F485421
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 307 | 1818 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0380051|Ga0495592_0380051_35_361 |
| Length | 108 |
| Sequence | MKTLPVLQPLCCGPDTPVMSAGAAADLAATFKALSDPTRVAIVNRLAATECCVCDLTAAFALSQPTVSHHLRILRDAGLVEAERRGTWAYYRLAPDAVDRLQGIFTPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 179 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 304 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 9.13 |
| Rhizosphere | 90.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495592_0380051 | 3300046454 | Unclassified | 899 |
| 2 | Ga0070658_10044395 | 3300005327 | Bacteria | 3592 |
| 3 | Ga0070658_10122757 | 3300005327 | Bacteria | 2159 |
| 4 | Ga0070658_10515143 | 3300005327 | Bacteria | 1034 |
| 5 | Ga0070658_10528988 | 3300005327 | Bacteria | 1020 |
| 6 | Ga0070676_10147072 | 3300005328 | Bacteria | 1505 |
| 7 | Ga0070683_100175213 | 3300005329 | Bacteria | 2036 |
| 8 | Ga0070683_100632167 | 3300005329 | Bacteria | 1025 |
| 9 | Ga0070683_101320943 | 3300005329 | Bacteria | 693 |
| 10 | Ga0070683_101406161 | 3300005329 | Bacteria | 670 |
| 11 | Ga0070690_100772180 | 3300005330 | Bacteria | 743 |
| 12 | Ga0070670_100331849 | 3300005331 | Bacteria | 1334 |
| 13 | Ga0070680_100017427 | 3300005336 | Bacteria | 5665 |
| 14 | Ga0070680_100100954 | 3300005336 | Bacteria | 2395 |
| 15 | Ga0070680_100141281 | 3300005336 | Bacteria | 2019 |
| 16 | Ga0070682_100193090 | 3300005337 | Bacteria | 1431 |
| 17 | Ga0070682_100428020 | 3300005337 | Bacteria | 1008 |
| 18 | Ga0070660_101114452 | 3300005339 | Bacteria | 668 |
| 19 | Ga0070660_101514059 | 3300005339 | Bacteria | 570 |
| 20 | Ga0070691_10003297 | 3300005341 | Bacteria | 7236 |
| 21 | Ga0070691_10106161 | 3300005341 | Bacteria | 1400 |
| 22 | Ga0070661_100273140 | 3300005344 | Bacteria | 1310 |
| 23 | Ga0070661_100288695 | 3300005344 | Bacteria | 1274 |
| 24 | Ga0070661_100748239 | 3300005344 | Bacteria | 799 |
| 25 | Ga0070668_100636256 | 3300005347 | Bacteria | 936 |
| 26 | Ga0070675_100410503 | 3300005354 | Bacteria | 1209 |
| 27 | Ga0070675_100981198 | 3300005354 | Bacteria | 775 |
| 28 | Ga0070671_101191739 | 3300005355 | Bacteria | 670 |
| 29 | Ga0070673_101254533 | 3300005364 | Unclassified | 695 |
| 30 | Ga0070659_100035344 | 3300005366 | Bacteria | 3891 |
| 31 | Ga0070659_100377317 | 3300005366 | Bacteria | 1194 |
| 32 | Ga0070709_10013994 | 3300005434 | Bacteria | 4527 |
| 33 | Ga0070709_10059358 | 3300005434 | Bacteria | 2428 |
| 34 | Ga0070709_10079845 | 3300005434 | Bacteria | 2132 |
| 35 | Ga0070709_10298990 | 3300005434 | Bacteria | 1175 |
| 36 | Ga0070709_10616801 | 3300005434 | Bacteria | 837 |
| 37 | Ga0070714_100006571 | 3300005435 | Bacteria | 8993 |
| 38 | Ga0070714_100018726 | 3300005435 | Bacteria | 5632 |
| 39 | Ga0070714_100021410 | 3300005435 | Bacteria | 5291 |
| 40 | Ga0070714_100024680 | 3300005435 | Bacteria | 4954 |
| 41 | Ga0070714_100089592 | 3300005435 | Bacteria | 2693 |
| 42 | Ga0070714_100168279 | 3300005435 | Bacteria | 1987 |
| 43 | Ga0070714_100217596 | 3300005435 | Bacteria | 1754 |
| 44 | Ga0070714_100635790 | 3300005435 | Bacteria | 1026 |
| 45 | Ga0070714_100903528 | 3300005435 | Bacteria | 857 |
| 46 | Ga0070714_101933995 | 3300005435 | Bacteria | 575 |
| 47 | Ga0070714_102372707 | 3300005435 | Bacteria | 515 |
| 48 | Ga0070713_100000665 | 3300005436 | Bacteria | 21987 |
| 49 | Ga0070713_100003272 | 3300005436 | Bacteria | 10673 |
| 50 | Ga0070713_100088784 | 3300005436 | Bacteria | 2654 |
| 51 | Ga0070713_100317293 | 3300005436 | Bacteria | 1438 |
| 52 | Ga0070713_101252079 | 3300005436 | Bacteria | 718 |
| 53 | Ga0070713_101457887 | 3300005436 | Bacteria | 664 |
| 54 | Ga0070713_101838984 | 3300005436 | Bacteria | 588 |
| 55 | Ga0070710_10005614 | 3300005437 | Bacteria | 5972 |
| 56 | Ga0070710_10017125 | 3300005437 | Bacteria | 3703 |
| 57 | Ga0070710_11103591 | 3300005437 | Bacteria | 582 |
| 58 | Ga0070711_100003012 | 3300005439 | Bacteria | 9738 |
| 59 | Ga0070711_100157689 | 3300005439 | Bacteria | 1718 |
| 60 | Ga0070711_100165876 | 3300005439 | Bacteria | 1679 |
| 61 | Ga0070711_100517865 | 3300005439 | Bacteria | 985 |
| 62 | Ga0070711_100752871 | 3300005439 | Bacteria | 823 |
| 63 | Ga0070711_100752873 | 3300005439 | Bacteria | 823 |
| 64 | Ga0070700_100035388 | 3300005441 | Bacteria | 3022 |
| 65 | Ga0070694_100827684 | 3300005444 | Bacteria | 760 |
| 66 | Ga0070694_101218275 | 3300005444 | Bacteria | 631 |
| 67 | Ga0070708_101492004 | 3300005445 | Bacteria | 630 |
| 68 | Ga0070678_101477111 | 3300005456 | Bacteria | 636 |
| 69 | Ga0070662_100145972 | 3300005457 | Bacteria | 1838 |
| 70 | Ga0070681_10159545 | 3300005458 | Bacteria | 2179 |
| 71 | Ga0070681_10172802 | 3300005458 | Bacteria | 2082 |
| 72 | Ga0070681_10247448 | 3300005458 | Bacteria | 1696 |
| 73 | Ga0070681_10409027 | 3300005458 | Bacteria | 1268 |
| 74 | Ga0070681_10527471 | 3300005458 | Bacteria | 1094 |
| 75 | Ga0070681_10758832 | 3300005458 | Bacteria | 887 |
| 76 | Ga0070681_11241019 | 3300005458 | Bacteria | 668 |
| 77 | Ga0070706_100309744 | 3300005467 | Bacteria | 1473 |
| 78 | Ga0070707_100001128 | 3300005468 | Bacteria | 26352 |
| 79 | Ga0070707_100236323 | 3300005468 | Bacteria | 1779 |
| 80 | Ga0070707_100292878 | 3300005468 | Bacteria | 1582 |
| 81 | Ga0070698_100218758 | 3300005471 | Bacteria | 1839 |
| 82 | Ga0070699_100147402 | 3300005518 | Bacteria | 2080 |
| 83 | Ga0070699_100421020 | 3300005518 | Bacteria | 1209 |
| 84 | Ga0070699_101757010 | 3300005518 | Bacteria | 568 |
| 85 | Ga0070699_101877367 | 3300005518 | Bacteria | 548 |
| 86 | Ga0070679_100027058 | 3300005530 | Bacteria | 5640 |
| 87 | Ga0070679_100056618 | 3300005530 | Bacteria | 3906 |
| 88 | Ga0070679_100093701 | 3300005530 | Bacteria | 2991 |
| 89 | Ga0070679_100304361 | 3300005530 | Bacteria | 1544 |
| 90 | Ga0070679_100454624 | 3300005530 | Bacteria | 1225 |
| 91 | Ga0070679_100979094 | 3300005530 | Bacteria | 790 |
| 92 | Ga0070679_100983132 | 3300005530 | Bacteria | 788 |
| 93 | Ga0070684_100039997 | 3300005535 | Bacteria | 4034 |
| 94 | Ga0070684_100080081 | 3300005535 | Bacteria | 2889 |
| 95 | Ga0070684_100091374 | 3300005535 | Bacteria | 2708 |
| 96 | Ga0070684_100155070 | 3300005535 | Unclassified | 2076 |
| 97 | Ga0070697_100075331 | 3300005536 | Bacteria | 2773 |
| 98 | Ga0070697_100291644 | 3300005536 | Bacteria | 1401 |
| 99 | Ga0068853_101017515 | 3300005539 | Bacteria | 798 |
| 100 | Ga0070686_100186324 | 3300005544 | Bacteria | 1478 |
| 101 | Ga0070695_100336921 | 3300005545 | Bacteria | 1126 |
| 102 | Ga0070696_100409068 | 3300005546 | Bacteria | 1063 |
| 103 | Ga0070696_101135120 | 3300005546 | Bacteria | 658 |
| 104 | Ga0070696_101229899 | 3300005546 | Bacteria | 634 |
| 105 | Ga0070693_100034992 | 3300005547 | Bacteria | 2783 |
| 106 | Ga0070693_100624307 | 3300005547 | Bacteria | 781 |
| 107 | Ga0068855_100435518 | 3300005563 | Bacteria | 1432 |
| 108 | Ga0068855_100512356 | 3300005563 | Bacteria | 1302 |
| 109 | Ga0068855_102185358 | 3300005563 | Bacteria | 556 |
| 110 | Ga0070664_100335279 | 3300005564 | Bacteria | 1373 |
| 111 | Ga0070664_101041477 | 3300005564 | Bacteria | 770 |
| 112 | Ga0068857_101706091 | 3300005577 | Unclassified | 616 |
| 113 | Ga0068854_100143605 | 3300005578 | Bacteria | 1834 |
| 114 | Ga0068854_102144527 | 3300005578 | Bacteria | 516 |
| 115 | Ga0068856_100032269 | 3300005614 | Bacteria | 5126 |
| 116 | Ga0068856_100178555 | 3300005614 | Bacteria | 2136 |
| 117 | Ga0068856_101033386 | 3300005614 | Bacteria | 840 |
| 118 | Ga0068856_101166972 | 3300005614 | Bacteria | 787 |
| 119 | Ga0070702_100181288 | 3300005615 | Bacteria | 1378 |
| 120 | Ga0070702_100247249 | 3300005615 | Bacteria | 1207 |
| 121 | Ga0068852_100432879 | 3300005616 | Bacteria | 1299 |
| 122 | Ga0068864_100554753 | 3300005618 | Bacteria | 1111 |
| 123 | Ga0068861_100028909 | 3300005719 | Bacteria | 4048 |
| 124 | Ga0068861_101526338 | 3300005719 | Bacteria | 656 |
| 125 | Ga0068851_11012902 | 3300005834 | Bacteria | 524 |
| 126 | Ga0068870_10525230 | 3300005840 | Bacteria | 793 |
| 127 | Ga0068870_10968959 | 3300005840 | Bacteria | 605 |
| 128 | Ga0068863_100253539 | 3300005841 | Bacteria | 1700 |
| 129 | Ga0068863_100850875 | 3300005841 | Bacteria | 911 |
| 130 | Ga0068862_100231587 | 3300005844 | Bacteria | 1676 |
| 131 | Ga0081455_10080411 | 3300005937 | Bacteria | 2672 |
| 132 | Ga0081455_10253218 | 3300005937 | Bacteria | 1287 |
| 133 | Ga0070717_10004499 | 3300006028 | Bacteria | 10074 |
| 134 | Ga0070717_10006185 | 3300006028 | Bacteria | 8788 |
| 135 | Ga0070717_10007203 | 3300006028 | Bacteria | 8249 |
| 136 | Ga0070717_10048414 | 3300006028 | Bacteria | 3486 |
| 137 | Ga0070717_10071076 | 3300006028 | Bacteria | 2902 |
| 138 | Ga0070717_10327682 | 3300006028 | Bacteria | 1365 |
| 139 | Ga0070717_10573047 | 3300006028 | Unclassified | 1023 |
| 140 | Ga0070717_10672763 | 3300006028 | Bacteria | 940 |
| 141 | Ga0070717_10933892 | 3300006028 | Bacteria | 790 |
| 142 | Ga0070717_10982947 | 3300006028 | Bacteria | 768 |
| 143 | Ga0075365_10440972 | 3300006038 | Bacteria | 919 |
| 144 | Ga0075363_100571199 | 3300006048 | Bacteria | 676 |
| 145 | Ga0075432_10000679 | 3300006058 | Bacteria | 10462 |
| 146 | Ga0070715_10000827 | 3300006163 | Bacteria | 8487 |
| 147 | Ga0070716_100000663 | 3300006173 | Bacteria | 14622 |
| 148 | Ga0070716_100016673 | 3300006173 | Bacteria | 3796 |
| 149 | Ga0070716_100153010 | 3300006173 | Bacteria | 1486 |
| 150 | Ga0070716_101159383 | 3300006173 | Bacteria | 619 |
| 151 | Ga0070712_100518931 | 3300006175 | Bacteria | 1000 |
| 152 | Ga0070712_100843397 | 3300006175 | Bacteria | 788 |
| 153 | Ga0070712_101503096 | 3300006175 | Bacteria | 588 |
| 154 | Ga0070712_101652676 | 3300006175 | Bacteria | 560 |
| 155 | Ga0075362_10689156 | 3300006177 | Bacteria | 532 |
| 156 | Ga0097621_101303333 | 3300006237 | Bacteria | 686 |
| 157 | Ga0068871_100103360 | 3300006358 | Bacteria | 2389 |
| 158 | Ga0075428_100123242 | 3300006844 | Bacteria | 2821 |
| 159 | Ga0075428_100393181 | 3300006844 | Unclassified | 1486 |
| 160 | Ga0075431_100188959 | 3300006847 | Bacteria | 2111 |
| 161 | Ga0075433_10047201 | 3300006852 | Bacteria | 3745 |
| 162 | Ga0075433_10510479 | 3300006852 | Bacteria | 1058 |
| 163 | Ga0075433_10638010 | 3300006852 | Bacteria | 934 |
| 164 | Ga0075434_100015565 | 3300006871 | Bacteria | 7300 |
| 165 | Ga0075434_100072472 | 3300006871 | Bacteria | 3437 |
| 166 | Ga0075434_101163200 | 3300006871 | Bacteria | 784 |
| 167 | Ga0075429_100038332 | 3300006880 | Bacteria | 4172 |
| 168 | Ga0068865_101164905 | 3300006881 | Bacteria | 681 |
| 169 | Ga0075436_101139093 | 3300006914 | Bacteria | 588 |
| 170 | Ga0105251_10467878 | 3300009011 | Bacteria | 586 |
| 171 | Ga0105240_10141561 | 3300009093 | Bacteria | 2875 |
