metagRoot

F485631

General Info

Members	Datasets	Scaffolds	Average Seq Length
916	579	600	291

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2894817345\|2894820409
Length	308
Sequence	RFILALGCATMLAGATPASADDKLKVVASFSVLGDVVREVGGSHVDVSTLIGPNGDPHEYEPAPDDAKRLRDAQVVFVSGLGLEGFMDRLVKASGFKGEPVVASANIKPLDLEEEAGHDHNHEGHDHGHEHDVDPHVWNDPKNVESWVGVIEQALAKADPSQAESFKTNAARYTAELQKLDAFAKAEIGKTPKENRRILTSHDAFGYFGAAYGVTFLSPVGLSTESEASARDVAKLIDQIKAEKIRTYFFENSNDPRLVRQIAQATGAEPGGELYVESLSGPDGPASTYAKMFRHNVELVAGALSRTN

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
3	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
4	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
5	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
6	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
7	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
8	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
9	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
10	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
11	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
12	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
13	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
14	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
15	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
16	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
17	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
18	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
19	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
20	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
21	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
22	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
23	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
24	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
25	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
26	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
27	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
28	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
29	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
30	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
31	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
32	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
33	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
34	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
35	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
36	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
37	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
38	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
39	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
40	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
41	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
42	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
43	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
44	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
45	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
46	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
47	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
48	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
49	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
50	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
51	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
52	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
53	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
54	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
55	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
56	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
57	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
58	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
59	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
60	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
61	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
62	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
63	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
64	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
65	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
66	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
67	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
68	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
69	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
70	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
71	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
72	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
73	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
74	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
75	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
76	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
77	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
78	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
79	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
80	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
81	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
82	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
83	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
84	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
85	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
86	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
87	2718217882	Rhizobium sp. N741	Isolate	Nodule
88	2718217927	Rhizobium sp. N324	Isolate	Nodule
89	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
90	2718218009	Rhizobium sp. N561	Isolate	Nodule
91	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
92	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
93	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
94	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
95	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
96	2718218363	Rhizobium sp. N113	Isolate	Nodule
97	2718218365	Rhizobium sp. N731	Isolate	Nodule
98	2718218366	Rhizobium sp. N621	Isolate	Nodule
99	2718218423	Rhizobium sp. N941	Isolate	Nodule
100	2721755514	Rhizobium sp. N6212	Isolate	Nodule
101	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
102	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
103	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
104	2721755809	Rhizobium sp. N541	Isolate	Nodule
105	2721755810	Rhizobium sp. N871	Isolate	Nodule
106	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
107	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
108	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
109	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
110	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
111	2728369365	Rhizobium sp. N1341	Isolate	Nodule
112	2728369397	Rhizobium sp. N1314	Isolate	Nodule
113	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
114	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
115	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
116	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
117	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
118	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
119	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
120	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
121	2791355256	Rhizobium sp. M10	Isolate	Nodule
122	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
123	2791355260	Rhizobium sp. L9	Isolate	Nodule
124	2791355261	Rhizobium sp. J15	Isolate	Nodule
125	2791355262	Rhizobium sp. M1	Isolate	Nodule
126	2791355263	Rhizobium chutanense C5	Isolate	Nodule
127	2791355264	Rhizobium sp. S9	Isolate	Nodule
128	2791355265	Rhizobium sp. H4	Isolate	Nodule
129	2791355266	Rhizobium sp. L43	Isolate	Nodule
130	2791355267	Rhizobium sp. L18	Isolate	Nodule
131	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
132	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
133	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
134	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
135	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
136	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
137	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
138	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
139	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
140	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
141	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
142	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
143	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
144	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
145	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
146	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
147	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
148	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
149	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
150	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
151	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
152	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
153	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
154	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
155	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
156	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
157	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
158	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
159	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
160	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
161	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
162	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
163	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
164	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
165	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
166	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
167	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
168	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
169	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
170	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
171	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
172	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
173	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
174	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
175	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
176	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
177	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
178	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
179	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
180	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
181	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
182	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
183	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
184	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
185	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
186	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
187	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
188	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
189	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
190	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
191	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
192	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
193	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
194	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
195	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
196	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
197	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
198	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
199	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
200	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
201	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
202	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
203	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
204	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
205	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
206	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
207	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
208	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
209	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
210	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
211	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
212	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
213	2847085930	Erwinia persicina B64	Isolate	Bulb
214	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
215	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
216	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
217	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
218	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
219	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
220	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
221	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
222	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
223	2876601092	Pantoea endophytica 596	Isolate	Unclassified
224	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
225	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
226	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
227	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
228	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
229	2900051742	Pectobacterium zantedeschiae 2M	Isolate	Stem Tuber
230	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
231	2904504865	Serratia marcescens 1822	Isolate	Unclassified
232	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
233	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
234	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
235	2919150387	Rahnella aceris 1817	Isolate	Unclassified
236	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
237	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
238	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
239	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
240	2927143783	Rahnella sp. 2050	Isolate	Unclassified
241	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
242	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
243	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
244	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
245	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
246	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
247	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
248	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
249	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
250	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
251	2937967321	Serratia sp. YC16	Isolate	Unclassified
252	2939577877	Serratia sp. 509	Isolate	Rhizosphere
253	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
254	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
255	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
256	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
257	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
258	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
259	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
260	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
261	2996887358	Rhizobium sp. R711	Isolate	Nodule
262	2996893221	Rhizobium sp. R635	Isolate	Nodule
263	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
264	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
265	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
266	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
267	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
268	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
269	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
270	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
271	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
272	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
273	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
274	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
275	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
276	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
277	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
278	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
279	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
280	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
281	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
282	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
283	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
284	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
285	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
286	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
287	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
288	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
289	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
290	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
291	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
292	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
293	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
294	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
295	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
296	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
297	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
298	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
299	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
300	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
301	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
302	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
303	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
304	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
305	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
306	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
307	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
308	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
309	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
310	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
311	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
312	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
313	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
314	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
315	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
316	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
317	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
318	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
319	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
320	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
321	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
322	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
323	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
324	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
325	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
326	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
327	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
328	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
329	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
330	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
331	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
332	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
333	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
334	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
335	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
336	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
337	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
338	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
339	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
340	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
341	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
342	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
343	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
344	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
345	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
346	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
347	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
348	3300009763	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix	Metagenome	Nodule
349	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
350	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
351	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
352	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
353	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
354	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
355	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
356	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
357	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
358	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
359	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
360	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
361	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
362	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
363	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
364	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
365	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
366	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
367	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
368	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
369	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
370	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
371	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
372	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
373	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
374	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
375	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
376	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
377	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
378	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
379	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
380	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
381	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
382	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
383	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
384	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
385	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
386	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
387	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
388	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
389	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
390	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
391	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
411	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
414	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
415	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
416	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
417	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
418	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
419	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
420	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
421	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
422	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
423	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
424	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
425	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
426	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
427	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
428	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
429	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
430	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
431	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
432	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
433	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
434	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
435	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
436	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
437	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
438	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
439	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
440	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
441	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
442	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
443	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
444	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
445	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
446	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
447	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
448	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
449	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
450	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
451	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
452	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
453	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
454	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
455	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
456	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
457	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
458	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
459	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
460	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
461	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
462	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
463	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
464	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
465	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
466	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
467	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
468	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
469	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
470	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
471	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
472	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
473	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
474	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
475	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
476	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
477	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
478	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
479	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
480	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
481	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
482	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
483	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
484	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
485	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
486	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
487	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
488	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
489	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
490	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
491	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
492	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
493	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
494	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
495	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
496	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
497	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
498	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
499	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
500	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
501	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
503	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
504	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
505	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
506	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
507	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
508	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
509	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
510	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
511	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
512	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
513	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
514	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
515	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
516	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
517	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
518	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
519	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
520	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
521	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
522	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
523	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
524	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
525	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
526	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
527	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
528	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
529	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
530	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
531	640753048	Serratia proteamaculans 568	Isolate	Endosphere
532	8004592986	Serratia sp. S119	Isolate	Unclassified
533	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
534	8005258706	Rhizobium sp. R693	Isolate	Nodule
535	8005275841	Rhizobium sp. N4311	Isolate	Nodule
536	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
537	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
538	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
539	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
540	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
541	8005321885	Rhizobium sp. R72	Isolate	Nodule
542	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
543	8005382845	Rhizobium sp. R634	Isolate	Nodule
544	8005395548	Rhizobium sp. R339	Isolate	Nodule
545	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
546	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
547	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
548	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
549	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
550	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
551	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
552	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
553	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
554	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
555	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
556	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
557	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
558	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
559	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
560	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
561	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
562	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
563	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
564	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
565	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
566	8018176218	Rhizobium sp. N122	Isolate	Nodule
567	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
568	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
569	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
570	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
571	8024501048	Rhizobium sp. H4	Isolate	Nodule
572	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
573	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
574	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
575	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
576	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
577	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
578	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
579	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	65.5
Metatranscriptomes	0
Isolates	34.5

