004 | Ga0307414_10123475 | Ga0307414_101234752 | 327 |
| 718 | 3300037471 | Ga0395905_0025498 | Ga0395905_0025498_1486_2571 | 327 |
| 719 | 3300049583 | Ga0501067_0008761 | Ga0501067_0008761_3000_4079 | 327 |
| 720 | 3300049584 | Ga0501068_0106968 | Ga0501068_0106968_460_1539 | 327 |
| 721 | 3300049742 | Ga0501080_0041816 | Ga0501080_0041816_781_1851 | 327 |
| 722 | 3300001989 | JGI24739J22299_10000306 | JGI24739J22299_1000030612 | 328 |
| 723 | 3300001990 | JGI24737J22298_10000049 | JGI24737J22298_1000004919 | 328 |
| 724 | 3300002067 | JGI24735J21928_10026800 | JGI24735J21928_100268002 | 328 |
| 725 | 3300002073 | JGI24745J21846_1001888 | JGI24745J21846_10018882 | 328 |
| 726 | 3300002075 | JGI24738J21930_10000024 | JGI24738J21930_1000002412 | 328 |
| 727 | 3300002244 | JGI24742J22300_10020299 | JGI24742J22300_100202991 | 328 |
| 728 | 3300005328 | Ga0070676_10010686 | Ga0070676_100106864 | 328 |
| 729 | 3300005331 | Ga0070670_100020135 | Ga0070670_1000201354 | 328 |
| 730 | 3300005333 | Ga0070677_10012208 | Ga0070677_100122084 | 328 |
| 731 | 3300005334 | Ga0068869_100000033 | Ga0068869_10000003320 | 328 |
| 732 | 3300005335 | Ga0070666_10040687 | Ga0070666_100406873 | 328 |
| 733 | 3300005338 | Ga0068868_100000099 | Ga0068868_10000009935 | 328 |
| 734 | 3300005340 | Ga0070689_100003667 | Ga0070689_1000036679 | 328 |
| 735 | 3300005343 | Ga0070687_100075266 | Ga0070687_1000752662 | 328 |
| 736 | 3300005344 | Ga0070661_100015402 | Ga0070661_1000154023 | 328 |
| 737 | 3300005347 | Ga0070668_100013195 | Ga0070668_1000131957 | 328 |
| 738 | 3300005353 | Ga0070669_100000414 | Ga0070669_10000041421 | 328 |
| 739 | 3300005354 | Ga0070675_100082521 | Ga0070675_1000825213 | 328 |
| 740 | 3300005355 | Ga0070671_100107702 | Ga0070671_1001077022 | 328 |
| 741 | 3300005364 | Ga0070673_100000136 | Ga0070673_10000013629 | 328 |
| 742 | 3300005366 | Ga0070659_100001334 | Ga0070659_10000133412 | 328 |
| 743 | 3300005367 | Ga0070667_100003948 | Ga0070667_10000394814 | 328 |
| 744 | 3300005456 | Ga0070678_100141912 | Ga0070678_1001419122 | 328 |
| 745 | 3300005457 | Ga0070662_100000571 | Ga0070662_1000005719 | 328 |
| 746 | 3300005459 | Ga0068867_100000243 | Ga0068867_10000024316 | 328 |
| 747 | 3300005539 | Ga0068853_100001263 | Ga0068853_10000126310 | 328 |
| 748 | 3300005543 | Ga0070672_100001681 | Ga0070672_1000016818 | 328 |
| 749 | 3300005543 | Ga0070672_100119051 | Ga0070672_1001190512 | 328 |
| 750 | 3300005547 | Ga0070693_100085512 | Ga0070693_1000855122 | 328 |
| 751 | 3300005563 | Ga0068855_100002389 | Ga0068855_10000238919 | 328 |
| 752 | 3300005577 | Ga0068857_100000527 | Ga0068857_1000005274 | 328 |
| 753 | 3300005578 | Ga0068854_100000214 | Ga0068854_10000021422 | 328 |
| 754 | 3300005616 | Ga0068852_100000235 | Ga0068852_10000023519 | 328 |
| 755 | 3300005617 | Ga0068859_100017035 | Ga0068859_1000170353 | 328 |
| 756 | 3300005618 | Ga0068864_100000156 | Ga0068864_10000015640 | 328 |
