F485607

General Info

Members Datasets Scaffolds Average Seq Length
915 593 581 166

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2526164512|2526213938
Length 167
Sequence APLLLSPRPLEAAAFAPYGQVIEPGAARRVLEINGGTARRFHDLARIEPGPEGRVLVSIFQAEPRQLPLLVTLMERHPLASQAFMPLSGRPYLVLVAAPGEELRAASLQLFLAAPGQGVNFNPGTWHHPLLALEGPSDFLVIDREGPGNNCEERALDQPCAIAAGRA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
29 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
30 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
31 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
32 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
33 2519899620 Rhizobium sp. Pop5 Isolate Nodule
34 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
35 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
36 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
37 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
40 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
41 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
42 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
43 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
44 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
45 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
46 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
47 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
48 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
49 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
50 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
51 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
52 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
53 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
54 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
57 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
58 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
59 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
60 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
61 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
62 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
63 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
66 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
67 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
68 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
69 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
70 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
71 2643221557 Ensifer sp. Root558 Isolate Unclassified
72 2643221558 Rhizobium sp. Root149 Isolate Unclassified
73 2643221568 Rhizobium sp. Root564 Isolate Unclassified
74 2643221599 Rhizobium sp. Root708 Isolate Unclassified
75 2643221607 Rhizobium sp. Root73 Isolate Unclassified
76 2643221610 Ensifer sp. Root74 Isolate Unclassified
77 2643221618 Ensifer sp. Root231 Isolate Unclassified
78 2643221626 Ensifer sp. Root31 Isolate Unclassified
79 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
80 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
81 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
82 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
83 2643221655 Ensifer sp. Root1252 Isolate Unclassified
84 2643221659 Ensifer sp. Root127 Isolate Unclassified
85 2643221668 Ensifer sp. Root423 Isolate Unclassified
86 2643221675 Ensifer sp. Root1298 Isolate Unclassified
87 2643221680 Ensifer sp. Root1312 Isolate Unclassified
88 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
89 2643221688 Rhizobium sp. Root482 Isolate Unclassified
90 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
91 2643221698 Ensifer sp. Root142 Isolate Unclassified
92 2643221712 Ensifer sp. Root258 Isolate Unclassified
93 2643221719 Rhizobium sp. Root274 Isolate Unclassified
94 2643221723 Ensifer sp. Root278 Isolate Unclassified
95 2643221726 Ensifer sp. Root954 Isolate Unclassified
96 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
97 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
98 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
99 2718217882 Rhizobium sp. N741 Isolate Nodule
100 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
101 2718218009 Rhizobium sp. N561 Isolate Nodule
102 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
103 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
104 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
105 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
106 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
107 2718218363 Rhizobium sp. N113 Isolate Nodule
108 2718218365 Rhizobium sp. N731 Isolate Nodule
109 2718218366 Rhizobium sp. N621 Isolate Nodule
110 2718218423 Rhizobium sp. N941 Isolate Nodule
111 2721755514 Rhizobium sp. N6212 Isolate Nodule
112 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
113 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
114 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
115 2721755809 Rhizobium sp. N541 Isolate Nodule
116 2721755810 Rhizobium sp. N871 Isolate Nodule
117 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
118 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
119 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
120 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
121 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
122 2728369365 Rhizobium sp. N1341 Isolate Nodule
123 2728369397 Rhizobium sp. N1314 Isolate Nodule
124 2738541293 Rhizobium sp. GV031 Isolate Unclassified
125 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
126 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
127 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
128 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
129 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
130 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
131 2791355256 Rhizobium sp. M10 Isolate Nodule
132 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
133 2791355260 Rhizobium sp. L9 Isolate Nodule
134 2791355261 Rhizobium sp. J15 Isolate Nodule
135 2791355262 Rhizobium sp. M1 Isolate Nodule
136 2791355263 Rhizobium chutanense C5 Isolate Nodule
137 2791355264 Rhizobium sp. S9 Isolate Nodule
138 2791355265 Rhizobium sp. H4 Isolate Nodule
139 2791355266 Rhizobium sp. L43 Isolate Nodule
140 2791355267 Rhizobium sp. L18 Isolate Nodule
141 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
142 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
143 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
144 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
145 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
146 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
147 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
148 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
149 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
150 2802429633 Rhizobium anhuiense J3 Isolate Nodule
151 2802429634 Rhizobium anhuiense S10 Isolate Nodule
152 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
153 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
154 2802429637 Rhizobium anhuiense C15 Isolate Nodule
155 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
156 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
157 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
158 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
159 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
160 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
161 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
162 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
163 2838048938 Rhizobium pisi 27/80 Isolate Nodule
164 2838061910 Rhizobium phaseoli L15 Isolate Nodule
165 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
166 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
167 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
168 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
169 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
170 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
171 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
172 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
173 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
174 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
175 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
176 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
177 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
178 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
179 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
180 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
181 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
182 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
183 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
184 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
185 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
186 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
187 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
188 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
189 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
190 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
191 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
192 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
193 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
194 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
195 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
196 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
197 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
198 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
199 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
200 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
201 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
202 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
203 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
204 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
205 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
206 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
207 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
208 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
209 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
210 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
211 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
212 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
213 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
214 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
215 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
216 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
217 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
218 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
219 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
220 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
221 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
222 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
223 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
224 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
225 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
226 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
227 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
228 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
229 2844163670 Ensifer sp. 1H6 Isolate Unclassified
230 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
231 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
232 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
233 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
234 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
235 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
236 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
237 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
238 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
239 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
240 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
241 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
242 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
243 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
244 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
245 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
246 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
247 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
248 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
249 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
250 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
251 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
252 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
253 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
254 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
255 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
256 2933599457 Rhizobium phaseoli M3 Isolate Nodule
257 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
258 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
259 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
260 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
261 2936381700 Rhizobium chutanense C16 Isolate Unclassified
262 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
263 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
264 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
265 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
266 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
267 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
268 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
269 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
270 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
271 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