Biome Distribution

Category	Percentage (%)
Aerial Root	0.33
Bulb	0.11
Endosphere	19.43
Nodule	21.07
Rhizoplane	3.17
Rhizosphere	35.15
Stem	0
Stem Tuber	0.55
Unclassified	20.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1608559	2162886007	Bacteria	5209
2	JGI24740J21852_10000381	3300001979	Bacteria	19024
3	JGI24739J22299_10000806	3300001989	Bacteria	11467
4	JGI25155J39150_1000006	3300002704	Bacteria	244109
5	JGI25156J39149_1000019	3300002705	Bacteria	160845
6	JGI25162J39368_1000003	3300002737	Bacteria	575218
7	JGI25162J39368_1000266	3300002737	Bacteria	50234
8	JGI25162J39368_1002807	3300002737	Bacteria	6110
9	JGI25162J39368_1002826	3300002737	Bacteria	6068
10	JGI25154J39366_1000055	3300002738	Bacteria	115597
11	JGI25158J39367_1003851	3300002739	Bacteria	2282
12	JGI25157J39369_1000024	3300002741	Bacteria	160844
13	JGI25163J39215_1000015	3300002771	Bacteria	83621
14	JGI25164J39214_1000009	3300002772	Bacteria	303437
15	JGI25152J39213_1001438	3300002773	Bacteria	10266
16	JGI25152J39213_1002121	3300002773	Bacteria	7781
17	JGI25152J39213_1002372	3300002773	Bacteria	7227
18	JGI25152J39213_1002384	3300002773	Bacteria	7190
19	JGI25152J39213_1002526	3300002773	Bacteria	6897
20	JGI25152J39213_1003623	3300002773	Bacteria	5218
21	JGI25150J39212_1000393	3300002774	Bacteria	20736
22	JGI25159J45721_1000114	3300002987	Bacteria	38646
23	JGI25159J45721_1000282	3300002987	Bacteria	23910
24	JGI25151J46595_10000629	3300003187	Bacteria	30634
25	JGI25151J46595_10003518	3300003187	Bacteria	8623
26	JGI25151J46595_10004511	3300003187	Bacteria	7354
27	JGI25151J46595_10018657	3300003187	Bacteria	2969
28	JGI25165J46597_1000702	3300003214	Bacteria	26615
29	JGI25165J46597_1001090	3300003214	Bacteria	17328
30	JGI25165J46597_1007373	3300003214	Bacteria	1834
31	JGI25153J46596_10004222	3300003215	Bacteria	7781
32	JGI25153J46596_10004769	3300003215	Bacteria	7227
33	JGI25153J46596_10007653	3300003215	Bacteria	5268
34	JGI25153J46596_10007976	3300003215	Bacteria	5126
35	JGI25153J46596_10010688	3300003215	Bacteria	4129
36	rootH2_10013369	3300003320	Bacteria	8058
37	rootL2_10024518	3300003322	Bacteria	13529
38	rootH1_10114000	3300003323	Bacteria	1207
39	JGI25160J50197_1000053	3300003354	Bacteria	127632
40	JGI25160J50197_1003064	3300003354	Bacteria	7621
41	JGI25161J50226_1000039	3300003374	Bacteria	127632
42	JGI25161J50226_1000235	3300003374	Bacteria	33663
43	JGI25161J50226_1006127	3300003374	Bacteria	2221
44	Ga0055538_1000005	3300003751	Bacteria	575218
45	Ga0055539_1000007	3300003752	Bacteria	575218
46	Ga0055533_1000009	3300003756	Bacteria	575218
47	Ga0055525_1000010	3300003759	Bacteria	575218
48	Ga0055526_1000370	3300003771	Bacteria	36363
49	Ga0055526_1004419	3300003771	Bacteria	8454
50	Ga0055526_1009515	3300003771	Bacteria	4657
51	Ga0055524_1001510	3300003775	Bacteria	13181
52	Ga0055524_1005682	3300003775	Bacteria	5527
53	Ga0055524_1014098	3300003775	Bacteria	2980
54	Ga0055524_1016636	3300003775	Bacteria	2628
55	Ga0055524_1026349	3300003775	Bacteria	1799
56	Ga0055524_1027822	3300003775	Bacteria	1706
57	Ga0055536_1008626	3300003781	Bacteria	4346
58	Ga0055536_1038577	3300003781	Bacteria	1156
59	Ga0055528_1000462	3300003790	Bacteria	32478
60	Ga0055528_1001272	3300003790	Bacteria	15881
61	Ga0055528_1001662	3300003790	Bacteria	13028
62	Ga0055528_1027170	3300003790	Bacteria	1619
63	Ga0055530_10018359	3300003791	Bacteria	2158
64	Ga0055540_1000353	3300003792	Bacteria	39050
65	Ga0055540_1009694	3300003792	Bacteria	3292
66	Ga0055540_1020074	3300003792	Bacteria	1780
67	Ga0055531_10000882	3300003794	Bacteria	24537
68	Ga0055541_1000005	3300003841	Bacteria	575218
69	Ga0058692_1001067	3300003856	Bacteria	10709
70	Ga0058692_1001381	3300003856	Bacteria	8982
71	Ga0058692_1001672	3300003856	Bacteria	7964
72	Ga0058692_1002841	3300003856	Bacteria	5670
73	Ga0058692_1003283	3300003856	Bacteria	5052
74	Ga0058692_1007699	3300003856	Bacteria	2837
75	Ga0058692_1007718	3300003856	Bacteria	2832
76	Ga0055543_1000015	3300004625	Bacteria	177197
77	Ga0055543_1000033	3300004625	Bacteria	129476
78	Ga0055543_1003199	3300004625	Bacteria	4979
79	Ga0065165_1000361	3300005262	Bacteria	74514
80	Ga0065165_1012743	3300005262	Bacteria	3400
81	Ga0065165_1043132	3300005262	Bacteria	1326
82	Ga0065704_10239387	3300005289	Bacteria	1019
83	Ga0070670_100000105	3300005331	Bacteria	77938
84	Ga0070682_100021900	3300005337	Bacteria	3778
85	Ga0070661_100156540	3300005344	Bacteria	1724
86	Ga0070668_100001974	3300005347	Bacteria	14981
87	Ga0070659_100050337	3300005366	Bacteria	3275
88	Ga0070700_100150901	3300005441	Bacteria	1589
89	Ga0070694_100037549	3300005444	Bacteria	3213
90	Ga0070663_100016889	3300005455	Bacteria	4750
91	Ga0070678_100047798	3300005456	Bacteria	3077
92	Ga0070662_100002901	3300005457	Bacteria	10649
93	Ga0070681_10011052	3300005458	Bacteria	8926
94	Ga0070679_100013244	3300005530	Bacteria	7893
95	Ga0068853_100277046	3300005539	Bacteria	1546
96	Ga0070696_100027635	3300005546	Bacteria	3867
97	Ga0070693_100019320	3300005547	Bacteria	3570
98	Ga0070665_100150669	3300005548	Bacteria	2329
99	Ga0070665_100166870	3300005548	Bacteria	2204
100	Ga0070704_100264740	3300005549	Bacteria	1418
101	Ga0070664_100254775	3300005564	Bacteria	1578
102	Ga0068857_100099301	3300005577	Bacteria	2611
103	Ga0068856_100142263	3300005614	Bacteria	2406
104	Ga0070702_100024184	3300005615	Bacteria	3237
105	Ga0068859_100259403	3300005617	Bacteria	1829
106	Ga0068870_10062742	3300005840	Bacteria	2003
107	Ga0081540_1014373	3300005983	Bacteria	5073
108	Ga0081540_1098174	3300005983	Bacteria	1269
109	Ga0075365_10004157	3300006038	Bacteria	7617
110	Ga0075365_10005512	3300006038	Bacteria	6834
111	Ga0075364_10045437	3300006051	Bacteria	2858
112	Ga0075362_10018305	3300006177	Bacteria	2896
113	Ga0075362_10091813	3300006177	Bacteria	1410
114	Ga0075367_10000427	3300006178	Bacteria	15620
115	Ga0075369_10002856	3300006186	Bacteria	6227
116	Ga0075369_10033306	3300006186	Bacteria	2183
117	Ga0075369_10038513	3300006186	Bacteria	2039
118	Ga0075366_10042042	3300006195	Bacteria	2706
119	Ga0097620_100259401	3300006931	Bacteria	1829
120	Ga0079104_1000288	3300006946	Bacteria	64299
121	Ga0079104_1000583	3300006946	Bacteria	36612
122	Ga0079104_1013299	3300006946	Bacteria	2543
123	Ga0105251_10001543	3300009011	Bacteria	19777
124	Ga0105251_10001666	3300009011	Bacteria	18741
125	Ga0105251_10002277	3300009011	Bacteria	15229
126	Ga0105251_10005164	3300009011	Bacteria	8623
127	Ga0105251_10035618	3300009011	Bacteria	2455
128	Ga0105251_10053589	3300009011	Bacteria	1917
129	Ga0105244_10000048	3300009036	Bacteria	141340
130	Ga0105244_10000414	3300009036	Bacteria	39718
131	Ga0105244_10000675	3300009036	Bacteria	29941
132	Ga0105244_10000964	3300009036	Bacteria	24177
133	Ga0105244_10001774	3300009036	Bacteria	16953
134	Ga0105244_10002388	3300009036	Bacteria	14224
135	Ga0105244_10003574	3300009036	Bacteria	11047
136	Ga0105244_10005739	3300009036	Bacteria	8189
137	Ga0105244_10006625	3300009036	Bacteria	7462
138	Ga0105244_10008641	3300009036	Bacteria	6342
139	Ga0105244_10011964	3300009036	Bacteria	5163
140	Ga0105244_10048855	3300009036	Bacteria	2164
141	Ga0105244_10051216	3300009036	Bacteria	2104
142	Ga0105244_10150892	3300009036	Bacteria	1113
143	Ga0105250_10000003	3300009092	Bacteria	547770
144	Ga0105250_10000143	3300009092	Bacteria	62505
145	Ga0105250_10002510	3300009092	Bacteria	9195
146	Ga0105250_10006232	3300009092	Bacteria	5234
147	Ga0105250_10007039	3300009092	Bacteria	4857
148	Ga0105240_10000027	3300009093	Bacteria	348486
149	Ga0105247_10000192	3300009101	Bacteria	60167
150	Ga0105243_10091305	3300009148	Bacteria	2508
151	Ga0105241_10000004	3300009174	Bacteria	803007
152	Ga0105248_10227363	3300009177	Bacteria	2100
153	Ga0105237_10003539	3300009545	Bacteria	18513
154	Ga0105238_10036717	3300009551	Bacteria	4982
155	Ga0105249_10059134	3300009553	Bacteria	3514
156	Ga0123340_1039218	3300009763	Bacteria	2297
157	Ga0123341_1000098	3300009765	Bacteria	37289
158	Ga0123342_1011467	3300009766	Bacteria	9667
159	Ga0123342_1013091	3300009766	Bacteria	8419
160	Ga0105239_10023413	3300010375	Bacteria	6801
161	Ga0105246_10008452	3300011119	Bacteria	6327
162	Ga0105246_10068129	3300011119	Bacteria	2495
163	Ga0157373_10000201	3300013100	Bacteria	49344
164	Ga0157373_10000465	3300013100	Bacteria	32219
165	Ga0157373_10013195	3300013100	Bacteria	6065
166	Ga0157373_10102684	3300013100	Bacteria	2012
167	Ga0157371_10000007	3300013102	Bacteria	401847
168	Ga0157371_10000352	3300013102	Bacteria	58713
169	Ga0157371_10002201	3300013102	Bacteria	18909
170	Ga0157370_10000048	3300013104	Bacteria	124683
171	Ga0157370_10000122	3300013104	Bacteria	91538
172	Ga0157370_10000557	3300013104	Bacteria	46529
173	Ga0157374_10453904	3300013296	Bacteria	1283
174	Ga0163162_10020008	3300013306	Bacteria	6574
175	Ga0163162_10031809	3300013306	Bacteria	5236
176	Ga0157372_10008056	3300013307	Bacteria	11209
177	Ga0157372_10025977	3300013307	Bacteria	6370
178	Ga0157372_10038079	3300013307	Bacteria	5306
179	Ga0157372_10046585	3300013307	Bacteria	4814
180	Ga0157372_10527608	3300013307	Bacteria	1376
181	Ga0157375_10506017	3300013308	Bacteria	1372
182	Ga0182008_10001572	3300014497	Bacteria	15193
183	Ga0182006_1003226	3300015261	Bacteria	8470
184	Ga0163161_10000004	3300017792	Bacteria	333149
185	Ga0163161_10006578	3300017792	Bacteria	8047
186	Ga0163161_10240991	3300017792	Bacteria	1406
187	Ga0209435_100011	3300025206	Bacteria	413027
188	Ga0209760_100057	3300025207	Bacteria	99434
189	Ga0209436_100002	3300025208	Bacteria	222172
190	Ga0209784_100001	3300025224	Bacteria	3600592
191	Ga0209566_100001	3300025225	Bacteria	3600765
192	Ga0209674_100002	3300025226	Bacteria	3600592
193	Ga0209563_100008	3300025230	Bacteria	1554545
194	Ga0207427_100002	3300025231	Bacteria	1355321
195	Ga0209437_100007	3300025233	Bacteria	938377
196	Ga0209437_100036	3300025233	Bacteria	469153
197	Ga0209437_100086	3300025233	Bacteria	254578
198	Ga0209437_100235	3300025233	Bacteria	92210
199	Ga0207425_1000312	3300025245	Bacteria	35041
200	Ga0207425_1001501	3300025245	Bacteria	9659
201	Ga0207425_1019069	3300025245	Bacteria	1482
202	Ga0207425_1033364	3300025245	Bacteria	1014
203	Ga0209646_1000024	3300025246	Bacteria	413027
204	Ga0209646_1013754	3300025246	Bacteria	1225
205	Ga0209026_1000030	3300025250	Bacteria	329811
206	Ga0209677_100004	3300025253	Bacteria	1554545
207	Ga0209677_100188	3300025253	Bacteria	50341
208	Ga0209759_1000011	3300025256	Bacteria	413027
209	Ga0209129_1000078	3300025258	Bacteria	192880
210	Ga0209129_1000304	3300025258	Bacteria	44743
211	Ga0209129_1000393	3300025258	Bacteria	35041
212	Ga0209129_1000688	3300025258	Bacteria	22158
213	Ga0209129_1000814	3300025258	Bacteria	19660
214	Ga0209129_1002239	3300025258	Bacteria	9667
215	Ga0209129_1002723	3300025258	Bacteria	8277
216	Ga0209233_1000056	3300025261	Bacteria	438104
217	Ga0209233_1000110	3300025261	Bacteria	260825
218	Ga0209233_1000271	3300025261	Bacteria	73658
219	Ga0209233_1012316	3300025261	Bacteria	2484
220	Ga0209673_1000015	3300025273	Bacteria	530618
221	Ga0209673_1000091	3300025273	Bacteria	201875
222	Ga0209673_1003500	3300025273	Bacteria	9209
223	Ga0209673_1007798	3300025273	Bacteria	4862
224	Ga0209673_1008706	3300025273	Bacteria	4487
225	Ga0209673_1017608	3300025273	Bacteria	2629
226	Ga0209673_1017611	3300025273	Bacteria	2629
227	Ga0209673_1031412	3300025273	Bacteria	1653
228	Ga0209130_1000015	3300025284	Bacteria	409631
229	Ga0209130_1000038	3300025284	Bacteria	264226
230	Ga0209675_1018617	3300025291	Bacteria	1938
231	Ga0209676_1032317	3300025292	Bacteria	1576
232	Ga0209025_1000205	3300025294	Bacteria	141452
233	Ga0209025_1000489	3300025294	Bacteria	76167
234	Ga0209025_1000664	3300025294	Bacteria	59562
235	Ga0209025_1001772	3300025294	Bacteria	25723
236	Ga0209025_1004687	3300025294	Bacteria	11675
237	Ga0209025_1005568	3300025294	Bacteria	10203
238	Ga0209025_1041183	3300025294	Bacteria	1983
239	Ga0209564_1000821	3300025295	Bacteria	42300
240	Ga0209564_1001024	3300025295	Bacteria	34391
241	Ga0209564_1002078	3300025295	Bacteria	17199
242	Ga0209564_1003738	3300025295	Bacteria	9953
243	Ga0209564_1010890	3300025295	Bacteria	4137
244	Ga0209758_1000549	3300025297	Bacteria	59562
245	Ga0209758_1000620	3300025297	Bacteria	54509
246	Ga0209758_1001053	3300025297	Bacteria	36113
247	Ga0209758_1001580	3300025297	Bacteria	26036
248	Ga0209758_1001626	3300025297	Bacteria	25578
249	Ga0209758_1002625	3300025297	Bacteria	17862
250	Ga0209758_1043879	3300025297	Bacteria	1642
251	Ga0209758_1050273	3300025297	Bacteria	1463
252	Ga0209050_1002690	3300025298	Bacteria	14457
253	Ga0209050_1002861	3300025298	Bacteria	13669
254	Ga0209256_1001819	3300025299	Bacteria	20012
255	Ga0209256_1002657	3300025299	Bacteria	14032
256	Ga0209256_1005935	3300025299	Bacteria	6737
257	Ga0209256_1009237	3300025299	Bacteria	4361
258	Ga0209256_1017649	3300025299	Bacteria	2358
259	Ga0209256_1025093	3300025299	Bacteria	1742
260	Ga0207426_1000081	3300025302	Bacteria	304502
261	Ga0207426_1000144	3300025302	Bacteria	191590
262	Ga0207426_1000406	3300025302	Bacteria	72462
263	Ga0209051_1000408	3300025303	Bacteria	59354
264	Ga0209051_1003930	3300025303	Bacteria	9469
265	Ga0209051_1007957	3300025303	Bacteria	5703
266	Ga0209051_1017164	3300025303	Bacteria	3243
267	Ga0209051_1027832	3300025303	Bacteria	2244
268	Ga0209257_1000882	3300025304	Bacteria	42353
269	Ga0209257_1005245	3300025304	Bacteria	9253
270	Ga0207696_1000004	3300025711	Bacteria	671626
271	Ga0207696_1000033	3300025711	Bacteria	360689
272	Ga0207696_1000192	3300025711	Bacteria	94285