| 757 | 3300005840 | Ga0068870_10110614 | Ga0068870_101106142 | 328 |
| 758 | 3300005841 | Ga0068863_100028419 | Ga0068863_1000284194 | 328 |
| 759 | 3300005841 | Ga0068863_100064005 | Ga0068863_1000640052 | 328 |
| 760 | 3300005843 | Ga0068860_100000516 | Ga0068860_10000051650 | 328 |
| 761 | 3300005844 | Ga0068862_100028077 | Ga0068862_1000280772 | 328 |
| 762 | 3300006847 | Ga0075431_100011843 | Ga0075431_1000118432 | 328 |
| 763 | 3300006881 | Ga0068865_100000518 | Ga0068865_10000051812 | 328 |
| 764 | 3300006931 | Ga0097620_100017035 | Ga0097620_1000170353 | 328 |
| 765 | 3300009098 | Ga0105245_10000068 | Ga0105245_1000006842 | 328 |
| 766 | 3300009177 | Ga0105248_10003826 | Ga0105248_1000382613 | 328 |
| 767 | 3300009551 | Ga0105238_10127732 | Ga0105238_101277322 | 328 |
| 768 | 3300011119 | Ga0105246_10018628 | Ga0105246_100186284 | 328 |
| 769 | 3300013100 | Ga0157373_10019319 | Ga0157373_100193192 | 328 |
| 770 | 3300013102 | Ga0157371_10003433 | Ga0157371_100034331 | 328 |
| 771 | 3300013297 | Ga0157378_10002566 | Ga0157378_100025662 | 328 |
| 772 | 3300013307 | Ga0157372_10106485 | Ga0157372_101064853 | 328 |
| 773 | 3300014745 | Ga0157377_10002887 | Ga0157377_100028877 | 328 |
| 774 | 3300025315 | Ga0207697_10000100 | Ga0207697_1000010038 | 328 |
| 775 | 3300025901 | Ga0207688_10004766 | Ga0207688_100047665 | 328 |
| 776 | 3300025903 | Ga0207680_10128223 | Ga0207680_101282232 | 328 |
| 777 | 3300025904 | Ga0207647_10000369 | Ga0207647_1000036919 | 328 |
| 778 | 3300025907 | Ga0207645_10015453 | Ga0207645_100154534 | 328 |
| 779 | 3300025909 | Ga0207705_10001718 | Ga0207705_100017187 | 328 |
| 780 | 3300025918 | Ga0207662_10047846 | Ga0207662_100478465 | 328 |
| 781 | 3300025919 | Ga0207657_10000975 | Ga0207657_1000097528 | 328 |
| 782 | 3300025920 | Ga0207649_10043021 | Ga0207649_100430213 | 328 |
| 783 | 3300025923 | Ga0207681_10000720 | Ga0207681_100007208 | 328 |
| 784 | 3300025924 | Ga0207694_10106869 | Ga0207694_101068692 | 328 |
| 785 | 3300025925 | Ga0207650_10017500 | Ga0207650_100175003 | 328 |
| 786 | 3300025926 | Ga0207659_10055966 | Ga0207659_100559663 | 328 |
| 787 | 3300025927 | Ga0207687_10000257 | Ga0207687_1000025739 | 328 |
| 788 | 3300025931 | Ga0207644_10101050 | Ga0207644_101010502 | 328 |
| 789 | 3300025932 | Ga0207690_10000589 | Ga0207690_100005899 | 328 |
| 790 | 3300025933 | Ga0207706_10000932 | Ga0207706_1000093219 | 328 |
| 791 | 3300025938 | Ga0207704_10006836 | Ga0207704_100068364 | 328 |
| 792 | 3300025940 | Ga0207691_10003706 | Ga0207691_100037067 | 328 |
| 793 | 3300025940 | Ga0207691_10204200 | Ga0207691_102042002 | 328 |
| 794 | 3300025941 | Ga0207711_10002091 | Ga0207711_1000209115 | 328 |
| 795 | 3300025942 | Ga0207689_10000131 | Ga0207689_1000013151 | 328 |
| 796 | 3300025945 | Ga0207679_10023093 | Ga0207679_100230933 | 328 |
| 797 | 3300025949 | Ga0207667_10012623 | Ga0207667_1001262310 | 328 |