272 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
273 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
274 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
275 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
276 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
277 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
278 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
279 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
280 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
281 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
282 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
283 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
284 2996887358 Rhizobium sp. R711 Isolate Nodule
285 2996893221 Rhizobium sp. R635 Isolate Nodule
286 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
287 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
288 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
289 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
290 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
291 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
292 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
293 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
294 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
295 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
296 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
297 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
298 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
299 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
300 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
301 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
302 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
303 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
304 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
305 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
306 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
307 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
308 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
309 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
310 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
311 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
312 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
313 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
314 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
315 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
316 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
317 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
318 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
319 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
320 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
321 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
322 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
323 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
324 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
325 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
326 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
327 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
328 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
329 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
330 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
331 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
332 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
333 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
334 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
335 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
336 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
337 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
338 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
339 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
340 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
341 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
342 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
343 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
344 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
345 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
346 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
347 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
348 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
349 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
350 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
351 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
352 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
353 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
354 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
355 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
356 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
357 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
358 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
359 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
360 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
361 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
362 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
363 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
364 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
365 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
366 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
367 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
369 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
370 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
371 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
373 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
374 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
377 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
379 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
382 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
399 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
401 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
403 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
404 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
405 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
406 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
407 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
408 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
409 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
410 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
411 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
412 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
413 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
414 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
415 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
416 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
417 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
418 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
419 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
420 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
421 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
422 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
423 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
424 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
425 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
426 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
427 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
428 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
429 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
430 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
431 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
432 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
433 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
434 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
435 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
436 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
437 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
438 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
439 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
440 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
441 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
442 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
443 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
444 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
445 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
446 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
447 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
448 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
449 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
450 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
451 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
452 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
453 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
454 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
455 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
456 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
457 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
458 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
459 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
460 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
461 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
465 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
466 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
467 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
468 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
469 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
470 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
471 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
472 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
473 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
474 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
475 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
476 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
477 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
478 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
479 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
480 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
481 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
482 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
483 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
484 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
485 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
486 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
487 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
490 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
491 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
492 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
493 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
494 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
495 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
496 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
497 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
498 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
499 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
500 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
501 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
502 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
503 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
504 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
514 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
515 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
516 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
517 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
518 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
520 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
521 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
522 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
523 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
524 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
525 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
526 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
527 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
528 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
529 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
530 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
531 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
532 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
533 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
534 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
535 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
536 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
537 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
538 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
541 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
544 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
545 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
546 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
547 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
548 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
549 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
550 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
551 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
552 8005258706 Rhizobium sp. R693 Isolate Nodule
553 8005275841 Rhizobium sp. N4311 Isolate Nodule
554 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