| 172 | Ga0105240_10316562 | 3300009093 | Bacteria | 1780 |
| 173 | Ga0105240_10338374 | 3300009093 | Bacteria | 1710 |
| 174 | Ga0105240_10611884 | 3300009093 | Bacteria | 1198 |
| 175 | Ga0105240_11432469 | 3300009093 | Unclassified | 726 |
| 176 | Ga0111539_10165764 | 3300009094 | Bacteria | 2583 |
| 177 | Ga0111539_10262132 | 3300009094 | Bacteria | 2012 |
| 178 | Ga0105245_10004034 | 3300009098 | Bacteria | 13061 |
| 179 | Ga0105245_10515291 | 3300009098 | Bacteria | 1214 |
| 180 | Ga0105245_11197322 | 3300009098 | Bacteria | 807 |
| 181 | Ga0105245_12777298 | 3300009098 | Bacteria | 542 |
| 182 | Ga0105247_10036142 | 3300009101 | Bacteria | 3012 |
| 183 | Ga0114129_10063673 | 3300009147 | Bacteria | 5148 |
| 184 | Ga0114129_10648011 | 3300009147 | Bacteria | 1364 |
| 185 | Ga0105243_10025030 | 3300009148 | Bacteria | 4558 |
| 186 | Ga0105241_11432051 | 3300009174 | Bacteria | 663 |
| 187 | Ga0105242_10687791 | 3300009176 | Bacteria | 999 |
| 188 | Ga0105248_10103121 | 3300009177 | Bacteria | 3215 |
| 189 | Ga0105248_11503081 | 3300009177 | Bacteria | 762 |
| 190 | Ga0105237_10232057 | 3300009545 | Bacteria | 1846 |
| 191 | Ga0105237_10309328 | 3300009545 | Bacteria | 1583 |
| 192 | Ga0105237_11742852 | 3300009545 | Unclassified | 630 |
| 193 | Ga0105238_10857318 | 3300009551 | Bacteria | 926 |
| 194 | Ga0105249_10511302 | 3300009553 | Bacteria | 1247 |
| 195 | Ga0099796_10590025 | 3300010159 | Bacteria | 500 |
| 196 | Ga0105239_10034836 | 3300010375 | Bacteria | 5529 |
| 197 | Ga0105239_10474213 | 3300010375 | Bacteria | 1421 |
| 198 | Ga0105246_10556353 | 3300011119 | Bacteria | 984 |
| 199 | Ga0157373_10034934 | 3300013100 | Bacteria | 3610 |
| 200 | Ga0157373_10259228 | 3300013100 | Bacteria | 1230 |
| 201 | Ga0157373_10652694 | 3300013100 | Bacteria | 768 |
| 202 | Ga0157373_11251760 | 3300013100 | Bacteria | 560 |
| 203 | Ga0157371_10954246 | 3300013102 | Bacteria | 652 |
| 204 | Ga0157370_10142668 | 3300013104 | Bacteria | 2232 |
| 205 | Ga0157370_10510318 | 3300013104 | Bacteria | 1104 |
| 206 | Ga0157370_10543607 | 3300013104 | Bacteria | 1065 |
| 207 | Ga0157369_10003691 | 3300013105 | Bacteria | 18191 |
| 208 | Ga0157369_10110278 | 3300013105 | Bacteria | 2926 |
| 209 | Ga0157369_10192968 | 3300013105 | Bacteria | 2139 |
| 210 | Ga0157369_10299755 | 3300013105 | Bacteria | 1672 |
| 211 | Ga0157369_11877808 | 3300013105 | Bacteria | 608 |
| 212 | Ga0157369_12658762 | 3300013105 | Bacteria | 505 |
| 213 | Ga0157374_10006679 | 3300013296 | Bacteria | 9803 |
| 214 | Ga0157374_10367072 | 3300013296 | Bacteria | 1432 |
| 215 | Ga0157374_10473095 | 3300013296 | Bacteria | 1256 |
| 216 | Ga0163162_10269355 | 3300013306 | Bacteria | 1835 |
| 217 | Ga0163162_10601374 | 3300013306 | Bacteria | 1226 |
| 218 | Ga0157372_10479504 | 3300013307 | Bacteria | 1450 |
| 219 | Ga0157372_10886001 | 3300013307 | Unclassified | 1036 |
| 220 | Ga0157372_11075517 | 3300013307 | Bacteria | 931 |
| 221 | Ga0157372_11737139 | 3300013307 | Bacteria | 718 |
| 222 | Ga0157375_10356336 | 3300013308 | Bacteria | 1629 |
| 223 | Ga0182008_10546385 | 3300014497 | Bacteria | 643 |
| 224 | Ga0157377_10022167 | 3300014745 | Bacteria | 3350 |
| 225 | Ga0157379_10575949 | 3300014968 | Bacteria | 1049 |
| 226 | Ga0157379_10649141 | 3300014968 | Bacteria | 988 |
| 227 | Ga0157376_10040289 | 3300014969 | Bacteria | 3817 |
| 228 | Ga0157376_11040707 | 3300014969 | Bacteria | 843 |
| 229 | Ga0157376_11211765 | 3300014969 | Bacteria | 783 |
| 230 | Ga0182006_1238395 | 3300015261 | Bacteria | 598 |
| 231 | Ga0206356_10507006 | 3300020070 | Bacteria | 577 |
| 232 | Ga0206356_10820228 | 3300020070 | Bacteria | 614 |
| 233 | Ga0206352_10411163 | 3300020078 | Bacteria | 652 |
| 234 | Ga0206354_10452674 | 3300020081 | Bacteria | 3527 |
| 235 | Ga0206354_10625982 | 3300020081 | Bacteria | 1362 |
| 236 | Ga0206353_10335697 | 3300020082 | Bacteria | 1090 |
| 237 | Ga0206353_10669165 | 3300020082 | Bacteria | 574 |
| 238 | Ga0206353_11395614 | 3300020082 | Bacteria | 968 |
| 239 | Ga0206353_11950027 | 3300020082 | Bacteria | 773 |
| 240 | Ga0207692_10016300 | 3300025898 | Bacteria | 3287 |
| 241 | Ga0207710_10300252 | 3300025900 | Bacteria | 811 |
| 242 | Ga0207688_10010611 | 3300025901 | Bacteria | 5009 |
| 243 | Ga0207685_10014224 | 3300025905 | Bacteria | 2486 |
| 244 | Ga0207685_10092708 | 3300025905 | Bacteria | 1275 |
| 245 | Ga0207699_10016756 | 3300025906 | Bacteria | 3841 |
| 246 | Ga0207699_10016833 | 3300025906 | Bacteria | 3834 |
| 247 | Ga0207699_10023034 | 3300025906 | Bacteria | 3384 |
| 248 | Ga0207699_10042106 | 3300025906 | Bacteria | 2643 |
| 249 | Ga0207699_10133514 | 3300025906 | Bacteria | 1622 |
| 250 | Ga0207699_10862541 | 3300025906 | Bacteria | 667 |
| 251 | Ga0207645_10427267 | 3300025907 | Bacteria | 893 |
| 252 | Ga0207643_10017811 | 3300025908 | Bacteria | 3889 |
| 253 | Ga0207705_10579597 | 3300025909 | Bacteria | 872 |
| 254 | Ga0207705_10819387 | 3300025909 | Bacteria | 722 |
| 255 | Ga0207684_10102190 | 3300025910 | Unclassified | 2451 |
| 256 | Ga0207684_10579532 | 3300025910 | Bacteria | 959 |
| 257 | Ga0207654_11187282 | 3300025911 | Bacteria | 556 |
| 258 | Ga0207707_10033045 | 3300025912 | Bacteria | 4528 |
| 259 | Ga0207707_10341224 | 3300025912 | Bacteria | 1292 |
| 260 | Ga0207707_10389194 | 3300025912 | Bacteria | 1198 |
| 261 | Ga0207707_10481572 | 3300025912 | Bacteria | 1060 |
| 262 | Ga0207707_10606472 | 3300025912 | Bacteria | 926 |
| 263 | Ga0207707_11497584 | 3300025912 | Bacteria | 535 |
| 264 | Ga0207695_10686866 | 3300025913 | Bacteria | 904 |
| 265 | Ga0207695_10920486 | 3300025913 | Unclassified | 754 |
| 266 | Ga0207695_11330436 | 3300025913 | Bacteria | 599 |
| 267 | Ga0207671_10629333 | 3300025914 | Bacteria | 855 |
| 268 | Ga0207693_10002222 | 3300025915 | Bacteria | 16897 |
| 269 | Ga0207693_10014582 | 3300025915 | Bacteria | 6315 |
| 270 | Ga0207693_10124112 | 3300025915 | Bacteria | 2029 |
| 271 | Ga0207693_10238612 | 3300025915 | Bacteria | 1427 |
| 272 | Ga0207693_10956475 | 3300025915 | Bacteria | 655 |
| 273 | Ga0207663_10012957 | 3300025916 | Bacteria | 4522 |
| 274 | Ga0207663_10049683 | 3300025916 | Bacteria | 2603 |
| 275 | Ga0207663_10163046 | 3300025916 | Bacteria | 1576 |
| 276 | Ga0207663_11511964 | 3300025916 | Bacteria | 541 |
| 277 | Ga0207660_10367144 | 3300025917 | Bacteria | 1155 |
| 278 | Ga0207660_10487603 | 3300025917 | Bacteria | 999 |
| 279 | Ga0207657_10002895 | 3300025919 | Bacteria | 18432 |
| 280 | Ga0207649_10302439 | 3300025920 | Bacteria | 1170 |
| 281 | Ga0207649_10450156 | 3300025920 | Bacteria | 972 |
| 282 | Ga0207649_10571844 | 3300025920 | Bacteria | 867 |
| 283 | Ga0207649_10640482 | 3300025920 | Bacteria | 820 |
| 284 | Ga0207649_10827551 | 3300025920 | Bacteria | 724 |
| 285 | Ga0207652_10097627 | 3300025921 | Bacteria | 2590 |
| 286 | Ga0207652_10185900 | 3300025921 | Bacteria | 1868 |
| 287 | Ga0207652_10214505 | 3300025921 | Bacteria | 1734 |
| 288 | Ga0207652_10288949 | 3300025921 | Bacteria | 1479 |
| 289 | Ga0207652_11023483 | 3300025921 | Bacteria | 725 |
| 290 | Ga0207652_11532898 | 3300025921 | Bacteria | 570 |
| 291 | Ga0207646_10004762 | 3300025922 | Bacteria | 14607 |
| 292 | Ga0207646_10225185 | 3300025922 | Bacteria | 1694 |
| 293 | Ga0207646_10520686 | 3300025922 | Bacteria | 1071 |
| 294 | Ga0207646_10724533 | 3300025922 | Bacteria | 888 |
| 295 | Ga0207694_10182801 | 3300025924 | Bacteria | 1701 |
| 296 | Ga0207687_10002673 | 3300025927 | Bacteria | 12065 |
| 297 | Ga0207687_10426819 | 3300025927 | Bacteria | 1095 |
| 298 | Ga0207687_10806445 | 3300025927 | Bacteria | 801 |
| 299 | Ga0207687_11668601 | 3300025927 | Bacteria | 546 |
| 300 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 301 | Ga0207700_10031669 | 3300025928 | Bacteria | 3760 |
| 302 | Ga0207700_10039117 | 3300025928 | Bacteria | 3449 |
| 303 | Ga0207700_10055842 | 3300025928 | Bacteria | 2969 |
| 304 | Ga0207664_10005419 | 3300025929 | Bacteria | 8714 |
| 305 | Ga0207664_10005888 | 3300025929 | Bacteria | 8387 |
| 306 | Ga0207664_10012720 | 3300025929 | Bacteria | 6023 |
| 307 | Ga0207664_10042598 | 3300025929 | Bacteria | 3545 |
| 308 | Ga0207664_10052460 | 3300025929 | Bacteria | 3225 |
| 309 | Ga0207664_10165502 | 3300025929 | Bacteria | 1889 |
| 310 | Ga0207664_10195155 | 3300025929 | Bacteria | 1745 |
| 311 | Ga0207664_10200706 | 3300025929 | Bacteria | 1721 |
| 312 | Ga0207664_10358981 | 3300025929 | Bacteria | 1290 |
| 313 | Ga0207664_10410561 | 3300025929 | Bacteria | 1205 |
| 314 | Ga0207664_10770972 | 3300025929 | Bacteria | 865 |
| 315 | Ga0207664_11311534 | 3300025929 | Bacteria | 643 |
| 316 | Ga0207664_11820136 | 3300025929 | Bacteria | 531 |
| 317 | Ga0207644_11092596 | 3300025931 | Bacteria | 670 |
| 318 | Ga0207690_10137563 | 3300025932 | Bacteria | 1795 |
| 319 | Ga0207690_10214523 | 3300025932 | Bacteria | 1469 |
| 320 | Ga0207690_11304649 | 3300025932 | Bacteria | 607 |
| 321 | Ga0207690_11605830 | 3300025932 | Bacteria | 543 |
| 322 | Ga0207706_10022328 | 3300025933 | Bacteria | 5679 |
| 323 | Ga0207686_10612027 | 3300025934 | Bacteria | 858 |
| 324 | Ga0207709_10127255 | 3300025935 | Bacteria | 1730 |
| 325 | Ga0207665_10000562 | 3300025939 | Bacteria | 25011 |
| 326 | Ga0207665_10098939 | 3300025939 | Bacteria | 2033 |
| 327 | Ga0207665_10215708 | 3300025939 | Bacteria | 1404 |
| 328 | Ga0207665_11144015 | 3300025939 | Bacteria | 621 |
| 329 | Ga0207711_10353822 | 3300025941 | Bacteria | 1360 |
| 330 | Ga0207711_10413675 | 3300025941 | Bacteria | 1254 |
| 331 | Ga0207661_10051353 | 3300025944 | Bacteria | 3290 |
| 332 | Ga0207661_10195790 | 3300025944 | Bacteria | 1774 |
| 333 | Ga0207661_10891694 | 3300025944 | Bacteria | 819 |
| 334 | Ga0207661_11126848 | 3300025944 | Bacteria | 722 |
| 335 | Ga0207679_10150754 | 3300025945 | Bacteria | 1892 |
| 336 | Ga0207679_10253078 | 3300025945 | Bacteria | 1498 |
| 337 | Ga0207679_11673611 | 3300025945 | Unclassified | 582 |
| 338 | Ga0207667_10571403 | 3300025949 | Bacteria | 1142 |
| 339 | Ga0207667_10585123 | 3300025949 | Bacteria | 1126 |
| 340 | Ga0207667_10926996 | 3300025949 | Bacteria | 862 |
| 341 | Ga0207712_10823697 | 3300025961 | Bacteria | 817 |
| 342 | Ga0207712_11722232 | 3300025961 | Bacteria | 562 |
| 343 | Ga0207668_10171576 | 3300025972 | Bacteria | 1702 |
| 344 | Ga0207639_10578495 | 3300026041 | Bacteria | 1034 |
| 345 | Ga0207708_10064612 | 3300026075 | Bacteria | 2796 |
| 346 | Ga0207702_10141358 | 3300026078 | Bacteria | 2178 |
| 347 | Ga0207702_10281837 | 3300026078 | Bacteria | 1571 |
| 348 | Ga0207702_11073481 | 3300026078 | Bacteria | 799 |
| 349 | Ga0207641_10784247 | 3300026088 | Bacteria | 942 |
| 350 | Ga0207676_10500286 | 3300026095 | Bacteria | 1154 |
| 351 | Ga0207683_11391410 | 3300026121 | Bacteria | 649 |
| 352 | Ga0207698_10148731 | 3300026142 | Bacteria | 2029 |