| 798 | 3300025960 | Ga0207651_10000065 | Ga0207651_1000006513 | 328 |
| 799 | 3300025972 | Ga0207668_10009397 | Ga0207668_100093972 | 328 |
| 800 | 3300025981 | Ga0207640_10000462 | Ga0207640_100004629 | 328 |
| 801 | 3300025986 | Ga0207658_10011629 | Ga0207658_100116295 | 328 |
| 802 | 3300026023 | Ga0207677_10000306 | Ga0207677_1000030621 | 328 |
| 803 | 3300026067 | Ga0207678_10044737 | Ga0207678_100447373 | 328 |
| 804 | 3300026088 | Ga0207641_10002702 | Ga0207641_1000270212 | 328 |
| 805 | 3300026089 | Ga0207648_10001272 | Ga0207648_1000127215 | 328 |
| 806 | 3300026095 | Ga0207676_10000519 | Ga0207676_1000051931 | 328 |
| 807 | 3300026116 | Ga0207674_10001456 | Ga0207674_1000145628 | 328 |
| 808 | 3300026142 | Ga0207698_10005605 | Ga0207698_100056058 | 328 |
| 809 | 3300028380 | Ga0268265_10016066 | Ga0268265_100160662 | 328 |
| 810 | 3300031824 | Ga0307413_10018108 | Ga0307413_100181082 | 328 |
| 811 | 3300031824 | Ga0307413_10064851 | Ga0307413_100648513 | 328 |
| 812 | 3300031824 | Ga0307413_10180524 | Ga0307413_101805242 | 328 |
| 813 | 3300031852 | Ga0307410_10013584 | Ga0307410_100135844 | 328 |
| 814 | 3300031903 | Ga0307407_10006616 | Ga0307407_100066163 | 328 |
| 815 | 3300031911 | Ga0307412_10015128 | Ga0307412_100151284 | 328 |
| 816 | 3300031995 | Ga0307409_100069016 | Ga0307409_1000690162 | 328 |
| 817 | 3300032004 | Ga0307414_10020831 | Ga0307414_100208314 | 328 |
| 818 | 3300032004 | Ga0307414_10047777 | Ga0307414_100477773 | 328 |
| 819 | 3300032005 | Ga0307411_10017056 | Ga0307411_100170562 | 328 |
| 820 | 3300032005 | Ga0307411_10025189 | Ga0307411_100251893 | 328 |
| 821 | 3300032126 | Ga0307415_100316558 | Ga0307415_1003165582 | 328 |
| 822 | 3300005327 | Ga0070658_10228926 | Ga0070658_102289261 | 329 |
| 823 | 3300005344 | Ga0070661_100034524 | Ga0070661_1000345244 | 329 |
| 824 | 3300005354 | Ga0070675_100002420 | Ga0070675_1000024203 | 329 |
| 825 | 3300005355 | Ga0070671_100028055 | Ga0070671_1000280553 | 329 |
| 826 | 3300005364 | Ga0070673_100015478 | Ga0070673_1000154786 | 329 |
| 827 | 3300005366 | Ga0070659_100204312 | Ga0070659_1002043121 | 329 |
| 828 | 3300005367 | Ga0070667_100035221 | Ga0070667_1000352213 | 329 |
| 829 | 3300005367 | Ga0070667_100035278 | Ga0070667_1000352782 | 329 |
| 830 | 3300005435 | Ga0070714_100130542 | Ga0070714_1001305422 | 329 |
| 831 | 3300005436 | Ga0070713_100005100 | Ga0070713_1000051006 | 329 |
| 832 | 3300005455 | Ga0070663_100049456 | Ga0070663_1000494563 | 329 |
| 833 | 3300005457 | Ga0070662_100055374 | Ga0070662_1000553743 | 329 |
| 834 | 3300005543 | Ga0070672_100006817 | Ga0070672_1000068177 | 329 |
| 835 | 3300005546 | Ga0070696_100037866 | Ga0070696_1000378662 | 329 |
| 836 | 3300005546 | Ga0070696_100048160 | Ga0070696_1000481603 | 329 |
| 837 | 3300005548 | Ga0070665_100064330 | Ga0070665_1000643302 | 329 |
| 838 | 3300005563 | Ga0068855_100020473 | Ga0068855_1000204736 | 329 |