555 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
556 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
557 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
558 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
559 8005321885 Rhizobium sp. R72 Isolate Nodule
560 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
561 8005382845 Rhizobium sp. R634 Isolate Nodule
562 8005395548 Rhizobium sp. R339 Isolate Nodule
563 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
564 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
565 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
566 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
567 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
568 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
569 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
570 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
571 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
572 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
573 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
574 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
575 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
576 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
577 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
578 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
579 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
580 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
581 8018176218 Rhizobium sp. N122 Isolate Nodule
582 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
583 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
584 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
585 8024501048 Rhizobium sp. H4 Isolate Nodule
586 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
587 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
588 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
589 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
590 8056382006 Rhizobium croatiense 13T Isolate Nodule
591 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
592 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
593 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.5
Metatranscriptomes 0
Isolates 36.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 22.84
Nodule 26.12
Rhizoplane 2.95
Rhizosphere 25.68
Stem 0
Stem Tuber 0
Unclassified 22.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000083 3300002705 Bacteria 70138
2 JGI25162J39368_1000217 3300002737 Bacteria 59945
3 JGI25162J39368_1000272 3300002737 Bacteria 49890
4 JGI25162J39368_1000416 3300002737 Bacteria 34791
5 JGI25154J39366_1000052 3300002738 Bacteria 120209
6 JGI25158J39367_1000097 3300002739 Bacteria 20403
7 JGI25157J39369_1000110 3300002741 Bacteria 69643
8 JGI25152J39213_1001348 3300002773 Bacteria 10778
9 JGI25152J39213_1002158 3300002773 Bacteria 7716
10 JGI25152J39213_1004295 3300002773 Bacteria 4541
11 JGI25152J39213_1004334 3300002773 Bacteria 4506
12 JGI25152J39213_1009466 3300002773 Bacteria 2313
13 JGI25150J39212_1000100 3300002774 Bacteria 49138
14 JGI25150J39212_1003426 3300002774 Bacteria 3708
15 JGI25159J45721_1000004 3300002987 Bacteria 215789
16 JGI25159J45721_1000832 3300002987 Bacteria 13465
17 JGI25159J45721_1005369 3300002987 Bacteria 4035
18 JGI25151J46595_10000146 3300003187 Bacteria 93373
19 JGI25151J46595_10002021 3300003187 Bacteria 12689
20 JGI25151J46595_10003013 3300003187 Bacteria 9572
21 JGI25151J46595_10005988 3300003187 Bacteria 6192
22 JGI25151J46595_10027604 3300003187 Bacteria 2272
23 JGI25165J46597_1000363 3300003214 Bacteria 50542
24 JGI25165J46597_1000767 3300003214 Bacteria 24591
25 JGI25165J46597_1005503 3300003214 Bacteria 2428
26 JGI25153J46596_10000764 3300003215 Bacteria 19680
27 JGI25153J46596_10002359 3300003215 Bacteria 10937
28 JGI25153J46596_10004820 3300003215 Bacteria 7185
29 JGI25153J46596_10009056 3300003215 Bacteria 4677
30 JGI25153J46596_10009420 3300003215 Bacteria 4541
31 JGI25153J46596_10009505 3300003215 Bacteria 4506
32 rootH1_10095586 3300003316 Bacteria 1605
33 rootH2_10153370 3300003320 Bacteria 3052
34 rootL2_10044385 3300003322 Bacteria 6042
35 rootL2_10144352 3300003322 Bacteria 1299
36 rootL2_10226363 3300003322 Bacteria 1012
37 rootH1_10100409 3300003323 Bacteria 3026
38 rootH1_10142840 3300003323 Bacteria 1407
39 rootH1_10174238 3300003323 Bacteria 1288
40 rootH1_10218912 3300003323 Bacteria 3221
41 JGI25160J50197_1000001 3300003354 Bacteria 782301
42 JGI25160J50197_1000021 3300003354 Bacteria 215789
43 JGI25160J50197_1000351 3300003354 Bacteria 30617
44 JGI25160J50197_1018193 3300003354 Bacteria 2197
45 JGI25161J50226_1000001 3300003374 Bacteria 655036
46 JGI25161J50226_1000167 3300003374 Bacteria 45203
47 JGI25161J50226_1000534 3300003374 Bacteria 16346
48 JGI25161J50226_1005657 3300003374 Bacteria 2382
49 Ga0055526_1000842 3300003771 Bacteria 22899
50 Ga0055526_1003643 3300003771 Bacteria 9648
51 Ga0055526_1004423 3300003771 Bacteria 8446
52 Ga0055526_1005849 3300003771 Bacteria 6907
53 Ga0055526_1063234 3300003771 Bacteria 779
54 Ga0055524_1000572 3300003775 Bacteria 27327
55 Ga0055524_1002425 3300003775 Bacteria 9616
56 Ga0055524_1003892 3300003775 Bacteria 7079
57 Ga0055524_1007700 3300003775 Bacteria 4549
58 Ga0055524_1013955 3300003775 Bacteria 3002
59 Ga0055528_1000158 3300003790 Bacteria 56769
60 Ga0055528_1000749 3300003790 Bacteria 22632
61 Ga0055528_1003189 3300003790 Bacteria 8389
62 Ga0055528_1006485 3300003790 Bacteria 5304
63 Ga0055528_1009307 3300003790 Bacteria 4115
64 Ga0055528_1009987 3300003790 Bacteria 3910
65 Ga0055528_1028730 3300003790 Bacteria 1526
66 Ga0055540_1000518 3300003792 Bacteria 29203
67 Ga0055540_1005724 3300003792 Bacteria 5129
68 Ga0055540_1006013 3300003792 Bacteria 4916
69 Ga0055540_1028060 3300003792 Bacteria 1336
70 Ga0055540_1061240 3300003792 Bacteria 752
71 Ga0058692_1019323 3300003856 Bacteria 1453
72 Ga0055543_1000060 3300004625 Bacteria 98330
73 Ga0055543_1000102 3300004625 Bacteria 73861
74 Ga0055543_1000216 3300004625 Bacteria 46311
75 Ga0055543_1000699 3300004625 Bacteria 17145
76 Ga0065165_1000008 3300005262 Bacteria 334429
77 Ga0065165_1000033 3300005262 Bacteria 215827
78 Ga0065165_1004363 3300005262 Bacteria 8852
79 Ga0065165_1024721 3300005262 Bacteria 2011
80 Ga0070670_100001104 3300005331 Bacteria 21445
81 Ga0070682_100093382 3300005337 Bacteria 1973
82 Ga0070668_100017103 3300005347 Bacteria 5428
83 Ga0070671_100033648 3300005355 Bacteria 4241
84 Ga0070663_100013668 3300005455 Bacteria 5186
85 Ga0070662_100218583 3300005457 Bacteria 1519
86 Ga0070665_100033521 3300005548 Bacteria 5167
87 Ga0070665_100077343 3300005548 Bacteria 3334
88 Ga0068855_100081851 3300005563 Bacteria 3742
89 Ga0070664_101564288 3300005564 Bacteria 624
90 Ga0068856_100069955 3300005614 Bacteria 3471
91 Ga0068852_100100370 3300005616 Bacteria 2611
92 Ga0068864_101465118 3300005618 Bacteria 685
93 Ga0068851_10083539 3300005834 Bacteria 1671
94 Ga0075365_10007766 3300006038 Bacteria 6041
95 Ga0075365_10010140 3300006038 Bacteria 5469
96 Ga0075363_100019422 3300006048 Bacteria 3398
97 Ga0075363_100246900 3300006048 Bacteria 1027
98 Ga0075364_10015660 3300006051 Bacteria 4706
99 Ga0075367_10000779 3300006178 Bacteria 12517
100 Ga0075367_10011013 3300006178 Bacteria 4769
101 Ga0075369_10003894 3300006186 Bacteria 5473
102 Ga0075369_10013982 3300006186 Bacteria 3198
103 Ga0075366_10003058 3300006195 Bacteria 8734
104 Ga0075370_10002851 3300006353 Bacteria 8118
105 Ga0075370_10003951 3300006353 Bacteria 7122
106 Ga0075370_10145512 3300006353 Bacteria 1387
107 Ga0079104_1002930 3300006946 Bacteria 8469
108 Ga0105251_10178836 3300009011 Bacteria 956
109 Ga0105244_10110776 3300009036 Bacteria 1336
110 Ga0105240_10000014 3300009093 Bacteria 482033
111 Ga0105242_11072798 3300009176 Bacteria 818
112 Ga0105248_10253766 3300009177 Bacteria 1979
113 Ga0105237_10002158 3300009545 Bacteria 24754
114 Ga0105238_10322407 3300009551 Bacteria 1531
115 Ga0105249_10082826 3300009553 Bacteria 2985
116 Ga0123341_1000035 3300009765 Bacteria 62072
117 Ga0123342_1009440 3300009766 Bacteria 11684
118 Ga0123342_1011443 3300009766 Bacteria 9682
119 Ga0105239_10010022 3300010375 Bacteria 10629
120 Ga0157322_1000730 3300012490 Bacteria 1376
121 Ga0157314_1019153 3300012500 Bacteria 682
122 Ga0157371_10010788 3300013102 Bacteria 7093
123 Ga0157370_10000329 3300013104 Bacteria 59662
124 Ga0157370_10222128 3300013104 Bacteria 1750
125 Ga0157369_10024034 3300013105 Bacteria 6781
126 Ga0157369_10137963 3300013105 Bacteria 2581
127 Ga0171463_1007 3300013249 Bacteria 301198
128 Ga0157374_10432742 3300013296 Bacteria 1315
129 Ga0163162_11225313 3300013306 Bacteria 852
130 Ga0182008_10047466 3300014497 Bacteria 2133
131 Ga0182007_10149017 3300015262 Bacteria 794
132 Ga0182005_1000982 3300015265 Bacteria 12354
133 Ga0183363_1071 3300015690 Bacteria 30324
134 Ga0214542_1000268 3300021321 Bacteria 87082
135 Ga0214543_1000022 3300021327 Bacteria 241930
136 Ga0214543_1000219 3300021327 Bacteria 87102
137 Ga0228711_1000911 3300022739 Bacteria 40698
138 Ga0228710_1001018 3300022740 Bacteria 40304
139 Ga0209435_100027 3300025206 Bacteria 196217
140 Ga0209436_100081 3300025208 Bacteria 48215
141 Ga0209436_101492 3300025208 Bacteria 8099
142 Ga0209437_100051 3300025233 Bacteria 392523
143 Ga0209437_100060 3300025233 Bacteria 355034
144 Ga0209437_120317 3300025233 Bacteria 819
145 Ga0207425_1000046 3300025245 Bacteria 189433
146 Ga0207425_1002771 3300025245 Bacteria 5954
147 Ga0207425_1004453 3300025245 Bacteria 4198
148 Ga0207425_1005031 3300025245 Bacteria 3841
149 Ga0207425_1011923 3300025245 Bacteria 2056
150 Ga0209646_1000086 3300025246 Bacteria 196217
151 Ga0209026_1000082 3300025250 Bacteria 196315
152 Ga0209677_100540 3300025253 Bacteria 21044
153 Ga0209759_1000063 3300025256 Bacteria 196315
154 Ga0209129_1000171 3300025258 Bacteria 95724
155 Ga0209129_1000283 3300025258 Bacteria 48305
156 Ga0209129_1000450 3300025258 Bacteria 30620
157 Ga0209129_1001443 3300025258 Bacteria 13284
158 Ga0209129_1001916 3300025258 Bacteria 10956
159 Ga0209129_1009838 3300025258 Bacteria 2461
160 Ga0209233_1000095 3300025261 Bacteria 303783
161 Ga0209233_1000190 3300025261 Bacteria 130713
162 Ga0209233_1000228 3300025261 Bacteria 100100
163 Ga0209455_1012427 3300025272 Bacteria 2039
164 Ga0209673_1000010 3300025273 Bacteria 596656
165 Ga0209673_1000025 3300025273 Bacteria 404572
166 Ga0209673_1000112 3300025273 Bacteria 179676
167 Ga0209673_1000637 3300025273 Bacteria 53013
168 Ga0209673_1002270 3300025273 Bacteria 13798
169 Ga0209673_1003653 3300025273 Bacteria 8892
170 Ga0209673_1004043 3300025273 Bacteria 8113
171 Ga0209673_1007813 3300025273 Bacteria 4852
172 Ga0209673_1016727 3300025273 Bacteria 2729
173 Ga0209130_1000003 3300025284 Bacteria 677988
174 Ga0209130_1000017 3300025284 Bacteria 388431
175 Ga0209130_1000023 3300025284 Bacteria 359355
176 Ga0209675_1028606 3300025291 Bacteria 1352
177 Ga0209676_1013693 3300025292 Bacteria 3102
178 Ga0209676_1015342 3300025292 Bacteria 2823
179 Ga0209676_1045217 3300025292 Bacteria 1200
180 Ga0209025_1000091 3300025294 Bacteria 250401
181 Ga0209025_1000137 3300025294 Bacteria 190136
182 Ga0209025_1000154 3300025294 Bacteria 170288
183 Ga0209025_1000161 3300025294 Bacteria 166506
184 Ga0209025_1000545 3300025294 Bacteria 70608
185 Ga0209025_1001424 3300025294 Bacteria 31618
186 Ga0209025_1003075 3300025294 Bacteria 16381
187 Ga0209025_1005945 3300025294 Bacteria 9717
188 Ga0209025_1006114 3300025294 Bacteria 9496
189 Ga0209025_1017218 3300025294 Bacteria 4192
190 Ga0209025_1022109 3300025294 Bacteria 3391
191 Ga0209025_1031234 3300025294 Bacteria 2525
192 Ga0209025_1041893 3300025294 Bacteria 1953
193 Ga0209025_1053647 3300025294 Bacteria 1578
194 Ga0209564_1000013 3300025295 Bacteria 775755
195 Ga0209564_1000564 3300025295 Bacteria 58801
196 Ga0209564_1000672 3300025295 Bacteria 50497
197 Ga0209564_1001566 3300025295 Bacteria 22444
198 Ga0209564_1003798 3300025295 Bacteria 9803
199 Ga0209564_1004779 3300025295 Bacteria 8082
200 Ga0209564_1012665 3300025295 Bacteria 3654
201 Ga0209564_1024044 3300025295 Bacteria 2094
202 Ga0209564_1048366 3300025295 Bacteria 1063
203 Ga0209758_1000123 3300025297 Bacteria 190136
204 Ga0209758_1000725 3300025297 Bacteria 48331
205 Ga0209758_1000863 3300025297 Bacteria 41967
206 Ga0209758_1001901 3300025297 Bacteria 22797
207 Ga0209758_1001960 3300025297 Bacteria 22253
208 Ga0209758_1002718 3300025297 Bacteria 17421
209 Ga0209758_1013190 3300025297 Bacteria 4537
210 Ga0209758_1052307 3300025297 Bacteria 1414
211 Ga0209050_1026624 3300025298 Bacteria 1929
212 Ga0209256_1000153 3300025299 Bacteria 144736
213 Ga0209256_1000914 3300025299 Bacteria 36121
214 Ga0209256_1001132 3300025299 Bacteria 30392
215 Ga0209256_1001499 3300025299 Bacteria 23682
216 Ga0209256_1003097 3300025299 Bacteria 12188
217 Ga0209256_1003344 3300025299 Bacteria 11369
218 Ga0207426_1000006 3300025302 Bacteria 1025969
219 Ga0207426_1000008 3300025302 Bacteria 848730
220 Ga0207426_1000011 3300025302 Bacteria 791203
221 Ga0207426_1000228 3300025302 Bacteria 129261
222 Ga0207426_1006647 3300025302 Bacteria 4975
223 Ga0207426_1045577 3300025302 Bacteria 1333
224 Ga0209051_1000462 3300025303 Bacteria 53349
225 Ga0209051_1001635 3300025303 Bacteria 18178
226 Ga0209051_1018677 3300025303 Bacteria 3059
227 Ga0209051_1019438 3300025303 Bacteria 2962
228 Ga0209051_1024476 3300025303 Bacteria 2481
229 Ga0209051_1035888 3300025303 Bacteria 1838
230 Ga0209051_1040421 3300025303 Bacteria 1671
231 Ga0209257_1003221 3300025304 Bacteria 14390
232 Ga0209257_1026922 3300025304 Bacteria 1925
233 Ga0209257_1027936 3300025304 Bacteria 1866
234 Ga0207655_1070225 3300025728 Bacteria 1305
235 Ga0207695_10000037 3300025913 Bacteria 476303
236 Ga0207671_10001228 3300025914 Bacteria 30331
237 Ga0207650_10001248 3300025925 Bacteria 18474
238 Ga0207644_10058528 3300025931 Bacteria 2785