273	Ga0207696_1000247	3300025711	Bacteria	73166
274	Ga0207696_1000655	3300025711	Bacteria	24794
275	Ga0207696_1000705	3300025711	Bacteria	22787
276	Ga0207696_1020502	3300025711	Bacteria	2131
277	Ga0207655_1000011	3300025728	Bacteria	643321
278	Ga0207655_1000023	3300025728	Bacteria	467070
279	Ga0207655_1000029	3300025728	Bacteria	432187
280	Ga0207655_1000496	3300025728	Bacteria	50648
281	Ga0207655_1002600	3300025728	Bacteria	14356
282	Ga0207655_1003891	3300025728	Bacteria	10859
283	Ga0207655_1004702	3300025728	Bacteria	9556
284	Ga0207655_1005671	3300025728	Bacteria	8441
285	Ga0207655_1005732	3300025728	Bacteria	8380
286	Ga0207655_1017056	3300025728	Bacteria	3934
287	Ga0207655_1020883	3300025728	Bacteria	3346
288	Ga0207713_1000001	3300025735	Bacteria	2295391
289	Ga0207713_1000101	3300025735	Bacteria	140693
290	Ga0207713_1000317	3300025735	Bacteria	54719
291	Ga0207713_1002229	3300025735	Bacteria	14361
292	Ga0207713_1020591	3300025735	Bacteria	3190
293	Ga0207710_10000016	3300025900	Bacteria	388568
294	Ga0207647_10012406	3300025904	Bacteria	5931
295	Ga0207643_10152416	3300025908	Bacteria	1386
296	Ga0207654_10000006	3300025911	Bacteria	815027
297	Ga0207695_10000024	3300025913	Bacteria	632311
298	Ga0207671_10000463	3300025914	Bacteria	55685
299	Ga0207652_10025796	3300025921	Bacteria	4891
300	Ga0207694_10067228	3300025924	Bacteria	2797
301	Ga0207650_10000302	3300025925	Bacteria	48702
302	Ga0207690_10053974	3300025932	Bacteria	2699
303	Ga0207706_10024989	3300025933	Bacteria	5356
304	Ga0207711_10176911	3300025941	Bacteria	1939
305	Ga0207678_10000721	3300026067	Bacteria	30188
306	Ga0207702_10047765	3300026078	Bacteria	3608
307	Ga0207702_10169264	3300026078	Bacteria	2002
308	Ga0207674_10095221	3300026116	Bacteria	2964
309	Ga0207683_10148785	3300026121	Bacteria	2113
310	Ga0209281_1000008	3300027111	Bacteria	867470
311	Ga0209281_1000048	3300027111	Bacteria	322698
312	Ga0209281_1005687	3300027111	Bacteria	3400
313	Ga0209371_1000010	3300027312	Bacteria	922021
314	Ga0209371_1000117	3300027312	Bacteria	134858
315	Ga0209371_1000146	3300027312	Bacteria	115378
316	Ga0209371_1000220	3300027312	Bacteria	76323
317	Ga0209371_1001330	3300027312	Bacteria	17224
318	Ga0209371_1001611	3300027312	Bacteria	14673
319	Ga0209371_1001852	3300027312	Bacteria	13013
320	Ga0209371_1003358	3300027312	Bacteria	7860
321	Ga0209371_1004337	3300027312	Bacteria	6245
322	Ga0209371_1004536	3300027312	Bacteria	5964
323	Ga0209371_1009329	3300027312	Bacteria	3130
324	Ga0268266_10103023	3300028379	Bacteria	2518
325	Ga0307515_10020054	3300028794	Bacteria	11967
326	Ga0307515_10066787	3300028794	Bacteria	4974
327	Ga0307515_10124087	3300028794	Bacteria	2900
328	Ga0268256_1000022	3300030500	Bacteria	531115
329	Ga0268256_1000117	3300030500	Bacteria	115176
330	Ga0268256_1000508	3300030500	Bacteria	32757
331	Ga0268256_1001264	3300030500	Bacteria	15723
332	Ga0268256_1001432	3300030500	Bacteria	14385
333	Ga0268256_1001550	3300030500	Bacteria	13545
334	Ga0268256_1001623	3300030500	Bacteria	13013
335	Ga0268256_1004024	3300030500	Bacteria	6319
336	Ga0268256_1004201	3300030500	Bacteria	6076
337	Ga0268256_1018923	3300030500	Bacteria	1898
338	Ga0307513_10022721	3300031456	Bacteria	7359
339	Ga0307405_10000508	3300031731	Bacteria	14693
340	Ga0307510_10244613	3300033180	Bacteria	1286
341	Ga0395905_0034762	3300037471	Bacteria	4732
342	Ga0395905_0048516	3300037471	Bacteria	3979
343	Ga0395905_0163236	3300037471	Bacteria	2093
344	Ga0436360_0303139	3300039438	Unclassified	1162
345	Ga0436360_1234628	3300039438	Bacteria	1362
346	Ga0436361_0085638	3300039447	Bacteria	2207
347	Ga0439438_000001	3300041405	Bacteria	1263568
348	Ga0439438_002233	3300041405	Bacteria	8335
349	Ga0439447_000441	3300041407	Bacteria	15475
350	Ga0439447_002555	3300041407	Bacteria	6623
351	Ga0439447_014161	3300041407	Bacteria	2242
352	Ga0439466_0000012	3300041411	Bacteria	179902
353	Ga0439466_0012345	3300041411	Bacteria	3150
354	Ga0439465_0011289	3300041413	Bacteria	2803
355	Ga0439465_0017452	3300041413	Bacteria	2240
356	Ga0451798_0557005	3300041458	Bacteria	2629
357	Ga0451807_0963549	3300041486	Bacteria	1660
358	Ga0451833_0659595	3300041491	Bacteria	1603
359	Ga0451835_1130679	3300041492	Bacteria	2614
360	Ga0451841_0151264	3300041498	Bacteria	2054
361	Ga0451847_0552116	3300041503	Bacteria	4724
362	Ga0451851_0205475	3300041507	Bacteria	2500
363	Ga0451853_3215872	3300041512	Bacteria	3765
364	Ga0439432_013522	3300042006	Bacteria	2775
365	Ga0439432_016730	3300042006	Bacteria	2467
366	Ga0439432_032249	3300042006	Bacteria	1690
367	Ga0439449_0027843	3300042007	Bacteria	2108
368	Ga0439452_000017	3300042010	Bacteria	324897
369	Ga0450907_000202	3300042146	Bacteria	21615
370	Ga0439464_0011137	3300042439	Bacteria	2377
371	Ga0495617_014301	3300046452	Bacteria	2697
372	Ga0495627_000136	3300046453	Bacteria	87662
373	Ga0495591_000028	3300046458	Bacteria	182419
374	Ga0495638_0003268	3300046460	Bacteria	12793
375	Ga0495638_0239660	3300046460	Bacteria	1005
376	Ga0495650_0000016	3300046471	Bacteria	554693
377	Ga0495650_0000033	3300046471	Bacteria	412188
378	Ga0495605_0004327	3300046474	Bacteria	8354
379	Ga0495584_0018333	3300046491	Bacteria	3557
380	Ga0495585_0035280	3300046492	Bacteria	2827
381	Ga0495585_0073035	3300046492	Bacteria	1868
382	Ga0495596_0002782	3300046500	Bacteria	9166
383	Ga0495583_0004616	3300046506	Bacteria	9737
384	Ga0495606_0000627	3300046507	Bacteria	55643
385	Ga0495606_0006905	3300046507	Bacteria	10332
386	Ga0495606_0013609	3300046507	Bacteria	6416
387	Ga0495610_0003869	3300046512	Bacteria	11374
388	Ga0495620_0019706	3300046515	Bacteria	3311
389	Ga0495631_0001550	3300046518	Bacteria	13832
390	Ga0495632_0003885	3300046519	Bacteria	10383
391	Ga0495637_0086274	3300046520	Bacteria	1245
392	Ga0495643_0074605	3300046522	Bacteria	1776
393	Ga0495644_0001706	3300046523	Bacteria	8899
394	Ga0495648_0003080	3300046524	Bacteria	14894
395	Ga0495648_0014103	3300046524	Bacteria	5871
396	Ga0495648_0029881	3300046524	Bacteria	3611
397	Ga0495654_0000020	3300046530	Bacteria	284814
398	Ga0495654_0000032	3300046530	Bacteria	205780
399	Ga0495654_0000945	3300046530	Bacteria	21509
400	Ga0495654_0010357	3300046530	Bacteria	5073
401	Ga0495654_0010943	3300046530	Bacteria	4929
402	Ga0495654_0111335	3300046530	Bacteria	1249
403	Ga0495597_0000215	3300046542	Bacteria	52907
404	Ga0495633_0049161	3300046558	Bacteria	1991
405	Ga0495656_0052005	3300046615	Bacteria	1755
406	Ga0495668_0064494	3300046616	Bacteria	2016
407	Ga0495668_0065006	3300046616	Bacteria	2008
408	Ga0495625_0003054	3300046660	Bacteria	17159
409	Ga0495625_0007525	3300046660	Bacteria	9460
410	Ga0495625_0296892	3300046660	Bacteria	1035
411	Ga0495661_0119588	3300046665	Bacteria	1457
412	Ga0495588_0015157	3300046674	Bacteria	3703
413	Ga0495671_0020033	3300046692	Bacteria	3529
414	Ga0495649_0270540	3300046694	Bacteria	869
415	Ga0495589_0000006	3300046794	Bacteria	303635
416	Ga0495589_0007123	3300046794	Bacteria	5860
417	Ga0495660_0000007	3300046810	Bacteria	485295
418	Ga0495660_0000011	3300046810	Bacteria	361397
419	Ga0495660_0024693	3300046810	Bacteria	3422
420	Ga0495660_0103527	3300046810	Bacteria	1462
421	Ga0495604_0066406	3300047317	Bacteria	2744
422	Ga0495672_0000004	3300047320	Bacteria	631810
423	Ga0495672_0000061	3300047320	Bacteria	212024
424	Ga0495672_0000145	3300047320	Bacteria	104177
425	Ga0495672_0065267	3300047320	Bacteria	2081
426	Ga0495683_0011735	3300047323	Bacteria	4608
427	Ga0495683_0050344	3300047323	Bacteria	2085
428	Ga0495687_014175	3300047443	Bacteria	4120
429	Ga0495687_065400	3300047443	Bacteria	1481
430	Ga0495679_000101	3300047446	Bacteria	77584
431	Ga0495673_0000023	3300047469	Bacteria	539904
432	Ga0495681_0029501	3300047470	Bacteria	2807
433	Ga0495681_0044491	3300047470	Bacteria	2133
434	Ga0495686_0001564	3300047472	Bacteria	24387
435	Ga0495686_0009610	3300047472	Bacteria	6947
436	Ga0495686_0054085	3300047472	Bacteria	2515
437	Ga0495686_0106854	3300047472	Bacteria	1682
438	Ga0495626_0071500	3300048091	Bacteria	1559
439	Ga0495626_0073209	3300048091	Bacteria	1535
440	Ga0496100_0015795	3300048903	Bacteria	4416
441	Ga0496100_0104256	3300048903	Bacteria	1959
442	Ga0496101_0000029	3300048904	Bacteria	198515
443	Ga0496102_0010820	3300048905	Bacteria	7856
444	Ga0496102_0134550	3300048905	Bacteria	2315
445	Ga0496103_0007474	3300048906	Bacteria	6513
446	Ga0496103_0075067	3300048906	Bacteria	2120
447	Ga0496104_0011288	3300048907	Bacteria	7997
448	Ga0496104_0206826	3300048907	Bacteria	1874
449	Ga0496105_0026519	3300048908	Bacteria	4728
450	Ga0496105_0027002	3300048908	Bacteria	4686
451	Ga0496105_0092696	3300048908	Bacteria	2494
452	Ga0496106_0003593	3300048909	Bacteria	11561
453	Ga0496106_0017917	3300048909	Bacteria	5238
454	Ga0496106_0087816	3300048909	Bacteria	2396
455	Ga0496107_0020740	3300048910	Bacteria	4644
456	Ga0496113_0090646	3300048916	Bacteria	2355
457	Ga0496114_0063382	3300048917	Bacteria	3095
458	Ga0496116_0000031	3300048919	Bacteria	420043
459	Ga0496116_0000054	3300048919	Bacteria	289010
460	Ga0496116_0000080	3300048919	Bacteria	224530
461	Ga0496116_0001225	3300048919	Bacteria	29890
462	Ga0496116_0003238	3300048919	Bacteria	16215
463	Ga0496116_0004222	3300048919	Bacteria	13807
464	Ga0496116_0008137	3300048919	Bacteria	9159
465	Ga0496116_0010821	3300048919	Bacteria	7610
466	Ga0496116_0011384	3300048919	Bacteria	7371
467	Ga0496116_0053568	3300048919	Bacteria	2663
468	Ga0496116_0134573	3300048919	Bacteria	1402
469	Ga0496116_0135188	3300048919	Bacteria	1398
470	Ga0496116_0142823	3300048919	Bacteria	1343
471	Ga0496116_0179732	3300048919	Bacteria	1134
472	Ga0496117_0000004	3300048920	Bacteria	877131
473	Ga0496117_0000212	3300048920	Bacteria	112241
474	Ga0496117_0000853	3300048920	Bacteria	47190
475	Ga0496117_0003954	3300048920	Bacteria	16751
476	Ga0496117_0008072	3300048920	Bacteria	10085
477	Ga0496117_0022466	3300048920	Bacteria	5058
478	Ga0496117_0030277	3300048920	Bacteria	4156
479	Ga0496117_0050019	3300048920	Bacteria	2967
480	Ga0496117_0052350	3300048920	Bacteria	2876
481	Ga0496117_0055522	3300048920	Bacteria	2767
482	Ga0496117_0076949	3300048920	Bacteria	2210
483	Ga0496117_0114132	3300048920	Bacteria	1675
484	Ga0496117_0282535	3300048920	Bacteria	888
485	Ga0496118_0000024	3300048921	Bacteria	385236
486	Ga0496118_0001049	3300048921	Bacteria	43132
487	Ga0496118_0001266	3300048921	Bacteria	38767
488	Ga0496118_0001729	3300048921	Bacteria	31774
489	Ga0496118_0009099	3300048921	Bacteria	10111
490	Ga0496118_0010980	3300048921	Bacteria	8899
491	Ga0496118_0011739	3300048921	Bacteria	8513
492	Ga0496118_0033305	3300048921	Bacteria	4230
493	Ga0496118_0132940	3300048921	Bacteria	1593
494	Ga0496119_0000043	3300048922	Bacteria	192373
495	Ga0496119_0001522	3300048922	Bacteria	27704
496	Ga0496119_0001699	3300048922	Bacteria	25724
497	Ga0496119_0001837	3300048922	Bacteria	24578
498	Ga0496119_0003666	3300048922	Bacteria	15755
499	Ga0496119_0006217	3300048922	Bacteria	11158
500	Ga0496119_0011713	3300048922	Bacteria	7217
501	Ga0496119_0016418	3300048922	Bacteria	5636
502	Ga0496119_0054276	3300048922	Bacteria	2441
503	Ga0496119_0132736	3300048922	Bacteria	1355
504	Ga0496120_0000009	3300048923	Bacteria	386727
505	Ga0496120_0000429	3300048923	Bacteria	66724
506	Ga0496120_0000522	3300048923	Bacteria	59462
507	Ga0496120_0000703	3300048923	Bacteria	49030
508	Ga0496120_0000985	3300048923	Bacteria	38684
509	Ga0496120_0001034	3300048923	Bacteria	37245
510	Ga0496120_0001493	3300048923	Bacteria	27704
511	Ga0496120_0003807	3300048923	Bacteria	13291
512	Ga0496120_0004746	3300048923	Bacteria	11158
513	Ga0496121_0000131	3300048924	Bacteria	167955
514	Ga0496121_0005611	3300048924	Bacteria	15999
515	Ga0496121_0016470	3300048924	Bacteria	7632
516	Ga0496121_0026258	3300048924	Bacteria	5494
517	Ga0496121_0027561	3300048924	Bacteria	5314
518	Ga0496121_0087992	3300048924	Bacteria	2436
519	Ga0496121_0143667	3300048924	Bacteria	1766
520	Ga0496121_0273662	3300048924	Bacteria	1159
521	Ga0496122_0000013	3300048925	Bacteria	501039
522	Ga0496122_0002288	3300048925	Bacteria	27680
523	Ga0496122_0003190	3300048925	Bacteria	21875
524	Ga0496122_0028867	3300048925	Bacteria	4693
525	Ga0496122_0034652	3300048925	Bacteria	4126
526	Ga0496123_0000010	3300048926	Bacteria	501039
527	Ga0496123_0000651	3300048926	Bacteria	57756
528	Ga0496123_0002672	3300048926	Bacteria	21476
529	Ga0496123_0010552	3300048926	Bacteria	8144
530	Ga0496123_0017986	3300048926	Bacteria	5655
531	Ga0496123_0054599	3300048926	Bacteria	2628
532	Ga0496123_0064494	3300048926	Bacteria	2334
533	Ga0496123_0070756	3300048926	Bacteria	2181
534	Ga0496123_0083208	3300048926	Bacteria	1936
535	Ga0496123_0110863	3300048926	Bacteria	1569
536	Ga0496124_0000010	3300048927	Bacteria	595157
537	Ga0496124_0000039	3300048927	Bacteria	307831
538	Ga0496124_0000156	3300048927	Bacteria	137990
539	Ga0496124_0000262	3300048927	Bacteria	101572
540	Ga0496124_0002368	3300048927	Bacteria	24848
541	Ga0496124_0003707	3300048927	Bacteria	18441
542	Ga0496124_0003823	3300048927	Bacteria	18055
543	Ga0496124_0007776	3300048927	Bacteria	11324
544	Ga0496124_0014695	3300048927	Bacteria	7557
545	Ga0496124_0015369	3300048927	Bacteria	7340
546	Ga0496124_0020883	3300048927	Bacteria	6041
547	Ga0496124_0033193	3300048927	Bacteria	4543
548	Ga0496124_0044144	3300048927	Bacteria	3827
549	Ga0496124_0063657	3300048927	Bacteria	3080
550	Ga0496124_0213555	3300048927	Bacteria	1458
551	Ga0496125_0000019	3300048928	Bacteria	474989
552	Ga0496125_0006498	3300048928	Bacteria	12618
553	Ga0496125_0047336	3300048928	Bacteria	3598