| 353 | Ga0207698_11214937 | 3300026142 | Bacteria | 768 |
| 354 | Ga0207428_10026849 | 3300027907 | Bacteria | 4798 |
| 355 | Ga0265319_1044499 | 3300028563 | Bacteria | 1487 |
| 356 | Ga0265338_10013750 | 3300028800 | Bacteria | 9102 |
| 357 | Ga0265338_10269062 | 3300028800 | Bacteria | 1249 |
| 358 | Ga0265320_10417376 | 3300031240 | Bacteria | 592 |
| 359 | Ga0265340_10150508 | 3300031247 | Bacteria | 1061 |
| 360 | Ga0265327_10378016 | 3300031251 | Bacteria | 617 |
| 361 | Ga0307409_101057621 | 3300031995 | Bacteria | 832 |
| 362 | Ga0373926_0026255 | 3300035083 | Bacteria | 2036 |
| 363 | Ga0373934_0115427 | 3300035086 | Bacteria | 1091 |
| 364 | Ga0373934_0151337 | 3300035086 | Bacteria | 950 |
| 365 | Ga0373953_0287258 | 3300035117 | Bacteria | 717 |
| 366 | Ga0373954_0299716 | 3300035118 | Bacteria | 793 |
| 367 | Ga0373957_0158130 | 3300035120 | Unclassified | 933 |
| 368 | Ga0373943_0001293 | 3300035170 | Bacteria | 11237 |
| 369 | Ga0373955_0589098 | 3300035172 | Bacteria | 681 |
| 370 | Ga0373942_0143196 | 3300035207 | Bacteria | 763 |
| 371 | Ga0373942_0185210 | 3300035207 | Bacteria | 684 |
| 372 | Ga0373961_0193688 | 3300035241 | Bacteria | 714 |
| 373 | Ga0373924_0217957 | 3300035410 | Bacteria | 843 |
| 374 | Ga0373931_0039463 | 3300035691 | Bacteria | 2474 |
| 375 | Ga0373935_0135845 | 3300035692 | Bacteria | 1657 |
| 376 | Ga0373935_0731020 | 3300035692 | Unclassified | 729 |
| 377 | Ga0373927_0014230 | 3300035695 | Bacteria | 5274 |
| 378 | Ga0373933_0414377 | 3300035724 | Bacteria | 880 |
| 379 | Ga0373947_0004518 | 3300035725 | Bacteria | 8157 |
| 380 | Ga0373937_0016365 | 3300036401 | Bacteria | 6585 |
| 381 | Ga0373937_0073117 | 3300036401 | Bacteria | 3162 |
| 382 | Ga0373937_0153734 | 3300036401 | Bacteria | 2156 |
| 383 | Ga0373937_1746589 | 3300036401 | Unclassified | 569 |
| 384 | Ga0373925_0008872 | 3300037068 | Bacteria | 7325 |
| 385 | Ga0395899_0118777 | 3300037312 | Bacteria | 1895 |
| 386 | Ga0395899_0277241 | 3300037312 | Bacteria | 1142 |
| 387 | Ga0395899_0350796 | 3300037312 | Bacteria | 987 |
| 388 | Ga0395899_0411306 | 3300037312 | Bacteria | 893 |
| 389 | Ga0395900_0052091 | 3300037418 | Bacteria | 4214 |
| 390 | Ga0395900_0486521 | 3300037418 | Bacteria | 1186 |
| 391 | Ga0395900_0656083 | 3300037418 | Bacteria | 985 |
| 392 | Ga0395900_0718574 | 3300037418 | Bacteria | 931 |
| 393 | Ga0395900_1442136 | 3300037418 | Bacteria | 601 |
| 394 | Ga0395898_0144505 | 3300037466 | Bacteria | 2277 |
| 395 | Ga0395898_0250624 | 3300037466 | Bacteria | 1689 |
| 396 | Ga0395898_0293322 | 3300037466 | Bacteria | 1551 |
| 397 | Ga0395898_0327817 | 3300037466 | Bacteria | 1460 |
| 398 | Ga0395898_0940102 | 3300037466 | Bacteria | 802 |
| 399 | Ga0395905_0026568 | 3300037471 | Bacteria | 5458 |
| 400 | Ga0395905_0152208 | 3300037471 | Bacteria | 2176 |
| 401 | Ga0395905_0311865 | 3300037471 | Bacteria | 1462 |
| 402 | Ga0395901_0060380 | 3300038443 | Bacteria | 3945 |
| 403 | Ga0395901_0076808 | 3300038443 | Bacteria | 3485 |
| 404 | Ga0395901_0619852 | 3300038443 | Bacteria | 1089 |
| 405 | Ga0395901_0661751 | 3300038443 | Bacteria | 1046 |
| 406 | Ga0395901_0852558 | 3300038443 | Bacteria | 896 |
| 407 | Ga0436360_1070180 | 3300039438 | Unclassified | 529 |
| 408 | Ga0451804_1163253 | 3300041463 | Bacteria | 740 |
| 409 | Ga0451839_1184555 | 3300041496 | Unclassified | 676 |
| 410 | Ga0439440_0090678 | 3300042993 | Bacteria | 820 |
| 411 | Ga0466969_0002408 | 3300044656 | Bacteria | 9995 |
| 412 | Ga0466969_0009754 | 3300044656 | Bacteria | 5089 |
| 413 | Ga0466969_0070464 | 3300044656 | Bacteria | 1682 |
| 414 | Ga0466965_0092389 | 3300044683 | Bacteria | 1541 |
| 415 | Ga0466965_0211414 | 3300044683 | Bacteria | 1031 |
| 416 | Ga0466965_0241202 | 3300044683 | Bacteria | 968 |
| 417 | Ga0466966_0028183 | 3300044684 | Bacteria | 3659 |
| 418 | Ga0466966_0300071 | 3300044684 | Bacteria | 965 |
| 419 | Ga0466966_0800140 | 3300044684 | Bacteria | 568 |
| 420 | Ga0466961_0000819 | 3300044693 | Bacteria | 19417 |
| 421 | Ga0466961_0003296 | 3300044693 | Bacteria | 10061 |
| 422 | Ga0466961_0015491 | 3300044693 | Bacteria | 4892 |
| 423 | Ga0466961_0030502 | 3300044693 | Bacteria | 3465 |
| 424 | Ga0466961_0049913 | 3300044693 | Bacteria | 2673 |
| 425 | Ga0466961_0467256 | 3300044693 | Bacteria | 763 |
| 426 | Ga0466961_0617625 | 3300044693 | Bacteria | 651 |
| 427 | Ga0466963_0000590 | 3300044694 | Bacteria | 17295 |
| 428 | Ga0466963_0001319 | 3300044694 | Bacteria | 13206 |
| 429 | Ga0466963_0003019 | 3300044694 | Bacteria | 9521 |
| 430 | Ga0466963_0004719 | 3300044694 | Bacteria | 7957 |
| 431 | Ga0466963_0005067 | 3300044694 | Bacteria | 7699 |
| 432 | Ga0466963_0005412 | 3300044694 | Bacteria | 7476 |
| 433 | Ga0466963_0005809 | 3300044694 | Bacteria | 7260 |
| 434 | Ga0466963_0015937 | 3300044694 | Bacteria | 4666 |
| 435 | Ga0466963_0024000 | 3300044694 | Bacteria | 3879 |
| 436 | Ga0466963_0036952 | 3300044694 | Bacteria | 3187 |
| 437 | Ga0466963_0051616 | 3300044694 | Bacteria | 2726 |
| 438 | Ga0466963_0066808 | 3300044694 | Bacteria | 2412 |
| 439 | Ga0466963_0125438 | 3300044694 | Bacteria | 1769 |
| 440 | Ga0466963_0131834 | 3300044694 | Bacteria | 1727 |
| 441 | Ga0466963_0348661 | 3300044694 | Bacteria | 1042 |
| 442 | Ga0466963_0509068 | 3300044694 | Bacteria | 850 |
| 443 | Ga0466964_0009732 | 3300044706 | Bacteria | 3621 |
| 444 | Ga0466964_0029973 | 3300044706 | Bacteria | 2151 |
| 445 | Ga0466964_0038677 | 3300044706 | Bacteria | 1919 |
| 446 | Ga0466964_0057120 | 3300044706 | Bacteria | 1615 |
| 447 | Ga0466964_0178001 | 3300044706 | Bacteria | 1006 |
| 448 | Ga0466964_0231836 | 3300044706 | Bacteria | 901 |
| 449 | Ga0466964_0371619 | 3300044706 | Bacteria | 740 |
| 450 | Ga0466964_0372387 | 3300044706 | Bacteria | 739 |
| 451 | Ga0466964_0416237 | 3300044706 | Bacteria | 705 |
| 452 | Ga0466964_0541631 | 3300044706 | Bacteria | 631 |
| 453 | Ga0466971_0000170 | 3300044719 | Bacteria | 24398 |
| 454 | Ga0466971_0000741 | 3300044719 | Bacteria | 13061 |
| 455 | Ga0466971_0017475 | 3300044719 | Bacteria | 3174 |
| 456 | Ga0466971_0037187 | 3300044719 | Bacteria | 2182 |
| 457 | Ga0466971_0077275 | 3300044719 | Bacteria | 1515 |
| 458 | Ga0466971_0078463 | 3300044719 | Bacteria | 1504 |
| 459 | Ga0466971_0093363 | 3300044719 | Bacteria | 1379 |
| 460 | Ga0466971_0162452 | 3300044719 | Bacteria | 1046 |
| 461 | Ga0466968_0000750 | 3300044735 | Bacteria | 11237 |
| 462 | Ga0466968_0010254 | 3300044735 | Bacteria | 3629 |
| 463 | Ga0466968_0018495 | 3300044735 | Bacteria | 2795 |
| 464 | Ga0466968_0067811 | 3300044735 | Bacteria | 1548 |
| 465 | Ga0466968_0077865 | 3300044735 | Bacteria | 1452 |
| 466 | Ga0466968_0091380 | 3300044735 | Bacteria | 1349 |
| 467 | Ga0466968_0415079 | 3300044735 | Bacteria | 661 |
| 468 | Ga0466970_0031167 | 3300044765 | Bacteria | 2815 |
| 469 | Ga0466970_0061998 | 3300044765 | Bacteria | 2004 |
| 470 | Ga0466970_0147511 | 3300044765 | Bacteria | 1298 |
| 471 | Ga0466957_0005810 | 3300044842 | Bacteria | 6942 |
| 472 | Ga0466957_0010943 | 3300044842 | Bacteria | 5218 |
| 473 | Ga0466957_0015689 | 3300044842 | Bacteria | 4425 |
| 474 | Ga0466957_0022184 | 3300044842 | Bacteria | 3743 |
| 475 | Ga0466957_0024594 | 3300044842 | Bacteria | 3565 |
| 476 | Ga0466957_0045057 | 3300044842 | Bacteria | 2674 |
| 477 | Ga0466957_0099236 | 3300044842 | Bacteria | 1833 |
| 478 | Ga0466957_0165181 | 3300044842 | Bacteria | 1439 |
| 479 | Ga0466957_0171504 | 3300044842 | Bacteria | 1413 |
| 480 | Ga0466960_0042993 | 3300044901 | Bacteria | 2147 |
| 481 | Ga0466960_0252129 | 3300044901 | Bacteria | 981 |
| 482 | Ga0466960_0612556 | 3300044901 | Bacteria | 647 |
| 483 | Ga0466959_0001145 | 3300045049 | Bacteria | 15999 |
| 484 | Ga0466959_0001155 | 3300045049 | Bacteria | 15894 |
| 485 | Ga0466959_0016502 | 3300045049 | Bacteria | 5396 |
| 486 | Ga0466959_0019407 | 3300045049 | Bacteria | 5000 |
| 487 | Ga0466959_0077801 | 3300045049 | Bacteria | 2393 |
| 488 | Ga0466958_0002655 | 3300045836 | Bacteria | 9038 |
| 489 | Ga0466958_0007781 | 3300045836 | Bacteria | 5914 |
| 490 | Ga0466958_0011391 | 3300045836 | Bacteria | 5008 |
| 491 | Ga0466958_0018485 | 3300045836 | Bacteria | 4045 |
| 492 | Ga0466958_0024049 | 3300045836 | Bacteria | 3582 |
| 493 | Ga0466958_0052170 | 3300045836 | Bacteria | 2478 |
| 494 | Ga0466958_0057358 | 3300045836 | Bacteria | 2366 |
| 495 | Ga0466958_0065315 | 3300045836 | Bacteria | 2221 |
| 496 | Ga0466958_0076959 | 3300045836 | Bacteria | 2048 |
| 497 | Ga0466958_0207868 | 3300045836 | Bacteria | 1246 |
| 498 | Ga0466958_0292168 | 3300045836 | Bacteria | 1045 |
| 499 | Ga0466958_0345097 | 3300045836 | Bacteria | 958 |
| 500 | Ga0466958_0553382 | 3300045836 | Bacteria | 747 |
| 501 | Ga0466967_0005947 | 3300045976 | Bacteria | 8561 |
| 502 | Ga0466967_0007577 | 3300045976 | Bacteria | 7846 |
| 503 | Ga0466967_0007820 | 3300045976 | Bacteria | 7766 |
| 504 | Ga0466967_0017648 | 3300045976 | Bacteria | 5675 |
| 505 | Ga0466967_0019995 | 3300045976 | Bacteria | 5399 |
| 506 | Ga0466967_0022573 | 3300045976 | Bacteria | 5138 |
| 507 | Ga0466967_0030309 | 3300045976 | Bacteria | 4538 |
| 508 | Ga0466967_0055033 | 3300045976 | Bacteria | 3504 |
| 509 | Ga0466967_0066203 | 3300045976 | Bacteria | 3218 |
| 510 | Ga0466967_0139315 | 3300045976 | Bacteria | 2258 |
| 511 | Ga0466967_0206745 | 3300045976 | Bacteria | 1861 |
| 512 | Ga0466967_0299389 | 3300045976 | Bacteria | 1547 |
| 513 | Ga0466967_0315158 | 3300045976 | Bacteria | 1507 |
| 514 | Ga0466967_0354291 | 3300045976 | Bacteria | 1421 |
| 515 | Ga0466967_0431011 | 3300045976 | Bacteria | 1286 |
| 516 | Ga0466967_0504585 | 3300045976 | Bacteria | 1187 |
| 517 | Ga0466967_0511499 | 3300045976 | Bacteria | 1179 |
| 518 | Ga0466967_0539089 | 3300045976 | Bacteria | 1148 |
| 519 | Ga0466967_0650252 | 3300045976 | Bacteria | 1042 |
| 520 | Ga0466967_1081540 | 3300045976 | Bacteria | 799 |
| 521 | Ga0466967_1399607 | 3300045976 | Bacteria | 696 |
| 522 | Ga0466967_1499800 | 3300045976 | Bacteria | 672 |
| 523 | Ga0466967_1508444 | 3300045976 | Bacteria | 669 |
| 524 | Ga0466967_1850952 | 3300045976 | Bacteria | 600 |
| 525 | Ga0495592_0000198 | 3300046454 | Bacteria | 51379 |
| 526 | Ga0495592_0011866 | 3300046454 | Bacteria | 6602 |
| 527 | Ga0495592_0043169 | 3300046454 | Bacteria | 3374 |
| 528 | Ga0495592_0831752 | 3300046454 | Bacteria | 547 |
| 529 | Ga0495603_0106906 | 3300046455 | Bacteria | 1633 |
| 530 | Ga0495603_0562667 | 3300046455 | Bacteria | 653 |
| 531 | Ga0495629_0026822 | 3300046459 | Bacteria | 4091 |
| 532 | Ga0495629_0460966 | 3300046459 | Bacteria | 860 |
| 533 | Ga0495629_0556107 | 3300046459 | Bacteria | 770 |
| 534 | Ga0495641_0005676 | 3300046461 | Bacteria | 8315 |
| 535 | Ga0495641_0020462 | 3300046461 | Bacteria | 3355 |
| 536 | Ga0495641_0021139 | 3300046461 | Bacteria | 3281 |
| 537 | Ga0495651_0000064 | 3300046462 | Bacteria | 78474 |
| 538 | Ga0495651_0184859 | 3300046462 | Bacteria | 1472 |
| 539 | Ga0495651_0274558 | 3300046462 | Bacteria | 1141 |
| 540 | Ga0495651_0297503 | 3300046462 | Bacteria | 1084 |
| 541 | Ga0495651_0392996 | 3300046462 | Bacteria | 907 |
| 542 | Ga0495653_0006068 | 3300046463 | Bacteria | 9900 |
| 543 | Ga0495653_0008425 | 3300046463 | Bacteria | 8457 |
| 544 | Ga0495653_0061444 | 3300046463 | Bacteria | 2843 |
| 545 | Ga0495653_0078976 | 3300046463 | Bacteria | 2439 |
| 546 | Ga0495653_0176850 | 3300046463 | Bacteria | 1468 |
| 547 | Ga0495582_0003230 | 3300046473 | Bacteria | 9155 |
| 548 | Ga0495582_0037242 | 3300046473 | Bacteria | 2676 |
| 549 | Ga0495582_0072614 | 3300046473 | Bacteria | 1904 |
| 550 | Ga0495582_0110523 | 3300046473 | Bacteria | 1544 |
| 551 | Ga0495582_0283631 | 3300046473 | Bacteria | 951 |
| 552 | Ga0495582_0341394 | 3300046473 | Bacteria | 862 |
| 553 | Ga0495582_0645027 | 3300046473 | Bacteria | 613 |
| 554 | Ga0495639_0000865 | 3300046475 | Bacteria | 13721 |
| 555 | Ga0495639_0489985 | 3300046475 | Bacteria | 627 |
| 556 | Ga0495662_0023948 | 3300046476 | Bacteria | 2946 |
| 557 | Ga0495662_0336113 | 3300046476 | Bacteria | 743 |
| 558 | Ga0495664_0059305 | 3300046477 | Bacteria | 2277 |
| 559 | Ga0495664_0183041 | 3300046477 | Bacteria | 1270 |
| 560 | Ga0495664_0937769 | 3300046477 | Bacteria | 505 |
| 561 | Ga0495585_0342844 | 3300046492 | Bacteria | 727 |
| 562 | Ga0495594_0188830 | 3300046499 | Bacteria | 1174 |
| 563 | Ga0495596_0169800 | 3300046500 | Bacteria | 848 |
| 564 | Ga0495608_0003922 | 3300046511 | Bacteria | 10699 |
| 565 | Ga0495608_0016954 | 3300046511 | Bacteria | 5041 |
| 566 | Ga0495608_0087954 | 3300046511 | Unclassified | 2011 |
| 567 | Ga0495608_0264131 | 3300046511 | Bacteria | 1071 |
| 568 | Ga0495618_0081756 | 3300046514 | Bacteria | 2063 |
| 569 | Ga0495618_0395243 | 3300046514 | Bacteria | 846 |
| 570 | Ga0495618_0463277 | 3300046514 | Bacteria | 768 |
| 571 | Ga0495628_0000069 | 3300046516 | Bacteria | 82366 |
| 572 | Ga0495628_0020750 | 3300046516 | Bacteria | 5414 |
| 573 | Ga0495628_0268316 | 3300046516 | Bacteria | 1270 |
| 574 | Ga0495630_0026623 | 3300046517 | Bacteria | 4283 |
| 575 | Ga0495630_0065332 | 3300046517 | Bacteria | 2734 |
| 576 | Ga0495630_0412040 | 3300046517 | Bacteria | 1035 |
| 577 | Ga0495630_0747509 | 3300046517 | Bacteria | 747 |
| 578 | Ga0495630_0796266 | 3300046517 | Bacteria | 722 |
| 579 | Ga0495644_0415529 | 3300046523 | Bacteria | 533 |
| 580 | Ga0495663_0028750 | 3300046525 | Bacteria | 1638 |
| 581 | Ga0495666_0000935 | 3300046526 | Bacteria | 13743 |
| 582 | Ga0495652_0000356 | 3300046529 | Bacteria | 54548 |
| 583 | Ga0495652_0006105 | 3300046529 | Bacteria | 11264 |
| 584 | Ga0495652_0016953 | 3300046529 | Bacteria | 6508 |
| 585 | Ga0495652_0126713 | 3300046529 | Bacteria | 2027 |
| 586 | Ga0495652_0141181 | 3300046529 | Bacteria | 1894 |
| 587 | Ga0495652_0234556 | 3300046529 | Bacteria | 1370 |
| 588 | Ga0495652_0350183 | 3300046529 | Bacteria | 1058 |
| 589 | Ga0495652_0799592 | 3300046529 | Bacteria | 628 |
| 590 | Ga0495652_1049234 | 3300046529 | Bacteria | 531 |
| 591 | Ga0495652_1138091 | 3300046529 | Bacteria | 505 |
| 592 | Ga0495665_0000569 | 3300046531 | Bacteria | 18762 |
| 593 | Ga0495665_0656059 | 3300046531 | Bacteria | 522 |
| 594 | Ga0495640_0098538 | 3300046533 | Bacteria | 1921 |
| 595 | Ga0495640_0372316 | 3300046533 | Bacteria | 879 |
| 596 | Ga0495586_0187570 | 3300046535 | Bacteria | 1171 |
| 597 | Ga0495586_0289647 | 3300046535 | Bacteria | 937 |
| 598 | Ga0495587_0003524 | 3300046536 | Bacteria | 10424 |
| 599 | Ga0495587_0222887 | 3300046536 | Bacteria | 1063 |
| 600 | Ga0495609_0323313 | 3300046538 | Bacteria | 625 |
| 601 | Ga0495645_0000085 | 3300046543 | Bacteria | 64444 |
| 602 | Ga0495645_0040397 | 3300046543 | Bacteria | 3403 |
| 603 | Ga0495645_0059698 | 3300046543 | Bacteria | 2765 |
| 604 | Ga0495645_0237988 | 3300046543 | Bacteria | 1216 |
| 605 | Ga0495667_0077684 | 3300046559 | Bacteria | 2159 |
| 606 | Ga0495667_0105251 | 3300046559 | Bacteria | 1824 |
| 607 | Ga0495667_0656348 | 3300046559 | Bacteria | 651 |
| 608 | Ga0495656_0706626 | 3300046615 | Bacteria | 543 |
| 609 | Ga0495634_0102840 | 3300046642 | Bacteria | 1844 |
| 610 | Ga0495634_0129715 | 3300046642 | Unclassified | 1608 |
| 611 | Ga0495634_0135841 | 3300046642 | Unclassified | 1565 |
| 612 | Ga0495634_0264458 | 3300046642 | Bacteria | 1048 |
| 613 | Ga0495634_0298419 | 3300046642 | Bacteria | 975 |
| 614 | Ga0495634_0618498 | 3300046642 | Bacteria | 627 |
| 615 | Ga0495635_0088166 | 3300046663 | Bacteria | 2123 |
| 616 | Ga0495635_0339720 | 3300046663 | Bacteria | 1003 |
| 617 | Ga0495635_0580867 | 3300046663 | Bacteria | 733 |
| 618 | Ga0495635_0617381 | 3300046663 | Bacteria | 707 |
| 619 | Ga0495635_0772591 | 3300046663 | Bacteria | 620 |
| 620 | Ga0495635_1083902 | 3300046663 | Unclassified | 507 |
| 621 | Ga0495659_0242144 | 3300046664 | Bacteria | 750 |
| 622 | Ga0495657_0011016 | 3300046675 | Bacteria | 6781 |
| 623 | Ga0495657_0013391 | 3300046675 | Bacteria | 6055 |
| 624 | Ga0495657_0043961 | 3300046675 | Bacteria | 3042 |
| 625 | Ga0495657_0389883 | 3300046675 | Bacteria | 821 |
| 626 | Ga0495657_0704875 | 3300046675 | Bacteria | 580 |
| 627 | Ga0495599_0000716 | 3300046678 | Bacteria | 18725 |
| 628 | Ga0495599_0005564 | 3300046678 | Bacteria | 7557 |
| 629 | Ga0495599_0056515 | 3300046678 | Bacteria | 2456 |
| 630 | Ga0495599_0210363 | 3300046678 | Bacteria | 1193 |
| 631 | Ga0495599_0217191 | 3300046678 | Bacteria | 1171 |
| 632 | Ga0495623_0000030 | 3300046679 | Bacteria | 85003 |
| 633 | Ga0495623_0152356 | 3300046679 | Bacteria | 1366 |
| 634 | Ga0495623_0299034 | 3300046679 | Bacteria | 890 |
| 635 | Ga0495646_0028239 | 3300046680 | Bacteria | 3515 |
| 636 | Ga0495646_0130609 | 3300046680 | Bacteria | 1414 |
| 637 | Ga0495646_0140086 | 3300046680 | Bacteria | 1353 |
| 638 | Ga0495646_0320282 | 3300046680 | Bacteria | 817 |
| 639 | Ga0495647_0010053 | 3300046681 | Bacteria | 3217 |
| 640 | Ga0495647_0055401 | 3300046681 | Bacteria | 1552 |
| 641 | Ga0495658_0012266 | 3300046683 | Bacteria | 4334 |
| 642 | Ga0495658_0336496 | 3300046683 | Bacteria | 958 |
| 643 | Ga0495658_0337066 | 3300046683 | Bacteria | 957 |
| 644 | Ga0495658_0364830 | 3300046683 | Unclassified | 919 |
| 645 | Ga0495613_0012420 | 3300046689 | Bacteria | 6327 |
| 646 | Ga0495613_0149173 | 3300046689 | Bacteria | 1668 |
| 647 | Ga0495613_0167022 | 3300046689 | Bacteria | 1563 |
| 648 | Ga0495613_0212130 | 3300046689 | Bacteria | 1361 |
| 649 | Ga0495613_0386200 | 3300046689 | Bacteria | 957 |
| 650 | Ga0495624_0002753 | 3300046690 | Bacteria | 13207 |
| 651 | Ga0495624_0004809 | 3300046690 | Bacteria | 9822 |
| 652 | Ga0495624_0450836 | 3300046690 | Bacteria | 771 |
| 653 | Ga0495600_0037083 | 3300046809 | Bacteria | 3169 |
| 654 | Ga0495600_0042563 | 3300046809 | Bacteria | 2961 |
| 655 | Ga0495600_0147006 | 3300046809 | Bacteria | 1527 |
| 656 | Ga0495600_0451569 | 3300046809 | Bacteria | 795 |
| 657 | Ga0495600_0928182 | 3300046809 | Bacteria | 512 |
| 658 | Ga0495581_0035436 | 3300047315 | Bacteria | 2887 |
| 659 | Ga0495581_0426533 | 3300047315 | Unclassified | 773 |
| 660 | Ga0495604_0000103 | 3300047317 | Bacteria | 71556 |
| 661 | Ga0495604_0297930 | 3300047317 | Bacteria | 1084 |
| 662 | Ga0495604_0532297 | 3300047317 | Bacteria | 759 |
| 663 | Ga0495636_0409244 | 3300047318 | Bacteria | 647 |
| 664 | Ga0495674_0045217 | 3300047319 | Bacteria | 3909 |
| 665 | Ga0495674_0051543 | 3300047319 | Bacteria | 3628 |
| 666 | Ga0495674_0438607 | 3300047319 | Bacteria | 1050 |
| 667 | Ga0495674_0472270 | 3300047319 | Bacteria | 1006 |
| 668 | Ga0495674_0525063 | 3300047319 | Bacteria | 945 |
| 669 | Ga0495674_1457523 | 3300047319 | Unclassified | 508 |
| 670 | Ga0495676_0005516 | 3300047321 | Bacteria | 11599 |
| 671 | Ga0495676_0054466 | 3300047321 | Bacteria | 3180 |
| 672 | Ga0495676_0399301 | 3300047321 | Bacteria | 912 |
| 673 | Ga0495680_0010394 | 3300047322 | Bacteria | 8306 |
| 674 | Ga0495680_0020217 | 3300047322 | Bacteria | 5608 |
| 675 | Ga0495680_0096752 | 3300047322 | Unclassified | 2204 |
| 676 | Ga0495680_0141195 | 3300047322 | Bacteria | 1762 |
| 677 | Ga0495680_0261093 | 3300047322 | Bacteria | 1225 |
| 678 | Ga0495680_0740958 | 3300047322 | Bacteria | 646 |
| 679 | Ga0495675_0000282 | 3300047444 | Bacteria | 36859 |
| 680 | Ga0495675_0228784 | 3300047444 | Unclassified | 1123 |
| 681 | Ga0495675_0335860 | 3300047444 | Bacteria | 891 |
| 682 | Ga0495684_0028380 | 3300047471 | Bacteria | 4297 |
| 683 | Ga0495684_0088850 | 3300047471 | Bacteria | 2341 |
| 684 | Ga0495684_0236516 | 3300047471 | Bacteria | 1334 |
| 685 | Ga0495684_0315062 | 3300047471 | Bacteria | 1120 |
| 686 | Ga0495684_1068093 | 3300047471 | Bacteria | 508 |
| 687 | Ga0495593_0000807 | 3300047673 | Bacteria | 18118 |
| 688 | Ga0495602_0000080 | 3300048088 | Bacteria | 94171 |
| 689 | Ga0495602_0050967 | 3300048088 | Bacteria | 3692 |
| 690 | Ga0495602_0238376 | 3300048088 | Bacteria | 1362 |
| 691 | Ga0495602_0332925 | 3300048088 | Unclassified | 1101 |
| 692 | Ga0495602_0739391 | 3300048088 | Bacteria | 665 |
| 693 | Ga0495614_0000642 | 3300048089 | Bacteria | 14613 |
| 694 | Ga0496100_0007377 | 3300048903 | Bacteria | 6063 |
| 695 | Ga0496100_0014562 | 3300048903 | Bacteria | 4569 |
| 696 | Ga0496100_0240399 | 3300048903 | Bacteria | 1336 |
| 697 | Ga0496100_0869163 | 3300048903 | Bacteria | 708 |
| 698 | Ga0496100_1273207 | 3300048903 | Unclassified | 580 |
| 699 | Ga0496101_0002103 | 3300048904 | Bacteria | 12138 |
| 700 | Ga0496101_0147545 | 3300048904 | Bacteria | 1797 |
| 701 | Ga0496101_0189027 | 3300048904 | Bacteria | 1589 |
| 702 | Ga0496101_0419822 | 3300048904 | Bacteria | 1054 |
| 703 | Ga0496101_0602494 | 3300048904 | Bacteria | 868 |
| 704 | Ga0496101_1148667 | 3300048904 | Bacteria | 609 |
| 705 | Ga0496101_1193910 | 3300048904 | Bacteria | 596 |
| 706 | Ga0496102_0013820 | 3300048905 | Bacteria | 7006 |
| 707 | Ga0496102_0072684 | 3300048905 | Bacteria | 3161 |
| 708 | Ga0496102_1063559 | 3300048905 | Bacteria | 729 |
| 709 | Ga0496103_0168547 | 3300048906 | Bacteria | 1406 |
| 710 | Ga0496103_0655086 | 3300048906 | Unclassified | 667 |
| 711 | Ga0496104_0009909 | 3300048907 | Bacteria | 8507 |
| 712 | Ga0496104_0044880 | 3300048907 | Bacteria | 4154 |
| 713 | Ga0496104_0048847 | 3300048907 | Bacteria | 3990 |
| 714 | Ga0496104_0064181 | 3300048907 | Bacteria | 3484 |
| 715 | Ga0496104_0119395 | 3300048907 | Bacteria | 2531 |
| 716 | Ga0496104_0127021 | 3300048907 | Bacteria | 2449 |
| 717 | Ga0496104_0758284 | 3300048907 | Bacteria | 877 |
| 718 | Ga0496104_1341198 | 3300048907 | Bacteria | 618 |
| 719 | Ga0496105_0011626 | 3300048908 | Bacteria | 6964 |
| 720 | Ga0496105_0013058 | 3300048908 | Bacteria | 6583 |
| 721 | Ga0496105_0065979 | 3300048908 | Bacteria | 2987 |
| 722 | Ga0496105_0152098 | 3300048908 | Bacteria | 1902 |
| 723 | Ga0496105_0330004 | 3300048908 | Bacteria | 1221 |
| 724 | Ga0496105_0693303 | 3300048908 | Bacteria | 782 |
| 725 | Ga0496106_0011132 | 3300048909 | Bacteria | 6653 |
| 726 | Ga0496106_0640458 | 3300048909 | Bacteria | 850 |
| 727 | Ga0496106_1304809 | 3300048909 | Unclassified | 563 |
| 728 | Ga0496107_0133618 | 3300048910 | Bacteria | 1833 |
| 729 | Ga0496107_0170221 | 3300048910 | Bacteria | 1616 |
| 730 | Ga0496107_0592427 | 3300048910 | Bacteria | 820 |
| 731 | Ga0496107_0686372 | 3300048910 | Bacteria | 754 |
| 732 | Ga0496107_0885026 | 3300048910 | Unclassified | 651 |
| 733 | Ga0496107_0971834 | 3300048910 | Bacteria | 617 |
| 734 | Ga0496108_0022798 | 3300048911 | Bacteria | 5151 |
| 735 | Ga0496108_0068223 | 3300048911 | Bacteria | 3000 |
| 736 | Ga0496108_0070458 | 3300048911 | Bacteria | 2950 |
| 737 | Ga0496108_0240292 | 3300048911 | Bacteria | 1575 |
| 738 | Ga0496109_0018098 | 3300048912 | Bacteria | 6187 |
| 739 | Ga0496109_0032643 | 3300048912 | Bacteria | 4681 |
| 740 | Ga0496109_0077215 | 3300048912 | Bacteria | 3064 |
| 741 | Ga0496110_0015617 | 3300048913 | Bacteria | 6324 |
| 742 | Ga0496110_0027540 | 3300048913 | Bacteria | 4873 |
| 743 | Ga0496110_0063764 | 3300048913 | Bacteria | 3256 |
| 744 | Ga0496110_0209955 | 3300048913 | Bacteria | 1770 |
| 745 | Ga0496110_1109425 | 3300048913 | Bacteria | 699 |
| 746 | Ga0496111_0051238 | 3300048914 | Bacteria | 2980 |
| 747 | Ga0496111_0098022 | 3300048914 | Bacteria | 2152 |
| 748 | Ga0496111_0101276 | 3300048914 | Bacteria | 2116 |
| 749 | Ga0496111_0576730 | 3300048914 | Bacteria | 825 |
| 750 | Ga0496111_0711185 | 3300048914 | Bacteria | 730 |
| 751 | Ga0496112_0001848 | 3300048915 | Bacteria | 16642 |
| 752 | Ga0496112_0036826 | 3300048915 | Bacteria | 4773 |
| 753 | Ga0496112_0094398 | 3300048915 | Bacteria | 2962 |
| 754 | Ga0496112_0172870 | 3300048915 | Bacteria | 2125 |
| 755 | Ga0496112_0338230 | 3300048915 | Bacteria | 1449 |
| 756 | Ga0496112_0529835 | 3300048915 | Bacteria | 1112 |
| 757 | Ga0496112_1220975 | 3300048915 | Bacteria | 668 |
| 758 | Ga0496112_1873200 | 3300048915 | Bacteria | 511 |
| 759 | Ga0496113_0102368 | 3300048916 | Bacteria | 2220 |
| 760 | Ga0496113_0110515 | 3300048916 | Bacteria | 2139 |
| 761 | Ga0496113_0112489 | 3300048916 | Bacteria | 2121 |
| 762 | Ga0496113_0287134 | 3300048916 | Bacteria | 1316 |
| 763 | Ga0496113_0760299 | 3300048916 | Bacteria | 771 |
| 764 | Ga0496114_0004422 | 3300048917 | Bacteria | 10907 |
| 765 | Ga0496114_0079244 | 3300048917 | Bacteria | 2772 |
| 766 | Ga0496114_0181882 | 3300048917 | Bacteria | 1836 |
| 767 | Ga0496114_0409711 | 3300048917 | Bacteria | 1200 |
| 768 | Ga0496114_0501558 | 3300048917 | Bacteria | 1074 |
| 769 | Ga0496114_0503776 | 3300048917 | Bacteria | 1071 |
| 770 | Ga0496114_0556920 | 3300048917 | Bacteria | 1013 |
| 771 | Ga0496115_0012415 | 3300048918 | Bacteria | 6410 |
| 772 | Ga0496115_0038699 | 3300048918 | Bacteria | 3785 |
| 773 | Ga0496115_0174335 | 3300048918 | Bacteria | 1778 |
| 774 | Ga0496115_0839361 | 3300048918 | Bacteria | 712 |
| 775 | Ga0496115_0872471 | 3300048918 | Unclassified | 695 |
| 776 | Ga0501032_0041040 | 3300049569 | Unclassified | 3144 |
| 777 | Ga0501032_0287616 | 3300049569 | Bacteria | 1064 |
| 778 | Ga0501033_1108793 | 3300049570 | Bacteria | 526 |
| 779 | Ga0501034_1556560 | 3300049571 | Bacteria | 534 |
| 780 | Ga0501036_0147697 | 3300049572 | Bacteria | 1983 |
| 781 | Ga0501036_0172526 | 3300049572 | Bacteria | 1822 |
| 782 | Ga0501037_0020619 | 3300049573 | Bacteria | 4866 |
| 783 | Ga0501038_0005915 | 3300049574 | Bacteria | 11308 |
| 784 | Ga0501039_0048024 | 3300049575 | Bacteria | 3299 |
| 785 | Ga0501039_0139907 | 3300049575 | Bacteria | 1901 |
| 786 | Ga0501039_0223959 | 3300049575 | Bacteria | 1478 |
| 787 | Ga0501040_0027966 | 3300049576 | Bacteria | 3799 |
| 788 | Ga0501040_0151602 | 3300049576 | Bacteria | 1635 |
| 789 | Ga0501040_0939912 | 3300049576 | Bacteria | 626 |
| 790 | Ga0501041_0040823 | 3300049577 | Bacteria | 2818 |
| 791 | Ga0501041_0076368 | 3300049577 | Bacteria | 2061 |
| 792 | Ga0501041_0376191 | 3300049577 | Bacteria | 898 |
| 793 | Ga0501041_0691491 | 3300049577 | Bacteria | 652 |
| 794 | Ga0501042_0116784 | 3300049578 | Bacteria | 1921 |
| 795 | Ga0501042_0192183 | 3300049578 | Bacteria | 1472 |
| 796 | Ga0501043_0096192 | 3300049579 | Bacteria | 2327 |
| 797 | Ga0501043_0363087 | 3300049579 | Bacteria | 1099 |
| 798 | Ga0501043_0973759 | 3300049579 | Bacteria | 605 |
| 799 | Ga0501046_0032235 | 3300049580 | Bacteria | 4243 |
| 800 | Ga0501046_0558371 | 3300049580 | Bacteria | 815 |
| 801 | Ga0501046_0677640 | 3300049580 | Bacteria | 728 |
| 802 | Ga0501047_0052962 | 3300049581 | Bacteria | 3923 |
| 803 | Ga0501048_0018588 | 3300049582 | Bacteria | 5109 |
| 804 | Ga0501048_0146736 | 3300049582 | Bacteria | 1668 |
| 805 | Ga0501048_0497021 | 3300049582 | Bacteria | 874 |
| 806 | Ga0501067_0027298 | 3300049583 | Bacteria | 3163 |
| 807 | Ga0501067_0258899 | 3300049583 | Unclassified | 969 |
| 808 | Ga0501067_0850095 | 3300049583 | Bacteria | 514 |
| 809 | Ga0501068_0025740 | 3300049584 | Bacteria | 3462 |
| 810 | Ga0501068_0237721 | 3300049584 | Bacteria | 1159 |
| 811 | Ga0501068_0512500 | 3300049584 | Bacteria | 778 |
| 812 | Ga0501068_0686776 | 3300049584 | Bacteria | 669 |
| 813 | Ga0501069_0004410 | 3300049585 | Bacteria | 7266 |
| 814 | Ga0501069_0007201 | 3300049585 | Bacteria | 5831 |
| 815 | Ga0501069_0028911 | 3300049585 | Bacteria | 3041 |
| 816 | Ga0501069_0084754 | 3300049585 | Unclassified | 1788 |
| 817 | Ga0501069_0349361 | 3300049585 | Bacteria | 871 |
| 818 | Ga0501070_0052967 | 3300049586 | Unclassified | 3367 |
| 819 | Ga0501070_0094716 | 3300049586 | Bacteria | 2471 |
| 820 | Ga0501070_0741972 | 3300049586 | Bacteria | 774 |
| 821 | Ga0501071_0000255 | 3300049587 | Bacteria | 24900 |
| 822 | Ga0501071_0103180 | 3300049587 | Bacteria | 2103 |
| 823 | Ga0501071_0474439 | 3300049587 | Bacteria | 958 |
| 824 | Ga0501072_0004415 | 3300049588 | Bacteria | 10685 |
| 825 | Ga0501072_0055862 | 3300049588 | Bacteria | 3111 |
| 826 | Ga0501072_0324001 | 3300049588 | Bacteria | 1224 |
| 827 | Ga0501073_0038144 | 3300049589 | Bacteria | 3410 |
| 828 | Ga0501073_0465028 | 3300049589 | Bacteria | 874 |
| 829 | Ga0501074_0016778 | 3300049590 | Bacteria | 5314 |
| 830 | Ga0501074_0108216 | 3300049590 | Bacteria | 1989 |
| 831 | Ga0501074_0111407 | 3300049590 | Bacteria | 1958 |
| 832 | Ga0501075_0040548 | 3300049591 | Bacteria | 3487 |
| 833 | Ga0501075_0120633 | 3300049591 | Bacteria | 1995 |
| 834 | Ga0501075_0504120 | 3300049591 | Bacteria | 923 |
| 835 | Ga0501076_0036235 | 3300049592 | Bacteria | 3864 |
| 836 | Ga0501076_0123664 | 3300049592 | Bacteria | 2095 |
| 837 | Ga0501076_0171107 | 3300049592 | Unclassified | 1770 |
| 838 | Ga0501077_0012818 | 3300049593 | Bacteria | 5254 |
| 839 | Ga0501077_0018228 | 3300049593 | Bacteria | 4441 |
| 840 | Ga0501077_0041068 | 3300049593 | Bacteria | 2945 |
| 841 | Ga0501077_0861851 | 3300049593 | Bacteria | 582 |
| 842 | Ga0501079_0013247 | 3300049741 | Bacteria | 6287 |
| 843 | Ga0501079_0325558 | 3300049741 | Bacteria | 1203 |
| 844 | Ga0501080_0039769 | 3300049742 | Bacteria | 4388 |
| 845 | Ga0501080_0053707 | 3300049742 | Bacteria | 3752 |
| 846 | Ga0501080_0053907 | 3300049742 | Bacteria | 3745 |
| 847 | Ga0501081_0019102 | 3300049743 | Bacteria | 4558 |
| 848 | Ga0501081_0179394 | 3300049743 | Bacteria | 1531 |
| 849 | Ga0501081_0672760 | 3300049743 | Bacteria | 776 |
| 850 | Ga0501083_0022810 | 3300049744 | Bacteria | 4342 |
| 851 | Ga0501083_0097494 | 3300049744 | Bacteria | 1940 |
| 852 | Ga0501035_0236155 | 3300049822 | Bacteria | 1557 |
| 853 | Ga0501035_0443933 | 3300049822 | Bacteria | 1074 |
| 854 | Ga0501044_0589941 | 3300049823 | Bacteria | 1005 |
| 855 | Ga0501044_0715477 | 3300049823 | Bacteria | 886 |
| 856 | Ga0501045_0033228 | 3300049824 | Bacteria | 3740 |
| 857 | Ga0501045_0182542 | 3300049824 | Unclassified | 1563 |
| 858 | Ga0501045_0281045 | 3300049824 | Bacteria | 1239 |
| 859 | Ga0501045_0599692 | 3300049824 | Bacteria | 815 |
| 860 | nmdc:mga03683_613972_c1 | 3300050489 | Bacteria | 533 |
| 861 | nmdc:mga05p37_27961_c1 | 3300050507 | Bacteria | 2241 |
| 862 | nmdc:mga05p37_311677_c1 | 3300050507 | Bacteria | 1865 |
| 863 | nmdc:mga08y16_612892_c1 | 3300050511 | Bacteria | 1096 |
| 864 | nmdc:mga08y16_70993_c1 | 3300050511 | Bacteria | 3630 |
| 865 | nmdc:mga0n895_36635_c1 | 3300050512 | Bacteria | 4738 |
| 866 | nmdc:mga0rr50_271854_c1 | 3300050513 | Bacteria | 1412 |
| 867 | nmdc:mga0a205_262270_c1 | 3300050515 | Bacteria | 1605 |
| 868 | nmdc:mga0a205_576977_c1 | 3300050515 | Bacteria | 979 |
| 869 | nmdc:mga0a205_760324_c1 | 3300050515 | Bacteria | 817 |
| 870 | nmdc:mga0a205_808339_c1 | 3300050515 | Bacteria | 785 |
| 871 | Ga0495601_0000163 | 3300053077 | Bacteria | 36562 |
| 872 | Ga0495601_0015952 | 3300053077 | Bacteria | 4546 |
| 873 | Ga0495601_0031573 | 3300053077 | Bacteria | 3292 |
| 874 | Ga0495601_0213512 | 3300053077 | Bacteria | 1260 |
| 875 | Ga0495601_0464869 | 3300053077 | Bacteria | 818 |
| 876 | Ga0495601_0797739 | 3300053077 | Bacteria | 599 |
| 877 | Ga0495601_1085239 | 3300053077 | Bacteria | 501 |
| 878 | Ga0495612_0120804 | 3300053078 | Bacteria | 1127 |
| 879 | Ga0495595_0006135 | 3300053084 | Bacteria | 4886 |
| 880 | Ga0495595_0035071 | 3300053084 | Bacteria | 2272 |
| 881 | Ga0495595_0052842 | 3300053084 | Bacteria | 1886 |
| 882 | Ga0495595_0135861 | 3300053084 | Bacteria | 1204 |
| 883 | Ga0495595_0234899 | 3300053084 | Bacteria | 916 |
| 884 | Ga0495619_0000493 | 3300053085 | Bacteria | 26439 |
| 885 | Ga0495619_0079060 | 3300053085 | Bacteria | 2212 |
| 886 | Ga0495619_0096967 | 3300053085 | Bacteria | 2003 |
| 887 | Ga0495619_0108391 | 3300053085 | Bacteria | 1896 |
| 888 | Ga0495619_0177257 | 3300053085 | Bacteria | 1474 |
| 889 | Ga0495619_0345180 | 3300053085 | Bacteria | 1030 |
| 890 | Ga0495619_0427392 | 3300053085 | Bacteria | 914 |
| 891 | Ga0495619_0461135 | 3300053085 | Bacteria | 875 |
| 892 | Ga0500566_0198571 | 3300053094 | Bacteria | 1015 |
| 893 | Ga0501084_0000979 | 3300054114 | Bacteria | 22169 |
| 894 | Ga0501084_0022006 | 3300054114 | Bacteria | 5318 |
| 895 | Ga0501084_0147038 | 3300054114 | Bacteria | 1985 |
| 896 | Ga0501084_0186127 | 3300054114 | Bacteria | 1752 |
| 897 | Ga0501082_0010371 | 3300060353 | Bacteria | 8024 |
| 898 | Ga0501082_0352523 | 3300060353 | Bacteria | 1283 |
| 899 | Ga0501082_0546992 | 3300060353 | Bacteria | 1012 |
| 900 | Ga0466962_0001338 | 3300061719 | Bacteria | 11387 |
| 901 | Ga0466962_0008088 | 3300061719 | Bacteria | 5042 |
| 902 | Ga0466962_0021355 | 3300061719 | Bacteria | 3109 |
| 903 | Ga0466962_0041156 | 3300061719 | Bacteria | 2211 |
| 904 | Ga0466962_0046818 | 3300061719 | Bacteria | 2066 |
| 905 | Ga0466962_0064202 | 3300061719 | Bacteria | 1753 |
| 906 | Ga0466962_0299755 | 3300061719 | Bacteria | 795 |
| 907 | Ga0530510_0028568 | 3300061734 | Bacteria | 4000 |
| 908 | Ga0530510_0473528 | 3300061734 | Bacteria | 948 |
| 909 | Ga0530510_0477071 | 3300061734 | Bacteria | 944 |
| 910 | Ga0495592_0380051 | |||
| 911 | Ga0070658_10044395 | |||
| 912 | Ga0070658_10122757 | |||
| 913 | Ga0070658_10515143 | |||
| 914 | Ga0070658_10528988 | |||
| 915 | Ga0070676_10147072 | |||
| 916 | Ga0070683_100175213 | |||
| 917 | Ga0070683_100632167 | |||
| 918 | Ga0070683_101320943 | |||
| 919 | Ga0070683_101406161 | |||
| 920 | Ga0070690_100772180 | |||
| 921 | Ga0070670_100331849 | |||
| 922 | Ga0070680_100017427 | |||
| 923 | Ga0070680_100100954 | |||
| 924 | Ga0070680_100141281 | |||
| 925 | Ga0070682_100193090 | |||
| 926 | Ga0070682_100428020 | |||
| 927 | Ga0070660_101114452 | |||
| 928 | Ga0070660_101514059 | |||
| 929 | Ga0070691_10003297 | |||
| 930 | Ga0070691_10106161 | |||
| 931 | Ga0070661_100273140 | |||
| 932 | Ga0070661_100288695 | |||
| 933 | Ga0070661_100748239 | |||
| 934 | Ga0070668_100636256 | |||
| 935 | Ga0070675_100410503 | |||
| 936 | Ga0070675_100981198 | |||
| 937 | Ga0070671_101191739 | |||
| 938 | Ga0070673_101254533 | |||
| 939 | Ga0070659_100035344 | |||
| 940 | Ga0070659_100377317 | |||
| 941 | Ga0070709_10013994 | |||
| 942 | Ga0070709_10059358 | |||
| 943 | Ga0070709_10079845 | |||
| 944 | Ga0070709_10298990 | |||
| 945 | Ga0070709_10616801 | |||
| 946 | Ga0070714_100006571 | |||
| 947 | Ga0070714_100018726 | |||
| 948 | Ga0070714_100021410 | |||
| 949 | Ga0070714_100024680 | |||
| 950 | Ga0070714_100089592 | |||
| 951 | Ga0070714_100168279 | |||
| 952 | Ga0070714_100217596 | |||
| 953 | Ga0070714_100635790 | |||
| 954 | Ga0070714_100903528 | |||
| 955 | Ga0070714_101933995 | |||
| 956 | Ga0070714_102372707 | |||
| 957 | Ga0070713_100000665 | |||
| 958 | Ga0070713_100003272 | |||
| 959 | Ga0070713_100088784 | |||
| 960 | Ga0070713_100317293 | |||
| 961 | Ga0070713_101252079 | |||
| 962 | Ga0070713_101457887 | |||
| 963 | Ga0070713_101838984 | |||
| 964 | Ga0070710_10005614 | |||
| 965 | Ga0070710_10017125 | |||
| 966 | Ga0070710_11103591 | |||
| 967 | Ga0070711_100003012 | |||
| 968 | Ga0070711_100157689 | |||
| 969 | Ga0070711_100165876 | |||
| 970 | Ga0070711_100517865 | |||
| 971 | Ga0070711_100752871 | |||
| 972 | Ga0070711_100752873 | |||
| 973 | Ga0070700_100035388 | |||
| 974 | Ga0070694_100827684 | |||
| 975 | Ga0070694_101218275 | |||
| 976 | Ga0070708_101492004 | |||
| 977 | Ga0070678_101477111 | |||
| 978 | Ga0070662_100145972 | |||
| 979 | Ga0070681_10159545 | |||
| 980 | Ga0070681_10172802 | |||
| 981 | Ga0070681_10247448 | |||
| 982 | Ga0070681_10409027 | |||
| 983 | Ga0070681_10527471 | |||
| 984 | Ga0070681_10758832 | |||
| 985 | Ga0070681_11241019 | |||
| 986 | Ga0070706_100309744 | |||
| 987 | Ga0070707_100001128 | |||
| 988 | Ga0070707_100236323 | |||
| 989 | Ga0070707_100292878 | |||
| 990 | Ga0070698_100218758 | |||
| 991 | Ga0070699_100147402 | |||
| 992 | Ga0070699_100421020 | |||
| 993 | Ga0070699_101757010 | |||
| 994 | Ga0070699_101877367 | |||
| 995 | Ga0070679_100027058 | |||
| 996 | Ga0070679_100056618 | |||
| 997 | Ga0070679_100093701 | |||
| 998 | Ga0070679_100304361 | |||
| 999 | Ga0070679_100454624 | |||
| 1000 | Ga0070679_100979094 | |||
| 1001 | Ga0070679_100983132 | |||
| 1002 | Ga0070684_100039997 | |||
| 1003 | Ga0070684_100080081 | |||
| 1004 | Ga0070684_100091374 | |||
| 1005 | Ga0070684_100155070 | |||
| 1006 | Ga0070697_100075331 | |||
| 1007 | Ga0070697_100291644 | |||
| 1008 | Ga0068853_101017515 | |||
| 1009 | Ga0070686_100186324 | |||
| 1010 | Ga0070695_100336921 | |||
| 1011 | Ga0070696_100409068 | |||
| 1012 | Ga0070696_101135120 | |||
| 1013 | Ga0070696_101229899 | |||
| 1014 | Ga0070693_100034992 | |||
| 1015 | Ga0070693_100624307 | |||
| 1016 | Ga0068855_100435518 | |||
| 1017 | Ga0068855_100512356 | |||
| 1018 | Ga0068855_102185358 | |||
| 1019 | Ga0070664_100335279 | |||
| 1020 | Ga0070664_101041477 | |||
| 1021 | Ga0068857_101706091 | |||
| 1022 | Ga0068854_100143605 | |||
| 1023 | Ga0068854_102144527 | |||
| 1024 | Ga0068856_100032269 | |||
| 1025 | Ga0068856_100178555 | |||
| 1026 | Ga0068856_101033386 | |||
| 1027 | Ga0068856_101166972 | |||
| 1028 | Ga0070702_100181288 | |||
| 1029 | Ga0070702_100247249 | |||
| 1030 | Ga0068852_100432879 | |||
| 1031 | Ga0068864_100554753 | |||
| 1032 | Ga0068861_100028909 | |||
| 1033 | Ga0068861_101526338 | |||
| 1034 | Ga0068851_11012902 | |||
| 1035 | Ga0068870_10525230 | |||
| 1036 | Ga0068870_10968959 | |||
| 1037 | Ga0068863_100253539 | |||
| 1038 | Ga0068863_100850875 | |||
| 1039 | Ga0068862_100231587 | |||
| 1040 | Ga0081455_10080411 | |||
| 1041 | Ga0081455_10253218 | |||
| 1042 | Ga0070717_10004499 | |||
| 1043 | Ga0070717_10006185 | |||
| 1044 | Ga0070717_10007203 | |||
| 1045 | Ga0070717_10048414 | |||
| 1046 | Ga0070717_10071076 | |||
| 1047 | Ga0070717_10327682 | |||
| 1048 | Ga0070717_10573047 | |||
| 1049 | Ga0070717_10672763 | |||
| 1050 | Ga0070717_10933892 | |||
| 1051 | Ga0070717_10982947 | |||
| 1052 | Ga0075365_10440972 | |||
| 1053 | Ga0075363_100571199 | |||
| 1054 | Ga0075432_10000679 | |||
| 1055 | Ga0070715_10000827 | |||
| 1056 | Ga0070716_100000663 | |||
| 1057 | Ga0070716_100016673 | |||
| 1058 | Ga0070716_100153010 | |||
| 1059 | Ga0070716_101159383 | |||
| 1060 | Ga0070712_100518931 | |||
| 1061 | Ga0070712_100843397 | |||
| 1062 | Ga0070712_101503096 | |||
| 1063 | Ga0070712_101652676 | |||
| 1064 | Ga0075362_10689156 | |||
| 1065 | Ga0097621_101303333 | |||
| 1066 | Ga0068871_100103360 | |||
| 1067 | Ga0075428_100123242 | |||
| 1068 | Ga0075428_100393181 | |||
| 1069 | Ga0075431_100188959 | |||
| 1070 | Ga0075433_10047201 | |||
| 1071 | Ga0075433_10510479 | |||
| 1072 | Ga0075433_10638010 | |||
| 1073 | Ga0075434_100015565 | |||
| 1074 | Ga0075434_100072472 | |||
| 1075 | Ga0075434_101163200 | |||
| 1076 | Ga0075429_100038332 | |||
| 1077 | Ga0068865_101164905 | |||
| 1078 | Ga0075436_101139093 | |||
| 1079 | Ga0105251_10467878 | |||
| 1080 | Ga0105240_10141561 | |||
| 1081 | Ga0105240_10316562 | |||
| 1082 | Ga0105240_10338374 | |||
| 1083 | Ga0105240_10611884 | |||
| 1084 | Ga0105240_11432469 | |||
| 1085 | Ga0111539_10165764 | |||
| 1086 | Ga0111539_10262132 | |||
| 1087 | Ga0105245_10004034 | |||
| 1088 | Ga0105245_10515291 | |||
| 1089 | Ga0105245_11197322 | |||
| 1090 | Ga0105245_12777298 | |||
| 1091 | Ga0105247_10036142 | |||
| 1092 | Ga0114129_10063673 | |||
| 1093 | Ga0114129_10648011 | |||
| 1094 | Ga0105243_10025030 | |||
| 1095 | Ga0105241_11432051 | |||
| 1096 | Ga0105242_10687791 | |||
| 1097 | Ga0105248_10103121 | |||
| 1098 | Ga0105248_11503081 | |||
| 1099 | Ga0105237_10232057 | |||
| 1100 | Ga0105237_10309328 | |||
| 1101 | Ga0105237_11742852 | |||
| 1102 | Ga0105238_10857318 | |||
| 1103 | Ga0105249_10511302 | |||
| 1104 | Ga0099796_10590025 | |||
| 1105 | Ga0105239_10034836 | |||
| 1106 | Ga0105239_10474213 | |||
| 1107 | Ga0105246_10556353 | |||
| 1108 | Ga0157373_10034934 | |||
| 1109 | Ga0157373_10259228 | |||
| 1110 | Ga0157373_10652694 | |||
| 1111 | Ga0157373_11251760 | |||
| 1112 | Ga0157371_10954246 | |||
| 1113 | Ga0157370_10142668 | |||
| 1114 | Ga0157370_10510318 | |||
| 1115 | Ga0157370_10543607 | |||
| 1116 | Ga0157369_10003691 | |||
| 1117 | Ga0157369_10110278 | |||
| 1118 | Ga0157369_10192968 | |||
| 1119 | Ga0157369_10299755 | |||
| 1120 | Ga0157369_11877808 | |||
| 1121 | Ga0157369_12658762 | |||
| 1122 | Ga0157374_10006679 | |||
| 1123 | Ga0157374_10367072 | |||
| 1124 | Ga0157374_10473095 | |||
| 1125 | Ga0163162_10269355 | |||
| 1126 | Ga0163162_10601374 | |||
| 1127 | Ga0157372_10479504 | |||
| 1128 | Ga0157372_10886001 | |||
| 1129 | Ga0157372_11075517 | |||
| 1130 | Ga0157372_11737139 | |||
| 1131 | Ga0157375_10356336 | |||
| 1132 | Ga0182008_10546385 | |||
| 1133 | Ga0157377_10022167 | |||
| 1134 | Ga0157379_10575949 | |||
| 1135 | Ga0157379_10649141 | |||
| 1136 | Ga0157376_10040289 | |||
| 1137 | Ga0157376_11040707 | |||
| 1138 | Ga0157376_11211765 | |||
| 1139 | Ga0182006_1238395 | |||
| 1140 | Ga0206356_10507006 | |||
| 1141 | Ga0206356_10820228 | |||
| 1142 | Ga0206352_10411163 | |||
| 1143 | Ga0206354_10452674 | |||
| 1144 | Ga0206354_10625982 | |||
| 1145 | Ga0206353_10335697 | |||
| 1146 | Ga0206353_10669165 | |||
| 1147 | Ga0206353_11395614 | |||
| 1148 | Ga0206353_11950027 | |||
| 1149 | Ga0207692_10016300 | |||
| 1150 | Ga0207710_10300252 | |||
| 1151 | Ga0207688_10010611 | |||
| 1152 | Ga0207685_10014224 | |||
| 1153 | Ga0207685_10092708 | |||
| 1154 | Ga0207699_10016756 | |||
| 1155 | Ga0207699_10016833 | |||
| 1156 | Ga0207699_10023034 | |||
| 1157 | Ga0207699_10042106 | |||
| 1158 | Ga0207699_10133514 | |||
| 1159 | Ga0207699_10862541 | |||
| 1160 | Ga0207645_10427267 | |||
| 1161 | Ga0207643_10017811 | |||
| 1162 | Ga0207705_10579597 | |||
| 1163 | Ga0207705_10819387 | |||
| 1164 | Ga0207684_10102190 | |||
| 1165 | Ga0207684_10579532 | |||
| 1166 | Ga0207654_11187282 | |||
| 1167 | Ga0207707_10033045 | |||
| 1168 | Ga0207707_10341224 | |||
| 1169 | Ga0207707_10389194 | |||
| 1170 | Ga0207707_10481572 | |||
| 1171 | Ga0207707_10606472 | |||
| 1172 | Ga0207707_11497584 | |||
| 1173 | Ga0207695_10686866 | |||
| 1174 | Ga0207695_10920486 | |||
| 1175 | Ga0207695_11330436 | |||
| 1176 | Ga0207671_10629333 | |||
| 1177 | Ga0207693_10002222 | |||
| 1178 | Ga0207693_10014582 | |||
| 1179 | Ga0207693_10124112 | |||
| 1180 | Ga0207693_10238612 | |||
| 1181 | Ga0207693_10956475 | |||
| 1182 | Ga0207663_10012957 | |||
| 1183 | Ga0207663_10049683 | |||
| 1184 | Ga0207663_10163046 | |||
| 1185 | Ga0207663_11511964 | |||
| 1186 | Ga0207660_10367144 | |||
| 1187 | Ga0207660_10487603 | |||
| 1188 | Ga0207657_10002895 | |||
| 1189 | Ga0207649_10302439 | |||
| 1190 | Ga0207649_10450156 | |||
| 1191 | Ga0207649_10571844 | |||
| 1192 | Ga0207649_10640482 | |||
| 1193 | Ga0207649_10827551 | |||
| 1194 | Ga0207652_10097627 | |||
| 1195 | Ga0207652_10185900 | |||
| 1196 | Ga0207652_10214505 | |||
| 1197 | Ga0207652_10288949 | |||
| 1198 | Ga0207652_11023483 | |||
| 1199 | Ga0207652_11532898 | |||
| 1200 | Ga0207646_10004762 | |||
| 1201 | Ga0207646_10225185 | |||
| 1202 | Ga0207646_10520686 | |||
| 1203 | Ga0207646_10724533 | |||
| 1204 | Ga0207694_10182801 | |||
| 1205 | Ga0207687_10002673 | |||
| 1206 | Ga0207687_10426819 | |||
| 1207 | Ga0207687_10806445 | |||
| 1208 | Ga0207687_11668601 | |||
| 1209 | Ga0207700_10000039 | |||
| 1210 | Ga0207700_10031669 | |||
| 1211 | Ga0207700_10039117 | |||
| 1212 | Ga0207700_10055842 | |||
| 1213 | Ga0207664_10005419 | |||
| 1214 | Ga0207664_10005888 | |||
| 1215 | Ga0207664_10012720 | |||
| 1216 | Ga0207664_10042598 | |||
| 1217 | Ga0207664_10052460 | |||
| 1218 | Ga0207664_10165502 | |||
| 1219 | Ga0207664_10195155 | |||
| 1220 | Ga0207664_10200706 | |||
| 1221 | Ga0207664_10358981 | |||
| 1222 | Ga0207664_10410561 | |||
| 1223 | Ga0207664_10770972 | |||
| 1224 | Ga0207664_11311534 | |||
| 1225 | Ga0207664_11820136 | |||
| 1226 | Ga0207644_11092596 | |||
| 1227 | Ga0207690_10137563 | |||
| 1228 | Ga0207690_10214523 | |||
| 1229 | Ga0207690_11304649 | |||
| 1230 | Ga0207690_11605830 | |||
| 1231 | Ga0207706_10022328 | |||
| 1232 | Ga0207686_10612027 | |||
| 1233 | Ga0207709_10127255 | |||
| 1234 | Ga0207665_10000562 | |||
| 1235 | Ga0207665_10098939 | |||
| 1236 | Ga0207665_10215708 | |||
| 1237 | Ga0207665_11144015 | |||
| 1238 | Ga0207711_10353822 | |||
| 1239 | Ga0207711_10413675 | |||
| 1240 | Ga0207661_10051353 | |||
| 1241 | Ga0207661_10195790 | |||
| 1242 | Ga0207661_10891694 | |||
| 1243 | Ga0207661_11126848 | |||
| 1244 | Ga0207679_10150754 | |||
| 1245 | Ga0207679_10253078 | |||
| 1246 | Ga0207679_11673611 | |||
| 1247 | Ga0207667_10571403 | |||
| 1248 | Ga0207667_10585123 | |||
| 1249 | Ga0207667_10926996 | |||
| 1250 | Ga0207712_10823697 | |||
| 1251 | Ga0207712_11722232 | |||
| 1252 | Ga0207668_10171576 | |||
| 1253 | Ga0207639_10578495 | |||
| 1254 | Ga0207708_10064612 | |||
| 1255 | Ga0207702_10141358 | |||
| 1256 | Ga0207702_10281837 | |||
| 1257 | Ga0207702_11073481 | |||
| 1258 | Ga0207641_10784247 | |||
| 1259 | Ga0207676_10500286 | |||
| 1260 | Ga0207683_11391410 | |||
| 1261 | Ga0207698_10148731 | |||
| 1262 | Ga0207698_11214937 | |||
| 1263 | Ga0207428_10026849 | |||
| 1264 | Ga0265319_1044499 | |||
| 1265 | Ga0265338_10013750 | |||
| 1266 | Ga0265338_10269062 | |||
| 1267 | Ga0265320_10417376 | |||
| 1268 | Ga0265340_10150508 | |||
| 1269 | Ga0265327_10378016 | |||
| 1270 | Ga0307409_101057621 | |||
| 1271 | Ga0373926_0026255 | |||
| 1272 | Ga0373934_0115427 | |||
| 1273 | Ga0373934_0151337 | |||
| 1274 | Ga0373953_0287258 | |||
| 1275 | Ga0373954_0299716 | |||
| 1276 | Ga0373957_0158130 | |||
| 1277 | Ga0373943_0001293 | |||
| 1278 | Ga0373955_0589098 | |||
| 1279 | Ga0373942_0143196 | |||
| 1280 | Ga0373942_0185210 | |||
| 1281 | Ga0373961_0193688 | |||
| 1282 | Ga0373924_0217957 | |||
| 1283 | Ga0373931_0039463 | |||
| 1284 | Ga0373935_0135845 | |||
| 1285 | Ga0373935_0731020 | |||
| 1286 | Ga0373927_0014230 | |||
| 1287 | Ga0373933_0414377 | |||
| 1288 | Ga0373947_0004518 | |||
| 1289 | Ga0373937_0016365 | |||
| 1290 | Ga0373937_0073117 | |||
| 1291 | Ga0373937_0153734 | |||
| 1292 | Ga0373937_1746589 | |||
| 1293 | Ga0373925_0008872 | |||
| 1294 | Ga0395899_0118777 | |||
| 1295 | Ga0395899_0277241 | |||
| 1296 | Ga0395899_0350796 | |||
| 1297 | Ga0395899_0411306 | |||
| 1298 | Ga0395900_0052091 | |||
| 1299 | Ga0395900_0486521 | |||
| 1300 | Ga0395900_0656083 | |||
| 1301 | Ga0395900_0718574 | |||
| 1302 | Ga0395900_1442136 | |||
| 1303 | Ga0395898_0144505 | |||
| 1304 | Ga0395898_0250624 | |||
| 1305 | Ga0395898_0293322 | |||
| 1306 | Ga0395898_0327817 | |||
| 1307 | Ga0395898_0940102 | |||
| 1308 | Ga0395905_0026568 | |||
| 1309 | Ga0395905_0152208 | |||
| 1310 | Ga0395905_0311865 | |||
| 1311 | Ga0395901_0060380 | |||
| 1312 | Ga0395901_0076808 | |||
| 1313 | Ga0395901_0619852 | |||
| 1314 | Ga0395901_0661751 | |||
| 1315 | Ga0395901_0852558 | |||
| 1316 | Ga0436360_1070180 | |||
| 1317 | Ga0451804_1163253 | |||
| 1318 | Ga0451839_1184555 | |||
| 1319 | Ga0439440_0090678 | |||
| 1320 | Ga0466969_0002408 | |||
| 1321 | Ga0466969_0009754 | |||
| 1322 | Ga0466969_0070464 | |||
| 1323 | Ga0466965_0092389 | |||
| 1324 | Ga0466965_0211414 | |||
| 1325 | Ga0466965_0241202 | |||
| 1326 | Ga0466966_0028183 | |||
| 1327 | Ga0466966_0300071 | |||
| 1328 | Ga0466966_0800140 | |||
| 1329 | Ga0466961_0000819 | |||
| 1330 | Ga0466961_0003296 | |||
| 1331 | Ga0466961_0015491 | |||
| 1332 | Ga0466961_0030502 | |||
| 1333 | Ga0466961_0049913 | |||
| 1334 | Ga0466961_0467256 | |||
| 1335 | Ga0466961_0617625 | |||
| 1336 | Ga0466963_0000590 | |||
| 1337 | Ga0466963_0001319 | |||
| 1338 | Ga0466963_0003019 | |||
| 1339 | Ga0466963_0004719 | |||
| 1340 | Ga0466963_0005067 | |||
| 1341 | Ga0466963_0005412 | |||
| 1342 | Ga0466963_0005809 | |||
| 1343 | Ga0466963_0015937 | |||
| 1344 | Ga0466963_0024000 | |||
| 1345 | Ga0466963_0036952 | |||
| 1346 | Ga0466963_0051616 | |||
| 1347 | Ga0466963_0066808 | |||
| 1348 | Ga0466963_0125438 | |||
| 1349 | Ga0466963_0131834 | |||
| 1350 | Ga0466963_0348661 | |||
| 1351 | Ga0466963_0509068 | |||
| 1352 | Ga0466964_0009732 | |||
| 1353 | Ga0466964_0029973 | |||
| 1354 | Ga0466964_0038677 | |||
| 1355 | Ga0466964_0057120 | |||
| 1356 | Ga0466964_0178001 | |||
| 1357 | Ga0466964_0231836 | |||
| 1358 | Ga0466964_0371619 | |||
| 1359 | Ga0466964_0372387 | |||
| 1360 | Ga0466964_0416237 | |||
| 1361 | Ga0466964_0541631 | |||
| 1362 | Ga0466971_0000170 | |||
| 1363 | Ga0466971_0000741 | |||
| 1364 | Ga0466971_0017475 | |||
| 1365 | Ga0466971_0037187 | |||
| 1366 | Ga0466971_0077275 | |||
| 1367 | Ga0466971_0078463 | |||
| 1368 | Ga0466971_0093363 | |||
| 1369 | Ga0466971_0162452 | |||
| 1370 | Ga0466968_0000750 | |||
| 1371 | Ga0466968_0010254 | |||
| 1372 | Ga0466968_0018495 | |||
| 1373 | Ga0466968_0067811 | |||
| 1374 | Ga0466968_0077865 | |||
| 1375 | Ga0466968_0091380 | |||
| 1376 | Ga0466968_0415079 | |||
| 1377 | Ga0466970_0031167 | |||
| 1378 | Ga0466970_0061998 | |||
| 1379 | Ga0466970_0147511 | |||
| 1380 | Ga0466957_0005810 | |||
| 1381 | Ga0466957_0010943 | |||
| 1382 | Ga0466957_0015689 | |||
| 1383 | Ga0466957_0022184 | |||
| 1384 | Ga0466957_0024594 | |||
| 1385 | Ga0466957_0045057 | |||
| 1386 | Ga0466957_0099236 | |||
| 1387 | Ga0466957_0165181 | |||
| 1388 | Ga0466957_0171504 | |||
| 1389 | Ga0466960_0042993 | |||
| 1390 | Ga0466960_0252129 | |||
| 1391 | Ga0466960_0612556 | |||
| 1392 | Ga0466959_0001145 | |||
| 1393 | Ga0466959_0001155 | |||
| 1394 | Ga0466959_0016502 | |||
| 1395 | Ga0466959_0019407 | |||
| 1396 | Ga0466959_0077801 | |||
| 1397 | Ga0466958_0002655 | |||
| 1398 | Ga0466958_0007781 | |||
| 1399 | Ga0466958_0011391 | |||
| 1400 | Ga0466958_0018485 | |||
| 1401 | Ga0466958_0024049 | |||
| 1402 | Ga0466958_0052170 | |||
| 1403 | Ga0466958_0057358 | |||
| 1404 | Ga0466958_0065315 | |||
| 1405 | Ga0466958_0076959 | |||
| 1406 | Ga0466958_0207868 | |||
| 1407 | Ga0466958_0292168 | |||
| 1408 | Ga0466958_0345097 | |||
| 1409 | Ga0466958_0553382 | |||
| 1410 | Ga0466967_0005947 | |||
| 1411 | Ga0466967_0007577 | |||
| 1412 | Ga0466967_0007820 | |||
| 1413 | Ga0466967_0017648 | |||
| 1414 | Ga0466967_0019995 | |||
| 1415 | Ga0466967_0022573 | |||
| 1416 | Ga0466967_0030309 | |||
| 1417 | Ga0466967_0055033 | |||
| 1418 | Ga0466967_0066203 | |||
| 1419 | Ga0466967_0139315 | |||
| 1420 | Ga0466967_0206745 | |||
| 1421 | Ga0466967_0299389 | |||
| 1422 | Ga0466967_0315158 | |||
| 1423 | Ga0466967_0354291 | |||
| 1424 | Ga0466967_0431011 | |||
| 1425 | Ga0466967_0504585 | |||
| 1426 | Ga0466967_0511499 | |||
| 1427 | Ga0466967_0539089 | |||
| 1428 | Ga0466967_0650252 | |||
| 1429 | Ga0466967_1081540 | |||
| 1430 | Ga0466967_1399607 | |||
| 1431 | Ga0466967_1499800 | |||
| 1432 | Ga0466967_1508444 | |||
| 1433 | Ga0466967_1850952 | |||
| 1434 | Ga0495592_0000198 | |||
| 1435 | Ga0495592_0011866 | |||
| 1436 | Ga0495592_0043169 | |||
| 1437 | Ga0495592_0831752 | |||
| 1438 | Ga0495603_0106906 | |||
| 1439 | Ga0495603_0562667 | |||
| 1440 | Ga0495629_0026822 | |||
| 1441 | Ga0495629_0460966 | |||
| 1442 | Ga0495629_0556107 | |||
| 1443 | Ga0495641_0005676 | |||
| 1444 | Ga0495641_0020462 | |||
| 1445 | Ga0495641_0021139 | |||
| 1446 | Ga0495651_0000064 | |||
| 1447 | Ga0495651_0184859 | |||
| 1448 | Ga0495651_0274558 | |||
| 1449 | Ga0495651_0297503 | |||
| 1450 | Ga0495651_0392996 | |||
| 1451 | Ga0495653_0006068 | |||
| 1452 | Ga0495653_0008425 | |||
| 1453 | Ga0495653_0061444 | |||
| 1454 | Ga0495653_0078976 | |||
| 1455 | Ga0495653_0176850 | |||
| 1456 | Ga0495582_0003230 | |||
| 1457 | Ga0495582_0037242 | |||
| 1458 | Ga0495582_0072614 | |||
| 1459 | Ga0495582_0110523 | |||
| 1460 | Ga0495582_0283631 | |||
| 1461 | Ga0495582_0341394 | |||
| 1462 | Ga0495582_0645027 | |||
| 1463 | Ga0495639_0000865 | |||
| 1464 | Ga0495639_0489985 | |||
| 1465 | Ga0495662_0023948 | |||
| 1466 | Ga0495662_0336113 | |||
| 1467 | Ga0495664_0059305 | |||
| 1468 | Ga0495664_0183041 | |||
| 1469 | Ga0495664_0937769 | |||
| 1470 | Ga0495585_0342844 | |||
| 1471 | Ga0495594_0188830 | |||
| 1472 | Ga0495596_0169800 | |||
| 1473 | Ga0495608_0003922 | |||
| 1474 | Ga0495608_0016954 | |||
| 1475 | Ga0495608_0087954 | |||
| 1476 | Ga0495608_0264131 | |||
| 1477 | Ga0495618_0081756 | |||
| 1478 | Ga0495618_0395243 | |||
| 1479 | Ga0495618_0463277 | |||
| 1480 | Ga0495628_0000069 | |||
| 1481 | Ga0495628_0020750 | |||
| 1482 | Ga0495628_0268316 | |||
| 1483 | Ga0495630_0026623 | |||
| 1484 | Ga0495630_0065332 | |||
| 1485 | Ga0495630_0412040 | |||
| 1486 | Ga0495630_0747509 | |||
| 1487 | Ga0495630_0796266 | |||
| 1488 | Ga0495644_0415529 | |||
| 1489 | Ga0495663_0028750 | |||
| 1490 | Ga0495666_0000935 | |||
| 1491 | Ga0495652_0000356 | |||
| 1492 | Ga0495652_0006105 | |||
| 1493 | Ga0495652_0016953 | |||
| 1494 | Ga0495652_0126713 | |||
| 1495 | Ga0495652_0141181 | |||
| 1496 | Ga0495652_0234556 | |||
| 1497 | Ga0495652_0350183 | |||
| 1498 | Ga0495652_0799592 | |||
| 1499 | Ga0495652_1049234 | |||
| 1500 | Ga0495652_1138091 | |||
| 1501 | Ga0495665_0000569 | |||
| 1502 | Ga0495665_0656059 | |||
| 1503 | Ga0495640_0098538 | |||
| 1504 | Ga0495640_0372316 | |||
| 1505 | Ga0495586_0187570 | |||
| 1506 | Ga0495586_0289647 | |||
| 1507 | Ga0495587_0003524 | |||
| 1508 | Ga0495587_0222887 | |||
| 1509 | Ga0495609_0323313 | |||
| 1510 | Ga0495645_0000085 | |||
| 1511 | Ga0495645_0040397 | |||
| 1512 | Ga0495645_0059698 | |||
| 1513 | Ga0495645_0237988 | |||
| 1514 | Ga0495667_0077684 | |||
| 1515 | Ga0495667_0105251 | |||
| 1516 | Ga0495667_0656348 | |||
| 1517 | Ga0495656_0706626 | |||
| 1518 | Ga0495634_0102840 | |||
| 1519 | Ga0495634_0129715 | |||
| 1520 | Ga0495634_0135841 | |||
| 1521 | Ga0495634_0264458 | |||
| 1522 | Ga0495634_0298419 | |||
| 1523 | Ga0495634_0618498 | |||
| 1524 | Ga0495635_0088166 | |||
| 1525 | Ga0495635_0339720 | |||
| 1526 | Ga0495635_0580867 | |||
| 1527 | Ga0495635_0617381 | |||
| 1528 | Ga0495635_0772591 | |||
| 1529 | Ga0495635_1083902 | |||
| 1530 | Ga0495659_0242144 | |||
| 1531 | Ga0495657_0011016 | |||
| 1532 | Ga0495657_0013391 | |||
| 1533 | Ga0495657_0043961 | |||
| 1534 | Ga0495657_0389883 | |||
| 1535 | Ga0495657_0704875 | |||