239 Ga0207706_10396628 3300025933 Bacteria 1196
240 Ga0207711_10061404 3300025941 Bacteria 3240
241 Ga0207711_10777985 3300025941 Bacteria 892
242 Ga0207667_10244061 3300025949 Bacteria 1838
243 Ga0207712_10070189 3300025961 Bacteria 2516
244 Ga0207668_10019380 3300025972 Bacteria 4300
245 Ga0207678_10025462 3300026067 Bacteria 5164
246 Ga0207702_10034211 3300026078 Bacteria 4248
247 Ga0207675_101198773 3300026118 Bacteria 779
248 Ga0207698_10040802 3300026142 Bacteria 3453
249 Ga0209281_1000314 3300027111 Bacteria 86424
250 Ga0209371_1003792 3300027312 Bacteria 7034
251 Ga0209282_1000068 3300027666 Bacteria 85817
252 Ga0268266_10016723 3300028379 Bacteria 6272
253 Ga0268266_10113508 3300028379 Bacteria 2403
254 Ga0268266_11307936 3300028379 Bacteria 700
255 Ga0268256_1004051 3300030500 Bacteria 6289
256 Ga0307513_10009210 3300031456 Bacteria 12501
257 Ga0307406_10005188 3300031901 Bacteria 7115
258 Ga0315914_1000937 3300031967 Bacteria 41175
259 Ga0307414_10046066 3300032004 Bacteria 2990
260 Ga0307411_10465817 3300032005 Bacteria 1061
261 Ga0315913_1000094 3300033430 Bacteria 51134
262 Ga0315915_1000007 3300033464 Bacteria 319225
263 Ga0373935_0064610 3300035692 Bacteria 2347
264 Ga0373927_0000419 3300035695 Bacteria 32608
265 Ga0373925_0013435 3300037068 Bacteria 5926
266 Ga0439439_0066880 3300041406 Bacteria 959
267 Ga0439465_0007418 3300041413 Bacteria 3485
268 Ga0439465_0020742 3300041413 Bacteria 2059
269 Ga0439465_0192233 3300041413 Bacteria 741
270 Ga0451791_1551885 3300041451 Bacteria 571
271 Ga0451795_1420712 3300041456 Bacteria 947
272 Ga0451798_0238337 3300041458 Bacteria 1781
273 Ga0451833_1231102 3300041491 Bacteria 1539
274 Ga0451833_1502043 3300041491 Bacteria 1414
275 Ga0451835_0807566 3300041492 Bacteria 982
276 Ga0451835_1058308 3300041492 Bacteria 1432
277 Ga0451837_1738972 3300041494 Bacteria 1291
278 Ga0451837_1746634 3300041494 Bacteria 2134
279 Ga0451839_0192833 3300041496 Bacteria 865
280 Ga0451839_0948094 3300041496 Bacteria 1416
281 Ga0451841_0429116 3300041498 Bacteria 2017
282 Ga0451841_1104641 3300041498 Bacteria 2487
283 Ga0451845_0499475 3300041501 Bacteria 2039
284 Ga0451845_0973335 3300041501 Bacteria 975
285 Ga0451847_0082401 3300041503 Bacteria 2081
286 Ga0451847_0607285 3300041503 Bacteria 2584
287 Ga0451849_1443791 3300041505 Bacteria 1396
288 Ga0451851_0943143 3300041507 Bacteria 1850
289 Ga0451843_1685512 3300041509 Bacteria 1244
290 Ga0451855_0815820 3300041511 Bacteria 4040
291 Ga0451853_2501046 3300041512 Bacteria 4302
292 Ga0451853_3684319 3300041512 Bacteria 1569
293 Ga0439431_0056870 3300041997 Bacteria 1023
294 Ga0439432_007950 3300042006 Bacteria 3740
295 Ga0439432_026777 3300042006 Bacteria 1887
296 Ga0439432_033500 3300042006 Bacteria 1652
297 Ga0439449_0036583 3300042007 Bacteria 1826
298 Ga0439449_0152285 3300042007 Bacteria 862
299 Ga0439452_072212 3300042010 Bacteria 759
300 Ga0439462_0033305 3300042015 Bacteria 1366
301 Ga0450906_050612 3300042145 Bacteria 734
302 Ga0495629_0162058 3300046459 Bacteria 1553
303 Ga0495638_0000953 3300046460 Bacteria 29358
304 Ga0495638_0066963 3300046460 Bacteria 2206
305 Ga0495650_0047731 3300046471 Bacteria 1789
306 Ga0495605_0001474 3300046474 Bacteria 15363
307 Ga0495662_0050509 3300046476 Bacteria 2007
308 Ga0495585_0025457 3300046492 Bacteria 3388
309 Ga0495585_0035085 3300046492 Bacteria 2837
310 Ga0495585_0093666 3300046492 Bacteria 1615
311 Ga0495607_0027658 3300046501 Bacteria 3503
312 Ga0495607_0061843 3300046501 Bacteria 2126
313 Ga0495607_0118772 3300046501 Bacteria 1391
314 Ga0495583_0003748 3300046506 Bacteria 11302
315 Ga0495583_0071976 3300046506 Bacteria 1518
316 Ga0495606_0002168 3300046507 Bacteria 23621
317 Ga0495606_0007555 3300046507 Bacteria 9692
318 Ga0495606_0079620 3300046507 Bacteria 2040
319 Ga0495606_0098151 3300046507 Bacteria 1788
320 Ga0495606_0108264 3300046507 Bacteria 1680
321 Ga0495610_0012771 3300046512 Bacteria 5027
322 Ga0495610_0078298 3300046512 Bacteria 1524
323 Ga0495610_0206397 3300046512 Bacteria 801
324 Ga0495616_0029527 3300046513 Bacteria 2893
325 Ga0495620_0013879 3300046515 Bacteria 4112
326 Ga0495620_0015027 3300046515 Bacteria 3917
327 Ga0495620_0049762 3300046515 Bacteria 1791
328 Ga0495620_0116773 3300046515 Bacteria 1054
329 Ga0495631_0012885 3300046518 Bacteria 4071
330 Ga0495631_0112723 3300046518 Bacteria 1169
331 Ga0495632_0021253 3300046519 Bacteria 3500
332 Ga0495632_0027050 3300046519 Bacteria 3009
333 Ga0495632_0031964 3300046519 Bacteria 2715
334 Ga0495643_0015550 3300046522 Bacteria 4494
335 Ga0495643_0021412 3300046522 Bacteria 3709
336 Ga0495643_0028677 3300046522 Bacteria 3118
337 Ga0495643_0030166 3300046522 Bacteria 3030
338 Ga0495643_0046895 3300046522 Bacteria 2341
339 Ga0495648_0024217 3300046524 Bacteria 4140
340 Ga0495652_0139625 3300046529 Bacteria 1907
341 Ga0495654_0046838 3300046530 Bacteria 2128
342 Ga0495654_0085348 3300046530 Bacteria 1473
343 Ga0495640_0155864 3300046533 Bacteria 1466
344 Ga0495609_0008203 3300046538 Bacteria 5126
345 Ga0495621_0249847 3300046539 Bacteria 724
346 Ga0495597_0005392 3300046542 Bacteria 6777
347 Ga0495597_0041159 3300046542 Bacteria 2065
348 Ga0495633_0021557 3300046558 Bacteria 3221
349 Ga0495633_0049675 3300046558 Bacteria 1979
350 Ga0495633_0081890 3300046558 Bacteria 1502
351 Ga0495668_0003159 3300046616 Bacteria 12699
352 Ga0495668_0080778 3300046616 Bacteria 1784
353 Ga0495668_0160466 3300046616 Bacteria 1231
354 Ga0495625_0005331 3300046660 Bacteria 11778
355 Ga0495625_0079315 3300046660 Bacteria 2290
356 Ga0495625_0395524 3300046660 Bacteria 864
357 Ga0495661_0220406 3300046665 Bacteria 983
358 Ga0495588_0028037 3300046674 Bacteria 2817
359 Ga0495588_0297038 3300046674 Bacteria 851
360 Ga0495657_0015576 3300046675 Bacteria 5558
361 Ga0495623_0272196 3300046679 Bacteria 945
362 Ga0495658_0015476 3300046683 Bacteria 3914
363 Ga0495624_0175362 3300046690 Bacteria 1307
364 Ga0495670_0003394 3300046691 Bacteria 7829
365 Ga0495670_0168934 3300046691 Bacteria 1151
366 Ga0495671_0052719 3300046692 Bacteria 2021
367 Ga0495671_0279731 3300046692 Bacteria 804
368 Ga0495649_0133392 3300046694 Bacteria 1310
369 Ga0495649_0301388 3300046694 Bacteria 816
370 Ga0495649_0310166 3300046694 Bacteria 802
371 Ga0495600_0181214 3300046809 Bacteria 1357
372 Ga0495660_0006886 3300046810 Bacteria 6694
373 Ga0495660_0045004 3300046810 Bacteria 2425
374 Ga0495660_0100978 3300046810 Bacteria 1485
375 Ga0495660_0151581 3300046810 Bacteria 1144
376 Ga0495604_0020148 3300047317 Bacteria 5329
377 Ga0495672_0003408 3300047320 Bacteria 13639
378 Ga0495683_0106909 3300047323 Bacteria 1340
379 Ga0495683_0108272 3300047323 Bacteria 1329
380 Ga0495687_071801 3300047443 Bacteria 1385
381 Ga0495673_0057862 3300047469 Bacteria 1673
382 Ga0495686_0007900 3300047472 Bacteria 7901
383 Ga0495686_0016439 3300047472 Bacteria 5017
384 Ga0495686_0018844 3300047472 Bacteria 4622
385 Ga0495686_0076249 3300047472 Bacteria 2054
386 Ga0495686_0152204 3300047472 Bacteria 1357
387 Ga0495686_0167317 3300047472 Bacteria 1281
388 Ga0495602_0064072 3300048088 Bacteria 3181
389 Ga0495626_0076009 3300048091 Bacteria 1500
390 Ga0496100_0082487 3300048903 Bacteria 2174
391 Ga0496100_0130452 3300048903 Bacteria 1770
392 Ga0496100_0417950 3300048903 Bacteria 1024
393 Ga0496101_0152268 3300048904 Bacteria 1769
394 Ga0496101_0500149 3300048904 Bacteria 960
395 Ga0496102_0004330 3300048905 Bacteria 12011
396 Ga0496102_0060372 3300048905 Bacteria 3467
397 Ga0496102_0398169 3300048905 Bacteria 1295
398 Ga0496102_0422780 3300048905 Bacteria 1252
399 Ga0496103_0036078 3300048906 Bacteria 3027
400 Ga0496103_0067827 3300048906 Bacteria 2228
401 Ga0496104_0049484 3300048907 Bacteria 3963
402 Ga0496105_0029943 3300048908 Bacteria 4457
403 Ga0496106_0001496 3300048909 Bacteria 17571
404 Ga0496106_0257501 3300048909 Bacteria 1396
405 Ga0496106_0312292 3300048909 Bacteria 1261
406 Ga0496107_0235302 3300048910 Bacteria 1363
407 Ga0496111_0052564 3300048914 Bacteria 2942
408 Ga0496113_0029675 3300048916 Bacteria 3953
409 Ga0496113_0130856 3300048916 Bacteria 1969
410 Ga0496114_0600412 3300048917 Bacteria 971
411 Ga0496116_0000105 3300048919 Bacteria 192704
412 Ga0496116_0006216 3300048919 Bacteria 10902
413 Ga0496116_0016794 3300048919 Bacteria 5712
414 Ga0496116_0022826 3300048919 Bacteria 4676
415 Ga0496116_0027730 3300048919 Bacteria 4116
416 Ga0496116_0088663 3300048919 Bacteria 1889
417 Ga0496116_0130640 3300048919 Bacteria 1432
418 Ga0496116_0162805 3300048919 Bacteria 1221
419 Ga0496116_0168630 3300048919 Bacteria 1189
420 Ga0496116_0175723 3300048919 Bacteria 1153
421 Ga0496116_0252900 3300048919 Bacteria 875
422 Ga0496116_0337550 3300048919 Bacteria 696
423 Ga0496117_0002241 3300048920 Bacteria 24957
424 Ga0496117_0003292 3300048920 Bacteria 18915
425 Ga0496117_0020448 3300048920 Bacteria 5395
426 Ga0496117_0025317 3300048920 Bacteria 4668
427 Ga0496117_0026153 3300048920 Bacteria 4571
428 Ga0496117_0026472 3300048920 Bacteria 4538
429 Ga0496117_0077801 3300048920 Bacteria 2193
430 Ga0496117_0135002 3300048920 Bacteria 1488
431 Ga0496118_0001388 3300048921 Bacteria 36504
432 Ga0496118_0004636 3300048921 Bacteria 16127
433 Ga0496118_0023728 3300048921 Bacteria 5316
434 Ga0496118_0027341 3300048921 Bacteria 4830
435 Ga0496118_0093072 3300048921 Bacteria 2066
436 Ga0496119_0041712 3300048922 Bacteria 2918
437 Ga0496119_0046892 3300048922 Bacteria 2693
438 Ga0496119_0052554 3300048922 Bacteria 2494
439 Ga0496119_0053295 3300048922 Bacteria 2472
440 Ga0496119_0053562 3300048922 Bacteria 2463
441 Ga0496119_0066220 3300048922 Bacteria 2136
442 Ga0496119_0251684 3300048922 Bacteria 890
443 Ga0496120_0016940 3300048923 Bacteria 4743
444 Ga0496120_0024822 3300048923 Bacteria 3731
445 Ga0496120_0061705 3300048923 Bacteria 2091
446 Ga0496120_0063461 3300048923 Bacteria 2055
447 Ga0496120_0124784 3300048923 Bacteria 1326
448 Ga0496121_0000003 3300048924 Bacteria 1191431
449 Ga0496121_0001287 3300048924 Bacteria 43216
450 Ga0496121_0009257 3300048924 Bacteria 11372
451 Ga0496121_0019082 3300048924 Bacteria 6878
452 Ga0496121_0020642 3300048924 Bacteria 6505
453 Ga0496121_0023780 3300048924 Bacteria 5884
454 Ga0496121_0034993 3300048924 Bacteria 4508
455 Ga0496121_0044494 3300048924 Bacteria 3828
456 Ga0496121_0046491 3300048924 Bacteria 3714
457 Ga0496121_0128385 3300048924 Bacteria 1902
458 Ga0496121_0261940 3300048924 Bacteria 1193
459 Ga0496121_0351527 3300048924 Bacteria 981
460 Ga0496121_0455654 3300048924 Bacteria 823
461 Ga0496122_0000414 3300048925 Bacteria 90664
462 Ga0496122_0004472 3300048925 Bacteria 17302
463 Ga0496122_0007629 3300048925 Bacteria 11950
464 Ga0496122_0027041 3300048925 Bacteria 4920
465 Ga0496122_0046450 3300048925 Bacteria 3362
466 Ga0496122_0076984 3300048925 Bacteria 2345
467 Ga0496122_0083743 3300048925 Bacteria 2209
468 Ga0496122_0085683 3300048925 Bacteria 2172
469 Ga0496122_0222764 3300048925 Bacteria 1080
470 Ga0496123_0000147 3300048926 Bacteria 143834
471 Ga0496123_0004704 3300048926 Bacteria 14130
472 Ga0496123_0026575 3300048926 Bacteria 4331
473 Ga0496123_0027668 3300048926 Bacteria 4218
474 Ga0496123_0035340 3300048926 Bacteria 3562
475 Ga0496123_0037700 3300048926 Bacteria 3410
476 Ga0496123_0037920 3300048926 Bacteria 3396
477 Ga0496123_0039968 3300048926 Bacteria 3274
478 Ga0496123_0072249 3300048926 Bacteria 2147
479 Ga0496123_0072636 3300048926 Bacteria 2139
480 Ga0496123_0176583 3300048926 Bacteria 1120
481 Ga0496123_0490819 3300048926 Bacteria 538
482 Ga0496124_0000348 3300048927 Bacteria 84728
483 Ga0496124_0006920 3300048927 Bacteria 12188
484 Ga0496124_0014287 3300048927 Bacteria 7685
485 Ga0496124_0060381 3300048927 Bacteria 3180
486 Ga0496124_0082420 3300048927 Bacteria 2640
487 Ga0496124_0090792 3300048927 Bacteria 2490
488 Ga0496124_0110472 3300048927 Bacteria 2213
489 Ga0496124_0251993 3300048927 Bacteria 1305
490 Ga0496124_0530043 3300048927 Bacteria 782
491 Ga0496124_0805054 3300048927 Bacteria 581
492 Ga0496125_0001144 3300048928 Bacteria 40287
493 Ga0496125_0001465 3300048928 Bacteria 34178
494 Ga0496125_0022507 3300048928 Bacteria 5849
495 Ga0496125_0029569 3300048928 Bacteria 4921
496 Ga0496125_0041754 3300048928 Bacteria 3917
497 Ga0496125_0051306 3300048928 Bacteria 3403
498 Ga0496125_0107302 3300048928 Bacteria 2035
499 Ga0496125_0176967 3300048928 Bacteria 1426
500 Ga0496125_0399768 3300048928 Bacteria 803
501 Ga0496126_0000188 3300048929 Bacteria 139625
502 Ga0496126_0000879 3300048929 Bacteria 52860
503 Ga0496126_0012445 3300048929 Bacteria 8714
504 Ga0496126_0026789 3300048929 Bacteria 5520
505 Ga0496126_0063420 3300048929 Bacteria 3312
506 Ga0496126_0154814 3300048929 Bacteria 1962
507 Ga0496126_0183512 3300048929 Bacteria 1776
508 Ga0496126_0205108 3300048929 Bacteria 1662
509 Ga0496126_0264240 3300048929 Bacteria 1430
510 Ga0496126_0316630 3300048929 Bacteria 1283
511 Ga0496126_0354689 3300048929 Bacteria 1199
512 Ga0495678_023199 3300049459 Bacteria 2702
513 Ga0495682_0014013 3300049460 Bacteria 3044
514 Ga0501032_0042585 3300049569 Bacteria 3079
515 Ga0501032_0292454 3300049569 Bacteria 1054
516 Ga0501034_0056607 3300049571 Bacteria 3944
517 Ga0501034_0233824 3300049571 Bacteria 1786
518 Ga0501034_0546293 3300049571 Bacteria 1068
519 Ga0501034_0659324 3300049571 Bacteria 947
520 Ga0501036_0050174 3300049572 Bacteria 3534
521 Ga0501036_0407196 3300049572 Bacteria 1134
522 Ga0501037_0068354 3300049573 Bacteria 2586
523 Ga0501038_0106209 3300049574 Bacteria 2331
524 Ga0501039_0040985 3300049575 Bacteria 3575
525 Ga0501039_0370172 3300049575 Bacteria 1126
526 Ga0501043_0042912 3300049579 Bacteria 3555
527 Ga0501046_0148852 3300049580 Bacteria 1767
528 Ga0501046_0773174 3300049580 Bacteria 674
529 Ga0501048_0075266 3300049582 Bacteria 2382
530 Ga0501068_0118339 3300049584 Bacteria 1651
531 Ga0501073_0059397 3300049589 Bacteria 2671
532 Ga0501073_0421242 3300049589 Bacteria 923