| 839 | 3300005564 | Ga0070664_100002014 | Ga0070664_1000020145 | 329 |
| 840 | 3300005564 | Ga0070664_100115048 | Ga0070664_1001150483 | 329 |
| 841 | 3300005577 | Ga0068857_100003804 | Ga0068857_10000380416 | 329 |
| 842 | 3300005614 | Ga0068856_100090091 | Ga0068856_1000900912 | 329 |
| 843 | 3300005618 | Ga0068864_100037639 | Ga0068864_1000376393 | 329 |
| 844 | 3300005618 | Ga0068864_100067060 | Ga0068864_1000670603 | 329 |
| 845 | 3300005841 | Ga0068863_100209643 | Ga0068863_1002096431 | 329 |
| 846 | 3300009177 | Ga0105248_10108402 | Ga0105248_101084022 | 329 |
| 847 | 3300009177 | Ga0105248_10129959 | Ga0105248_101299593 | 329 |
| 848 | 3300011119 | Ga0105246_10126932 | Ga0105246_101269322 | 329 |
| 849 | 3300014325 | Ga0163163_10084744 | Ga0163163_100847442 | 329 |
| 850 | 3300025909 | Ga0207705_10124247 | Ga0207705_101242472 | 329 |
| 851 | 3300025914 | Ga0207671_10012102 | Ga0207671_100121022 | 329 |
| 852 | 3300025920 | Ga0207649_10060836 | Ga0207649_100608361 | 329 |
| 853 | 3300025925 | Ga0207650_10065528 | Ga0207650_100655282 | 329 |
| 854 | 3300025928 | Ga0207700_10017679 | Ga0207700_100176793 | 329 |
| 855 | 3300025931 | Ga0207644_10030881 | Ga0207644_100308812 | 329 |
| 856 | 3300025931 | Ga0207644_10159069 | Ga0207644_101590691 | 329 |
| 857 | 3300025940 | Ga0207691_10006074 | Ga0207691_100060746 | 329 |
| 858 | 3300025941 | Ga0207711_10094166 | Ga0207711_100941663 | 329 |
| 859 | 3300025945 | Ga0207679_10066590 | Ga0207679_100665902 | 329 |
| 860 | 3300025949 | Ga0207667_10072965 | Ga0207667_100729653 | 329 |
| 861 | 3300025960 | Ga0207651_10080599 | Ga0207651_100805992 | 329 |
| 862 | 3300025986 | Ga0207658_10039167 | Ga0207658_100391673 | 329 |
| 863 | 3300025986 | Ga0207658_10064991 | Ga0207658_100649913 | 329 |
| 864 | 3300026035 | Ga0207703_10267873 | Ga0207703_102678732 | 329 |
| 865 | 3300026088 | Ga0207641_10051480 | Ga0207641_100514803 | 329 |
| 866 | 3300026116 | Ga0207674_10001471 | Ga0207674_1000147115 | 329 |
| 867 | 3300028379 | Ga0268266_10134810 | Ga0268266_101348102 | 329 |
| 868 | 3300037418 | Ga0395900_0001813 | Ga0395900_0001813_14381_15556 | 329 |
| 869 | 3300037418 | Ga0395900_0014179 | Ga0395900_0014179_3437_4513 | 329 |
| 870 | 3300037471 | Ga0395905_0000559 | Ga0395905_0000559_14441_15616 | 329 |
| 871 | 3300037471 | Ga0395905_0082003 | Ga0395905_0082003_132_1211 | 329 |
| 872 | 3300038443 | Ga0395901_0000310 | Ga0395901_0000310_22493_23569 | 329 |
| 873 | 3300044658 | Ga0466972_0007995 | Ga0466972_0007995_87_1187 | 329 |
| 874 | 3300046684 | Ga0495669_0002086 | Ga0495669_0002086_681_1772 | 329 |
| 875 | 3300048903 | Ga0496100_0028868 | Ga0496100_0028868_1371_2450 | 329 |
| 876 | 3300048904 | Ga0496101_0132500 | Ga0496101_0132500_339_1418 | 329 |
| 877 | 3300048905 | Ga0496102_0146888 | Ga0496102_0146888_1064_2143 | 329 |
| 878 | 3300048907 | Ga0496104_0077176 | Ga0496104_0077176_565_1644 | 329 |