554	Ga0496125_0157943	3300048928	Bacteria	1545
555	Ga0496125_0195302	3300048928	Bacteria	1332
556	Ga0496126_0000252	3300048929	Bacteria	115370
557	Ga0496126_0000690	3300048929	Bacteria	61848
558	Ga0496126_0064301	3300048929	Bacteria	3287
559	Ga0496126_0093360	3300048929	Bacteria	2642
560	Ga0496126_0241558	3300048929	Bacteria	1509
561	Ga0496126_0413039	3300048929	Bacteria	1092
562	Ga0495678_000388	3300049459	Bacteria	44393
563	Ga0495678_031629	3300049459	Bacteria	2204
564	Ga0495678_121004	3300049459	Bacteria	879
565	Ga0495682_0000004	3300049460	Bacteria	378337
566	Ga0501032_0079698	3300049569	Bacteria	2180
567	Ga0501033_0000165	3300049570	Bacteria	63213
568	Ga0501043_0180591	3300049579	Bacteria	1644
569	Ga0501047_0163128	3300049581	Bacteria	2100
570	Ga0501048_0000685	3300049582	Bacteria	24597
571	Ga0501073_0032898	3300049589	Bacteria	3695
572	Ga0501280_012431	3300049776	Bacteria	1196
573	Ga0501035_0001055	3300049822	Bacteria	28892
574	Ga0501044_0270980	3300049823	Bacteria	1633
575	nmdc:mga00v17_15227_c1	3300050491	Bacteria	4312
576	nmdc:mga00v17_53867_c1	3300050491	Bacteria	2453
577	nmdc:mga0yw44_217981_c1	3300050492	Bacteria	1264
578	nmdc:mga0k408_129741_c1	3300050493	Bacteria	1496
579	nmdc:mga0sz30_42923_c1	3300050516	Bacteria	1903
580	Ga0500578_0109880	3300053086	Bacteria	1739
581	Ga0500556_0011201	3300053104	Bacteria	2652
582	Ga0500569_009051	3300053109	Bacteria	2301
583	Ga0500608_021746	3300053122	Bacteria	2967
584	Ga0500618_001066	3300053125	Bacteria	13544
585	Ga0500621_000001	3300053126	Bacteria	1049698
586	Ga0500658_0000540	3300053134	Bacteria	15962
587	Ga0500559_0015321	3300053136	Bacteria	3237
588	Ga0500568_0001297	3300053139	Bacteria	16411
589	Ga0500568_0013671	3300053139	Bacteria	3692
590	Ga0500604_0012180	3300053151	Bacteria	2319
591	Ga0500616_0000758	3300053153	Bacteria	37186
592	Ga0500616_0003660	3300053153	Bacteria	11529
593	Ga0500616_0024187	3300053153	Bacteria	3378
594	Ga0500616_0037788	3300053153	Bacteria	2612
595	Ga0500622_0001715	3300053156	Bacteria	17000
596	Ga0500627_0136813	3300053158	Bacteria	1107
597	Ga0500633_0033032	3300053160	Bacteria	1685
598	Ga0500636_0000023	3300053177	Bacteria	89900
599	Ga0500636_0000562	3300053177	Bacteria	20257
600	Ga0501082_0079348	3300060353	Bacteria	2832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003792	Ga0055540_1020074	Ga0055540_10200742	240
2	3300060353	Ga0501082_0079348	Ga0501082_0079348_802_1659	253
3	3300048921	Ga0496118_0009099	Ga0496118_0009099_2044_2901	254
4	3300053151	Ga0500604_0012180	Ga0500604_0012180_1247_2107	254
5	3300048909	Ga0496106_0003593	Ga0496106_0003593_3356_4216	255
6	3300009545	Ga0105237_10003539	Ga0105237_100035396	258
7	3300025914	Ga0207671_10000463	Ga0207671_1000046360	258
8	3300048920	Ga0496117_0114132	Ga0496117_0114132_640_1542	258
9	3300048924	Ga0496121_0087992	Ga0496121_0087992_248_1150	258
10	3300001979	JGI24740J21852_10000381	JGI24740J21852_100003815	260
11	3300002737	JGI25162J39368_1000266	JGI25162J39368_100026641	260
12	3300003214	JGI25165J46597_1000702	JGI25165J46597_100070213	260
13	3300003214	JGI25165J46597_1007373	JGI25165J46597_10073731	260
14	3300005548	Ga0070665_100150669	Ga0070665_1001506692	260
15	3300005614	Ga0068856_100142263	Ga0068856_1001422632	260
16	3300009093	Ga0105240_10000027	Ga0105240_10000027114	260
17	3300009177	Ga0105248_10227363	Ga0105248_102273633	260
18	3300013104	Ga0157370_10000048	Ga0157370_1000004894	260
19	3300025233	Ga0209437_100036	Ga0209437_100036241	260
20	3300025246	Ga0209646_1013754	Ga0209646_10137542	260
21	3300025253	Ga0209677_100188	Ga0209677_10018834	260
22	3300025261	Ga0209233_1000056	Ga0209233_1000056351	260
23	3300025261	Ga0209233_1000271	Ga0209233_100027119	260
24	3300025913	Ga0207695_10000024	Ga0207695_10000024516	260
25	3300025941	Ga0207711_10176911	Ga0207711_101769112	260
26	3300026078	Ga0207702_10047765	Ga0207702_100477653	260
27	3300026078	Ga0207702_10169264	Ga0207702_101692642	260
28	3300028379	Ga0268266_10103023	Ga0268266_101030233	260
29	3300048919	Ga0496116_0135188	Ga0496116_0135188_449_1351	260
30	3300048921	Ga0496118_0001729	Ga0496118_0001729_30625_31527	260
31	3300002987	JGI25159J45721_1000114	JGI25159J45721_100011429	262
32	3300003354	JGI25160J50197_1000053	JGI25160J50197_100005390	262
33	3300003374	JGI25161J50226_1000039	JGI25161J50226_100003990	262
34	3300004625	Ga0055543_1000015	Ga0055543_100001598	262
35	3300005262	Ga0065165_1000361	Ga0065165_100036128	262
36	3300025284	Ga0209130_1000038	Ga0209130_100003890	262
37	3300025302	Ga0207426_1000081	Ga0207426_1000081130	262
38	3300048927	Ga0496124_0063657	Ga0496124_0063657_212_1066	264
39	3300009765	Ga0123341_1000098	Ga0123341_100009828	265
40	3300048924	Ga0496121_0143667	Ga0496121_0143667_239_1138	265
41	3300048929	Ga0496126_0064301	Ga0496126_0064301_554_1453	265
42	3300002773	JGI25152J39213_1002372	JGI25152J39213_10023722	266
43	3300003215	JGI25153J46596_10004769	JGI25153J46596_100047692	266
44	3300025245	Ga0207425_1001501	Ga0207425_100150111	266
45	3300025258	Ga0209129_1002239	Ga0209129_100223911	266
46	3300025297	Ga0209758_1001626	Ga0209758_100162614	266
47	3300047472	Ga0495686_0054085	Ga0495686_0054085_1512_2411	266
48	3300049569	Ga0501032_0079698	Ga0501032_0079698_1013_1912	266
49	3300049579	Ga0501043_0180591	Ga0501043_0180591_526_1425	266
50	3300049581	Ga0501047_0163128	Ga0501047_0163128_962_1861	266
51	3300053139	Ga0500568_0013671	Ga0500568_0013671_1186_2085	266
52	3300002773	JGI25152J39213_1002121	JGI25152J39213_100212113	267
53	3300003187	JGI25151J46595_10018657	JGI25151J46595_100186574	267
54	3300003215	JGI25153J46596_10004222	JGI25153J46596_100042222	267
55	3300005548	Ga0070665_100166870	Ga0070665_1001668703	267
56	3300025245	Ga0207425_1019069	Ga0207425_10190692	267
57	3300025258	Ga0209129_1000688	Ga0209129_100068816	267
58	3300025294	Ga0209025_1005568	Ga0209025_10055684	267
59	3300025297	Ga0209758_1001580	Ga0209758_100158016	267
60	3300048919	Ga0496116_0142823	Ga0496116_0142823_325_1209	267
61	3300048091	Ga0495626_0071500	Ga0495626_0071500_552_1451	268
62	3300053156	Ga0500622_0001715	Ga0500622_0001715_2160_3059	268
63	iso_pu_bacteria	2847797336	2847800883	268
64	3300005262	Ga0065165_1012743	Ga0065165_10127434	269
65	3300002739	JGI25158J39367_1003851	JGI25158J39367_10038512	271
66	3300002773	JGI25152J39213_1002526	JGI25152J39213_10025267	271
67	3300002987	JGI25159J45721_1000282	JGI25159J45721_100028212	271
68	3300003215	JGI25153J46596_10007653	JGI25153J46596_100076534	271
69	3300003374	JGI25161J50226_1000235	JGI25161J50226_100023532	271
70	3300003771	Ga0055526_1000370	Ga0055526_100037032	271
71	3300003775	Ga0055524_1001510	Ga0055524_100151012	271
72	3300003790	Ga0055528_1001662	Ga0055528_10016629	271
73	3300004625	Ga0055543_1000033	Ga0055543_100003352	271
74	3300005262	Ga0065165_1043132	Ga0065165_10431322	271
75	3300025208	Ga0209436_100002	Ga0209436_10000277	271
76	3300025258	Ga0209129_1000304	Ga0209129_100030439	271
77	3300025273	Ga0209673_1008706	Ga0209673_10087067	271
78	3300025284	Ga0209130_1000015	Ga0209130_1000015249	271
79	3300025295	Ga0209564_1000821	Ga0209564_100082136	271
80	3300025297	Ga0209758_1001053	Ga0209758_100105321	271
81	3300025299	Ga0209256_1005935	Ga0209256_10059353	271
82	3300025302	Ga0207426_1000144	Ga0207426_100014419	271
83	3300025303	Ga0209051_1007957	Ga0209051_10079575	271
84	3300031731	Ga0307405_10000508	Ga0307405_1000050813	271
85	3300048927	Ga0496124_0213555	Ga0496124_0213555_171_1070	271
86	3300009148	Ga0105243_10091305	Ga0105243_100913052	272
87	3300009551	Ga0105238_10036717	Ga0105238_100367173	272
88	3300010375	Ga0105239_10023413	Ga0105239_100234137	272
89	3300011119	Ga0105246_10008452	Ga0105246_100084523	272
90	3300013100	Ga0157373_10102684	Ga0157373_101026842	272
91	3300013296	Ga0157374_10453904	Ga0157374_104539042	272
92	3300025297	Ga0209758_1043879	Ga0209758_10438792	272
93	3300048905	Ga0496102_0134550	Ga0496102_0134550_213_1049	272
94	3300048906	Ga0496103_0007474	Ga0496103_0007474_4663_5499	272
95	3300048909	Ga0496106_0017917	Ga0496106_0017917_1277_2113	272
96	3300048910	Ga0496107_0020740	Ga0496107_0020740_695_1531	272
97	3300048917	Ga0496114_0063382	Ga0496114_0063382_674_1510	272
98	3300048919	Ga0496116_0134573	Ga0496116_0134573_26_925	272
99	3300048924	Ga0496121_0005611	Ga0496121_0005611_6777_7676	272
100	3300048928	Ga0496125_0047336	Ga0496125_0047336_2330_3229	272
101	3300013104	Ga0157370_10000557	Ga0157370_1000055717	273
102	3300048919	Ga0496116_0001225	Ga0496116_0001225_12093_12914	273
103	3300048920	Ga0496117_0000212	Ga0496117_0000212_64423_65244	273
104	3300048920	Ga0496117_0282535	Ga0496117_0282535_56_877	273
105	3300048921	Ga0496118_0001049	Ga0496118_0001049_35335_36156	273
106	3300048927	Ga0496124_0014695	Ga0496124_0014695_3808_4629	273
107	3300049459	Ga0495678_121004	Ga0495678_121004_44_865	273
108	3300003775	Ga0055524_1027822	Ga0055524_10278221	274
109	3300003790	Ga0055528_1027170	Ga0055528_10271702	274
110	3300025273	Ga0209673_1031412	Ga0209673_10314122	274
111	3300025295	Ga0209564_1003738	Ga0209564_10037389	274
112	3300025299	Ga0209256_1025093	Ga0209256_10250932	274
113	3300002773	JGI25152J39213_1002384	JGI25152J39213_10023843	275
114	3300003187	JGI25151J46595_10004511	JGI25151J46595_100045115	275
115	3300025258	Ga0209129_1000078	Ga0209129_100007839	275
116	3300025294	Ga0209025_1000489	Ga0209025_100048914	275
117	3300025294	Ga0209025_1001772	Ga0209025_100177218	275
118	3300025303	Ga0209051_1027832	Ga0209051_10278323	275
119	3300046694	Ga0495649_0270540	Ga0495649_0270540_12_839	275
120	3300002773	JGI25152J39213_1003623	JGI25152J39213_10036235	278
121	3300002774	JGI25150J39212_1000393	JGI25150J39212_10003937	278
122	3300003187	JGI25151J46595_10000629	JGI25151J46595_1000062911	278
123	3300003215	JGI25153J46596_10007976	JGI25153J46596_100079764	278
124	3300025245	Ga0207425_1000312	Ga0207425_100031214	278
125	3300025258	Ga0209129_1000393	Ga0209129_100039314	278
126	3300025273	Ga0209673_1007798	Ga0209673_10077983	278
127	3300025294	Ga0209025_1000664	Ga0209025_100066414	278
128	3300025297	Ga0209758_1000549	Ga0209758_100054914	278
129	3300041458	Ga0451798_0557005	Ga0451798_0557005_872_1726	278
130	3300041486	Ga0451807_0963549	Ga0451807_0963549_257_1111	278
131	3300041491	Ga0451833_0659595	Ga0451833_0659595_388_1242	278
132	3300041492	Ga0451835_1130679	Ga0451835_1130679_972_1826	278
133	3300041498	Ga0451841_0151264	Ga0451841_0151264_347_1201	278
134	3300041503	Ga0451847_0552116	Ga0451847_0552116_3763_4617	278
135	3300041507	Ga0451851_0205475	Ga0451851_0205475_948_1802	278
136	3300041512	Ga0451853_3215872	Ga0451853_3215872_1167_2021	278
137	3300046460	Ga0495638_0239660	Ga0495638_0239660_95_949	278
138	3300046474	Ga0495605_0004327	Ga0495605_0004327_784_1638	278
139	3300046507	Ga0495606_0013609	Ga0495606_0013609_721_1575	278
140	3300046515	Ga0495620_0019706	Ga0495620_0019706_618_1472	278
141	3300046518	Ga0495631_0001550	Ga0495631_0001550_781_1635	278
142	3300046519	Ga0495632_0003885	Ga0495632_0003885_6046_6900	278
143	3300046524	Ga0495648_0014103	Ga0495648_0014103_1229_2083	278
144	3300046530	Ga0495654_0111335	Ga0495654_0111335_111_965	278
145	3300046616	Ga0495668_0064494	Ga0495668_0064494_743_1597	278
146	3300046660	Ga0495625_0007525	Ga0495625_0007525_568_1422	278
147	3300046810	Ga0495660_0103527	Ga0495660_0103527_142_996	278
148	3300047323	Ga0495683_0050344	Ga0495683_0050344_602_1456	278
149	3300047443	Ga0495687_014175	Ga0495687_014175_2644_3498	278
150	3300048919	Ga0496116_0003238	Ga0496116_0003238_8512_9411	278
151	3300048920	Ga0496117_0022466	Ga0496117_0022466_3435_4334	278
152	3300048921	Ga0496118_0132940	Ga0496118_0132940_185_1084	278
153	3300048924	Ga0496121_0027561	Ga0496121_0027561_3591_4490	278
154	3300048925	Ga0496122_0003190	Ga0496122_0003190_11274_12173	278
155	3300048926	Ga0496123_0017986	Ga0496123_0017986_4691_5590	278
156	3300048927	Ga0496124_0003707	Ga0496124_0003707_8848_9747	278
157	3300049459	Ga0495678_031629	Ga0495678_031629_567_1421	278
158	3300050492	nmdc:mga0yw44_217981_c1	nmdc:mga0yw44_217981_c1_254_1108	278
159	3300050493	nmdc:mga0k408_129741_c1	nmdc:mga0k408_129741_c1_409_1263	278
160	3300053109	Ga0500569_009051	Ga0500569_009051_1226_2080	278
161	3300053134	Ga0500658_0000540	Ga0500658_0000540_9647_10501	278
162	3300053158	Ga0500627_0136813	Ga0500627_0136813_171_1025	278
163	3300009766	Ga0123342_1011467	Ga0123342_10114676	279
164	3300048920	Ga0496117_0076949	Ga0496117_0076949_1122_2018	280
165	3300053160	Ga0500633_0033032	Ga0500633_0033032_114_974	280
166	3300006946	Ga0079104_1000288	Ga0079104_100028863	281
167	3300013307	Ga0157372_10527608	Ga0157372_105276081	281
168	3300027111	Ga0209281_1000048	Ga0209281_1000048256	281
169	3300048919	Ga0496116_0000080	Ga0496116_0000080_197226_198122	281
170	3300048922	Ga0496119_0132736	Ga0496119_0132736_103_999	281
171	3300048925	Ga0496122_0028867	Ga0496122_0028867_3368_4264	281
172	3300048926	Ga0496123_0070756	Ga0496123_0070756_1249_2145	281
173	3300048928	Ga0496125_0195302	Ga0496125_0195302_303_1199	281
174	3300048929	Ga0496126_0000690	Ga0496126_0000690_35039_35935	281
175	3300053136	Ga0500559_0015321	Ga0500559_0015321_2159_3076	281
176	3300025294	Ga0209025_1004687	Ga0209025_10046873	283
177	3300048906	Ga0496103_0075067	Ga0496103_0075067_61_930	283
178	3300048908	Ga0496105_0026519	Ga0496105_0026519_3511_4380	283
179	3300048922	Ga0496119_0011713	Ga0496119_0011713_459_1328	283
180	3300048926	Ga0496123_0064494	Ga0496123_0064494_531_1400	283
181	3300048927	Ga0496124_0020883	Ga0496124_0020883_4651_5520	283
182	3300009553	Ga0105249_10059134	Ga0105249_100591344	284