533 Ga0501080_0378860 3300049742 Bacteria 1275
534 Ga0501083_0036853 3300049744 Bacteria 3333
535 Ga0501083_0085696 3300049744 Bacteria 2084
536 Ga0501280_004434 3300049776 Bacteria 2067
537 Ga0501035_0046668 3300049822 Bacteria 3896
538 Ga0501035_0114306 3300049822 Bacteria 2364
539 Ga0501044_0051657 3300049823 Bacteria 4238
540 Ga0501044_0271447 3300049823 Bacteria 1631
541 nmdc:mga03683_5823_c1 3300050489 Bacteria 4185
542 nmdc:mga03n38_183942_c1 3300050490 Bacteria 1072
543 nmdc:mga03n38_357398_c1 3300050490 Bacteria 796
544 nmdc:mga00v17_19824_c1 3300050491 Bacteria 3846
545 nmdc:mga0yw44_19943_c1 3300050492 Bacteria 3709
546 nmdc:mga0yw44_40104_c1 3300050492 Bacteria 2780
547 nmdc:mga06z11_20051_c1 3300050494 Bacteria 3085
548 nmdc:mga06z11_51470_c1 3300050494 Bacteria 2109
549 nmdc:mga07m45_144524_c1 3300050496 Bacteria 1378
550 nmdc:mga07m45_435_c1 3300050496 Bacteria 17361
551 nmdc:mga0sz30_100272_c1 3300050516 Bacteria 1265
552 nmdc:mga0sz30_12651_c1 3300050516 Bacteria 3286
553 Ga0495601_0213437 3300053077 Bacteria 1261
554 Ga0500610_0003011 3300053079 Bacteria 6361
555 Ga0495619_0137969 3300053085 Bacteria 1678
556 Ga0500578_0347755 3300053086 Bacteria 867
557 Ga0500643_082782 3300053087 Bacteria 880
558 Ga0500650_0092591 3300053098 Bacteria 1415
559 Ga0500594_0001767 3300053118 Bacteria 4704
560 Ga0500608_022686 3300053122 Bacteria 2911
561 Ga0500614_095452 3300053123 Bacteria 851
562 Ga0500618_005217 3300053125 Bacteria 3992
563 Ga0500618_008675 3300053125 Bacteria 2821
564 Ga0500642_0310063 3300053130 Bacteria 710
565 Ga0500658_0010742 3300053134 Bacteria 3378
566 Ga0500658_0043795 3300053134 Bacteria 1803
567 Ga0500658_0046487 3300053134 Bacteria 1758
568 Ga0500568_0001459 3300053139 Bacteria 15147
569 Ga0500568_0007906 3300053139 Bacteria 5176
570 Ga0500568_0042642 3300053139 Bacteria 1817
571 Ga0500590_013983 3300053148 Bacteria 4130
572 Ga0500604_0009282 3300053151 Bacteria 2620
573 Ga0500604_0042873 3300053151 Bacteria 1373
574 Ga0500616_0005056 3300053153 Bacteria 9116
575 Ga0500622_0000821 3300053156 Bacteria 26574
576 Ga0500622_0001665 3300053156 Bacteria 17370
577 Ga0500622_0284525 3300053156 Bacteria 711
578 Ga0500624_019938 3300053157 Bacteria 1070
579 Ga0500627_0022298 3300053158 Bacteria 2567
580 Ga0500633_0001402 3300053160 Bacteria 4517
581 Ga0500636_0169273 3300053177 Bacteria 1183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2837651117 2837652289 159
2 iso_pu_bacteria 2791355094 2792638845 160
3 iso_pu_bacteria 2891373044 2891373628 160
4 iso_pu_bacteria 2989349275 2989350108 160
5 iso_pu_bacteria 2513237138 2513870175 161
6 iso_pu_bacteria 2582581306 2585265723 161
7 iso_pu_bacteria 2582581865 2585388929 161
8 iso_pu_bacteria 2582581866 2585395378 161
9 iso_pu_bacteria 2599185352 2600194886 161
10 iso_pu_bacteria 2643221557 2643804157 161
11 iso_pu_bacteria 2643221610 2644065068 161
12 iso_pu_bacteria 2643221618 2644105221 161
13 iso_pu_bacteria 2643221626 2644145703 161
14 iso_pu_bacteria 2643221655 2644309634 161
15 iso_pu_bacteria 2643221659 2644331198 161
16 iso_pu_bacteria 2643221668 2644376522 161
17 iso_pu_bacteria 2643221675 2644416741 161
18 iso_pu_bacteria 2643221680 2644449781 161
19 iso_pu_bacteria 2643221688 2644494271 161
20 iso_pu_bacteria 2643221698 2644543363 161
21 iso_pu_bacteria 2643221712 2644616158 161
22 iso_pu_bacteria 2643221723 2644675783 161
23 iso_pu_bacteria 2643221726 2644689913 161
24 iso_pu_bacteria 2844163670 2844163978 161
25 iso_pu_bacteria 2896384573 2896391133 161
26 iso_pu_bacteria 2920822456 2920825525 161
27 iso_pu_bacteria 2923556063 2923561148 161
28 iso_pu_bacteria 2941499720 2941504691 161
29 iso_pu_bacteria 2995392953 2995396537 161
30 iso_pu_bacteria 2508501122 2509108111 162
31 iso_pu_bacteria 2509276019 2509376713 162
32 iso_pu_bacteria 2509276021 2509391736 162
33 iso_pu_bacteria 2509276033 2509447403 162
34 iso_pu_bacteria 2510461076 2510895676 162
35 iso_pu_bacteria 2510917028 2511182419 162
36 iso_pu_bacteria 2512875026 2512969577 162
37 iso_pu_bacteria 2513237088 2513597612 162
38 iso_pu_bacteria 2513237089 2513606199 162
39 iso_pu_bacteria 2513237144 2513908482 162
40 iso_pu_bacteria 2513237146 2513928154 162
41 iso_pu_bacteria 2513237156 2513985092 162
42 iso_pu_bacteria 2513237160 2514007914 162
43 iso_pu_bacteria 2513237162 2514018013 162
44 iso_pu_bacteria 2515154113 2515635124 162
45 iso_pu_bacteria 2515154114 2515645566 162
46 iso_pu_bacteria 2515154116 2515655053 162
47 iso_pu_bacteria 2516653085 2517077369 162
48 iso_pu_bacteria 2517287029 2517407749 162
49 iso_pu_bacteria 2517487022 2517565545 162
50 iso_pu_bacteria 2519899620 2520380353 162
51 iso_pu_bacteria 2524023209 2524458912 162
52 iso_pu_bacteria 2529292951 2530646509 162
53 iso_pu_bacteria 2534681796 2535517159 162
54 iso_pu_bacteria 2558860100 2558863922 162
55 iso_pu_bacteria 2582581294 2585201946 162
56 iso_pu_bacteria 2582581298 2585225346 162
57 iso_pu_bacteria 2582581299 2585228577 162
58 iso_pu_bacteria 2582581308 2585279340 162
59 iso_pu_bacteria 2582581315 2585323055 162
60 iso_pu_bacteria 2582581316 2585331167 162
61 iso_pu_bacteria 2582581867 2585401016 162
62 iso_pu_bacteria 2585427526 2585524797 162
63 iso_pu_bacteria 2585427527 2585531175 162
64 iso_pu_bacteria 2585427528 2585538478 162
65 iso_pu_bacteria 2585427529 2585547902 162
66 iso_pu_bacteria 2585427530 2585552901 162
67 iso_pu_bacteria 2585427590 2585822083 162
68 iso_pu_bacteria 2585427593 2585836431 162
69 iso_pu_bacteria 2585427594 2585843537 162
70 iso_pu_bacteria 2599185170 2599416956 162
71 iso_pu_bacteria 2615840624 2616293077 162
72 iso_pu_bacteria 2615840626 2616311083 162
73 iso_pu_bacteria 2615840698 2616554520 162
74 iso_pu_bacteria 2617270742 2617385413 162
75 iso_pu_bacteria 2643221558 2643811268 162
76 iso_pu_bacteria 2643221568 2643856533 162
77 iso_pu_bacteria 2643221599 2644006982 162
78 iso_pu_bacteria 2643221634 2644191763 162
79 iso_pu_bacteria 2643221643 2644242610 162
80 iso_pu_bacteria 2657244999 2657681764 162
81 iso_pu_bacteria 2667528174 2671111162 162
82 iso_pu_bacteria 2690316117 2692315248 162
83 iso_pu_bacteria 2718217882 2719182075 162
84 iso_pu_bacteria 2718218009 2719732791 162
85 iso_pu_bacteria 2718218363 2721148166 162
86 iso_pu_bacteria 2718218365 2721159619 162
87 iso_pu_bacteria 2718218366 2721165002 162
88 iso_pu_bacteria 2721755514 2722841172 162
89 iso_pu_bacteria 2721755810 2724045547 162
90 iso_pu_bacteria 2728369365 2730165310 162
91 iso_pu_bacteria 2728369397 2730299251 162
92 iso_pu_bacteria 2738541293 2738804968 162
93 iso_pu_bacteria 2738541333 2739033120 162
94 iso_pu_bacteria 2751185821 2753462393 162
95 iso_pu_bacteria 2765235942 2766066164 162
96 iso_pu_bacteria 2775507266 2778175702 162
97 iso_pu_bacteria 2791355092 2792625905 162
98 iso_pu_bacteria 2791355259 2793318148 162
99 iso_pu_bacteria 2791355260 2793319459 162
100 iso_pu_bacteria 2791355261 2793328914 162
101 iso_pu_bacteria 2791355263 2793339557 162
102 iso_pu_bacteria 2791355264 2793346972 162
103 iso_pu_bacteria 2791355266 2793362487 162
104 iso_pu_bacteria 2791355267 2793367610 162
105 iso_pu_bacteria 2802428858 2802716007 162
106 iso_pu_bacteria 2802428859 2802722969 162
107 iso_pu_bacteria 2802428860 2802728899 162
108 iso_pu_bacteria 2802428861 2802735265 162
109 iso_pu_bacteria 2802428862 2802742131 162
110 iso_pu_bacteria 2802428863 2802748578 162
111 iso_pu_bacteria 2802429268 2804752949 162
112 iso_pu_bacteria 2802429633 2806045259 162
113 iso_pu_bacteria 2802429634 2806049946 162
114 iso_pu_bacteria 2802429635 2806056784 162
115 iso_pu_bacteria 2802429636 2806064166 162
116 iso_pu_bacteria 2802429637 2806071434 162
117 iso_pu_bacteria 2818991448 2819609408 162
118 iso_pu_bacteria 2818991453 2819641280 162
119 iso_pu_bacteria 2838016132 2838020067 162
120 iso_pu_bacteria 2838022645 2838023569 162
121 iso_pu_bacteria 2838029111 2838033329 162
122 iso_pu_bacteria 2838035591 2838041714 162
123 iso_pu_bacteria 2838042994 2838045255 162
124 iso_pu_bacteria 2838048938 2838053269 162
125 iso_pu_bacteria 2838061910 2838065385 162
126 iso_pu_bacteria 2838068647 2838069862 162
127 iso_pu_bacteria 2838661181 2838661311 162
128 iso_pu_bacteria 2838668709 2838674804 162
129 iso_pu_bacteria 2838680041 2838683160 162
130 iso_pu_bacteria 2838686498 2838686756 162
131 iso_pu_bacteria 2838694306 2838697896 162
132 iso_pu_bacteria 2838701080 2838707143 162
133 iso_pu_bacteria 2838707686 2838711011 162
134 iso_pu_bacteria 2838729681 2838730286 162
135 iso_pu_bacteria 2838742623 2838742699 162
136 iso_pu_bacteria 2841851746 2841854584 162
137 iso_pu_bacteria 2841864319 2841867249 162
138 iso_pu_bacteria 2842077413 2842079186 162
139 iso_pu_bacteria 2842110456 2842112976 162
140 iso_pu_bacteria 2842118031 2842118303 162
141 iso_pu_bacteria 2842146304 2842151787 162
142 iso_pu_bacteria 2842156927 2842158396 162
143 iso_pu_bacteria 2842163707 2842170228 162
144 iso_pu_bacteria 2842180545 2842182012 162
145 iso_pu_bacteria 2842192696 2842195769 162
146 iso_pu_bacteria 2842198810 2842199083 162
147 iso_pu_bacteria 2842205361 2842209526 162
148 iso_pu_bacteria 2842217011 2842218236 162
149 iso_pu_bacteria 2842229732 2842229989 162
150 iso_pu_bacteria 2842237096 2842240217 162
151 iso_pu_bacteria 2842243621 2842243878 162
152 iso_pu_bacteria 2842250916 2842256981 162
153 iso_pu_bacteria 2842257432 2842258037 162
154 iso_pu_bacteria 2842264693 2842267785 162
155 iso_pu_bacteria 2842271015 2842271706 162
156 iso_pu_bacteria 2842278818 2842282980 162
157 iso_pu_bacteria 2842285085 2842285323 162
158 iso_pu_bacteria 2842291075 2842292848 162
159 iso_pu_bacteria 2842298080 2842298264 162
160 iso_pu_bacteria 2842304105 2842305337 162
161 iso_pu_bacteria 2842311132 2842313935 162
162 iso_pu_bacteria 2842317721 2842319828 162
163 iso_pu_bacteria 2842341865 2842348137 162
164 iso_pu_bacteria 2842357229 2842360136 162
165 iso_pu_bacteria 2842363717 2842368383 162
166 iso_pu_bacteria 2842370503 2842373790 162
167 iso_pu_bacteria 2842377471 2842379245 162
168 iso_pu_bacteria 2842384541 2842384814 162
169 iso_pu_bacteria 2842395702 2842400053 162
170 iso_pu_bacteria 2842402390 2842402683 162
171 iso_pu_bacteria 2842409023 2842409946 162
172 iso_pu_bacteria 2842415677 2842416594 162
173 iso_pu_bacteria 2842422224 2842423476 162
174 iso_pu_bacteria 2842428310 2842430429 162
175 iso_pu_bacteria 2842434925 2842436759 162
176 iso_pu_bacteria 2842441272 2842443399 162
177 iso_pu_bacteria 2842447887 2842449270 162
178 iso_pu_bacteria 2842462802 2842466683 162
179 iso_pu_bacteria 2842469257 2842471371 162
180 iso_pu_bacteria 2842475841 2842480006 162
181 iso_pu_bacteria 2842482326 2842483799 162
182 iso_pu_bacteria 2842489311 2842493631 162
183 iso_pu_bacteria 2842495871 2842497782 162
184 iso_pu_bacteria 2842502639 2842505209 162
185 iso_pu_bacteria 2842509118 2842514218 162
186 iso_pu_bacteria 2844454524 2844458053 162
187 iso_pu_bacteria 2847417321 2847419695 162
188 iso_pu_bacteria 2848992105 2848994697 162
189 iso_pu_bacteria 2850079185 2850081715 162
190 iso_pu_bacteria 2852387548 2852390546 162
191 iso_pu_bacteria 2854896431 2854901424 162
192 iso_pu_bacteria 2854916844 2854918965 162
193 iso_pu_bacteria 2855872281 2855877212 162
194 iso_pu_bacteria 2857516855 2857517131 162
195 iso_pu_bacteria 2891048133 2891051200 162
196 iso_pu_bacteria 2899803654 2899806753 162
197 iso_pu_bacteria 2913295892 2913296154 162
198 iso_pu_bacteria 2915980308 2915983672 162
199 iso_pu_bacteria 2916061851 2916063340 162
200 iso_pu_bacteria 2919100787 2919106165 162
201 iso_pu_bacteria 2919166419 2919169543 162
202 iso_pu_bacteria 2919408235 2919410271 162
203 iso_pu_bacteria 2921250672 2921256911 162
204 iso_pu_bacteria 2933016740 2933018540 162
205 iso_pu_bacteria 2933570622 2933571144 162
206 iso_pu_bacteria 2933586486 2933588967 162
207 iso_pu_bacteria 2935894831 2935896719 162
208 iso_pu_bacteria 2936367885 2936371754 162
209 iso_pu_bacteria 2936375103 2936379589 162
210 iso_pu_bacteria 2936381700 2936388142 162
211 iso_pu_bacteria 2937029754 2937035024 162
212 iso_pu_bacteria 2937036028 2937039255 162
213 iso_pu_bacteria 2937078374 2937084332 162
214 iso_pu_bacteria 2937084907 2937090734 162
215 iso_pu_bacteria 2957375807 2957379060 162
216 iso_pu_bacteria 2957437181 2957440573 162
217 iso_pu_bacteria 2960591022 2960596752 162
218 iso_pu_bacteria 2960631154 2960634392 162
219 iso_pu_bacteria 2960680706 2960683380 162
220 iso_pu_bacteria 2960693952 2960695231 162
221 iso_pu_bacteria 2967686174 2967687953 162
222 iso_pu_bacteria 2967728569 2967732703 162
223 iso_pu_bacteria 2970026789 2970028874 162
224 iso_pu_bacteria 2970122695 2970126629 162
225 iso_pu_bacteria 2970143518 2970148412 162
226 iso_pu_bacteria 2977530762 2977533878 162
227 iso_pu_bacteria 2977544691 2977547966 162
228 iso_pu_bacteria 2978969890 2978971946 162
229 iso_pu_bacteria 2996887358 2996892759 162
230 iso_pu_bacteria 2996893221 2996897930 162
231 iso_pu_bacteria 3005409236 3005414272 162
232 iso_pu_bacteria 3005416602 3005418908 162
233 iso_pu_bacteria 3005452660 3005454975 162
234 iso_pu_bacteria 643692032 643826591 162
235 iso_pu_bacteria 8003999396 8004004022 162
236 iso_pu_bacteria 8005246636 8005249867 162
237 iso_pu_bacteria 8005258706 8005259474 162
238 iso_pu_bacteria 8005275841 8005281502 162
239 iso_pu_bacteria 8005301065 8005303409 162
240 iso_pu_bacteria 8005314921 8005318200 162
241 iso_pu_bacteria 8005321885 8005327286 162
242 iso_pu_bacteria 8005376324 8005381213 162
243 iso_pu_bacteria 8005382845 8005388826 162
244 iso_pu_bacteria 8005395548 8005395807 162
245 iso_pu_bacteria 8005484373 8005488923 162
246 iso_pu_bacteria 8005542996 8005545974 162
247 iso_pu_bacteria 8005570704 8005573175 162
248 iso_pu_bacteria 8005645114 8005646005 162
249 iso_pu_bacteria 8005682033 8005682615 162
250 iso_pu_bacteria 8005688590 8005691819 162
251 iso_pu_bacteria 8005695170 8005697701 162