| 1536 | Ga0495599_0000716 | |||
| 1537 | Ga0495599_0005564 | |||
| 1538 | Ga0495599_0056515 | |||
| 1539 | Ga0495599_0210363 | |||
| 1540 | Ga0495599_0217191 | |||
| 1541 | Ga0495623_0000030 | |||
| 1542 | Ga0495623_0152356 | |||
| 1543 | Ga0495623_0299034 | |||
| 1544 | Ga0495646_0028239 | |||
| 1545 | Ga0495646_0130609 | |||
| 1546 | Ga0495646_0140086 | |||
| 1547 | Ga0495646_0320282 | |||
| 1548 | Ga0495647_0010053 | |||
| 1549 | Ga0495647_0055401 | |||
| 1550 | Ga0495658_0012266 | |||
| 1551 | Ga0495658_0336496 | |||
| 1552 | Ga0495658_0337066 | |||
| 1553 | Ga0495658_0364830 | |||
| 1554 | Ga0495613_0012420 | |||
| 1555 | Ga0495613_0149173 | |||
| 1556 | Ga0495613_0167022 | |||
| 1557 | Ga0495613_0212130 | |||
| 1558 | Ga0495613_0386200 | |||
| 1559 | Ga0495624_0002753 | |||
| 1560 | Ga0495624_0004809 | |||
| 1561 | Ga0495624_0450836 | |||
| 1562 | Ga0495600_0037083 | |||
| 1563 | Ga0495600_0042563 | |||
| 1564 | Ga0495600_0147006 | |||
| 1565 | Ga0495600_0451569 | |||
| 1566 | Ga0495600_0928182 | |||
| 1567 | Ga0495581_0035436 | |||
| 1568 | Ga0495581_0426533 | |||
| 1569 | Ga0495604_0000103 | |||
| 1570 | Ga0495604_0297930 | |||
| 1571 | Ga0495604_0532297 | |||
| 1572 | Ga0495636_0409244 | |||
| 1573 | Ga0495674_0045217 | |||
| 1574 | Ga0495674_0051543 | |||
| 1575 | Ga0495674_0438607 | |||
| 1576 | Ga0495674_0472270 | |||
| 1577 | Ga0495674_0525063 | |||
| 1578 | Ga0495674_1457523 | |||
| 1579 | Ga0495676_0005516 | |||
| 1580 | Ga0495676_0054466 | |||
| 1581 | Ga0495676_0399301 | |||
| 1582 | Ga0495680_0010394 | |||
| 1583 | Ga0495680_0020217 | |||
| 1584 | Ga0495680_0096752 | |||
| 1585 | Ga0495680_0141195 | |||
| 1586 | Ga0495680_0261093 | |||
| 1587 | Ga0495680_0740958 | |||
| 1588 | Ga0495675_0000282 | |||
| 1589 | Ga0495675_0228784 | |||
| 1590 | Ga0495675_0335860 | |||
| 1591 | Ga0495684_0028380 | |||
| 1592 | Ga0495684_0088850 | |||
| 1593 | Ga0495684_0236516 | |||
| 1594 | Ga0495684_0315062 | |||
| 1595 | Ga0495684_1068093 | |||
| 1596 | Ga0495593_0000807 | |||
| 1597 | Ga0495602_0000080 | |||
| 1598 | Ga0495602_0050967 | |||
| 1599 | Ga0495602_0238376 | |||
| 1600 | Ga0495602_0332925 | |||
| 1601 | Ga0495602_0739391 | |||
| 1602 | Ga0495614_0000642 | |||
| 1603 | Ga0496100_0007377 | |||
| 1604 | Ga0496100_0014562 | |||
| 1605 | Ga0496100_0240399 | |||
| 1606 | Ga0496100_0869163 | |||
| 1607 | Ga0496100_1273207 | |||
| 1608 | Ga0496101_0002103 | |||
| 1609 | Ga0496101_0147545 | |||
| 1610 | Ga0496101_0189027 | |||
| 1611 | Ga0496101_0419822 | |||
| 1612 | Ga0496101_0602494 | |||
| 1613 | Ga0496101_1148667 | |||
| 1614 | Ga0496101_1193910 | |||
| 1615 | Ga0496102_0013820 | |||
| 1616 | Ga0496102_0072684 | |||
| 1617 | Ga0496102_1063559 | |||
| 1618 | Ga0496103_0168547 | |||
| 1619 | Ga0496103_0655086 | |||
| 1620 | Ga0496104_0009909 | |||
| 1621 | Ga0496104_0044880 | |||
| 1622 | Ga0496104_0048847 | |||
| 1623 | Ga0496104_0064181 | |||
| 1624 | Ga0496104_0119395 | |||
| 1625 | Ga0496104_0127021 | |||
| 1626 | Ga0496104_0758284 | |||
| 1627 | Ga0496104_1341198 | |||
| 1628 | Ga0496105_0011626 | |||
| 1629 | Ga0496105_0013058 | |||
| 1630 | Ga0496105_0065979 | |||
| 1631 | Ga0496105_0152098 | |||
| 1632 | Ga0496105_0330004 | |||
| 1633 | Ga0496105_0693303 | |||
| 1634 | Ga0496106_0011132 | |||
| 1635 | Ga0496106_0640458 | |||
| 1636 | Ga0496106_1304809 | |||
| 1637 | Ga0496107_0133618 | |||
| 1638 | Ga0496107_0170221 | |||
| 1639 | Ga0496107_0592427 | |||
| 1640 | Ga0496107_0686372 | |||
| 1641 | Ga0496107_0885026 | |||
| 1642 | Ga0496107_0971834 | |||
| 1643 | Ga0496108_0022798 | |||
| 1644 | Ga0496108_0068223 | |||
| 1645 | Ga0496108_0070458 | |||
| 1646 | Ga0496108_0240292 | |||
| 1647 | Ga0496109_0018098 | |||
| 1648 | Ga0496109_0032643 | |||
| 1649 | Ga0496109_0077215 | |||
| 1650 | Ga0496110_0015617 | |||
| 1651 | Ga0496110_0027540 | |||
| 1652 | Ga0496110_0063764 | |||
| 1653 | Ga0496110_0209955 | |||
| 1654 | Ga0496110_1109425 | |||
| 1655 | Ga0496111_0051238 | |||
| 1656 | Ga0496111_0098022 | |||
| 1657 | Ga0496111_0101276 | |||
| 1658 | Ga0496111_0576730 | |||
| 1659 | Ga0496111_0711185 | |||
| 1660 | Ga0496112_0001848 | |||
| 1661 | Ga0496112_0036826 | |||
| 1662 | Ga0496112_0094398 | |||
| 1663 | Ga0496112_0172870 | |||
| 1664 | Ga0496112_0338230 | |||
| 1665 | Ga0496112_0529835 | |||
| 1666 | Ga0496112_1220975 | |||
| 1667 | Ga0496112_1873200 | |||
| 1668 | Ga0496113_0102368 | |||
| 1669 | Ga0496113_0110515 | |||
| 1670 | Ga0496113_0112489 | |||
| 1671 | Ga0496113_0287134 | |||
| 1672 | Ga0496113_0760299 | |||
| 1673 | Ga0496114_0004422 | |||
| 1674 | Ga0496114_0079244 | |||
| 1675 | Ga0496114_0181882 | |||
| 1676 | Ga0496114_0409711 | |||
| 1677 | Ga0496114_0501558 | |||
| 1678 | Ga0496114_0503776 | |||
| 1679 | Ga0496114_0556920 | |||
| 1680 | Ga0496115_0012415 | |||
| 1681 | Ga0496115_0038699 | |||
| 1682 | Ga0496115_0174335 | |||
| 1683 | Ga0496115_0839361 | |||
| 1684 | Ga0496115_0872471 | |||
| 1685 | Ga0501032_0041040 | |||
| 1686 | Ga0501032_0287616 | |||
| 1687 | Ga0501033_1108793 | |||
| 1688 | Ga0501034_1556560 | |||
| 1689 | Ga0501036_0147697 | |||
| 1690 | Ga0501036_0172526 | |||
| 1691 | Ga0501037_0020619 | |||
| 1692 | Ga0501038_0005915 | |||
| 1693 | Ga0501039_0048024 | |||
| 1694 | Ga0501039_0139907 | |||
| 1695 | Ga0501039_0223959 | |||
| 1696 | Ga0501040_0027966 | |||
| 1697 | Ga0501040_0151602 | |||
| 1698 | Ga0501040_0939912 | |||
| 1699 | Ga0501041_0040823 | |||
| 1700 | Ga0501041_0076368 | |||
| 1701 | Ga0501041_0376191 | |||
| 1702 | Ga0501041_0691491 | |||
| 1703 | Ga0501042_0116784 | |||
| 1704 | Ga0501042_0192183 | |||
| 1705 | Ga0501043_0096192 | |||
| 1706 | Ga0501043_0363087 | |||
| 1707 | Ga0501043_0973759 | |||
| 1708 | Ga0501046_0032235 | |||
| 1709 | Ga0501046_0558371 | |||
| 1710 | Ga0501046_0677640 | |||
| 1711 | Ga0501047_0052962 | |||
| 1712 | Ga0501048_0018588 | |||
| 1713 | Ga0501048_0146736 | |||
| 1714 | Ga0501048_0497021 | |||
| 1715 | Ga0501067_0027298 | |||
| 1716 | Ga0501067_0258899 | |||
| 1717 | Ga0501067_0850095 | |||
| 1718 | Ga0501068_0025740 | |||
| 1719 | Ga0501068_0237721 | |||
| 1720 | Ga0501068_0512500 | |||
| 1721 | Ga0501068_0686776 | |||
| 1722 | Ga0501069_0004410 | |||
| 1723 | Ga0501069_0007201 | |||
| 1724 | Ga0501069_0028911 | |||
| 1725 | Ga0501069_0084754 | |||
| 1726 | Ga0501069_0349361 | |||
| 1727 | Ga0501070_0052967 | |||
| 1728 | Ga0501070_0094716 | |||
| 1729 | Ga0501070_0741972 | |||
| 1730 | Ga0501071_0000255 | |||
| 1731 | Ga0501071_0103180 | |||
| 1732 | Ga0501071_0474439 | |||
| 1733 | Ga0501072_0004415 | |||
| 1734 | Ga0501072_0055862 | |||
| 1735 | Ga0501072_0324001 | |||
| 1736 | Ga0501073_0038144 | |||
| 1737 | Ga0501073_0465028 | |||
| 1738 | Ga0501074_0016778 | |||
| 1739 | Ga0501074_0108216 | |||
| 1740 | Ga0501074_0111407 | |||
| 1741 | Ga0501075_0040548 | |||
| 1742 | Ga0501075_0120633 | |||
| 1743 | Ga0501075_0504120 | |||
| 1744 | Ga0501076_0036235 | |||
| 1745 | Ga0501076_0123664 | |||
| 1746 | Ga0501076_0171107 | |||
| 1747 | Ga0501077_0012818 | |||
| 1748 | Ga0501077_0018228 | |||
| 1749 | Ga0501077_0041068 | |||
| 1750 | Ga0501077_0861851 | |||
| 1751 | Ga0501079_0013247 | |||
| 1752 | Ga0501079_0325558 | |||
| 1753 | Ga0501080_0039769 | |||
| 1754 | Ga0501080_0053707 | |||
| 1755 | Ga0501080_0053907 | |||
| 1756 | Ga0501081_0019102 | |||
| 1757 | Ga0501081_0179394 | |||
| 1758 | Ga0501081_0672760 | |||
| 1759 | Ga0501083_0022810 | |||
| 1760 | Ga0501083_0097494 | |||
| 1761 | Ga0501035_0236155 | |||
| 1762 | Ga0501035_0443933 | |||
| 1763 | Ga0501044_0589941 | |||
| 1764 | Ga0501044_0715477 | |||
| 1765 | Ga0501045_0033228 | |||
| 1766 | Ga0501045_0182542 | |||
| 1767 | Ga0501045_0281045 | |||
| 1768 | Ga0501045_0599692 | |||
| 1769 | nmdc:mga03683_613972_c1 | |||
| 1770 | nmdc:mga05p37_27961_c1 | |||
| 1771 | nmdc:mga05p37_311677_c1 | |||
| 1772 | nmdc:mga08y16_612892_c1 | |||
| 1773 | nmdc:mga08y16_70993_c1 | |||
| 1774 | nmdc:mga0n895_36635_c1 | |||
| 1775 | nmdc:mga0rr50_271854_c1 | |||
| 1776 | nmdc:mga0a205_262270_c1 | |||
| 1777 | nmdc:mga0a205_576977_c1 | |||
| 1778 | nmdc:mga0a205_760324_c1 | |||
| 1779 | nmdc:mga0a205_808339_c1 | |||
| 1780 | Ga0495601_0000163 | |||
| 1781 | Ga0495601_0015952 | |||
| 1782 | Ga0495601_0031573 | |||
| 1783 | Ga0495601_0213512 | |||
| 1784 | Ga0495601_0464869 | |||
| 1785 | Ga0495601_0797739 | |||
| 1786 | Ga0495601_1085239 | |||
| 1787 | Ga0495612_0120804 | |||
| 1788 | Ga0495595_0006135 | |||
| 1789 | Ga0495595_0035071 | |||
| 1790 | Ga0495595_0052842 | |||
| 1791 | Ga0495595_0135861 | |||
| 1792 | Ga0495595_0234899 | |||
| 1793 | Ga0495619_0000493 | |||
| 1794 | Ga0495619_0079060 | |||
| 1795 | Ga0495619_0096967 | |||
| 1796 | Ga0495619_0108391 | |||
| 1797 | Ga0495619_0177257 | |||
| 1798 | Ga0495619_0345180 | |||
| 1799 | Ga0495619_0427392 | |||
| 1800 | Ga0495619_0461135 | |||
| 1801 | Ga0500566_0198571 | |||
| 1802 | Ga0501084_0000979 | |||
| 1803 | Ga0501084_0022006 | |||
| 1804 | Ga0501084_0147038 | |||
| 1805 | Ga0501084_0186127 | |||
| 1806 | Ga0501082_0010371 | |||
| 1807 | Ga0501082_0352523 | |||
| 1808 | Ga0501082_0546992 | |||
| 1809 | Ga0466962_0001338 | |||
| 1810 | Ga0466962_0008088 | |||
| 1811 | Ga0466962_0021355 | |||
| 1812 | Ga0466962_0041156 | |||
| 1813 | Ga0466962_0046818 | |||
| 1814 | Ga0466962_0064202 | |||
| 1815 | Ga0466962_0299755 | |||
| 1816 | Ga0530510_0028568 | |||
| 1817 | Ga0530510_0473528 | |||
| 1818 | Ga0530510_0477071 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9387 | 36 | 91 |
| 6ghb-assembly2.cif.gz_D | crystal structure of spx in complex with yjbh (oxidized) | 0.9369 | 40 | 92 |
| 6ghb-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh (oxidized) | 0.9353 | 40 | 92 |
| 6gho-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh | 0.9324 | 39 | 94 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9318 | 23 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53478_1_106_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9526 | 24 | 103 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9496 | 47 | 91 | 3.30.230.130 |
| 2v9vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9467 | 48 | 90 | 1.10.10.10 |
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9462 | 22 | 103 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9451 | 33 | 90 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1BH43-F1-model_v4 | Bacterial regulatory protein, ArsR domain protein | 0.9837 | 20 | 93 |
GO:0003700
|
| AF-A0A553ZX70-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9834 | 19 | 99 |
GO:0003677
GO:0003700 GO:0046685 |
| AF-A0A2N2PVB9-F1-model_v4 | Transcriptional regulator | 0.9833 | 19 | 103 |
GO:0003700
|
| AF-A0A2M7A764-F1-model_v4 | Transcriptional regulator | 0.9808 | 17 | 105 |
GO:0003700
|
| AF-A0A535RW99-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9791 | 19 | 103 |
GO:0003700
|