183	3300009763	Ga0123340_1039218	Ga0123340_10392183	284
184	3300009766	Ga0123342_1013091	Ga0123342_10130912	284
185	3300046492	Ga0495585_0035280	Ga0495585_0035280_1198_2070	284
186	3300046506	Ga0495583_0004616	Ga0495583_0004616_630_1502	284
187	3300046616	Ga0495668_0065006	Ga0495668_0065006_894_1766	284
188	3300048907	Ga0496104_0206826	Ga0496104_0206826_466_1338	284
189	3300048909	Ga0496106_0087816	Ga0496106_0087816_517_1389	284
190	3300048916	Ga0496113_0090646	Ga0496113_0090646_130_1002	284
191	3300048919	Ga0496116_0008137	Ga0496116_0008137_5642_6514	284
192	3300048928	Ga0496125_0157943	Ga0496125_0157943_275_1147	284
193	3300037471	Ga0395905_0048516	Ga0395905_0048516_223_1119	285
194	iso_pu_bacteria	2738541317	2738945832	285
195	iso_pu_bacteria	2913308742	2913310485	285
196	3300003771	Ga0055526_1004419	Ga0055526_10044194	286
197	3300003775	Ga0055524_1026349	Ga0055524_10263492	286
198	3300003790	Ga0055528_1001272	Ga0055528_10012724	286
199	3300025273	Ga0209673_1000091	Ga0209673_100009118	286
200	3300025291	Ga0209675_1018617	Ga0209675_10186172	286
201	3300025295	Ga0209564_1001024	Ga0209564_100102418	286
202	3300025299	Ga0209256_1001819	Ga0209256_100181922	286
203	iso_pu_bacteria	2523231067	2523469927	287
204	iso_pu_bacteria	2643221558	2643810334	287
205	iso_pu_bacteria	2738543031	2739350434	287
206	iso_pu_bacteria	2791354903	2791923068	287
207	iso_pu_bacteria	2791355263	2793342880	287
208	iso_pu_bacteria	2888373701	2888374670	287
209	iso_pu_bacteria	2936381700	2936383887	287
210	iso_pu_bacteria	8005688590	8005690517	287
211	3300048919	Ga0496116_0010821	Ga0496116_0010821_4591_5475	288
212	3300048919	Ga0496116_0179732	Ga0496116_0179732_193_1077	288
213	3300048924	Ga0496121_0026258	Ga0496121_0026258_768_1652	288
214	3300048924	Ga0496121_0273662	Ga0496121_0273662_22_906	288
215	3300048925	Ga0496122_0034652	Ga0496122_0034652_3157_4041	288
216	3300048926	Ga0496123_0010552	Ga0496123_0010552_7070_7954	288
217	3300048927	Ga0496124_0033193	Ga0496124_0033193_199_1083	288
218	3300049570	Ga0501033_0000165	Ga0501033_0000165_33892_34782	288
219	3300049822	Ga0501035_0001055	Ga0501035_0001055_25049_25939	288
220	iso_pu_bacteria	2506520007	2506577097	288
221	iso_pu_bacteria	2506520008	2506582235	288
222	iso_pu_bacteria	2508501071	2508851063	288
223	iso_pu_bacteria	2511231025	2511379401	288
224	iso_pu_bacteria	2511231035	2511433856	288
225	iso_pu_bacteria	2537561728	2538427789	288
226	iso_pu_bacteria	2585427591	2585826757	288
227	iso_pu_bacteria	2585427592	2585831317	288
228	iso_pu_bacteria	2599185299	2599927100	288
229	iso_pu_bacteria	2608642108	2608668530	288
230	iso_pu_bacteria	2643221568	2643856172	288
231	iso_pu_bacteria	2643221653	2644297296	288
232	iso_pu_bacteria	2643221719	2644655549	288
233	iso_pu_bacteria	2648501693	2650895554	288
234	iso_pu_bacteria	2654587920	2656279466	288
235	iso_pu_bacteria	2667528173	2671108410	288
236	iso_pu_bacteria	2671180115	2671586284	288
237	iso_pu_bacteria	2684622997	2686355768	288
238	iso_pu_bacteria	2687453601	2689443499	288
239	iso_pu_bacteria	2772190666	2772437604	288
240	iso_pu_bacteria	2806310673	2807177212	288
241	iso_pu_bacteria	2808606414	2809124649	288
242	iso_pu_bacteria	2818991272	2819242968	288
243	iso_pu_bacteria	2838022645	2838026550	288
244	iso_pu_bacteria	2842198810	2842203116	288
245	iso_pu_bacteria	2844528606	2844532013	288
246	iso_pu_bacteria	2847085930	2847088730	288
247	iso_pu_bacteria	2855195626	2855198626	288
248	iso_pu_bacteria	2858466076	2858469707	288
249	iso_pu_bacteria	2865014394	2865017610	288
250	iso_pu_bacteria	2869551831	2869552916	288
251	iso_pu_bacteria	2871272651	2871273697	288
252	iso_pu_bacteria	2871282230	2871283233	288
253	iso_pu_bacteria	2876601092	2876601270	288
254	iso_pu_bacteria	2881609920	2881612218	288
255	iso_pu_bacteria	2888366609	2888367624	288
256	iso_pu_bacteria	2891670763	2891672514	288
257	iso_pu_bacteria	2894817345	2894820409	288
258	iso_pu_bacteria	2900051742	2900053583	288
259	iso_pu_bacteria	2904474040	2904474917	288
260	iso_pu_bacteria	2904504865	2904505644	288
261	iso_pu_bacteria	2908669403	2908671266	288
262	iso_pu_bacteria	2919150387	2919151263	288
263	iso_pu_bacteria	2919166419	2919167061	288
264	iso_pu_bacteria	2927143783	2927146137	288
265	iso_pu_bacteria	2932406140	2932407385	288
266	iso_pu_bacteria	2937967321	2937972140	288
267	iso_pu_bacteria	2939577877	2939579295	288
268	iso_pu_bacteria	2939602548	2939603030	288
269	iso_pu_bacteria	2945951305	2945953969	288
270	iso_pu_bacteria	2978969890	2978973477	288
271	iso_pu_bacteria	2978975091	2978976453	288
272	iso_pu_bacteria	2984494565	2984495618	288
273	iso_pu_bacteria	2984587000	2984591760	288
274	iso_pu_bacteria	2989776772	2989777771	288
275	iso_pu_bacteria	2990261002	2990264313	288
276	iso_pu_bacteria	640753048	640936643	288
277	iso_pu_bacteria	8004592986	8004594329	288
278	iso_pu_bacteria	8005246636	8005247054	288
279	iso_pu_bacteria	8015394850	8015398903	288
280	iso_pu_bacteria	8016733728	8016736890	288
281	iso_pu_bacteria	8018150411	8018151862	288
282	iso_pu_bacteria	8019499862	8019502099	288
283	iso_pu_bacteria	8054844752	8054847804	288
284	iso_pu_bacteria	8055431914	8055433039	288
285	3300046660	Ga0495625_0296892	Ga0495625_0296892_97_990	289
286	iso_pu_bacteria	2509276021	2509388161	289
287	iso_pu_bacteria	2509276033	2509443748	289
288	iso_pu_bacteria	2510065019	2510131728	289
289	iso_pu_bacteria	2510461076	2510898035	289
290	iso_pu_bacteria	2510917022	2511133928	289
291	iso_pu_bacteria	2510917026	2511173861	289
292	iso_pu_bacteria	2510917028	2511183591	289
293	iso_pu_bacteria	2510917030	2511196189	289
294	iso_pu_bacteria	2513237084	2513571304	289
295	iso_pu_bacteria	2513237085	2513579131	289
296	iso_pu_bacteria	2513237088	2513598682	289
297	iso_pu_bacteria	2513237093	2513632402	289
298	iso_pu_bacteria	2513237103	2513711733	289
299	iso_pu_bacteria	2513237138	2513866258	289
300	iso_pu_bacteria	2513237144	2513907868	289
301	iso_pu_bacteria	2513237146	2513927529	289
302	iso_pu_bacteria	2513237162	2514023355	289
303	iso_pu_bacteria	2515075009	2515110673	289
304	iso_pu_bacteria	2515154113	2515637960	289
305	iso_pu_bacteria	2515154114	2515645870	289
306	iso_pu_bacteria	2515154116	2515660650	289
307	iso_pu_bacteria	2515154134	2515742823	289
308	iso_pu_bacteria	2516653077	2517039374	289
309	iso_pu_bacteria	2516653085	2517079616	289
310	iso_pu_bacteria	2517093000	2517093549	289
311	iso_pu_bacteria	2517287029	2517405247	289
312	iso_pu_bacteria	2519899620	2520376627	289
313	iso_pu_bacteria	2524023209	2524457728	289
314	iso_pu_bacteria	2529292951	2530644356	289
315	iso_pu_bacteria	2534681796	2535515303	289
316	iso_pu_bacteria	2558860983	2561467215	289
317	iso_pu_bacteria	2582581294	2585204088	289
318	iso_pu_bacteria	2582581298	2585225644	289
319	iso_pu_bacteria	2582581299	2585229195	289
320	iso_pu_bacteria	2582581304	2585256963	289
321	iso_pu_bacteria	2582581307	2585276700	289
322	iso_pu_bacteria	2582581308	2585278612	289
323	iso_pu_bacteria	2582581315	2585325772	289
324	iso_pu_bacteria	2582581316	2585329940	289
325	iso_pu_bacteria	2582581867	2585403866	289
326	iso_pu_bacteria	2585427526	2585528564	289
327	iso_pu_bacteria	2585427527	2585536322	289
328	iso_pu_bacteria	2585427528	2585539936	289
329	iso_pu_bacteria	2585427529	2585548081	289
330	iso_pu_bacteria	2585427530	2585554196	289
331	iso_pu_bacteria	2585427531	2585560328	289
332	iso_pu_bacteria	2585427590	2585824359	289
333	iso_pu_bacteria	2585427593	2585837917	289
334	iso_pu_bacteria	2585427594	2585844408	289
335	iso_pu_bacteria	2585427608	2585901402	289
336	iso_pu_bacteria	2585427609	2585905486	289
337	iso_pu_bacteria	2585427633	2585994716	289
338	iso_pu_bacteria	2585427634	2585999199	289
339	iso_pu_bacteria	2585428125	2587979398	289
340	iso_pu_bacteria	2599185170	2599418960	289
341	iso_pu_bacteria	2615840624	2616295903	289
342	iso_pu_bacteria	2615840626	2616306113	289
343	iso_pu_bacteria	2615840698	2616553631	289
344	iso_pu_bacteria	2617270742	2617382681	289
345	iso_pu_bacteria	2643221599	2644007563	289
346	iso_pu_bacteria	2643221634	2644190810	289
347	iso_pu_bacteria	2643221643	2644241345	289
348	iso_pu_bacteria	2667528174	2671112580	289
349	iso_pu_bacteria	2718217882	2719179804	289
350	iso_pu_bacteria	2718217927	2719384410	289
351	iso_pu_bacteria	2718217997	2719664156	289
352	iso_pu_bacteria	2718218009	2719730474	289
353	iso_pu_bacteria	2718218199	2720490575	289
354	iso_pu_bacteria	2718218232	2720611954	289
355	iso_pu_bacteria	2718218233	2720618807	289
356	iso_pu_bacteria	2718218235	2720630208	289
357	iso_pu_bacteria	2718218269	2720773903	289
358	iso_pu_bacteria	2718218363	2721145897	289
359	iso_pu_bacteria	2718218365	2721157435	289
360	iso_pu_bacteria	2718218366	2721162776	289
361	iso_pu_bacteria	2718218423	2721398124	289
362	iso_pu_bacteria	2721755514	2722838946	289
363	iso_pu_bacteria	2721755556	2723025572	289
364	iso_pu_bacteria	2721755684	2723559157	289
365	iso_pu_bacteria	2721755685	2723565763	289
366	iso_pu_bacteria	2721755809	2724036934	289
367	iso_pu_bacteria	2721755810	2724043230	289
368	iso_pu_bacteria	2721755819	2724088510	289
369	iso_pu_bacteria	2721755822	2724103028	289
370	iso_pu_bacteria	2721755823	2724108890	289
371	iso_pu_bacteria	2724679232	2725952104	289
372	iso_pu_bacteria	2728369352	2730106508	289
373	iso_pu_bacteria	2728369365	2730163041	289
374	iso_pu_bacteria	2728369397	2730297067	289
375	iso_pu_bacteria	2738541293	2738802422	289
376	iso_pu_bacteria	2738541333	2739034795	289
377	iso_pu_bacteria	2765235942	2766062502	289
378	iso_pu_bacteria	2775507266	2778174378	289
379	iso_pu_bacteria	2791355256	2793299303	289
380	iso_pu_bacteria	2791355259	2793318306	289
381	iso_pu_bacteria	2791355260	2793320052	289
382	iso_pu_bacteria	2791355261	2793328321	289
383	iso_pu_bacteria	2791355262	2793332675	289
384	iso_pu_bacteria	2791355264	2793350545	289
385	iso_pu_bacteria	2791355265	2793353151	289
386	iso_pu_bacteria	2791355266	2793360948	289
387	iso_pu_bacteria	2791355267	2793364927	289
388	iso_pu_bacteria	2802429605	2805927339	289
389	iso_pu_bacteria	2802429606	2805938226	289
390	iso_pu_bacteria	2802429633	2806044087	289
391	iso_pu_bacteria	2802429634	2806052093	289
392	iso_pu_bacteria	2802429635	2806058394	289
393	iso_pu_bacteria	2802429636	2806066889	289
394	iso_pu_bacteria	2802429637	2806074634	289
395	iso_pu_bacteria	2818991448	2819608186	289
396	iso_pu_bacteria	2818991453	2819639544	289
397	iso_pu_bacteria	2838016132	2838021755	289
398	iso_pu_bacteria	2838029111	2838035169	289
399	iso_pu_bacteria	2838035591	2838037353	289
400	iso_pu_bacteria	2838042994	2838047324	289
401	iso_pu_bacteria	2838048938	2838054507	289
402	iso_pu_bacteria	2838061910	2838067479	289
403	iso_pu_bacteria	2838068647	2838074016	289
404	iso_pu_bacteria	2838661181	2838663461	289
405	iso_pu_bacteria	2838668709	2838673441	289
406	iso_pu_bacteria	2838680041	2838680830	289
407	iso_pu_bacteria	2838686498	2838692352	289
408	iso_pu_bacteria	2838694306	2838695137	289
409	iso_pu_bacteria	2838701080	2838705876	289
410	iso_pu_bacteria	2838707686	2838708513	289
411	iso_pu_bacteria	2838729681	2838732552	289
412	iso_pu_bacteria	2838742623	2838745447	289
413	iso_pu_bacteria	2841851746	2841855091	289
414	iso_pu_bacteria	2841864319	2841866570	289
415	iso_pu_bacteria	2842077413	2842080252	289
416	iso_pu_bacteria	2842110456	2842117678	289
417	iso_pu_bacteria	2842118031	2842120872	289
418	iso_pu_bacteria	2842146304	2842150728	289
419	iso_pu_bacteria	2842156927	2842161879	289
420	iso_pu_bacteria	2842163707	2842169255	289
421	iso_pu_bacteria	2842180545	2842185496	289
422	iso_pu_bacteria	2842192696	2842193137	289
423	iso_pu_bacteria	2842205361	2842206700	289
424	iso_pu_bacteria	2842217011	2842218537	289
425	iso_pu_bacteria	2842229732	2842233434	289
426	iso_pu_bacteria	2842237096	2842237925	289
427	iso_pu_bacteria	2842243621	2842249636	289
428	iso_pu_bacteria	2842250916	2842255651	289
429	iso_pu_bacteria	2842257432	2842261705	289
430	iso_pu_bacteria	2842264693	2842267206	289
431	iso_pu_bacteria	2842271015	2842276821	289
432	iso_pu_bacteria	2842278818	2842280607	289
433	iso_pu_bacteria	2842285085	2842289563	289
434	iso_pu_bacteria	2842291075	2842293912	289
435	iso_pu_bacteria	2842298080	2842300657	289
436	iso_pu_bacteria	2842304105	2842306211	289
437	iso_pu_bacteria	2842311132	2842315915	289
438	iso_pu_bacteria	2842317721	2842322271	289
439	iso_pu_bacteria	2842341865	2842342820	289
440	iso_pu_bacteria	2842357229	2842358225	289
441	iso_pu_bacteria	2842363717	2842369447	289
442	iso_pu_bacteria	2842370503	2842371293	289
443	iso_pu_bacteria	2842377471	2842380308	289
444	iso_pu_bacteria	2842384541	2842387380	289
445	iso_pu_bacteria	2842395702	2842400795	289
446	iso_pu_bacteria	2842402390	2842406911	289
447	iso_pu_bacteria	2842409023	2842413592	289
448	iso_pu_bacteria	2842415677	2842420445	289
449	iso_pu_bacteria	2842422224	2842427644	289
450	iso_pu_bacteria	2842428310	2842431543	289
451	iso_pu_bacteria	2842434925	2842437878	289
452	iso_pu_bacteria	2842441272	2842444692	289
453	iso_pu_bacteria	2842447887	2842450448	289
454	iso_pu_bacteria	2842462802	2842465480	289
455	iso_pu_bacteria	2842469257	2842472290	289
456	iso_pu_bacteria	2842475841	2842481953	289
457	iso_pu_bacteria	2842482326	2842482569	289
458	iso_pu_bacteria	2842489311	2842495224	289
459	iso_pu_bacteria	2842495871	2842501832	289
460	iso_pu_bacteria	2842502639	2842508828	289
461	iso_pu_bacteria	2842509118	2842509415	289
462	iso_pu_bacteria	2844454524	2844455706	289
463	iso_pu_bacteria	2852387548	2852388745	289
464	iso_pu_bacteria	2857516855	2857523969	289
465	iso_pu_bacteria	2919100787	2919101121	289
466	iso_pu_bacteria	2919171160	2919171839	289
467	iso_pu_bacteria	2919408235	2919409014	289
468	iso_pu_bacteria	2923556063	2923557409	289
469	iso_pu_bacteria	2933016740	2933017310	289
470	iso_pu_bacteria	2933570622	2933573280	289
471	iso_pu_bacteria	2933586486	2933593721	289
472	iso_pu_bacteria	2933599457	2933604472	289
473	iso_pu_bacteria	2935894831	2935895660	289
474	iso_pu_bacteria	2935901341	2935907413	289
475	iso_pu_bacteria	2936367885	2936368686	289
476	iso_pu_bacteria	2936375103	2936379406	289
477	iso_pu_bacteria	2996887358	2996891971	289
478	iso_pu_bacteria	2996893221	2996893683	289
479	iso_pu_bacteria	3002141150	3002141338	289
480	iso_pu_bacteria	3005409236	3005411435	289
481	iso_pu_bacteria	3005416602	3005422595	289
482	iso_pu_bacteria	3005445848	3005446390	289
483	iso_pu_bacteria	3005452660	3005453072	289
484	iso_pu_bacteria	639633055	639646930	289
485	iso_pu_bacteria	8005258706	8005263706	289
486	iso_pu_bacteria	8005275841	8005279125	289
487	iso_pu_bacteria	8005282627	8005283786	289
488	iso_pu_bacteria	8005289223	8005291945	289
489	iso_pu_bacteria	8005301065	8005304093	289
490	iso_pu_bacteria	8005307578	8005311013	289
491	iso_pu_bacteria	8005314921	8005321868	289
492	iso_pu_bacteria	8005321885	8005326498	289
493	iso_pu_bacteria	8005376324	8005377193	289
494	iso_pu_bacteria	8005382845	8005387057	289
495	iso_pu_bacteria	8005395548	8005401818	289
496	iso_pu_bacteria	8005430974	8005436374	289
497	iso_pu_bacteria	8005460587	8005461315	289
498	iso_pu_bacteria	8005484373	8005485926	289
499	iso_pu_bacteria	8005497431	8005498902	289
500	iso_pu_bacteria	8005542996	8005543985	289
501	iso_pu_bacteria	8005556819	8005559210	289
502	iso_pu_bacteria	8005563573	8005569873	289
503	iso_pu_bacteria	8005570704	8005577179	289
504	iso_pu_bacteria	8005619151	8005620088	289
505	iso_pu_bacteria	8005626139	8005628691	289
506	iso_pu_bacteria	8005645114	8005646695	289
507	iso_pu_bacteria	8005668836	8005670315	289
508	iso_pu_bacteria	8005682033	8005684899	289
509	iso_pu_bacteria	8005695170	8005699025	289
510	iso_pu_bacteria	8018127388	8018133360	289
511	iso_pu_bacteria	8018163183	8018167074	289
512	iso_pu_bacteria	8018176218	8018179233	289
513	iso_pu_bacteria	8023680758	8023683967	289
514	iso_pu_bacteria	8024479707	8024480538	289
515	iso_pu_bacteria	8024486573	8024487692	289
516	iso_pu_bacteria	8024501048	8024502602	289
517	iso_pu_bacteria	8046767195	8046769766	289
518	iso_pu_bacteria	8054460903	8054461479	289
519	iso_pu_bacteria	8056375014	8056379127	289
520	iso_pu_bacteria	8056382006	8056386193	289
521	iso_pu_bacteria	8057575449	8057577383	289
522	iso_pu_bacteria	8057874678	8057881209	289
523	3300003781	Ga0055536_1038577	Ga0055536_10385771	290
524	3300039438	Ga0436360_0303139	Ga0436360_0303139_47_964	290
525	3300039438	Ga0436360_1234628	Ga0436360_1234628_319_1236	290
526	3300039447	Ga0436361_0085638	Ga0436361_0085638_522_1439	290
527	3300053122	Ga0500608_021746	Ga0500608_021746_129_1022	290
528	iso_pu_bacteria	2599185156	2599335260	290
529	iso_pu_bacteria	2842922631	2842927117	290
530	3300003323	rootH1_10114000	rootH1_101140002	291
531	3300005331	Ga0070670_100000105	Ga0070670_10000010549	291
532	3300005983	Ga0081540_1014373	Ga0081540_10143736	291
533	3300005983	Ga0081540_1098174	Ga0081540_10981742	291
534	3300009036	Ga0105244_10006625	Ga0105244_100066253	291
535	3300025925	Ga0207650_10000302	Ga0207650_1000030250	291
536	3300027312	Ga0209371_1004536	Ga0209371_10045363	291
537	3300028794	Ga0307515_10020054	Ga0307515_100200548	291
538	3300028794	Ga0307515_10124087	Ga0307515_101240872	291
539	3300030500	Ga0268256_1004024	Ga0268256_10040244	291
540	3300037471	Ga0395905_0034762	Ga0395905_0034762_3763_4659	291
541	3300037471	Ga0395905_0163236	Ga0395905_0163236_64_966	291
542	3300048927	Ga0496124_0000262	Ga0496124_0000262_22174_23070	291
543	3300053104	Ga0500556_0011201	Ga0500556_0011201_1578_2474	291
544	3300053153	Ga0500616_0037788	Ga0500616_0037788_1365_2261	291
545	3300053177	Ga0500636_0000023	Ga0500636_0000023_18939_19838	291
546	3300053177	Ga0500636_0000562	Ga0500636_0000562_7710_8606	291
547	3300001989	JGI24739J22299_10000806	JGI24739J22299_1000080611	292
548	3300002704	JGI25155J39150_1000006	JGI25155J39150_1000006115	292
549	3300002705	JGI25156J39149_1000019	JGI25156J39149_1000019130	292
550	3300002737	JGI25162J39368_1000003	JGI25162J39368_1000003256	292
551	3300002737	JGI25162J39368_1002807	JGI25162J39368_10028076	292
552	3300002737	JGI25162J39368_1002826	JGI25162J39368_10028261	292
553	3300002738	JGI25154J39366_1000055	JGI25154J39366_100005558	292
554	3300002741	JGI25157J39369_1000024	JGI25157J39369_100002432	292
555	3300002771	JGI25163J39215_1000015	JGI25163J39215_100001543	292
556	3300002772	JGI25164J39214_1000009	JGI25164J39214_100000934	292
557	3300002773	JGI25152J39213_1001438	JGI25152J39213_10014383	292
558	3300003187	JGI25151J46595_10003518	JGI25151J46595_100035183	292
559	3300003214	JGI25165J46597_1001090	JGI25165J46597_100109011	292
560	3300003215	JGI25153J46596_10010688	JGI25153J46596_100106885	292
561	3300003320	rootH2_10013369	rootH2_100133691	292
562	3300003322	rootL2_10024518	rootL2_1002451813	292
563	3300003354	JGI25160J50197_1003064	JGI25160J50197_10030642	292
564	3300003374	JGI25161J50226_1006127	JGI25161J50226_10061271	292
565	3300003751	Ga0055538_1000005	Ga0055538_1000005256	292
566	3300003752	Ga0055539_1000007	Ga0055539_1000007256	292
567	3300003756	Ga0055533_1000009	Ga0055533_1000009256	292
568	3300003759	Ga0055525_1000010	Ga0055525_1000010256	292
569	3300003771	Ga0055526_1009515	Ga0055526_10095154	292
570	3300003775	Ga0055524_1005682	Ga0055524_10056822	292
571	3300003775	Ga0055524_1014098	Ga0055524_10140983	292
572	3300003775	Ga0055524_1016636	Ga0055524_10166363	292
573	3300003781	Ga0055536_1008626	Ga0055536_10086265	292
574	3300003790	Ga0055528_1000462	Ga0055528_100046225	292
575	3300003791	Ga0055530_10018359	Ga0055530_100183593	292
576	3300003792	Ga0055540_1000353	Ga0055540_10003533	292
577	3300003792	Ga0055540_1009694	Ga0055540_10096944	292
578	3300003794	Ga0055531_10000882	Ga0055531_100008824	292
579	3300003841	Ga0055541_1000005	Ga0055541_1000005308	292
580	3300003856	Ga0058692_1001067	Ga0058692_10010674	292
581	3300003856	Ga0058692_1001381	Ga0058692_10013815	292
582	3300003856	Ga0058692_1001672	Ga0058692_10016726	292
583	3300003856	Ga0058692_1002841	Ga0058692_10028414	292
584	3300003856	Ga0058692_1003283	Ga0058692_10032834	292
585	3300003856	Ga0058692_1007699	Ga0058692_10076993	292
586	3300003856	Ga0058692_1007718	Ga0058692_10077183	292
587	3300004625	Ga0055543_1003199	Ga0055543_10031996	292
588	3300005289	Ga0065704_10239387	Ga0065704_102393871	292
589	3300005337	Ga0070682_100021900	Ga0070682_1000219003	292
590	3300005344	Ga0070661_100156540	Ga0070661_1001565402	292
591	3300005347	Ga0070668_100001974	Ga0070668_10000197415	292
592	3300005366	Ga0070659_100050337	Ga0070659_1000503373	292
593	3300005441	Ga0070700_100150901	Ga0070700_1001509011	292
594	3300005444	Ga0070694_100037549	Ga0070694_1000375492	292
595	3300005455	Ga0070663_100016889	Ga0070663_1000168894	292
596	3300005456	Ga0070678_100047798	Ga0070678_1000477983	292
597	3300005457	Ga0070662_100002901	Ga0070662_1000029014	292
598	3300005458	Ga0070681_10011052	Ga0070681_100110524	292
599	3300005530	Ga0070679_100013244	Ga0070679_1000132448	292
600	3300005539	Ga0068853_100277046	Ga0068853_1002770462	292
601	3300005546	Ga0070696_100027635	Ga0070696_1000276354	292
602	3300005547	Ga0070693_100019320	Ga0070693_1000193206	292
603	3300005549	Ga0070704_100264740	Ga0070704_1002647402	292
604	3300005564	Ga0070664_100254775	Ga0070664_1002547752	292
605	3300005577	Ga0068857_100099301	Ga0068857_1000993013	292
606	3300005615	Ga0070702_100024184	Ga0070702_1000241842	292
607	3300005617	Ga0068859_100259403	Ga0068859_1002594032	292
608	3300005840	Ga0068870_10062742	Ga0068870_100627422	292
609	3300006038	Ga0075365_10004157	Ga0075365_100041577	292
610	3300006038	Ga0075365_10005512	Ga0075365_100055127	292
611	3300006051	Ga0075364_10045437	Ga0075364_100454374	292
612	3300006177	Ga0075362_10018305	Ga0075362_100183054	292
613	3300006177	Ga0075362_10091813	Ga0075362_100918131	292
614	3300006178	Ga0075367_10000427	Ga0075367_1000042713	292
615	3300006186	Ga0075369_10002856	Ga0075369_100028566	292
616	3300006186	Ga0075369_10033306	Ga0075369_100333063	292
617	3300006186	Ga0075369_10038513	Ga0075369_100385132	292
618	3300006195	Ga0075366_10042042	Ga0075366_100420422	292
619	3300006931	Ga0097620_100259401	Ga0097620_1002594012	292
620	3300006946	Ga0079104_1000583	Ga0079104_10005839	292
621	3300006946	Ga0079104_1013299	Ga0079104_10132995	292
622	3300009011	Ga0105251_10001543	Ga0105251_100015435	292
623	3300009011	Ga0105251_10001666	Ga0105251_1000166614	292
624	3300009011	Ga0105251_10002277	Ga0105251_100022774	292
625	3300009011	Ga0105251_10005164	Ga0105251_100051643	292
626	3300009011	Ga0105251_10035618	Ga0105251_100356183	292
627	3300009011	Ga0105251_10053589	Ga0105251_100535892	292
628	3300009036	Ga0105244_10000414	Ga0105244_1000041425	292
629	3300009036	Ga0105244_10000675	Ga0105244_1000067531	292
630	3300009036	Ga0105244_10002388	Ga0105244_100023882	292
631	3300009036	Ga0105244_10003574	Ga0105244_1000357410	292
632	3300009036	Ga0105244_10005739	Ga0105244_100057396	292
633	3300009036	Ga0105244_10008641	Ga0105244_100086414	292
634	3300009036	Ga0105244_10048855	Ga0105244_100488552	292
635	3300009036	Ga0105244_10051216	Ga0105244_100512163	292
636	3300009036	Ga0105244_10150892	Ga0105244_101508922	292
637	3300009092	Ga0105250_10000003	Ga0105250_10000003444	292
638	3300009092	Ga0105250_10002510	Ga0105250_100025109	292
639	3300009092	Ga0105250_10006232	Ga0105250_100062323	292
640	3300009092	Ga0105250_10007039	Ga0105250_100070394	292
641	3300009101	Ga0105247_10000192	Ga0105247_1000019216	292
642	3300009174	Ga0105241_10000004	Ga0105241_10000004223	292
643	3300011119	Ga0105246_10068129	Ga0105246_100681294	292
644	3300013100	Ga0157373_10000201	Ga0157373_1000020121	292
645	3300013100	Ga0157373_10000465	Ga0157373_1000046529	292
646	3300013100	Ga0157373_10013195	Ga0157373_100131954	292
647	3300013102	Ga0157371_10000352	Ga0157371_1000035229	292
648	3300013102	Ga0157371_10002201	Ga0157371_1000220113	292
649	3300013306	Ga0163162_10031809	Ga0163162_100318094	292
650	3300013307	Ga0157372_10008056	Ga0157372_1000805610	292
651	3300013307	Ga0157372_10025977	Ga0157372_1002597710	292
652	3300013307	Ga0157372_10038079	Ga0157372_100380796	292
653	3300013307	Ga0157372_10046585	Ga0157372_100465853	292
654	3300013308	Ga0157375_10506017	Ga0157375_105060171	292
655	3300014497	Ga0182008_10001572	Ga0182008_1000157213	292
656	3300015261	Ga0182006_1003226	Ga0182006_10032269	292
657	3300017792	Ga0163161_10000004	Ga0163161_10000004162	292
658	3300017792	Ga0163161_10006578	Ga0163161_100065784	292
659	3300017792	Ga0163161_10240991	Ga0163161_102409913	292
660	3300025206	Ga0209435_100011	Ga0209435_100011113	292
661	3300025207	Ga0209760_100057	Ga0209760_10005747	292
662	3300025224	Ga0209784_100001	Ga0209784_100001799	292
663	3300025225	Ga0209566_100001	Ga0209566_100001799	292
664	3300025226	Ga0209674_100002	Ga0209674_100002799	292
665	3300025230	Ga0209563_100008	Ga0209563_100008802	292
666	3300025231	Ga0207427_100002	Ga0207427_100002476	292
667	3300025233	Ga0209437_100007	Ga0209437_100007254	292
668	3300025233	Ga0209437_100086	Ga0209437_10008610	292
669	3300025233	Ga0209437_100235	Ga0209437_10023548	292
670	3300025245	Ga0207425_1033364	Ga0207425_10333642	292
671	3300025246	Ga0209646_1000024	Ga0209646_1000024298	292
672	3300025250	Ga0209026_1000030	Ga0209026_1000030298	292
673	3300025253	Ga0209677_100004	Ga0209677_100004802	292
674	3300025256	Ga0209759_1000011	Ga0209759_1000011113	292
675	3300025258	Ga0209129_1000814	Ga0209129_100081411	292
676	3300025258	Ga0209129_1002723	Ga0209129_10027235	292
677	3300025261	Ga0209233_1000110	Ga0209233_1000110238	292
678	3300025261	Ga0209233_1012316	Ga0209233_10123161	292
679	3300025273	Ga0209673_1000015	Ga0209673_1000015185	292
680	3300025273	Ga0209673_1003500	Ga0209673_10035003	292
681	3300025273	Ga0209673_1017608	Ga0209673_10176084	292
682	3300025273	Ga0209673_1017611	Ga0209673_10176112	292
683	3300025292	Ga0209676_1032317	Ga0209676_10323172	292
684	3300025294	Ga0209025_1000205	Ga0209025_100020537	292
685	3300025294	Ga0209025_1041183	Ga0209025_10411831	292
686	3300025295	Ga0209564_1002078	Ga0209564_10020786	292
687	3300025295	Ga0209564_1010890	Ga0209564_10108902	292
688	3300025297	Ga0209758_1000620	Ga0209758_100062025	292
689	3300025297	Ga0209758_1002625	Ga0209758_10026256	292
690	3300025297	Ga0209758_1050273	Ga0209758_10502732	292
691	3300025298	Ga0209050_1002690	Ga0209050_10026904	292
692	3300025298	Ga0209050_1002861	Ga0209050_10028618	292
693	3300025299	Ga0209256_1002657	Ga0209256_10026572	292
694	3300025299	Ga0209256_1009237	Ga0209256_10092376	292
695	3300025299	Ga0209256_1017649	Ga0209256_10176493	292
696	3300025302	Ga0207426_1000406	Ga0207426_100040652	292
697	3300025303	Ga0209051_1000408	Ga0209051_100040825	292
698	3300025303	Ga0209051_1003930	Ga0209051_10039304	292
699	3300025303	Ga0209051_1017164	Ga0209051_10171642	292
700	3300025304	Ga0209257_1000882	Ga0209257_100088219	292
701	3300025304	Ga0209257_1005245	Ga0209257_10052452	292
702	3300025711	Ga0207696_1000004	Ga0207696_1000004190	292
703	3300025711	Ga0207696_1000033	Ga0207696_1000033115	292
704	3300025711	Ga0207696_1000192	Ga0207696_100019266	292
705	3300025711	Ga0207696_1000247	Ga0207696_100024741	292
706	3300025711	Ga0207696_1000655	Ga0207696_10006559	292
707	3300025711	Ga0207696_1000705	Ga0207696_10007054	292
708	3300025711	Ga0207696_1020502	Ga0207696_10205021	292
709	3300025728	Ga0207655_1000011	Ga0207655_1000011153	292
710	3300025728	Ga0207655_1000023	Ga0207655_1000023293	292
711	3300025728	Ga0207655_1000029	Ga0207655_1000029196	292
712	3300025728	Ga0207655_1000496	Ga0207655_100049611	292
713	3300025728	Ga0207655_1002600	Ga0207655_10026006	292
714	3300025728	Ga0207655_1003891	Ga0207655_10038917	292
715	3300025728	Ga0207655_1004702	Ga0207655_10047023	292
716	3300025728	Ga0207655_1005671	Ga0207655_10056715	292
717	3300025728	Ga0207655_1005732	Ga0207655_10057325	292
718	3300025728	Ga0207655_1017056	Ga0207655_10170565	292
719	3300025728	Ga0207655_1020883	Ga0207655_10208834	292
720	3300025735	Ga0207713_1000001	Ga0207713_1000001166	292
721	3300025735	Ga0207713_1000101	Ga0207713_1000101117	292
722	3300025735	Ga0207713_1000317	Ga0207713_10003174	292
723	3300025735	Ga0207713_1002229	Ga0207713_10022294	292
724	3300025735	Ga0207713_1020591	Ga0207713_10205913	292
725	3300025900	Ga0207710_10000016	Ga0207710_10000016235	292
726	3300025904	Ga0207647_10012406	Ga0207647_100124061	292
727	3300025908	Ga0207643_10152416	Ga0207643_101524162	292
728	3300025911	Ga0207654_10000006	Ga0207654_10000006239	292
729	3300025921	Ga0207652_10025796	Ga0207652_100257965	292
730	3300025924	Ga0207694_10067228	Ga0207694_100672282	292
731	3300025932	Ga0207690_10053974	Ga0207690_100539744	292
732	3300025933	Ga0207706_10024989	Ga0207706_100249894	292
733	3300026067	Ga0207678_10000721	Ga0207678_1000072128	292
734	3300026116	Ga0207674_10095221	Ga0207674_100952212	292
735	3300026121	Ga0207683_10148785	Ga0207683_101487853	292
736	3300027111	Ga0209281_1000008	Ga0209281_1000008633	292
737	3300027111	Ga0209281_1005687	Ga0209281_10056872	292
738	3300027312	Ga0209371_1000010	Ga0209371_1000010703	292
739	3300027312	Ga0209371_1000117	Ga0209371_10001175	292
740	3300027312	Ga0209371_1000146	Ga0209371_100014660	292
741	3300027312	Ga0209371_1000220	Ga0209371_100022047	292
742	3300027312	Ga0209371_1001330	Ga0209371_100133015	292
743	3300027312	Ga0209371_1001611	Ga0209371_10016119	292
744	3300027312	Ga0209371_1001852	Ga0209371_10018528	292
745	3300027312	Ga0209371_1003358	Ga0209371_10033584	292
746	3300027312	Ga0209371_1004337	Ga0209371_10043374	292
747	3300027312	Ga0209371_1009329	Ga0209371_10093294	292
748	3300028794	Ga0307515_10066787	Ga0307515_100667873	292
749	3300030500	Ga0268256_1000022	Ga0268256_1000022162	292
750	3300030500	Ga0268256_1000117	Ga0268256_100011756	292
751	3300030500	Ga0268256_1000508	Ga0268256_100050824	292
752	3300030500	Ga0268256_1001264	Ga0268256_10012644	292
753	3300030500	Ga0268256_1001432	Ga0268256_10014322	292
754	3300030500	Ga0268256_1001550	Ga0268256_10015508	292
755	3300030500	Ga0268256_1001623	Ga0268256_100162310	292
756	3300030500	Ga0268256_1004201	Ga0268256_10042012	292
757	3300030500	Ga0268256_1018923	Ga0268256_10189231	292
758	3300031456	Ga0307513_10022721	Ga0307513_100227216	292
759	3300033180	Ga0307510_10244613	Ga0307510_102446131	292
760	3300041405	Ga0439438_000001	Ga0439438_000001_2282_3160	292
761	3300041405	Ga0439438_002233	Ga0439438_002233_5099_5977	292
762	3300041407	Ga0439447_000441	Ga0439447_000441_9990_10868	292
763	3300041407	Ga0439447_002555	Ga0439447_002555_4756_5634	292
764	3300041407	Ga0439447_014161	Ga0439447_014161_799_1677	292
765	3300041411	Ga0439466_0000012	Ga0439466_0000012_24829_25707	292
766	3300041411	Ga0439466_0012345	Ga0439466_0012345_616_1494	292
767	3300041413	Ga0439465_0011289	Ga0439465_0011289_1788_2690	292
768	3300041413	Ga0439465_0017452	Ga0439465_0017452_70_969	292
769	3300042006	Ga0439432_013522	Ga0439432_013522_758_1636	292
770	3300042006	Ga0439432_016730	Ga0439432_016730_1318_2196	292
771	3300042006	Ga0439432_032249	Ga0439432_032249_473_1351	292
772	3300042007	Ga0439449_0027843	Ga0439449_0027843_1155_2054	292
773	3300042010	Ga0439452_000017	Ga0439452_000017_195723_196601	292
774	3300042146	Ga0450907_000202	Ga0450907_000202_8368_9246	292
775	3300042439	Ga0439464_0011137	Ga0439464_0011137_1465_2343	292
776	3300046452	Ga0495617_014301	Ga0495617_014301_963_1841	292
777	3300046453	Ga0495627_000136	Ga0495627_000136_1035_1913	292
778	3300046458	Ga0495591_000028	Ga0495591_000028_180825_181703	292
779	3300046460	Ga0495638_0003268	Ga0495638_0003268_3819_4718	292
780	3300046471	Ga0495650_0000033	Ga0495650_0000033_275262_276140	292
781	3300046491	Ga0495584_0018333	Ga0495584_0018333_519_1397	292
782	3300046492	Ga0495585_0073035	Ga0495585_0073035_728_1627	292
783	3300046507	Ga0495606_0000627	Ga0495606_0000627_4499_5377	292
784	3300046507	Ga0495606_0006905	Ga0495606_0006905_566_1483	292
785	3300046512	Ga0495610_0003869	Ga0495610_0003869_465_1364	292
786	3300046520	Ga0495637_0086274	Ga0495637_0086274_269_1147	292
787	3300046522	Ga0495643_0074605	Ga0495643_0074605_595_1473	292
788	3300046523	Ga0495644_0001706	Ga0495644_0001706_34_912	292
789	3300046524	Ga0495648_0003080	Ga0495648_0003080_11604_12482	292
790	3300046524	Ga0495648_0029881	Ga0495648_0029881_961_1839	292
791	3300046530	Ga0495654_0000020	Ga0495654_0000020_130758_131636	292
792	3300046530	Ga0495654_0000032	Ga0495654_0000032_45558_46436	292
793	3300046530	Ga0495654_0000945	Ga0495654_0000945_16548_17426	292
794	3300046530	Ga0495654_0010357	Ga0495654_0010357_1411_2289	292
795	3300046530	Ga0495654_0010943	Ga0495654_0010943_62_940	292
796	3300046542	Ga0495597_0000215	Ga0495597_0000215_6358_7236	292
797	3300046558	Ga0495633_0049161	Ga0495633_0049161_110_1009	292
798	3300046615	Ga0495656_0052005	Ga0495656_0052005_743_1642	292
799	3300046660	Ga0495625_0003054	Ga0495625_0003054_790_1668	292
800	3300046665	Ga0495661_0119588	Ga0495661_0119588_164_1063	292
801	3300046674	Ga0495588_0015157	Ga0495588_0015157_523_1401	292
802	3300046692	Ga0495671_0020033	Ga0495671_0020033_1039_1917	292
803	3300046794	Ga0495589_0000006	Ga0495589_0000006_253118_253996	292
804	3300046794	Ga0495589_0007123	Ga0495589_0007123_788_1666	292
805	3300046810	Ga0495660_0000011	Ga0495660_0000011_99994_100872	292
806	3300046810	Ga0495660_0024693	Ga0495660_0024693_1750_2628	292
807	3300047317	Ga0495604_0066406	Ga0495604_0066406_663_1565	292
808	3300047320	Ga0495672_0000004	Ga0495672_0000004_435800_436678	292
809	3300047320	Ga0495672_0000061	Ga0495672_0000061_33308_34186	292
810	3300047320	Ga0495672_0000145	Ga0495672_0000145_92388_93266	292
811	3300047320	Ga0495672_0065267	Ga0495672_0065267_1153_2052	292
812	3300047323	Ga0495683_0011735	Ga0495683_0011735_2041_2919	292
813	3300047443	Ga0495687_065400	Ga0495687_065400_451_1350	292
814	3300047446	Ga0495679_000101	Ga0495679_000101_73620_74498	292
815	3300047469	Ga0495673_0000023	Ga0495673_0000023_388975_389853	292
816	3300047470	Ga0495681_0029501	Ga0495681_0029501_774_1652	292
817	3300047470	Ga0495681_0044491	Ga0495681_0044491_1062_1961	292
818	3300047472	Ga0495686_0001564	Ga0495686_0001564_8393_9310	292
819	3300047472	Ga0495686_0009610	Ga0495686_0009610_262_1161	292
820	3300047472	Ga0495686_0106854	Ga0495686_0106854_150_1052	292
821	3300048091	Ga0495626_0073209	Ga0495626_0073209_521_1420	292
822	3300048903	Ga0496100_0015795	Ga0496100_0015795_3227_4105	292
823	3300048903	Ga0496100_0104256	Ga0496100_0104256_605_1483	292
824	3300048904	Ga0496101_0000029	Ga0496101_0000029_23101_23979	292
825	3300048905	Ga0496102_0010820	Ga0496102_0010820_3078_3956	292
826	3300048908	Ga0496105_0027002	Ga0496105_0027002_541_1419	292
827	3300048908	Ga0496105_0092696	Ga0496105_0092696_649_1527	292
828	3300048919	Ga0496116_0000031	Ga0496116_0000031_231362_232240	292
829	3300048919	Ga0496116_0004222	Ga0496116_0004222_10359_11237	292
830	3300048919	Ga0496116_0011384	Ga0496116_0011384_3419_4297	292
831	3300048919	Ga0496116_0053568	Ga0496116_0053568_1291_2169	292
832	3300048920	Ga0496117_0000004	Ga0496117_0000004_847253_848131	292
833	3300048920	Ga0496117_0000853	Ga0496117_0000853_28728_29606	292
834	3300048920	Ga0496117_0003954	Ga0496117_0003954_6919_7797	292
835	3300048920	Ga0496117_0030277	Ga0496117_0030277_2926_3825	292
836	3300048920	Ga0496117_0050019	Ga0496117_0050019_450_1328	292
837	3300048920	Ga0496117_0055522	Ga0496117_0055522_1794_2672	292
838	3300048921	Ga0496118_0000024	Ga0496118_0000024_355358_356236	292
839	3300048921	Ga0496118_0001266	Ga0496118_0001266_19095_19973	292
840	3300048921	Ga0496118_0010980	Ga0496118_0010980_244_1122	292
841	3300048921	Ga0496118_0033305	Ga0496118_0033305_2330_3229	292
842	3300048922	Ga0496119_0000043	Ga0496119_0000043_22929_23807	292
843	3300048922	Ga0496119_0001522	Ga0496119_0001522_4985_5863	292
844	3300048922	Ga0496119_0001699	Ga0496119_0001699_3152_4030	292
845	3300048922	Ga0496119_0001837	Ga0496119_0001837_22574_23452	292
846	3300048922	Ga0496119_0003666	Ga0496119_0003666_2220_3098	292
847	3300048922	Ga0496119_0006217	Ga0496119_0006217_4986_5864	292
848	3300048922	Ga0496119_0016418	Ga0496119_0016418_2384_3262	292
849	3300048922	Ga0496119_0054276	Ga0496119_0054276_1277_2155	292
850	3300048923	Ga0496120_0000009	Ga0496120_0000009_165307_166185	292
851	3300048923	Ga0496120_0000429	Ga0496120_0000429_6809_7687	292
852	3300048923	Ga0496120_0000522	Ga0496120_0000522_26753_27631	292
853	3300048923	Ga0496120_0000703	Ga0496120_0000703_22928_23806	292
854	3300048923	Ga0496120_0000985	Ga0496120_0000985_17263_18141	292
855	3300048923	Ga0496120_0001034	Ga0496120_0001034_14801_15679	292
856	3300048923	Ga0496120_0001493	Ga0496120_0001493_4985_5863	292
857	3300048923	Ga0496120_0004746	Ga0496120_0004746_4986_5864	292
858	3300048924	Ga0496121_0000131	Ga0496121_0000131_14445_15323	292
859	3300048924	Ga0496121_0016470	Ga0496121_0016470_5358_6275	292
860	3300048925	Ga0496122_0002288	Ga0496122_0002288_21820_22698	292
861	3300048926	Ga0496123_0000651	Ga0496123_0000651_19102_19980	292
862	3300048926	Ga0496123_0002672	Ga0496123_0002672_6991_7869	292
863	3300048926	Ga0496123_0054599	Ga0496123_0054599_276_1154	292
864	3300048926	Ga0496123_0083208	Ga0496123_0083208_670_1569	292
865	3300048926	Ga0496123_0110863	Ga0496123_0110863_235_1134	292
866	3300048927	Ga0496124_0000039	Ga0496124_0000039_285209_286087	292
867	3300048927	Ga0496124_0000156	Ga0496124_0000156_72092_72970	292
868	3300048927	Ga0496124_0002368	Ga0496124_0002368_10571_11449	292
869	3300048927	Ga0496124_0003823	Ga0496124_0003823_4569_5447	292
870	3300048927	Ga0496124_0007776	Ga0496124_0007776_3222_4100	292
871	3300048927	Ga0496124_0015369	Ga0496124_0015369_5776_6654	292
872	3300048927	Ga0496124_0044144	Ga0496124_0044144_2305_3183	292
873	3300048928	Ga0496125_0006498	Ga0496125_0006498_272_1150	292
874	3300048929	Ga0496126_0093360	Ga0496126_0093360_1115_1993	292
875	3300048929	Ga0496126_0241558	Ga0496126_0241558_316_1215	292
876	3300048929	Ga0496126_0413039	Ga0496126_0413039_170_1048	292
877	3300049459	Ga0495678_000388	Ga0495678_000388_22151_23029	292
878	3300049460	Ga0495682_0000004	Ga0495682_0000004_137073_137951	292
879	3300049582	Ga0501048_0000685	Ga0501048_0000685_4341_5240	292
880	3300049589	Ga0501073_0032898	Ga0501073_0032898_834_1733	292
881	3300049776	Ga0501280_012431	Ga0501280_012431_163_1062	292
882	3300049823	Ga0501044_0270980	Ga0501044_0270980_667_1563	292
883	3300050491	nmdc:mga00v17_15227_c1	nmdc:mga00v17_15227_c1_1551_2429	292
884	3300050491	nmdc:mga00v17_53867_c1	nmdc:mga00v17_53867_c1_1547_2425	292
885	3300050516	nmdc:mga0sz30_42923_c1	nmdc:mga0sz30_42923_c1_642_1541	292
886	3300053086	Ga0500578_0109880	Ga0500578_0109880_130_1029	292
887	3300053126	Ga0500621_000001	Ga0500621_000001_195073_195951	292
888	3300053139	Ga0500568_0001297	Ga0500568_0001297_6909_7808	292
889	3300053153	Ga0500616_0000758	Ga0500616_0000758_13442_14341	292
890	3300053153	Ga0500616_0003660	Ga0500616_0003660_8950_9849	292
891	3300053153	Ga0500616_0024187	Ga0500616_0024187_1933_2832	292
892	iso_pu_bacteria	8005658619	8005660559	292
893	2162886007	SwRhRL2b_contig_1608559	SwRhRL2b_0653.00003600	293
894	3300009036	Ga0105244_10000048	Ga0105244_1000004826	293
895	3300009036	Ga0105244_10000964	Ga0105244_100009641	293
896	3300009036	Ga0105244_10001774	Ga0105244_100017748	293
897	3300009036	Ga0105244_10011964	Ga0105244_100119646	293
898	3300009092	Ga0105250_10000143	Ga0105250_1000014316	293
899	3300013102	Ga0157371_10000007	Ga0157371_10000007233	293
900	3300013104	Ga0157370_10000122	Ga0157370_1000012269	293
901	3300013306	Ga0163162_10020008	Ga0163162_100200083	293
902	3300046471	Ga0495650_0000016	Ga0495650_0000016_424652_425533	293
903	3300046500	Ga0495596_0002782	Ga0495596_0002782_3704_4621	293
904	3300046810	Ga0495660_0000007	Ga0495660_0000007_355241_356122	293
905	3300048907	Ga0496104_0011288	Ga0496104_0011288_4263_5144	293
906	3300048919	Ga0496116_0000054	Ga0496116_0000054_92093_92974	293
907	3300048920	Ga0496117_0008072	Ga0496117_0008072_4583_5464	293
908	3300048920	Ga0496117_0052350	Ga0496117_0052350_104_985	293
909	3300048921	Ga0496118_0011739	Ga0496118_0011739_5015_5896	293
910	3300048923	Ga0496120_0003807	Ga0496120_0003807_4107_4988	293
911	3300048925	Ga0496122_0000013	Ga0496122_0000013_403039_403920	293
912	3300048926	Ga0496123_0000010	Ga0496123_0000010_97120_98001	293
913	3300048927	Ga0496124_0000010	Ga0496124_0000010_186514_187395	293
914	3300048928	Ga0496125_0000019	Ga0496125_0000019_344858_345739	293
915	3300048929	Ga0496126_0000252	Ga0496126_0000252_71463_72344	293
916	3300053125	Ga0500618_001066	Ga0500618_001066_10155_11060	293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

26

303

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6xpn-assembly2.cif.gz_A	z-loop deletion mutant of aztc from paracoccus denitrificans	0.9687	25	292
5kzj-assembly2.cif.gz_B	loop deletion mutant of paracoccus denitrificans aztc	0.9663	23	292
3ujp-assembly1.cif.gz_B-2	structure of mntc protein at 2.7a	0.9633	23	292
5w57-assembly1.cif.gz_A	structure of holo aztc	0.9581	23	292
7me1-assembly2.cif.gz_B	yfea oligomer crystal 1, form 1	0.9563	23	290

ID	Description	Score	Start	End	Superfamily
5w57A02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain	0.9638	169	292	3.40.50.1980
4irmB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain	0.9613	26	171	3.40.50.1980
1toaB02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain	0.9483	169	293	3.40.50.1980
4oxrA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain	0.9426	24	162	3.40.50.1980
5jpdA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain	0.9415	165	292	3.40.50.1980

ID	Description	Score	Start	End	GO Terms
AF-A0A7D3QUQ1-F1-model_v4	Manganese ABC transporter substrate-binding lipoprotein	0.9949	48	280	GO:0007155 GO:0030001 GO:0030313 GO:0046872
AF-A0A6N9C2V5-F1-model_v4	Metal ABC transporter substrate-binding protein	0.9876	122	292	GO:0007155 GO:0030001 GO:0030313 GO:0046872
AF-A0A7D3QUQ1-F1-model_v4	Manganese ABC transporter substrate-binding lipoprotein	0.9864	48	280	GO:0007155 GO:0030001 GO:0030313 GO:0046872
AF-A0A257PME4-F1-model_v4	ABC transporter substrate-binding protein	0.978	19	292	GO:0007155 GO:0030001 GO:0030313 GO:0046872
AF-A0A2X5ED50-F1-model_v4	deleted	0.9774	2	293

Feature Viewer

pLDDT	pTM	Quality
91.64	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F485631

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

26

303

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map