252 iso_pu_bacteria 8018127388 8018127424 162
253 iso_pu_bacteria 8018150411 8018151283 162
254 iso_pu_bacteria 8018176218 8018179522 162
255 iso_pu_bacteria 8024479707 8024486290 162
256 iso_pu_bacteria 8024486573 8024488319 162
257 iso_pu_bacteria 8046767195 8046772358 162
258 iso_pu_bacteria 8054558443 8054561980 162
259 iso_pu_bacteria 8056375014 8056377555 162
260 iso_pu_bacteria 8056875544 8056875847 162
261 iso_pu_bacteria 8057575449 8057576686 162
262 3300049589 Ga0501073_0421242 Ga0501073_0421242_18_524 163
263 iso_pu_bacteria 2526164512 2526213938 163
264 iso_pu_bacteria 2599185156 2599332041 163
265 iso_pu_bacteria 2842922631 2842924376 163
266 3300003187 JGI25151J46595_10027604 JGI25151J46595_100276042 164
267 3300021321 Ga0214542_1000268 Ga0214542_100026816 164
268 3300021327 Ga0214543_1000219 Ga0214543_100021917 164
269 3300025294 Ga0209025_1000545 Ga0209025_10005455 164
270 3300032005 Ga0307411_10465817 Ga0307411_104658172 164
271 3300042006 Ga0439432_033500 Ga0439432_033500_239_748 164
272 3300042007 Ga0439449_0036583 Ga0439449_0036583_595_1104 164
273 3300042010 Ga0439452_072212 Ga0439452_072212_95_604 164
274 3300048920 Ga0496117_0002241 Ga0496117_0002241_8477_8971 164
275 3300048922 Ga0496119_0066220 Ga0496119_0066220_723_1217 164
276 3300048923 Ga0496120_0061705 Ga0496120_0061705_1153_1647 164
277 3300048925 Ga0496122_0000414 Ga0496122_0000414_50393_50887 164
278 3300048926 Ga0496123_0000147 Ga0496123_0000147_126663_127157 164
279 3300048927 Ga0496124_0000348 Ga0496124_0000348_56674_57168 164
280 3300048928 Ga0496125_0001465 Ga0496125_0001465_3334_3828 164
281 3300048929 Ga0496126_0000879 Ga0496126_0000879_36039_36533 164
282 3300048929 Ga0496126_0012445 Ga0496126_0012445_1740_2234 164
283 3300049569 Ga0501032_0042585 Ga0501032_0042585_2178_2672 164
284 3300049571 Ga0501034_0056607 Ga0501034_0056607_118_612 164
285 3300049571 Ga0501034_0233824 Ga0501034_0233824_843_1337 164
286 3300049571 Ga0501034_0546293 Ga0501034_0546293_428_922 164
287 3300049572 Ga0501036_0407196 Ga0501036_0407196_603_1097 164
288 3300049573 Ga0501037_0068354 Ga0501037_0068354_1048_1542 164
289 3300049574 Ga0501038_0106209 Ga0501038_0106209_821_1315 164
290 3300049575 Ga0501039_0370172 Ga0501039_0370172_146_640 164
291 3300049579 Ga0501043_0042912 Ga0501043_0042912_817_1311 164
292 3300049822 Ga0501035_0046668 Ga0501035_0046668_2027_2521 164
293 3300049823 Ga0501044_0271447 Ga0501044_0271447_548_1042 164
294 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000424 165
295 3300003187 JGI25151J46595_10005988 JGI25151J46595_100059884 165
296 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021185 165
297 3300003374 JGI25161J50226_1000534 JGI25161J50226_10005344 165
298 3300003771 Ga0055526_1005849 Ga0055526_10058496 165
299 3300003775 Ga0055524_1000572 Ga0055524_100057214 165
300 3300003792 Ga0055540_1061240 Ga0055540_10612402 165
301 3300004625 Ga0055543_1000102 Ga0055543_100010224 165
302 3300005262 Ga0065165_1000033 Ga0065165_1000033185 165
303 3300013249 Ga0171463_1007 Ga0171463_100785 165
304 3300015690 Ga0183363_1071 Ga0183363_10718 165
305 3300025208 Ga0209436_101492 Ga0209436_1014927 165
306 3300025284 Ga0209130_1000017 Ga0209130_1000017198 165
307 3300025292 Ga0209676_1013693 Ga0209676_10136933 165
308 3300025294 Ga0209025_1000161 Ga0209025_100016124 165
309 3300025294 Ga0209025_1022109 Ga0209025_10221095 165
310 3300025295 Ga0209564_1000013 Ga0209564_1000013646 165
311 3300025295 Ga0209564_1048366 Ga0209564_10483662 165
312 3300025298 Ga0209050_1026624 Ga0209050_10266243 165
313 3300025299 Ga0209256_1000153 Ga0209256_1000153119 165
314 3300025299 Ga0209256_1003344 Ga0209256_10033444 165
315 3300025302 Ga0207426_1000006 Ga0207426_1000006197 165
316 3300025303 Ga0209051_1019438 Ga0209051_10194383 165
317 3300025304 Ga0209257_1026922 Ga0209257_10269222 165
318 3300032004 Ga0307414_10046066 Ga0307414_100460664 165
319 3300046558 Ga0495633_0081890 Ga0495633_0081890_328_825 165
320 3300053151 Ga0500604_0042873 Ga0500604_0042873_551_1078 165
321 3300053156 Ga0500622_0000821 Ga0500622_0000821_13253_13753 165
322 3300053157 Ga0500624_019938 Ga0500624_019938_327_824 165
323 iso_pu_bacteria 2510917022 2511134083 165
324 iso_pu_bacteria 2582581283 2585167496 165
325 iso_pu_bacteria 2582581304 2585258210 165
326 iso_pu_bacteria 2582581307 2585271402 165
327 iso_pu_bacteria 2585427531 2585559145 165
328 iso_pu_bacteria 2585427608 2585898528 165
329 iso_pu_bacteria 2585427609 2585903909 165
330 iso_pu_bacteria 2585428125 2587980973 165
331 iso_pu_bacteria 2643221607 2644050182 165
332 iso_pu_bacteria 2643221636 2644204757 165
333 iso_pu_bacteria 2643221653 2644298957 165
334 iso_pu_bacteria 2643221686 2644483102 165
335 iso_pu_bacteria 2643221689 2644497749 165
336 iso_pu_bacteria 2643221719 2644657185 165
337 iso_pu_bacteria 2718217997 2719666445 165
338 iso_pu_bacteria 2718218199 2720492865 165
339 iso_pu_bacteria 2718218232 2720614326 165
340 iso_pu_bacteria 2718218233 2720621098 165
341 iso_pu_bacteria 2718218235 2720632424 165
342 iso_pu_bacteria 2718218269 2720776149 165
343 iso_pu_bacteria 2721755556 2723027746 165
344 iso_pu_bacteria 2721755684 2723561376 165
345 iso_pu_bacteria 2721755685 2723567999 165
346 iso_pu_bacteria 2721755819 2724090756 165
347 iso_pu_bacteria 2721755822 2724105264 165
348 iso_pu_bacteria 2721755823 2724111091 165
349 iso_pu_bacteria 2728369352 2730108682 165
350 iso_pu_bacteria 2791355256 2793294149 165
351 iso_pu_bacteria 2791355262 2793334907 165
352 iso_pu_bacteria 2791355265 2793351556 165
353 iso_pu_bacteria 2802429605 2805926788 165
354 iso_pu_bacteria 2802429606 2805932700 165
355 iso_pu_bacteria 2933599457 2933600668 165
356 iso_pu_bacteria 8005282627 8005284529 165
357 iso_pu_bacteria 8005289223 8005295801 165
358 iso_pu_bacteria 8005430974 8005437568 165
359 iso_pu_bacteria 8005497431 8005501182 165
360 iso_pu_bacteria 8005619151 8005622549 165
361 iso_pu_bacteria 8005626139 8005630051 165
362 iso_pu_bacteria 8005668836 8005672600 165
363 iso_pu_bacteria 8024501048 8024504725 165
364 iso_pu_bacteria 8049293176 8049295559 165
365 iso_pu_bacteria 8056382006 8056387197 165
366 3300002705 JGI25156J39149_1000083 JGI25156J39149_100008313 166
367 3300002737 JGI25162J39368_1000217 JGI25162J39368_10002178 166
368 3300002737 JGI25162J39368_1000272 JGI25162J39368_100027237 166
369 3300002737 JGI25162J39368_1000416 JGI25162J39368_100041611 166
370 3300002738 JGI25154J39366_1000052 JGI25154J39366_100005223 166
371 3300002739 JGI25158J39367_1000097 JGI25158J39367_100009712 166
372 3300002741 JGI25157J39369_1000110 JGI25157J39369_100011066 166
373 3300002773 JGI25152J39213_1001348 JGI25152J39213_100134810 166
374 3300002773 JGI25152J39213_1002158 JGI25152J39213_10021588 166
375 3300002773 JGI25152J39213_1004295 JGI25152J39213_10042955 166
376 3300002773 JGI25152J39213_1004334 JGI25152J39213_10043345 166
377 3300002773 JGI25152J39213_1009466 JGI25152J39213_10094662 166
378 3300002774 JGI25150J39212_1000100 JGI25150J39212_100010038 166
379 3300002774 JGI25150J39212_1003426 JGI25150J39212_10034264 166
380 3300002987 JGI25159J45721_1000832 JGI25159J45721_10008326 166
381 3300002987 JGI25159J45721_1005369 JGI25159J45721_10053694 166
382 3300003187 JGI25151J46595_10000146 JGI25151J46595_1000014680 166
383 3300003187 JGI25151J46595_10002021 JGI25151J46595_100020216 166
384 3300003187 JGI25151J46595_10003013 JGI25151J46595_100030134 166
385 3300003214 JGI25165J46597_1000363 JGI25165J46597_100036335 166
386 3300003214 JGI25165J46597_1000767 JGI25165J46597_100076714 166
387 3300003214 JGI25165J46597_1005503 JGI25165J46597_10055034 166
388 3300003215 JGI25153J46596_10000764 JGI25153J46596_1000076413 166
389 3300003215 JGI25153J46596_10002359 JGI25153J46596_100023596 166
390 3300003215 JGI25153J46596_10004820 JGI25153J46596_100048204 166
391 3300003215 JGI25153J46596_10009056 JGI25153J46596_100090566 166
392 3300003215 JGI25153J46596_10009420 JGI25153J46596_100094205 166
393 3300003215 JGI25153J46596_10009505 JGI25153J46596_100095055 166
394 3300003316 rootH1_10095586 rootH1_100955864 166
395 3300003320 rootH2_10153370 rootH2_101533704 166
396 3300003322 rootL2_10044385 rootL2_100443856 166
397 3300003322 rootL2_10144352 rootL2_101443522 166
398 3300003322 rootL2_10226363 rootL2_102263632 166
399 3300003323 rootH1_10100409 rootH1_101004094 166
400 3300003323 rootH1_10142840 rootH1_101428403 166
401 3300003323 rootH1_10174238 rootH1_101742382 166
402 3300003323 rootH1_10218912 rootH1_102189124 166
403 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001333 166
404 3300003354 JGI25160J50197_1000351 JGI25160J50197_100035111 166
405 3300003354 JGI25160J50197_1018193 JGI25160J50197_10181932 166
406 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001427 166
407 3300003374 JGI25161J50226_1000167 JGI25161J50226_100016725 166
408 3300003374 JGI25161J50226_1005657 JGI25161J50226_10056572 166
409 3300003771 Ga0055526_1000842 Ga0055526_100084216 166
410 3300003771 Ga0055526_1003643 Ga0055526_10036436 166
411 3300003771 Ga0055526_1004423 Ga0055526_10044239 166
412 3300003771 Ga0055526_1063234 Ga0055526_10632341 166
413 3300003775 Ga0055524_1002425 Ga0055524_10024258 166
414 3300003775 Ga0055524_1003892 Ga0055524_10038922 166
415 3300003775 Ga0055524_1007700 Ga0055524_10077004 166
416 3300003775 Ga0055524_1013955 Ga0055524_10139555 166
417 3300003790 Ga0055528_1000158 Ga0055528_100015853 166
418 3300003790 Ga0055528_1000749 Ga0055528_100074912 166
419 3300003790 Ga0055528_1003189 Ga0055528_10031899 166
420 3300003790 Ga0055528_1006485 Ga0055528_10064852 166
421 3300003790 Ga0055528_1009307 Ga0055528_10093073 166
422 3300003790 Ga0055528_1009987 Ga0055528_10099872 166
423 3300003790 Ga0055528_1028730 Ga0055528_10287302 166
424 3300003792 Ga0055540_1000518 Ga0055540_100051819 166
425 3300003792 Ga0055540_1005724 Ga0055540_10057243 166
426 3300003792 Ga0055540_1006013 Ga0055540_10060136 166
427 3300003792 Ga0055540_1028060 Ga0055540_10280601 166
428 3300003856 Ga0058692_1019323 Ga0058692_10193233 166
429 3300004625 Ga0055543_1000060 Ga0055543_100006013 166
430 3300004625 Ga0055543_1000216 Ga0055543_100021610 166
431 3300004625 Ga0055543_1000699 Ga0055543_10006992 166
432 3300005262 Ga0065165_1000008 Ga0065165_1000008122 166
433 3300005262 Ga0065165_1004363 Ga0065165_10043633 166
434 3300005262 Ga0065165_1024721 Ga0065165_10247213 166
435 3300005331 Ga0070670_100001104 Ga0070670_1000011048 166
436 3300005337 Ga0070682_100093382 Ga0070682_1000933824 166
437 3300005347 Ga0070668_100017103 Ga0070668_1000171034 166
438 3300005355 Ga0070671_100033648 Ga0070671_1000336485 166
439 3300005455 Ga0070663_100013668 Ga0070663_1000136682 166
440 3300005457 Ga0070662_100218583 Ga0070662_1002185832 166
441 3300005548 Ga0070665_100033521 Ga0070665_1000335213 166
442 3300005548 Ga0070665_100077343 Ga0070665_1000773434 166
443 3300005563 Ga0068855_100081851 Ga0068855_1000818515 166
444 3300005564 Ga0070664_101564288 Ga0070664_1015642881 166
445 3300005614 Ga0068856_100069955 Ga0068856_1000699554 166
446 3300005616 Ga0068852_100100370 Ga0068852_1001003703 166
447 3300005618 Ga0068864_101465118 Ga0068864_1014651182 166
448 3300005834 Ga0068851_10083539 Ga0068851_100835393 166
449 3300006038 Ga0075365_10007766 Ga0075365_100077667 166
450 3300006038 Ga0075365_10010140 Ga0075365_100101402 166
451 3300006048 Ga0075363_100019422 Ga0075363_1000194224 166
452 3300006048 Ga0075363_100246900 Ga0075363_1002469002 166
453 3300006051 Ga0075364_10015660 Ga0075364_100156604 166
454 3300006178 Ga0075367_10000779 Ga0075367_100007795 166
455 3300006178 Ga0075367_10011013 Ga0075367_100110136 166
456 3300006186 Ga0075369_10003894 Ga0075369_100038944 166
457 3300006186 Ga0075369_10013982 Ga0075369_100139823 166
458 3300006195 Ga0075366_10003058 Ga0075366_100030584 166
459 3300006353 Ga0075370_10002851 Ga0075370_100028518 166
460 3300006353 Ga0075370_10003951 Ga0075370_100039514 166
461 3300006353 Ga0075370_10145512 Ga0075370_101455122 166
462 3300006946 Ga0079104_1002930 Ga0079104_10029308 166
463 3300009011 Ga0105251_10178836 Ga0105251_101788362 166
464 3300009036 Ga0105244_10110776 Ga0105244_101107763 166
465 3300009093 Ga0105240_10000014 Ga0105240_10000014245 166
466 3300009176 Ga0105242_11072798 Ga0105242_110727982 166
467 3300009177 Ga0105248_10253766 Ga0105248_102537663 166
468 3300009545 Ga0105237_10002158 Ga0105237_100021583 166
469 3300009551 Ga0105238_10322407 Ga0105238_103224073 166
470 3300009553 Ga0105249_10082826 Ga0105249_100828266 166
471 3300009765 Ga0123341_1000035 Ga0123341_100003532 166
472 3300009766 Ga0123342_1009440 Ga0123342_100944010 166
473 3300009766 Ga0123342_1011443 Ga0123342_10114435 166
474 3300010375 Ga0105239_10010022 Ga0105239_100100223 166
475 3300012490 Ga0157322_1000730 Ga0157322_10007303 166
476 3300012500 Ga0157314_1019153 Ga0157314_10191531 166
477 3300013102 Ga0157371_10010788 Ga0157371_100107885 166
478 3300013104 Ga0157370_10000329 Ga0157370_1000032948 166
479 3300013104 Ga0157370_10222128 Ga0157370_102221281 166
480 3300013105 Ga0157369_10024034 Ga0157369_100240348 166
481 3300013105 Ga0157369_10137963 Ga0157369_101379634 166
482 3300013296 Ga0157374_10432742 Ga0157374_104327423 166
483 3300013306 Ga0163162_11225313 Ga0163162_112253132 166
484 3300014497 Ga0182008_10047466 Ga0182008_100474662 166
485 3300015262 Ga0182007_10149017 Ga0182007_101490172 166
486 3300015265 Ga0182005_1000982 Ga0182005_10009825 166
487 3300021327 Ga0214543_1000022 Ga0214543_1000022138 166
488 3300022739 Ga0228711_1000911 Ga0228711_100091126 166
489 3300022740 Ga0228710_1001018 Ga0228710_100101826 166
490 3300025206 Ga0209435_100027 Ga0209435_100027139 166
491 3300025208 Ga0209436_100081 Ga0209436_10008137 166
492 3300025233 Ga0209437_100051 Ga0209437_10005122 166
493 3300025233 Ga0209437_100060 Ga0209437_100060243 166
494 3300025233 Ga0209437_120317 Ga0209437_1203172 166
495 3300025245 Ga0207425_1000046 Ga0207425_100004676 166
496 3300025245 Ga0207425_1002771 Ga0207425_10027716 166
497 3300025245 Ga0207425_1004453 Ga0207425_10044532 166
498 3300025245 Ga0207425_1005031 Ga0207425_10050315 166
499 3300025245 Ga0207425_1011923 Ga0207425_10119233 166
500 3300025246 Ga0209646_1000086 Ga0209646_1000086139 166
501 3300025250 Ga0209026_1000082 Ga0209026_1000082139 166
502 3300025253 Ga0209677_100540 Ga0209677_1005403 166
503 3300025256 Ga0209759_1000063 Ga0209759_100006362 166
504 3300025258 Ga0209129_1000171 Ga0209129_100017126 166
505 3300025258 Ga0209129_1000283 Ga0209129_100028318 166
506 3300025258 Ga0209129_1000450 Ga0209129_100045019 166
507 3300025258 Ga0209129_1001443 Ga0209129_10014438 166
508 3300025258 Ga0209129_1001916 Ga0209129_10019167 166
509 3300025258 Ga0209129_1009838 Ga0209129_10098384 166
510 3300025261 Ga0209233_1000095 Ga0209233_100009515 166
511 3300025261 Ga0209233_1000190 Ga0209233_1000190117 166
512 3300025261 Ga0209233_1000228 Ga0209233_100022866 166
513 3300025272 Ga0209455_1012427 Ga0209455_10124273 166
514 3300025273 Ga0209673_1000010 Ga0209673_1000010565 166
515 3300025273 Ga0209673_1000025 Ga0209673_1000025148 166
516 3300025273 Ga0209673_1000112 Ga0209673_100011273 166
517 3300025273 Ga0209673_1000637 Ga0209673_100063745 166
518 3300025273 Ga0209673_1002270 Ga0209673_100227017 166
519 3300025273 Ga0209673_1003653 Ga0209673_10036537 166
520 3300025273 Ga0209673_1004043 Ga0209673_10040434 166
521 3300025273 Ga0209673_1007813 Ga0209673_10078134 166
522 3300025273 Ga0209673_1016727 Ga0209673_10167273 166
523 3300025284 Ga0209130_1000003 Ga0209130_1000003442 166
524 3300025284 Ga0209130_1000023 Ga0209130_100002345 166
525 3300025291 Ga0209675_1028606 Ga0209675_10286062 166
526 3300025292 Ga0209676_1015342 Ga0209676_10153421 166
527 3300025292 Ga0209676_1045217 Ga0209676_10452172 166
528 3300025294 Ga0209025_1000091 Ga0209025_1000091187 166
529 3300025294 Ga0209025_1000137 Ga0209025_1000137115 166
530 3300025294 Ga0209025_1000154 Ga0209025_100015490 166
531 3300025294 Ga0209025_1001424 Ga0209025_100142423 166
532 3300025294 Ga0209025_1003075 Ga0209025_10030752 166
533 3300025294 Ga0209025_1005945 Ga0209025_10059456 166
534 3300025294 Ga0209025_1006114 Ga0209025_10061145 166
535 3300025294 Ga0209025_1017218 Ga0209025_10172182 166
536 3300025294 Ga0209025_1031234 Ga0209025_10312342 166
537 3300025294 Ga0209025_1041893 Ga0209025_10418933 166
538 3300025294 Ga0209025_1053647 Ga0209025_10536472 166
539 3300025295 Ga0209564_1000564 Ga0209564_100056439 166
540 3300025295 Ga0209564_1000672 Ga0209564_100067219 166
541 3300025295 Ga0209564_1001566 Ga0209564_10015668 166
542 3300025295 Ga0209564_1003798 Ga0209564_10037989 166
543 3300025295 Ga0209564_1004779 Ga0209564_10047799 166
544 3300025295 Ga0209564_1012665 Ga0209564_10126655 166
545 3300025295 Ga0209564_1024044 Ga0209564_10240443 166
546 3300025297 Ga0209758_1000123 Ga0209758_1000123115 166
547 3300025297 Ga0209758_1000725 Ga0209758_100072526 166
548 3300025297 Ga0209758_1000863 Ga0209758_100086323 166
549 3300025297 Ga0209758_1001901 Ga0209758_100190114 166
550 3300025297 Ga0209758_1001960 Ga0209758_100196016 166
551 3300025297 Ga0209758_1002718 Ga0209758_10027189 166
552 3300025297 Ga0209758_1013190 Ga0209758_10131907 166
553 3300025297 Ga0209758_1052307 Ga0209758_10523072 166
554 3300025299 Ga0209256_1000914 Ga0209256_10009148 166
555 3300025299 Ga0209256_1001132 Ga0209256_100113217 166
556 3300025299 Ga0209256_1001499 Ga0209256_10014993 166
557 3300025299 Ga0209256_1003097 Ga0209256_100309710 166
558 3300025302 Ga0207426_1000008 Ga0207426_100000825 166
559 3300025302 Ga0207426_1000011 Ga0207426_1000011334 166
560 3300025302 Ga0207426_1000228 Ga0207426_100022899 166
561 3300025302 Ga0207426_1006647 Ga0207426_10066473 166
562 3300025302 Ga0207426_1045577 Ga0207426_10455773 166
563 3300025303 Ga0209051_1000462 Ga0209051_100046241 166
564 3300025303 Ga0209051_1001635 Ga0209051_100163514 166
565 3300025303 Ga0209051_1018677 Ga0209051_10186775 166
566 3300025303 Ga0209051_1024476 Ga0209051_10244763 166
567 3300025303 Ga0209051_1035888 Ga0209051_10358884 166
568 3300025303 Ga0209051_1040421 Ga0209051_10404212 166
569 3300025304 Ga0209257_1003221 Ga0209257_10032216 166
570 3300025304 Ga0209257_1027936 Ga0209257_10279363 166
571 3300025728 Ga0207655_1070225 Ga0207655_10702253 166
572 3300025913 Ga0207695_10000037 Ga0207695_10000037246 166
573 3300025914 Ga0207671_10001228 Ga0207671_1000122810 166
574 3300025925 Ga0207650_10001248 Ga0207650_1000124810 166
575 3300025931 Ga0207644_10058528 Ga0207644_100585283 166
576 3300025933 Ga0207706_10396628 Ga0207706_103966282 166
577 3300025941 Ga0207711_10061404 Ga0207711_100614042 166
578 3300025941 Ga0207711_10777985 Ga0207711_107779852 166
579 3300025949 Ga0207667_10244061 Ga0207667_102440613 166
580 3300025961 Ga0207712_10070189 Ga0207712_100701895 166
581 3300025972 Ga0207668_10019380 Ga0207668_100193804 166
582 3300026067 Ga0207678_10025462 Ga0207678_100254622 166
583 3300026078 Ga0207702_10034211 Ga0207702_100342114 166
584 3300026118 Ga0207675_101198773 Ga0207675_1011987731 166
585 3300026142 Ga0207698_10040802 Ga0207698_100408024 166
586 3300027111 Ga0209281_1000314 Ga0209281_100031415 166
587 3300027312 Ga0209371_1003792 Ga0209371_10037926 166
588 3300027666 Ga0209282_1000068 Ga0209282_100006815 166
589 3300028379 Ga0268266_10016723 Ga0268266_100167233 166
590 3300028379 Ga0268266_10113508 Ga0268266_101135082 166
591 3300028379 Ga0268266_11307936 Ga0268266_113079362 166
592 3300030500 Ga0268256_1004051 Ga0268256_10040516 166
593 3300031456 Ga0307513_10009210 Ga0307513_1000921014 166
594 3300031901 Ga0307406_10005188 Ga0307406_1000518810 166
595 3300031967 Ga0315914_1000937 Ga0315914_100093726 166
596 3300033430 Ga0315913_1000094 Ga0315913_100009413 166
597 3300033464 Ga0315915_1000007 Ga0315915_1000007256 166
598 3300035692 Ga0373935_0064610 Ga0373935_0064610_1004_1504 166
599 3300035695 Ga0373927_0000419 Ga0373927_0000419_11043_11543 166
600 3300037068 Ga0373925_0013435 Ga0373925_0013435_2168_2668 166
601 3300041406 Ga0439439_0066880 Ga0439439_0066880_213_722 166
602 3300041413 Ga0439465_0007418 Ga0439465_0007418_2933_3433 166
603 3300041413 Ga0439465_0020742 Ga0439465_0020742_14_523 166
604 3300041413 Ga0439465_0192233 Ga0439465_0192233_202_711 166
605 3300041451 Ga0451791_1551885 Ga0451791_1551885_28_528 166
606 3300041456 Ga0451795_1420712 Ga0451795_1420712_334_834 166
607 3300041458 Ga0451798_0238337 Ga0451798_0238337_791_1291 166
608 3300041491 Ga0451833_1231102 Ga0451833_1231102_841_1341 166
609 3300041491 Ga0451833_1502043 Ga0451833_1502043_814_1314 166
610 3300041492 Ga0451835_0807566 Ga0451835_0807566_383_904 166
611 3300041492 Ga0451835_1058308 Ga0451835_1058308_79_579 166
612 3300041494 Ga0451837_1738972 Ga0451837_1738972_574_1095 166
613 3300041494 Ga0451837_1746634 Ga0451837_1746634_101_601 166
614 3300041496 Ga0451839_0192833 Ga0451839_0192833_295_816 166
615 3300041496 Ga0451839_0948094 Ga0451839_0948094_97_597 166
616 3300041498 Ga0451841_0429116 Ga0451841_0429116_922_1422 166
617 3300041498 Ga0451841_1104641 Ga0451841_1104641_1177_1677 166
618 3300041501 Ga0451845_0499475 Ga0451845_0499475_851_1351 166
619 3300041501 Ga0451845_0973335 Ga0451845_0973335_90_590 166
620 3300041503 Ga0451847_0082401 Ga0451847_0082401_268_768 166
621 3300041503 Ga0451847_0607285 Ga0451847_0607285_1336_1836 166
622 3300041505 Ga0451849_1443791 Ga0451849_1443791_140_661 166
623 3300041507 Ga0451851_0943143 Ga0451851_0943143_90_590 166
624 3300041509 Ga0451843_1685512 Ga0451843_1685512_90_590 166
625 3300041511 Ga0451855_0815820 Ga0451855_0815820_1178_1678 166
626 3300041512 Ga0451853_2501046 Ga0451853_2501046_750_1250 166
627 3300041512 Ga0451853_3684319 Ga0451853_3684319_257_778 166
628 3300041997 Ga0439431_0056870 Ga0439431_0056870_168_668 166
629 3300042006 Ga0439432_007950 Ga0439432_007950_2654_3154 166
630 3300042006 Ga0439432_026777 Ga0439432_026777_63_572 166
631 3300042007 Ga0439449_0152285 Ga0439449_0152285_208_717 166
632 3300042015 Ga0439462_0033305 Ga0439462_0033305_436_945 166
633 3300042145 Ga0450906_050612 Ga0450906_050612_122_631 166
634 3300046459 Ga0495629_0162058 Ga0495629_0162058_695_1195 166
635 3300046460 Ga0495638_0000953 Ga0495638_0000953_6675_7175 166
636 3300046460 Ga0495638_0066963 Ga0495638_0066963_1030_1551 166
637 3300046471 Ga0495650_0047731 Ga0495650_0047731_1247_1747 166
638 3300046474 Ga0495605_0001474 Ga0495605_0001474_1095_1595 166
639 3300046476 Ga0495662_0050509 Ga0495662_0050509_862_1362 166
640 3300046492 Ga0495585_0025457 Ga0495585_0025457_1551_2051 166
641 3300046492 Ga0495585_0035085 Ga0495585_0035085_318_824 166
642 3300046492 Ga0495585_0093666 Ga0495585_0093666_55_555 166
643 3300046501 Ga0495607_0027658 Ga0495607_0027658_1113_1634 166
644 3300046501 Ga0495607_0061843 Ga0495607_0061843_862_1362 166
645 3300046501 Ga0495607_0118772 Ga0495607_0118772_823_1323 166
646 3300046506 Ga0495583_0003748 Ga0495583_0003748_6532_7032 166
647 3300046506 Ga0495583_0071976 Ga0495583_0071976_253_753 166
648 3300046507 Ga0495606_0002168 Ga0495606_0002168_4975_5475 166
649 3300046507 Ga0495606_0007555 Ga0495606_0007555_8797_9336 166
650 3300046507 Ga0495606_0079620 Ga0495606_0079620_707_1213 166
651 3300046507 Ga0495606_0098151 Ga0495606_0098151_749_1249 166
652 3300046507 Ga0495606_0108264 Ga0495606_0108264_328_837 166
653 3300046512 Ga0495610_0012771 Ga0495610_0012771_2009_2509 166
654 3300046512 Ga0495610_0078298 Ga0495610_0078298_358_897 166
655 3300046512 Ga0495610_0206397 Ga0495610_0206397_42_542 166
656 3300046513 Ga0495616_0029527 Ga0495616_0029527_1139_1639 166
657 3300046515 Ga0495620_0013879 Ga0495620_0013879_1101_1601 166
658 3300046515 Ga0495620_0015027 Ga0495620_0015027_1237_1776 166
659 3300046515 Ga0495620_0049762 Ga0495620_0049762_140_646 166
660 3300046515 Ga0495620_0116773 Ga0495620_0116773_435_935 166
661 3300046518 Ga0495631_0012885 Ga0495631_0012885_274_774 166
662 3300046518 Ga0495631_0112723 Ga0495631_0112723_97_618 166
663 3300046519 Ga0495632_0021253 Ga0495632_0021253_1340_1861 166
664 3300046519 Ga0495632_0027050 Ga0495632_0027050_1786_2286 166
665 3300046519 Ga0495632_0031964 Ga0495632_0031964_430_930 166
666 3300046522 Ga0495643_0015550 Ga0495643_0015550_2010_2531 166
667 3300046522 Ga0495643_0021412 Ga0495643_0021412_2222_2722 166
668 3300046522 Ga0495643_0028677 Ga0495643_0028677_1104_1604 166
669 3300046522 Ga0495643_0030166 Ga0495643_0030166_87_587 166
670 3300046522 Ga0495643_0046895 Ga0495643_0046895_1657_2157 166
671 3300046524 Ga0495648_0024217 Ga0495648_0024217_2487_2987 166
672 3300046529 Ga0495652_0139625 Ga0495652_0139625_991_1491 166
673 3300046530 Ga0495654_0046838 Ga0495654_0046838_95_595 166
674 3300046530 Ga0495654_0085348 Ga0495654_0085348_189_710 166
675 3300046533 Ga0495640_0155864 Ga0495640_0155864_196_696 166
676 3300046538 Ga0495609_0008203 Ga0495609_0008203_1505_2005 166
677 3300046539 Ga0495621_0249847 Ga0495621_0249847_103_603 166
678 3300046542 Ga0495597_0005392 Ga0495597_0005392_464_1003 166
679 3300046542 Ga0495597_0041159 Ga0495597_0041159_609_1109 166
680 3300046558 Ga0495633_0021557 Ga0495633_0021557_1456_1956 166
681 3300046558 Ga0495633_0049675 Ga0495633_0049675_1411_1911 166
682 3300046616 Ga0495668_0003159 Ga0495668_0003159_9612_10112 166
683 3300046616 Ga0495668_0080778 Ga0495668_0080778_386_886 166
684 3300046616 Ga0495668_0160466 Ga0495668_0160466_193_714 166
685 3300046660 Ga0495625_0005331 Ga0495625_0005331_3203_3703 166
686 3300046660 Ga0495625_0079315 Ga0495625_0079315_1473_1979 166
687 3300046660 Ga0495625_0395524 Ga0495625_0395524_48_548 166
688 3300046665 Ga0495661_0220406 Ga0495661_0220406_45_551 166
689 3300046674 Ga0495588_0028037 Ga0495588_0028037_870_1370 166
690 3300046674 Ga0495588_0297038 Ga0495588_0297038_299_799 166
691 3300046675 Ga0495657_0015576 Ga0495657_0015576_4297_4797 166
692 3300046679 Ga0495623_0272196 Ga0495623_0272196_247_747 166
693 3300046683 Ga0495658_0015476 Ga0495658_0015476_2163_2663 166
694 3300046690 Ga0495624_0175362 Ga0495624_0175362_225_725 166
695 3300046691 Ga0495670_0003394 Ga0495670_0003394_1706_2206 166
696 3300046691 Ga0495670_0168934 Ga0495670_0168934_380_880 166
697 3300046692 Ga0495671_0052719 Ga0495671_0052719_940_1440 166
698 3300046692 Ga0495671_0279731 Ga0495671_0279731_270_770 166
699 3300046694 Ga0495649_0133392 Ga0495649_0133392_136_636 166
700 3300046694 Ga0495649_0301388 Ga0495649_0301388_257_757 166
701 3300046694 Ga0495649_0310166 Ga0495649_0310166_250_750 166
702 3300046809 Ga0495600_0181214 Ga0495600_0181214_737_1237 166
703 3300046810 Ga0495660_0006886 Ga0495660_0006886_931_1452 166
704 3300046810 Ga0495660_0045004 Ga0495660_0045004_1042_1542 166
705 3300046810 Ga0495660_0100978 Ga0495660_0100978_213_713 166
706 3300046810 Ga0495660_0151581 Ga0495660_0151581_514_1014 166
707 3300047317 Ga0495604_0020148 Ga0495604_0020148_3471_3971 166
708 3300047320 Ga0495672_0003408 Ga0495672_0003408_4115_4615 166
709 3300047323 Ga0495683_0106909 Ga0495683_0106909_653_1153 166
710 3300047323 Ga0495683_0108272 Ga0495683_0108272_477_1016 166
711 3300047443 Ga0495687_071801 Ga0495687_071801_96_662 166
712 3300047469 Ga0495673_0057862 Ga0495673_0057862_965_1465 166
713 3300047472 Ga0495686_0007900 Ga0495686_0007900_2772_3272 166
714 3300047472 Ga0495686_0016439 Ga0495686_0016439_1959_2459 166
715 3300047472 Ga0495686_0018844 Ga0495686_0018844_2786_3295 166
716 3300047472 Ga0495686_0076249 Ga0495686_0076249_888_1427 166
717 3300047472 Ga0495686_0152204 Ga0495686_0152204_676_1182 166
718 3300047472 Ga0495686_0167317 Ga0495686_0167317_303_803 166
719 3300048088 Ga0495602_0064072 Ga0495602_0064072_2445_2945 166
720 3300048091 Ga0495626_0076009 Ga0495626_0076009_657_1157 166
721 3300048903 Ga0496100_0082487 Ga0496100_0082487_1076_1576 166
722 3300048903 Ga0496100_0130452 Ga0496100_0130452_711_1211 166
723 3300048903 Ga0496100_0417950 Ga0496100_0417950_98_598 166
724 3300048904 Ga0496101_0152268 Ga0496101_0152268_253_753 166
725 3300048904 Ga0496101_0500149 Ga0496101_0500149_39_539 166
726 3300048905 Ga0496102_0004330 Ga0496102_0004330_2658_3158 166
727 3300048905 Ga0496102_0060372 Ga0496102_0060372_1696_2196 166
728 3300048905 Ga0496102_0398169 Ga0496102_0398169_510_1010 166
729 3300048905 Ga0496102_0422780 Ga0496102_0422780_406_906 166
730 3300048906 Ga0496103_0036078 Ga0496103_0036078_1234_1734 166
731 3300048906 Ga0496103_0067827 Ga0496103_0067827_1200_1700 166
732 3300048907 Ga0496104_0049484 Ga0496104_0049484_1479_1979 166
733 3300048908 Ga0496105_0029943 Ga0496105_0029943_1704_2204 166
734 3300048909 Ga0496106_0001496 Ga0496106_0001496_3228_3728 166
735 3300048909 Ga0496106_0257501 Ga0496106_0257501_790_1290 166
736 3300048909 Ga0496106_0312292 Ga0496106_0312292_324_824 166
737 3300048910 Ga0496107_0235302 Ga0496107_0235302_119_619 166
738 3300048914 Ga0496111_0052564 Ga0496111_0052564_1280_1780 166
739 3300048916 Ga0496113_0029675 Ga0496113_0029675_1973_2473 166
740 3300048916 Ga0496113_0130856 Ga0496113_0130856_1127_1627 166
741 3300048917 Ga0496114_0600412 Ga0496114_0600412_59_565 166
742 3300048919 Ga0496116_0000105 Ga0496116_0000105_127337_127837 166
743 3300048919 Ga0496116_0006216 Ga0496116_0006216_1482_1982 166
744 3300048919 Ga0496116_0016794 Ga0496116_0016794_2504_3004 166
745 3300048919 Ga0496116_0022826 Ga0496116_0022826_2092_2592 166
746 3300048919 Ga0496116_0027730 Ga0496116_0027730_1303_1803 166
747 3300048919 Ga0496116_0088663 Ga0496116_0088663_1267_1782 166
748 3300048919 Ga0496116_0130640 Ga0496116_0130640_884_1384 166
749 3300048919 Ga0496116_0162805 Ga0496116_0162805_676_1191 166
750 3300048919 Ga0496116_0168630 Ga0496116_0168630_537_1037 166
751 3300048919 Ga0496116_0175723 Ga0496116_0175723_216_716 166
752 3300048919 Ga0496116_0252900 Ga0496116_0252900_28_543 166
753 3300048919 Ga0496116_0337550 Ga0496116_0337550_154_669 166
754 3300048920 Ga0496117_0003292 Ga0496117_0003292_7537_8037 166
755 3300048920 Ga0496117_0020448 Ga0496117_0020448_2570_3085 166
756 3300048920 Ga0496117_0025317 Ga0496117_0025317_1331_1852 166
757 3300048920 Ga0496117_0026153 Ga0496117_0026153_1561_2061 166
758 3300048920 Ga0496117_0026472 Ga0496117_0026472_2508_3008 166
759 3300048920 Ga0496117_0077801 Ga0496117_0077801_10_510 166
760 3300048920 Ga0496117_0135002 Ga0496117_0135002_441_941 166
761 3300048921 Ga0496118_0001388 Ga0496118_0001388_25287_25787 166
762 3300048921 Ga0496118_0004636 Ga0496118_0004636_11766_12287 166
763 3300048921 Ga0496118_0023728 Ga0496118_0023728_2854_3354 166
764 3300048921 Ga0496118_0027341 Ga0496118_0027341_2176_2676 166
765 3300048921 Ga0496118_0093072 Ga0496118_0093072_351_851 166
766 3300048922 Ga0496119_0041712 Ga0496119_0041712_980_1480 166
767 3300048922 Ga0496119_0046892 Ga0496119_0046892_1145_1660 166
768 3300048922 Ga0496119_0052554 Ga0496119_0052554_373_873 166
769 3300048922 Ga0496119_0053295 Ga0496119_0053295_707_1207 166
770 3300048922 Ga0496119_0053562 Ga0496119_0053562_600_1100 166
771 3300048922 Ga0496119_0251684 Ga0496119_0251684_266_781 166
772 3300048923 Ga0496120_0016940 Ga0496120_0016940_3871_4371 166
773 3300048923 Ga0496120_0024822 Ga0496120_0024822_179_694 166
774 3300048923 Ga0496120_0063461 Ga0496120_0063461_491_991 166
775 3300048923 Ga0496120_0124784 Ga0496120_0124784_749_1249 166
776 3300048924 Ga0496121_0000003 Ga0496121_0000003_617466_617981 166
777 3300048924 Ga0496121_0001287 Ga0496121_0001287_11024_11524 166
778 3300048924 Ga0496121_0009257 Ga0496121_0009257_7726_8226 166
779 3300048924 Ga0496121_0019082 Ga0496121_0019082_3944_4444 166
780 3300048924 Ga0496121_0020642 Ga0496121_0020642_3906_4406 166
781 3300048924 Ga0496121_0023780 Ga0496121_0023780_2856_3356 166
782 3300048924 Ga0496121_0034993 Ga0496121_0034993_2768_3268 166
783 3300048924 Ga0496121_0044494 Ga0496121_0044494_1533_2033 166
784 3300048924 Ga0496121_0046491 Ga0496121_0046491_1184_1684 166
785 3300048924 Ga0496121_0128385 Ga0496121_0128385_461_976 166
786 3300048924 Ga0496121_0261940 Ga0496121_0261940_332_832 166
787 3300048924 Ga0496121_0351527 Ga0496121_0351527_78_578 166
788 3300048924 Ga0496121_0455654 Ga0496121_0455654_286_786 166
789 3300048925 Ga0496122_0004472 Ga0496122_0004472_3243_3743 166
790 3300048925 Ga0496122_0007629 Ga0496122_0007629_1321_1821 166
791 3300048925 Ga0496122_0027041 Ga0496122_0027041_1717_2217 166
792 3300048925 Ga0496122_0046450 Ga0496122_0046450_2682_3182 166
793 3300048925 Ga0496122_0076984 Ga0496122_0076984_1808_2308 166
794 3300048925 Ga0496122_0083743 Ga0496122_0083743_1132_1647 166
795 3300048925 Ga0496122_0085683 Ga0496122_0085683_1457_1957 166
796 3300048925 Ga0496122_0222764 Ga0496122_0222764_326_826 166
797 3300048926 Ga0496123_0004704 Ga0496123_0004704_2970_3470 166
798 3300048926 Ga0496123_0026575 Ga0496123_0026575_2384_2884 166
799 3300048926 Ga0496123_0027668 Ga0496123_0027668_1843_2343 166
800 3300048926 Ga0496123_0035340 Ga0496123_0035340_1774_2274 166
801 3300048926 Ga0496123_0037700 Ga0496123_0037700_1888_2388 166
802 3300048926 Ga0496123_0037920 Ga0496123_0037920_1462_1962 166
803 3300048926 Ga0496123_0039968 Ga0496123_0039968_2722_3222 166
804 3300048926 Ga0496123_0072249 Ga0496123_0072249_1605_2120 166
805 3300048926 Ga0496123_0072636 Ga0496123_0072636_1258_1758 166
806 3300048926 Ga0496123_0176583 Ga0496123_0176583_578_1093 166
807 3300048926 Ga0496123_0490819 Ga0496123_0490819_12_512 166
808 3300048927 Ga0496124_0006920 Ga0496124_0006920_9321_9821 166
809 3300048927 Ga0496124_0014287 Ga0496124_0014287_2858_3358 166
810 3300048927 Ga0496124_0060381 Ga0496124_0060381_2007_2507 166
811 3300048927 Ga0496124_0082420 Ga0496124_0082420_472_972 166
812 3300048927 Ga0496124_0090792 Ga0496124_0090792_556_1056 166
813 3300048927 Ga0496124_0110472 Ga0496124_0110472_1678_2178 166
814 3300048927 Ga0496124_0251993 Ga0496124_0251993_678_1178 166
815 3300048927 Ga0496124_0530043 Ga0496124_0530043_248_748 166
816 3300048927 Ga0496124_0805054 Ga0496124_0805054_32_532 166
817 3300048928 Ga0496125_0001144 Ga0496125_0001144_14916_15431 166
818 3300048928 Ga0496125_0022507 Ga0496125_0022507_2562_3062 166
819 3300048928 Ga0496125_0029569 Ga0496125_0029569_1570_2070 166
820 3300048928 Ga0496125_0041754 Ga0496125_0041754_433_933 166
821 3300048928 Ga0496125_0051306 Ga0496125_0051306_723_1223 166
822 3300048928 Ga0496125_0107302 Ga0496125_0107302_1116_1616 166
823 3300048928 Ga0496125_0176967 Ga0496125_0176967_639_1139 166
824 3300048928 Ga0496125_0399768 Ga0496125_0399768_18_533 166
825 3300048929 Ga0496126_0000188 Ga0496126_0000188_74693_75193 166
826 3300048929 Ga0496126_0026789 Ga0496126_0026789_2348_2848 166
827 3300048929 Ga0496126_0063420 Ga0496126_0063420_1483_1983 166
828 3300048929 Ga0496126_0154814 Ga0496126_0154814_679_1179 166
829 3300048929 Ga0496126_0183512 Ga0496126_0183512_941_1465 166
830 3300048929 Ga0496126_0205108 Ga0496126_0205108_1102_1617 166
831 3300048929 Ga0496126_0264240 Ga0496126_0264240_821_1321 166
832 3300048929 Ga0496126_0316630 Ga0496126_0316630_401_901 166
833 3300048929 Ga0496126_0354689 Ga0496126_0354689_21_521 166
834 3300049459 Ga0495678_023199 Ga0495678_023199_1644_2144 166
835 3300049460 Ga0495682_0014013 Ga0495682_0014013_1440_1940 166
836 3300049569 Ga0501032_0292454 Ga0501032_0292454_234_734 166
837 3300049571 Ga0501034_0659324 Ga0501034_0659324_403_903 166
838 3300049572 Ga0501036_0050174 Ga0501036_0050174_489_989 166
839 3300049575 Ga0501039_0040985 Ga0501039_0040985_2297_2797 166
840 3300049580 Ga0501046_0148852 Ga0501046_0148852_184_684 166
841 3300049580 Ga0501046_0773174 Ga0501046_0773174_76_615 166
842 3300049582 Ga0501048_0075266 Ga0501048_0075266_900_1400 166
843 3300049584 Ga0501068_0118339 Ga0501068_0118339_702_1202 166
844 3300049589 Ga0501073_0059397 Ga0501073_0059397_560_1060 166
845 3300049742 Ga0501080_0378860 Ga0501080_0378860_132_632 166
846 3300049744 Ga0501083_0036853 Ga0501083_0036853_1477_1977 166
847 3300049744 Ga0501083_0085696 Ga0501083_0085696_1483_1983 166
848 3300049776 Ga0501280_004434 Ga0501280_004434_1047_1547 166
849 3300049822 Ga0501035_0114306 Ga0501035_0114306_429_929 166
850 3300049823 Ga0501044_0051657 Ga0501044_0051657_1126_1626 166
851 3300050489 nmdc:mga03683_5823_c1 nmdc:mga03683_5823_c1_1835_2356 166
852 3300050490 nmdc:mga03n38_183942_c1 nmdc:mga03n38_183942_c1_485_1006 166
853 3300050490 nmdc:mga03n38_357398_c1 nmdc:mga03n38_357398_c1_24_563 166
854 3300050491 nmdc:mga00v17_19824_c1 nmdc:mga00v17_19824_c1_583_1098 166
855 3300050492 nmdc:mga0yw44_19943_c1 nmdc:mga0yw44_19943_c1_1168_1689 166
856 3300050492 nmdc:mga0yw44_40104_c1 nmdc:mga0yw44_40104_c1_799_1299 166
857 3300050494 nmdc:mga06z11_20051_c1 nmdc:mga06z11_20051_c1_1671_2171 166
858 3300050494 nmdc:mga06z11_51470_c1 nmdc:mga06z11_51470_c1_582_1103 166
859 3300050496 nmdc:mga07m45_144524_c1 nmdc:mga07m45_144524_c1_252_773 166
860 3300050496 nmdc:mga07m45_435_c1 nmdc:mga07m45_435_c1_4034_4555 166
861 3300050516 nmdc:mga0sz30_100272_c1 nmdc:mga0sz30_100272_c1_234_734 166
862 3300050516 nmdc:mga0sz30_12651_c1 nmdc:mga0sz30_12651_c1_2524_3045 166
863 3300053077 Ga0495601_0213437 Ga0495601_0213437_619_1119 166
864 3300053079 Ga0500610_0003011 Ga0500610_0003011_704_1204 166
865 3300053085 Ga0495619_0137969 Ga0495619_0137969_268_768 166
866 3300053086 Ga0500578_0347755 Ga0500578_0347755_329_829 166
867 3300053087 Ga0500643_082782 Ga0500643_082782_170_670 166
868 3300053098 Ga0500650_0092591 Ga0500650_0092591_115_615 166
869 3300053118 Ga0500594_0001767 Ga0500594_0001767_999_1499 166
870 3300053122 Ga0500608_022686 Ga0500608_022686_1340_1846 166
871 3300053123 Ga0500614_095452 Ga0500614_095452_247_747 166
872 3300053125 Ga0500618_005217 Ga0500618_005217_2087_2587 166
873 3300053125 Ga0500618_008675 Ga0500618_008675_1245_1745 166
874 3300053130 Ga0500642_0310063 Ga0500642_0310063_98_598 166
875 3300053134 Ga0500658_0010742 Ga0500658_0010742_500_1039 166
876 3300053134 Ga0500658_0043795 Ga0500658_0043795_20_520 166
877 3300053134 Ga0500658_0046487 Ga0500658_0046487_578_1078 166
878 3300053139 Ga0500568_0001459 Ga0500568_0001459_2715_3215 166
879 3300053139 Ga0500568_0007906 Ga0500568_0007906_2648_3148 166
880 3300053139 Ga0500568_0042642 Ga0500568_0042642_1050_1550 166
881 3300053148 Ga0500590_013983 Ga0500590_013983_1516_2016 166
882 3300053151 Ga0500604_0009282 Ga0500604_0009282_1266_1766 166
883 3300053153 Ga0500616_0005056 Ga0500616_0005056_797_1297 166
884 3300053156 Ga0500622_0001665 Ga0500622_0001665_3074_3574 166
885 3300053156 Ga0500622_0284525 Ga0500622_0284525_60_581 166
886 3300053158 Ga0500627_0022298 Ga0500627_0022298_1357_1878 166
887 3300053160 Ga0500633_0001402 Ga0500633_0001402_2420_2920 166
888 3300053177 Ga0500636_0169273 Ga0500636_0169273_558_1058 166
889 iso_pu_bacteria 2510065019 2510134240 166
890 iso_pu_bacteria 2510917030 2511199317 166
891 iso_pu_bacteria 2513237084 2513567683 166
892 iso_pu_bacteria 2513237085 2513577965 166
893 iso_pu_bacteria 2513237093 2513631882 166
894 iso_pu_bacteria 2513237103 2513707910 166
895 iso_pu_bacteria 2515075009 2515113402 166
896 iso_pu_bacteria 2515154134 2515739773 166
897 iso_pu_bacteria 2516653077 2517037005 166
898 iso_pu_bacteria 2517093000 2517096128 166
899 iso_pu_bacteria 2718218423 2721400398 166
900 iso_pu_bacteria 2721755809 2724039211 166
901 iso_pu_bacteria 2724679232 2725950361 166
902 iso_pu_bacteria 2838736955 2838737724 166
903 iso_pu_bacteria 2841840854 2841841907 166
904 iso_pu_bacteria 2842140634 2842141686 166
905 iso_pu_bacteria 2929138655 2929141075 166
906 iso_pu_bacteria 2935901341 2935901662 166
907 iso_pu_bacteria 2984587000 2984590231 166
908 iso_pu_bacteria 639633055 639649460 166
909 iso_pu_bacteria 8005307578 8005313889 166
910 iso_pu_bacteria 8005460587 8005464086 166
911 iso_pu_bacteria 8005556819 8005561507 166
912 iso_pu_bacteria 8005563573 8005568285 166
913 iso_pu_bacteria 8018163183 8018164281 166
914 iso_pu_bacteria 8023680758 8023682875 166
915 iso_pu_bacteria 8057874678 8057882067 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04115

Ureidogly_lyase

Ureidoglycolate lyase

2

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bdr-assembly1.cif.gz_B crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49 0.9402 2 162
1yqc-assembly1.cif.gz_B crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7 0.8921 1 161
1xsr-assembly1.cif.gz_B x-ray structure of northeast structural genomics consortium target sfr7 0.8823 1 161
1xsq-assembly1.cif.gz_A crystal structure of ureidoglycolate hydrolase from e.coli. northeast structural genomics consortium target et81. 0.8795 1 161
1yqc-assembly1.cif.gz_B crystal structure of ureidoglycolate hydrolase (alla) from escherichia coli o157:h7 0.8709 1 161
ID Description Score Start End Superfamily
2bdrB00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.9232 3 162 2.60.120.480
af_O13843_3_189_2.60.120.480 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.9228 2 161 2.60.120.480
2bdrB00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.9066 3 162 2.60.120.480
af_O13843_3_189_2.60.120.480 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.8856 2 161 2.60.120.480
1xsqA00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.872 1 161 2.60.120.480
ID Description Score Start End GO Terms
AF-A0A5C7TYM5-F1-model_v4 deleted 0.9909 1 165
AF-A0A6N9ZNI9-F1-model_v4 Ureidoglycolate lyase (EC 4.3.2.3) (Ureidoglycolatase) 0.9871 1 166 GO:0000256
GO:0004848
GO:0006145
GO:0050385
AF-A0A367ZZK8-F1-model_v4 Ureidoglycolate lyase (EC 4.3.2.3) (Ureidoglycolatase) 0.9865 1 163 GO:0000256
GO:0004848
GO:0006145
GO:0050385
AF-A0A2N0D5E2-F1-model_v4 Ureidoglycolate lyase (EC 4.3.2.3) (Ureidoglycolatase) 0.9862 1 165 GO:0000256
GO:0004848
GO:0006145
GO:0050385
AF-A0A1S7MFQ1-F1-model_v4 deleted 0.9861 1 165

Feature Viewer

pLDDT pTM Quality
96.4 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map