| 879 | 3300048909 | Ga0496106_0003270 | Ga0496106_0003270_7011_8090 | 329 |
| 880 | 3300048910 | Ga0496107_0039067 | Ga0496107_0039067_300_1379 | 329 |
| 881 | 3300048913 | Ga0496110_0025309 | Ga0496110_0025309_2253_3344 | 329 |
| 882 | 3300048914 | Ga0496111_0020457 | Ga0496111_0020457_2575_3654 | 329 |
| 883 | 3300048914 | Ga0496111_0036441 | Ga0496111_0036441_1687_2778 | 329 |
| 884 | 3300048916 | Ga0496113_0017009 | Ga0496113_0017009_2168_3247 | 329 |
| 885 | 3300053083 | Ga0495655_0012687 | Ga0495655_0012687_449_1531 | 329 |
| 886 | 3300005347 | Ga0070668_100018180 | Ga0070668_1000181804 | 330 |
| 887 | 3300005459 | Ga0068867_100039626 | Ga0068867_1000396263 | 330 |
| 888 | 3300005539 | Ga0068853_100048599 | Ga0068853_1000485992 | 330 |
| 889 | 3300005616 | Ga0068852_100093268 | Ga0068852_1000932682 | 330 |
| 890 | 3300005834 | Ga0068851_10023967 | Ga0068851_100239673 | 330 |
| 891 | 3300025321 | Ga0207656_10010223 | Ga0207656_100102234 | 330 |
| 892 | 3300025907 | Ga0207645_10055236 | Ga0207645_100552362 | 330 |
| 893 | 3300025972 | Ga0207668_10024798 | Ga0207668_100247983 | 330 |
| 894 | 3300026041 | Ga0207639_10051496 | Ga0207639_100514962 | 330 |
| 895 | 3300026089 | Ga0207648_10052659 | Ga0207648_100526593 | 330 |
| 896 | 3300026142 | Ga0207698_10071065 | Ga0207698_100710653 | 330 |
| 897 | 3300037471 | Ga0395905_0102311 | Ga0395905_0102311_493_1584 | 330 |
| 898 | 3300038443 | Ga0395901_0181632 | Ga0395901_0181632_489_1565 | 330 |
| 899 | 3300001979 | JGI24740J21852_10002747 | JGI24740J21852_100027474 | 331 |
| 900 | 3300005327 | Ga0070658_10008389 | Ga0070658_100083892 | 331 |
| 901 | 3300005331 | Ga0070670_100064393 | Ga0070670_1000643934 | 331 |
| 902 | 3300005344 | Ga0070661_100132896 | Ga0070661_1001328962 | 331 |
| 903 | 3300005355 | Ga0070671_100031460 | Ga0070671_1000314604 | 331 |
| 904 | 3300005535 | Ga0070684_100241989 | Ga0070684_1002419892 | 331 |
| 905 | 3300005564 | Ga0070664_100013138 | Ga0070664_1000131385 | 331 |
| 906 | 3300005564 | Ga0070664_100044210 | Ga0070664_1000442103 | 331 |
| 907 | 3300005578 | Ga0068854_100006294 | Ga0068854_1000062942 | 331 |
| 908 | 3300025919 | Ga0207657_10003473 | Ga0207657_100034738 | 331 |
| 909 | 3300025945 | Ga0207679_10043955 | Ga0207679_100439552 | 331 |
| 910 | 3300025945 | Ga0207679_10271226 | Ga0207679_102712261 | 331 |
| 911 | 3300025981 | Ga0207640_10152368 | Ga0207640_101523682 | 331 |
| 912 | 3300026041 | Ga0207639_10004853 | Ga0207639_100048534 | 331 |
| 913 | 3300026067 | Ga0207678_10000879 | Ga0207678_1000087913 | 331 |
| 914 | 3300028379 | Ga0268266_10037907 | Ga0268266_100379072 | 331 |
| 915 | 3300037312 | Ga0395899_0013565 | Ga0395899_0013565_1246_2334 | 331 |
| 916 | 3300037418 | Ga0395900_0024613 | Ga0395900_0024613_298_1386 | 331 |
| 917 | 3300038443 | Ga0395901_0049272 | Ga0395901_0049272_658_1746 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar