F485421

General Info

Members Datasets Scaffolds Average Seq Length
909 307 1818 108

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0380051|Ga0495592_0380051_35_361
Length 108
Sequence MKTLPVLQPLCCGPDTPVMSAGAAADLAATFKALSDPTRVAIVNRLAATECCVCDLTAAFALSQPTVSHHLRILRDAGLVEAERRGTWAYYRLAPDAVDRLQGIFTPV

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.13
Rhizosphere 90.21
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0380051 3300046454 Unclassified 899
2 Ga0070658_10044395 3300005327 Bacteria 3592
3 Ga0070658_10122757 3300005327 Bacteria 2159
4 Ga0070658_10515143 3300005327 Bacteria 1034
5 Ga0070658_10528988 3300005327 Bacteria 1020
6 Ga0070676_10147072 3300005328 Bacteria 1505
7 Ga0070683_100175213 3300005329 Bacteria 2036
8 Ga0070683_100632167 3300005329 Bacteria 1025
9 Ga0070683_101320943 3300005329 Bacteria 693
10 Ga0070683_101406161 3300005329 Bacteria 670
11 Ga0070690_100772180 3300005330 Bacteria 743
12 Ga0070670_100331849 3300005331 Bacteria 1334
13 Ga0070680_100017427 3300005336 Bacteria 5665
14 Ga0070680_100100954 3300005336 Bacteria 2395
15 Ga0070680_100141281 3300005336 Bacteria 2019
16 Ga0070682_100193090 3300005337 Bacteria 1431
17 Ga0070682_100428020 3300005337 Bacteria 1008
18 Ga0070660_101114452 3300005339 Bacteria 668
19 Ga0070660_101514059 3300005339 Bacteria 570
20 Ga0070691_10003297 3300005341 Bacteria 7236
21 Ga0070691_10106161 3300005341 Bacteria 1400
22 Ga0070661_100273140 3300005344 Bacteria 1310
23 Ga0070661_100288695 3300005344 Bacteria 1274
24 Ga0070661_100748239 3300005344 Bacteria 799
25 Ga0070668_100636256 3300005347 Bacteria 936
26 Ga0070675_100410503 3300005354 Bacteria 1209
27 Ga0070675_100981198 3300005354 Bacteria 775
28 Ga0070671_101191739 3300005355 Bacteria 670
29 Ga0070673_101254533 3300005364 Unclassified 695
30 Ga0070659_100035344 3300005366 Bacteria 3891
31 Ga0070659_100377317 3300005366 Bacteria 1194
32 Ga0070709_10013994 3300005434 Bacteria 4527
33 Ga0070709_10059358 3300005434 Bacteria 2428
34 Ga0070709_10079845 3300005434 Bacteria 2132
35 Ga0070709_10298990 3300005434 Bacteria 1175
36 Ga0070709_10616801 3300005434 Bacteria 837
37 Ga0070714_100006571 3300005435 Bacteria 8993
38 Ga0070714_100018726 3300005435 Bacteria 5632
39 Ga0070714_100021410 3300005435 Bacteria 5291
40 Ga0070714_100024680 3300005435 Bacteria 4954
41 Ga0070714_100089592 3300005435 Bacteria 2693
42 Ga0070714_100168279 3300005435 Bacteria 1987
43 Ga0070714_100217596 3300005435 Bacteria 1754
44 Ga0070714_100635790 3300005435 Bacteria 1026
45 Ga0070714_100903528 3300005435 Bacteria 857
46 Ga0070714_101933995 3300005435 Bacteria 575
47 Ga0070714_102372707 3300005435 Bacteria 515
48 Ga0070713_100000665 3300005436 Bacteria 21987
49 Ga0070713_100003272 3300005436 Bacteria 10673
50 Ga0070713_100088784 3300005436 Bacteria 2654
51 Ga0070713_100317293 3300005436 Bacteria 1438
52 Ga0070713_101252079 3300005436 Bacteria 718
53 Ga0070713_101457887 3300005436 Bacteria 664
54 Ga0070713_101838984 3300005436 Bacteria 588
55 Ga0070710_10005614 3300005437 Bacteria 5972
56 Ga0070710_10017125 3300005437 Bacteria 3703
57 Ga0070710_11103591 3300005437 Bacteria 582
58 Ga0070711_100003012 3300005439 Bacteria 9738
59 Ga0070711_100157689 3300005439 Bacteria 1718
60 Ga0070711_100165876 3300005439 Bacteria 1679
61 Ga0070711_100517865 3300005439 Bacteria 985
62 Ga0070711_100752871 3300005439 Bacteria 823
63 Ga0070711_100752873 3300005439 Bacteria 823
64 Ga0070700_100035388 3300005441 Bacteria 3022
65 Ga0070694_100827684 3300005444 Bacteria 760
66 Ga0070694_101218275 3300005444 Bacteria 631
67 Ga0070708_101492004 3300005445 Bacteria 630
68 Ga0070678_101477111 3300005456 Bacteria 636
69 Ga0070662_100145972 3300005457 Bacteria 1838
70 Ga0070681_10159545 3300005458 Bacteria 2179
71 Ga0070681_10172802 3300005458 Bacteria 2082
72 Ga0070681_10247448 3300005458 Bacteria 1696
73 Ga0070681_10409027 3300005458 Bacteria 1268
74 Ga0070681_10527471 3300005458 Bacteria 1094
75 Ga0070681_10758832 3300005458 Bacteria 887
76 Ga0070681_11241019 3300005458 Bacteria 668
77 Ga0070706_100309744 3300005467 Bacteria 1473
78 Ga0070707_100001128 3300005468 Bacteria 26352
79 Ga0070707_100236323 3300005468 Bacteria 1779
80 Ga0070707_100292878 3300005468 Bacteria 1582
81 Ga0070698_100218758 3300005471 Bacteria 1839
82 Ga0070699_100147402 3300005518 Bacteria 2080
83 Ga0070699_100421020 3300005518 Bacteria 1209
84 Ga0070699_101757010 3300005518 Bacteria 568
85 Ga0070699_101877367 3300005518 Bacteria 548
86 Ga0070679_100027058 3300005530 Bacteria 5640
87 Ga0070679_100056618 3300005530 Bacteria 3906
88 Ga0070679_100093701 3300005530 Bacteria 2991
89 Ga0070679_100304361 3300005530 Bacteria 1544
90 Ga0070679_100454624 3300005530 Bacteria 1225
91 Ga0070679_100979094 3300005530 Bacteria 790
92 Ga0070679_100983132 3300005530 Bacteria 788
93 Ga0070684_100039997 3300005535 Bacteria 4034
94 Ga0070684_100080081 3300005535 Bacteria 2889
95 Ga0070684_100091374 3300005535 Bacteria 2708
96 Ga0070684_100155070 3300005535 Unclassified 2076
97 Ga0070697_100075331 3300005536 Bacteria 2773
98 Ga0070697_100291644 3300005536 Bacteria 1401
99 Ga0068853_101017515 3300005539 Bacteria 798
100 Ga0070686_100186324 3300005544 Bacteria 1478
101 Ga0070695_100336921 3300005545 Bacteria 1126
102 Ga0070696_100409068 3300005546 Bacteria 1063
103 Ga0070696_101135120 3300005546 Bacteria 658
104 Ga0070696_101229899 3300005546 Bacteria 634
105 Ga0070693_100034992 3300005547 Bacteria 2783
106 Ga0070693_100624307 3300005547 Bacteria 781
107 Ga0068855_100435518 3300005563 Bacteria 1432
108 Ga0068855_100512356 3300005563 Bacteria 1302
109 Ga0068855_102185358 3300005563 Bacteria 556
110 Ga0070664_100335279 3300005564 Bacteria 1373
111 Ga0070664_101041477 3300005564 Bacteria 770
112 Ga0068857_101706091 3300005577 Unclassified 616
113 Ga0068854_100143605 3300005578 Bacteria 1834
114 Ga0068854_102144527 3300005578 Bacteria 516
115 Ga0068856_100032269 3300005614 Bacteria 5126
116 Ga0068856_100178555 3300005614 Bacteria 2136
117 Ga0068856_101033386 3300005614 Bacteria 840
118 Ga0068856_101166972 3300005614 Bacteria 787
119 Ga0070702_100181288 3300005615 Bacteria 1378
120 Ga0070702_100247249 3300005615 Bacteria 1207
121 Ga0068852_100432879 3300005616 Bacteria 1299
122 Ga0068864_100554753 3300005618 Bacteria 1111
123 Ga0068861_100028909 3300005719 Bacteria 4048
124 Ga0068861_101526338 3300005719 Bacteria 656
125 Ga0068851_11012902 3300005834 Bacteria 524
126 Ga0068870_10525230 3300005840 Bacteria 793
127 Ga0068870_10968959 3300005840 Bacteria 605
128 Ga0068863_100253539 3300005841 Bacteria 1700
129 Ga0068863_100850875 3300005841 Bacteria 911
130 Ga0068862_100231587 3300005844 Bacteria 1676
131 Ga0081455_10080411 3300005937 Bacteria 2672
132 Ga0081455_10253218 3300005937 Bacteria 1287
133 Ga0070717_10004499 3300006028 Bacteria 10074
134 Ga0070717_10006185 3300006028 Bacteria 8788
135 Ga0070717_10007203 3300006028 Bacteria 8249
136 Ga0070717_10048414 3300006028 Bacteria 3486
137 Ga0070717_10071076 3300006028 Bacteria 2902
138 Ga0070717_10327682 3300006028 Bacteria 1365
139 Ga0070717_10573047 3300006028 Unclassified 1023
140 Ga0070717_10672763 3300006028 Bacteria 940
141 Ga0070717_10933892 3300006028 Bacteria 790
142 Ga0070717_10982947 3300006028 Bacteria 768
143 Ga0075365_10440972 3300006038 Bacteria 919
144 Ga0075363_100571199 3300006048 Bacteria 676
145 Ga0075432_10000679 3300006058 Bacteria 10462
146 Ga0070715_10000827 3300006163 Bacteria 8487
147 Ga0070716_100000663 3300006173 Bacteria 14622
148 Ga0070716_100016673 3300006173 Bacteria 3796
149 Ga0070716_100153010 3300006173 Bacteria 1486
150 Ga0070716_101159383 3300006173 Bacteria 619
151 Ga0070712_100518931 3300006175 Bacteria 1000
152 Ga0070712_100843397 3300006175 Bacteria 788
153 Ga0070712_101503096 3300006175 Bacteria 588
154 Ga0070712_101652676 3300006175 Bacteria 560
155 Ga0075362_10689156 3300006177 Bacteria 532
156 Ga0097621_101303333 3300006237 Bacteria 686
157 Ga0068871_100103360 3300006358 Bacteria 2389
158 Ga0075428_100123242 3300006844 Bacteria 2821
159 Ga0075428_100393181 3300006844 Unclassified 1486
160 Ga0075431_100188959 3300006847 Bacteria 2111
161 Ga0075433_10047201 3300006852 Bacteria 3745
162 Ga0075433_10510479 3300006852 Bacteria 1058
163 Ga0075433_10638010 3300006852 Bacteria 934
164 Ga0075434_100015565 3300006871 Bacteria 7300
165 Ga0075434_100072472 3300006871 Bacteria 3437
166 Ga0075434_101163200 3300006871 Bacteria 784
167 Ga0075429_100038332 3300006880 Bacteria 4172
168 Ga0068865_101164905 3300006881 Bacteria 681
169 Ga0075436_101139093 3300006914 Bacteria 588
170 Ga0105251_10467878 3300009011 Bacteria 586
171 Ga0105240_10141561 3300009093 Bacteria 2875
172 Ga0105240_10316562 3300009093 Bacteria 1780
173 Ga0105240_10338374 3300009093 Bacteria 1710
174 Ga0105240_10611884 3300009093 Bacteria 1198
175 Ga0105240_11432469 3300009093 Unclassified 726
176 Ga0111539_10165764 3300009094 Bacteria 2583
177 Ga0111539_10262132 3300009094 Bacteria 2012
178 Ga0105245_10004034 3300009098 Bacteria 13061
179 Ga0105245_10515291 3300009098 Bacteria 1214
180 Ga0105245_11197322 3300009098 Bacteria 807
181 Ga0105245_12777298 3300009098 Bacteria 542
182 Ga0105247_10036142 3300009101 Bacteria 3012
183 Ga0114129_10063673 3300009147 Bacteria 5148
184 Ga0114129_10648011 3300009147 Bacteria 1364
185 Ga0105243_10025030 3300009148 Bacteria 4558
186 Ga0105241_11432051 3300009174 Bacteria 663
187 Ga0105242_10687791 3300009176 Bacteria 999
188 Ga0105248_10103121 3300009177 Bacteria 3215
189 Ga0105248_11503081 3300009177 Bacteria 762
190 Ga0105237_10232057 3300009545 Bacteria 1846
191 Ga0105237_10309328 3300009545 Bacteria 1583
192 Ga0105237_11742852 3300009545 Unclassified 630
193 Ga0105238_10857318 3300009551 Bacteria 926
194 Ga0105249_10511302 3300009553 Bacteria 1247
195 Ga0099796_10590025 3300010159 Bacteria 500
196 Ga0105239_10034836 3300010375 Bacteria 5529
197 Ga0105239_10474213 3300010375 Bacteria 1421
198 Ga0105246_10556353 3300011119 Bacteria 984
199 Ga0157373_10034934 3300013100 Bacteria 3610
200 Ga0157373_10259228 3300013100 Bacteria 1230
201 Ga0157373_10652694 3300013100 Bacteria 768
202 Ga0157373_11251760 3300013100 Bacteria 560
203 Ga0157371_10954246 3300013102 Bacteria 652
204 Ga0157370_10142668 3300013104 Bacteria 2232
205 Ga0157370_10510318 3300013104 Bacteria 1104
206 Ga0157370_10543607 3300013104 Bacteria 1065
207 Ga0157369_10003691 3300013105 Bacteria 18191
208 Ga0157369_10110278 3300013105 Bacteria 2926
209 Ga0157369_10192968 3300013105 Bacteria 2139
210 Ga0157369_10299755 3300013105 Bacteria 1672
211 Ga0157369_11877808 3300013105 Bacteria 608
212 Ga0157369_12658762 3300013105 Bacteria 505
213 Ga0157374_10006679 3300013296 Bacteria 9803
214 Ga0157374_10367072 3300013296 Bacteria 1432
215 Ga0157374_10473095 3300013296 Bacteria 1256
216 Ga0163162_10269355 3300013306 Bacteria 1835
217 Ga0163162_10601374 3300013306 Bacteria 1226
218 Ga0157372_10479504 3300013307 Bacteria 1450
219 Ga0157372_10886001 3300013307 Unclassified 1036
220 Ga0157372_11075517 3300013307 Bacteria 931
221 Ga0157372_11737139 3300013307 Bacteria 718
222 Ga0157375_10356336 3300013308 Bacteria 1629
223 Ga0182008_10546385 3300014497 Bacteria 643
224 Ga0157377_10022167 3300014745 Bacteria 3350
225 Ga0157379_10575949 3300014968 Bacteria 1049
226 Ga0157379_10649141 3300014968 Bacteria 988
227 Ga0157376_10040289 3300014969 Bacteria 3817
228 Ga0157376_11040707 3300014969 Bacteria 843
229 Ga0157376_11211765 3300014969 Bacteria 783
230 Ga0182006_1238395 3300015261 Bacteria 598
231 Ga0206356_10507006 3300020070 Bacteria 577
232 Ga0206356_10820228 3300020070 Bacteria 614
233 Ga0206352_10411163 3300020078 Bacteria 652
234 Ga0206354_10452674 3300020081 Bacteria 3527
235 Ga0206354_10625982 3300020081 Bacteria 1362
236 Ga0206353_10335697 3300020082 Bacteria 1090
237 Ga0206353_10669165 3300020082 Bacteria 574
238 Ga0206353_11395614 3300020082 Bacteria 968
239 Ga0206353_11950027 3300020082 Bacteria 773
240 Ga0207692_10016300 3300025898 Bacteria 3287
241 Ga0207710_10300252 3300025900 Bacteria 811
242 Ga0207688_10010611 3300025901 Bacteria 5009
243 Ga0207685_10014224 3300025905 Bacteria 2486
244 Ga0207685_10092708 3300025905 Bacteria 1275
245 Ga0207699_10016756 3300025906 Bacteria 3841
246 Ga0207699_10016833 3300025906 Bacteria 3834
247 Ga0207699_10023034 3300025906 Bacteria 3384
248 Ga0207699_10042106 3300025906 Bacteria 2643
249 Ga0207699_10133514 3300025906 Bacteria 1622
250 Ga0207699_10862541 3300025906 Bacteria 667
251 Ga0207645_10427267 3300025907 Bacteria 893
252 Ga0207643_10017811 3300025908 Bacteria 3889
253 Ga0207705_10579597 3300025909 Bacteria 872
254 Ga0207705_10819387 3300025909 Bacteria 722
255 Ga0207684_10102190 3300025910 Unclassified 2451
256 Ga0207684_10579532 3300025910 Bacteria 959
257 Ga0207654_11187282 3300025911 Bacteria 556
258 Ga0207707_10033045 3300025912 Bacteria 4528
259 Ga0207707_10341224 3300025912 Bacteria 1292
260 Ga0207707_10389194 3300025912 Bacteria 1198
261 Ga0207707_10481572 3300025912 Bacteria 1060
262 Ga0207707_10606472 3300025912 Bacteria 926
263 Ga0207707_11497584 3300025912 Bacteria 535
264 Ga0207695_10686866 3300025913 Bacteria 904
265 Ga0207695_10920486 3300025913 Unclassified 754
266 Ga0207695_11330436 3300025913 Bacteria 599
267 Ga0207671_10629333 3300025914 Bacteria 855
268 Ga0207693_10002222 3300025915 Bacteria 16897
269 Ga0207693_10014582 3300025915 Bacteria 6315
270 Ga0207693_10124112 3300025915 Bacteria 2029
271 Ga0207693_10238612 3300025915 Bacteria 1427
272 Ga0207693_10956475 3300025915 Bacteria 655
273 Ga0207663_10012957 3300025916 Bacteria 4522
274 Ga0207663_10049683 3300025916 Bacteria 2603
275 Ga0207663_10163046 3300025916 Bacteria 1576
276 Ga0207663_11511964 3300025916 Bacteria 541
277 Ga0207660_10367144 3300025917 Bacteria 1155
278 Ga0207660_10487603 3300025917 Bacteria 999
279 Ga0207657_10002895 3300025919 Bacteria 18432
280 Ga0207649_10302439 3300025920 Bacteria 1170
281 Ga0207649_10450156 3300025920 Bacteria 972
282 Ga0207649_10571844 3300025920 Bacteria 867
283 Ga0207649_10640482 3300025920 Bacteria 820
284 Ga0207649_10827551 3300025920 Bacteria 724
285 Ga0207652_10097627 3300025921 Bacteria 2590
286 Ga0207652_10185900 3300025921 Bacteria 1868
287 Ga0207652_10214505 3300025921 Bacteria 1734
288 Ga0207652_10288949 3300025921 Bacteria 1479
289 Ga0207652_11023483 3300025921 Bacteria 725
290 Ga0207652_11532898 3300025921 Bacteria 570
291 Ga0207646_10004762 3300025922 Bacteria 14607
292 Ga0207646_10225185 3300025922 Bacteria 1694
293 Ga0207646_10520686 3300025922 Bacteria 1071
294 Ga0207646_10724533 3300025922 Bacteria 888
295 Ga0207694_10182801 3300025924 Bacteria 1701
296 Ga0207687_10002673 3300025927 Bacteria 12065
297 Ga0207687_10426819 3300025927 Bacteria 1095
298 Ga0207687_10806445 3300025927 Bacteria 801
299 Ga0207687_11668601 3300025927 Bacteria 546
300 Ga0207700_10000039 3300025928 Bacteria 102496
301 Ga0207700_10031669 3300025928 Bacteria 3760
302 Ga0207700_10039117 3300025928 Bacteria 3449
303 Ga0207700_10055842 3300025928 Bacteria 2969
304 Ga0207664_10005419 3300025929 Bacteria 8714
305 Ga0207664_10005888 3300025929 Bacteria 8387
306 Ga0207664_10012720 3300025929 Bacteria 6023
307 Ga0207664_10042598 3300025929 Bacteria 3545
308 Ga0207664_10052460 3300025929 Bacteria 3225
309 Ga0207664_10165502 3300025929 Bacteria 1889
310 Ga0207664_10195155 3300025929 Bacteria 1745
311 Ga0207664_10200706 3300025929 Bacteria 1721
312 Ga0207664_10358981 3300025929 Bacteria 1290
313 Ga0207664_10410561 3300025929 Bacteria 1205
314 Ga0207664_10770972 3300025929 Bacteria 865
315 Ga0207664_11311534 3300025929 Bacteria 643
316 Ga0207664_11820136 3300025929 Bacteria 531
317 Ga0207644_11092596 3300025931 Bacteria 670
318 Ga0207690_10137563 3300025932 Bacteria 1795
319 Ga0207690_10214523 3300025932 Bacteria 1469
320 Ga0207690_11304649 3300025932 Bacteria 607
321 Ga0207690_11605830 3300025932 Bacteria 543
322 Ga0207706_10022328 3300025933 Bacteria 5679
323 Ga0207686_10612027 3300025934 Bacteria 858
324 Ga0207709_10127255 3300025935 Bacteria 1730
325 Ga0207665_10000562 3300025939 Bacteria 25011
326 Ga0207665_10098939 3300025939 Bacteria 2033
327 Ga0207665_10215708 3300025939 Bacteria 1404
328 Ga0207665_11144015 3300025939 Bacteria 621
329 Ga0207711_10353822 3300025941 Bacteria 1360
330 Ga0207711_10413675 3300025941 Bacteria 1254
331 Ga0207661_10051353 3300025944 Bacteria 3290
332 Ga0207661_10195790 3300025944 Bacteria 1774
333 Ga0207661_10891694 3300025944 Bacteria 819
334 Ga0207661_11126848 3300025944 Bacteria 722
335 Ga0207679_10150754 3300025945 Bacteria 1892
336 Ga0207679_10253078 3300025945 Bacteria 1498
337 Ga0207679_11673611 3300025945 Unclassified 582
338 Ga0207667_10571403 3300025949 Bacteria 1142
339 Ga0207667_10585123 3300025949 Bacteria 1126
340 Ga0207667_10926996 3300025949 Bacteria 862
341 Ga0207712_10823697 3300025961 Bacteria 817
342 Ga0207712_11722232 3300025961 Bacteria 562
343 Ga0207668_10171576 3300025972 Bacteria 1702
344 Ga0207639_10578495 3300026041 Bacteria 1034
345 Ga0207708_10064612 3300026075 Bacteria 2796
346 Ga0207702_10141358 3300026078 Bacteria 2178
347 Ga0207702_10281837 3300026078 Bacteria 1571
348 Ga0207702_11073481 3300026078 Bacteria 799
349 Ga0207641_10784247 3300026088 Bacteria 942
350 Ga0207676_10500286 3300026095 Bacteria 1154
351 Ga0207683_11391410 3300026121 Bacteria 649
352 Ga0207698_10148731 3300026142 Bacteria 2029
353 Ga0207698_11214937 3300026142 Bacteria 768
354 Ga0207428_10026849 3300027907 Bacteria 4798
355 Ga0265319_1044499 3300028563 Bacteria 1487
356 Ga0265338_10013750 3300028800 Bacteria 9102
357 Ga0265338_10269062 3300028800 Bacteria 1249
358 Ga0265320_10417376 3300031240 Bacteria 592
359 Ga0265340_10150508 3300031247 Bacteria 1061
360 Ga0265327_10378016 3300031251 Bacteria 617
361 Ga0307409_101057621 3300031995 Bacteria 832
362 Ga0373926_0026255 3300035083 Bacteria 2036
363 Ga0373934_0115427 3300035086 Bacteria 1091
364 Ga0373934_0151337 3300035086 Bacteria 950
365 Ga0373953_0287258 3300035117 Bacteria 717
366 Ga0373954_0299716 3300035118 Bacteria 793
367 Ga0373957_0158130 3300035120 Unclassified 933
368 Ga0373943_0001293 3300035170 Bacteria 11237
369 Ga0373955_0589098 3300035172 Bacteria 681
370 Ga0373942_0143196 3300035207 Bacteria 763
371 Ga0373942_0185210 3300035207 Bacteria 684
372 Ga0373961_0193688 3300035241 Bacteria 714
373 Ga0373924_0217957 3300035410 Bacteria 843
374 Ga0373931_0039463 3300035691 Bacteria 2474
375 Ga0373935_0135845 3300035692 Bacteria 1657
376 Ga0373935_0731020 3300035692 Unclassified 729
377 Ga0373927_0014230 3300035695 Bacteria 5274
378 Ga0373933_0414377 3300035724 Bacteria 880
379 Ga0373947_0004518 3300035725 Bacteria 8157
380 Ga0373937_0016365 3300036401 Bacteria 6585
381 Ga0373937_0073117 3300036401 Bacteria 3162
382 Ga0373937_0153734 3300036401 Bacteria 2156
383 Ga0373937_1746589 3300036401 Unclassified 569
384 Ga0373925_0008872 3300037068 Bacteria 7325
385 Ga0395899_0118777 3300037312 Bacteria 1895
386 Ga0395899_0277241 3300037312 Bacteria 1142
387 Ga0395899_0350796 3300037312 Bacteria 987
388 Ga0395899_0411306 3300037312 Bacteria 893
389 Ga0395900_0052091 3300037418 Bacteria 4214
390 Ga0395900_0486521 3300037418 Bacteria 1186
391 Ga0395900_0656083 3300037418 Bacteria 985
392 Ga0395900_0718574 3300037418 Bacteria 931
393 Ga0395900_1442136 3300037418 Bacteria 601
394 Ga0395898_0144505 3300037466 Bacteria 2277
395 Ga0395898_0250624 3300037466 Bacteria 1689
396 Ga0395898_0293322 3300037466 Bacteria 1551
397 Ga0395898_0327817 3300037466 Bacteria 1460
398 Ga0395898_0940102 3300037466 Bacteria 802
399 Ga0395905_0026568 3300037471 Bacteria 5458
400 Ga0395905_0152208 3300037471 Bacteria 2176
401 Ga0395905_0311865 3300037471 Bacteria 1462
402 Ga0395901_0060380 3300038443 Bacteria 3945
403 Ga0395901_0076808 3300038443 Bacteria 3485
404 Ga0395901_0619852 3300038443 Bacteria 1089
405 Ga0395901_0661751 3300038443 Bacteria 1046
406 Ga0395901_0852558 3300038443 Bacteria 896
407 Ga0436360_1070180 3300039438 Unclassified 529
408 Ga0451804_1163253 3300041463 Bacteria 740
409 Ga0451839_1184555 3300041496 Unclassified 676
410 Ga0439440_0090678 3300042993 Bacteria 820
411 Ga0466969_0002408 3300044656 Bacteria 9995
412 Ga0466969_0009754 3300044656 Bacteria 5089
413 Ga0466969_0070464 3300044656 Bacteria 1682
414 Ga0466965_0092389 3300044683 Bacteria 1541
415 Ga0466965_0211414 3300044683 Bacteria 1031
416 Ga0466965_0241202 3300044683 Bacteria 968
417 Ga0466966_0028183 3300044684 Bacteria 3659
418 Ga0466966_0300071 3300044684 Bacteria 965
419 Ga0466966_0800140 3300044684 Bacteria 568
420 Ga0466961_0000819 3300044693 Bacteria 19417
421 Ga0466961_0003296 3300044693 Bacteria 10061
422 Ga0466961_0015491 3300044693 Bacteria 4892
423 Ga0466961_0030502 3300044693 Bacteria 3465
424 Ga0466961_0049913 3300044693 Bacteria 2673
425 Ga0466961_0467256 3300044693 Bacteria 763
426 Ga0466961_0617625 3300044693 Bacteria 651
427 Ga0466963_0000590 3300044694 Bacteria 17295
428 Ga0466963_0001319 3300044694 Bacteria 13206
429 Ga0466963_0003019 3300044694 Bacteria 9521
430 Ga0466963_0004719 3300044694 Bacteria 7957
431 Ga0466963_0005067 3300044694 Bacteria 7699
432 Ga0466963_0005412 3300044694 Bacteria 7476
433 Ga0466963_0005809 3300044694 Bacteria 7260
434 Ga0466963_0015937 3300044694 Bacteria 4666
435 Ga0466963_0024000 3300044694 Bacteria 3879
436 Ga0466963_0036952 3300044694 Bacteria 3187
437 Ga0466963_0051616 3300044694 Bacteria 2726
438 Ga0466963_0066808 3300044694 Bacteria 2412
439 Ga0466963_0125438 3300044694 Bacteria 1769
440 Ga0466963_0131834 3300044694 Bacteria 1727
441 Ga0466963_0348661 3300044694 Bacteria 1042
442 Ga0466963_0509068 3300044694 Bacteria 850
443 Ga0466964_0009732 3300044706 Bacteria 3621
444 Ga0466964_0029973 3300044706 Bacteria 2151
445 Ga0466964_0038677 3300044706 Bacteria 1919
446 Ga0466964_0057120 3300044706 Bacteria 1615
447 Ga0466964_0178001 3300044706 Bacteria 1006
448 Ga0466964_0231836 3300044706 Bacteria 901
449 Ga0466964_0371619 3300044706 Bacteria 740
450 Ga0466964_0372387 3300044706 Bacteria 739
451 Ga0466964_0416237 3300044706 Bacteria 705
452 Ga0466964_0541631 3300044706 Bacteria 631
453 Ga0466971_0000170 3300044719 Bacteria 24398
454 Ga0466971_0000741 3300044719 Bacteria 13061
455 Ga0466971_0017475 3300044719 Bacteria 3174
456 Ga0466971_0037187 3300044719 Bacteria 2182
457 Ga0466971_0077275 3300044719 Bacteria 1515
458 Ga0466971_0078463 3300044719 Bacteria 1504
459 Ga0466971_0093363 3300044719 Bacteria 1379
460 Ga0466971_0162452 3300044719 Bacteria 1046
461 Ga0466968_0000750 3300044735 Bacteria 11237
462 Ga0466968_0010254 3300044735 Bacteria 3629
463 Ga0466968_0018495 3300044735 Bacteria 2795
464 Ga0466968_0067811 3300044735 Bacteria 1548
465 Ga0466968_0077865 3300044735 Bacteria 1452
466 Ga0466968_0091380 3300044735 Bacteria 1349
467 Ga0466968_0415079 3300044735 Bacteria 661
468 Ga0466970_0031167 3300044765 Bacteria 2815
469 Ga0466970_0061998 3300044765 Bacteria 2004
470 Ga0466970_0147511 3300044765 Bacteria 1298
471 Ga0466957_0005810 3300044842 Bacteria 6942
472 Ga0466957_0010943 3300044842 Bacteria 5218
473 Ga0466957_0015689 3300044842 Bacteria 4425
474 Ga0466957_0022184 3300044842 Bacteria 3743
475 Ga0466957_0024594 3300044842 Bacteria 3565
476 Ga0466957_0045057 3300044842 Bacteria 2674
477 Ga0466957_0099236 3300044842 Bacteria 1833
478 Ga0466957_0165181 3300044842 Bacteria 1439
479 Ga0466957_0171504 3300044842 Bacteria 1413
480 Ga0466960_0042993 3300044901 Bacteria 2147
481 Ga0466960_0252129 3300044901 Bacteria 981
482 Ga0466960_0612556 3300044901 Bacteria 647
483 Ga0466959_0001145 3300045049 Bacteria 15999
484 Ga0466959_0001155 3300045049 Bacteria 15894
485 Ga0466959_0016502 3300045049 Bacteria 5396
486 Ga0466959_0019407 3300045049 Bacteria 5000
487 Ga0466959_0077801 3300045049 Bacteria 2393
488 Ga0466958_0002655 3300045836 Bacteria 9038
489 Ga0466958_0007781 3300045836 Bacteria 5914
490 Ga0466958_0011391 3300045836 Bacteria 5008
491 Ga0466958_0018485 3300045836 Bacteria 4045
492 Ga0466958_0024049 3300045836 Bacteria 3582
493 Ga0466958_0052170 3300045836 Bacteria 2478
494 Ga0466958_0057358 3300045836 Bacteria 2366
495 Ga0466958_0065315 3300045836 Bacteria 2221
496 Ga0466958_0076959 3300045836 Bacteria 2048
497 Ga0466958_0207868 3300045836 Bacteria 1246
498 Ga0466958_0292168 3300045836 Bacteria 1045
499 Ga0466958_0345097 3300045836 Bacteria 958
500 Ga0466958_0553382 3300045836 Bacteria 747
501 Ga0466967_0005947 3300045976 Bacteria 8561
502 Ga0466967_0007577 3300045976 Bacteria 7846
503 Ga0466967_0007820 3300045976 Bacteria 7766
504 Ga0466967_0017648 3300045976 Bacteria 5675
505 Ga0466967_0019995 3300045976 Bacteria 5399
506 Ga0466967_0022573 3300045976 Bacteria 5138
507 Ga0466967_0030309 3300045976 Bacteria 4538
508 Ga0466967_0055033 3300045976 Bacteria 3504
509 Ga0466967_0066203 3300045976 Bacteria 3218
510 Ga0466967_0139315 3300045976 Bacteria 2258
511 Ga0466967_0206745 3300045976 Bacteria 1861
512 Ga0466967_0299389 3300045976 Bacteria 1547
513 Ga0466967_0315158 3300045976 Bacteria 1507
514 Ga0466967_0354291 3300045976 Bacteria 1421
515 Ga0466967_0431011 3300045976 Bacteria 1286
516 Ga0466967_0504585 3300045976 Bacteria 1187
517 Ga0466967_0511499 3300045976 Bacteria 1179
518 Ga0466967_0539089 3300045976 Bacteria 1148
519 Ga0466967_0650252 3300045976 Bacteria 1042
520 Ga0466967_1081540 3300045976 Bacteria 799
521 Ga0466967_1399607 3300045976 Bacteria 696
522 Ga0466967_1499800 3300045976 Bacteria 672
523 Ga0466967_1508444 3300045976 Bacteria 669
524 Ga0466967_1850952 3300045976 Bacteria 600
525 Ga0495592_0000198 3300046454 Bacteria 51379
526 Ga0495592_0011866 3300046454 Bacteria 6602
527 Ga0495592_0043169 3300046454 Bacteria 3374
528 Ga0495592_0831752 3300046454 Bacteria 547
529 Ga0495603_0106906 3300046455 Bacteria 1633
530 Ga0495603_0562667 3300046455 Bacteria 653
531 Ga0495629_0026822 3300046459 Bacteria 4091
532 Ga0495629_0460966 3300046459 Bacteria 860
533 Ga0495629_0556107 3300046459 Bacteria 770
534 Ga0495641_0005676 3300046461 Bacteria 8315
535 Ga0495641_0020462 3300046461 Bacteria 3355
536 Ga0495641_0021139 3300046461 Bacteria 3281
537 Ga0495651_0000064 3300046462 Bacteria 78474
538 Ga0495651_0184859 3300046462 Bacteria 1472
539 Ga0495651_0274558 3300046462 Bacteria 1141
540 Ga0495651_0297503 3300046462 Bacteria 1084
541 Ga0495651_0392996 3300046462 Bacteria 907
542 Ga0495653_0006068 3300046463 Bacteria 9900
543 Ga0495653_0008425 3300046463 Bacteria 8457
544 Ga0495653_0061444 3300046463 Bacteria 2843
545 Ga0495653_0078976 3300046463 Bacteria 2439
546 Ga0495653_0176850 3300046463 Bacteria 1468
547 Ga0495582_0003230 3300046473 Bacteria 9155
548 Ga0495582_0037242 3300046473 Bacteria 2676
549 Ga0495582_0072614 3300046473 Bacteria 1904
550 Ga0495582_0110523 3300046473 Bacteria 1544
551 Ga0495582_0283631 3300046473 Bacteria 951
552 Ga0495582_0341394 3300046473 Bacteria 862
553 Ga0495582_0645027 3300046473 Bacteria 613
554 Ga0495639_0000865 3300046475 Bacteria 13721
555 Ga0495639_0489985 3300046475 Bacteria 627
556 Ga0495662_0023948 3300046476 Bacteria 2946
557 Ga0495662_0336113 3300046476 Bacteria 743
558 Ga0495664_0059305 3300046477 Bacteria 2277
559 Ga0495664_0183041 3300046477 Bacteria 1270
560 Ga0495664_0937769 3300046477 Bacteria 505
561 Ga0495585_0342844 3300046492 Bacteria 727
562 Ga0495594_0188830 3300046499 Bacteria 1174
563 Ga0495596_0169800 3300046500 Bacteria 848
564 Ga0495608_0003922 3300046511 Bacteria 10699
565 Ga0495608_0016954 3300046511 Bacteria 5041
566 Ga0495608_0087954 3300046511 Unclassified 2011
567 Ga0495608_0264131 3300046511 Bacteria 1071
568 Ga0495618_0081756 3300046514 Bacteria 2063
569 Ga0495618_0395243 3300046514 Bacteria 846
570 Ga0495618_0463277 3300046514 Bacteria 768
571 Ga0495628_0000069 3300046516 Bacteria 82366
572 Ga0495628_0020750 3300046516 Bacteria 5414
573 Ga0495628_0268316 3300046516 Bacteria 1270
574 Ga0495630_0026623 3300046517 Bacteria 4283
575 Ga0495630_0065332 3300046517 Bacteria 2734
576 Ga0495630_0412040 3300046517 Bacteria 1035
577 Ga0495630_0747509 3300046517 Bacteria 747
578 Ga0495630_0796266 3300046517 Bacteria 722
579 Ga0495644_0415529 3300046523 Bacteria 533
580 Ga0495663_0028750 3300046525 Bacteria 1638
581 Ga0495666_0000935 3300046526 Bacteria 13743
582 Ga0495652_0000356 3300046529 Bacteria 54548
583 Ga0495652_0006105 3300046529 Bacteria 11264
584 Ga0495652_0016953 3300046529 Bacteria 6508
585 Ga0495652_0126713 3300046529 Bacteria 2027
586 Ga0495652_0141181 3300046529 Bacteria 1894
587 Ga0495652_0234556 3300046529 Bacteria 1370
588 Ga0495652_0350183 3300046529 Bacteria 1058
589 Ga0495652_0799592 3300046529 Bacteria 628
590 Ga0495652_1049234 3300046529 Bacteria 531
591 Ga0495652_1138091 3300046529 Bacteria 505
592 Ga0495665_0000569 3300046531 Bacteria 18762
593 Ga0495665_0656059 3300046531 Bacteria 522
594 Ga0495640_0098538 3300046533 Bacteria 1921
595 Ga0495640_0372316 3300046533 Bacteria 879
596 Ga0495586_0187570 3300046535 Bacteria 1171
597 Ga0495586_0289647 3300046535 Bacteria 937
598 Ga0495587_0003524 3300046536 Bacteria 10424
599 Ga0495587_0222887 3300046536 Bacteria 1063
600 Ga0495609_0323313 3300046538 Bacteria 625
601 Ga0495645_0000085 3300046543 Bacteria 64444
602 Ga0495645_0040397 3300046543 Bacteria 3403
603 Ga0495645_0059698 3300046543 Bacteria 2765
604 Ga0495645_0237988 3300046543 Bacteria 1216
605 Ga0495667_0077684 3300046559 Bacteria 2159
606 Ga0495667_0105251 3300046559 Bacteria 1824
607 Ga0495667_0656348 3300046559 Bacteria 651
608 Ga0495656_0706626 3300046615 Bacteria 543
609 Ga0495634_0102840 3300046642 Bacteria 1844
610 Ga0495634_0129715 3300046642 Unclassified 1608
611 Ga0495634_0135841 3300046642 Unclassified 1565
612 Ga0495634_0264458 3300046642 Bacteria 1048
613 Ga0495634_0298419 3300046642 Bacteria 975
614 Ga0495634_0618498 3300046642 Bacteria 627
615 Ga0495635_0088166 3300046663 Bacteria 2123
616 Ga0495635_0339720 3300046663 Bacteria 1003
617 Ga0495635_0580867 3300046663 Bacteria 733
618 Ga0495635_0617381 3300046663 Bacteria 707
619 Ga0495635_0772591 3300046663 Bacteria 620
620 Ga0495635_1083902 3300046663 Unclassified 507
621 Ga0495659_0242144 3300046664 Bacteria 750
622 Ga0495657_0011016 3300046675 Bacteria 6781
623 Ga0495657_0013391 3300046675 Bacteria 6055
624 Ga0495657_0043961 3300046675 Bacteria 3042
625 Ga0495657_0389883 3300046675 Bacteria 821
626 Ga0495657_0704875 3300046675 Bacteria 580
627 Ga0495599_0000716 3300046678 Bacteria 18725
628 Ga0495599_0005564 3300046678 Bacteria 7557
629 Ga0495599_0056515 3300046678 Bacteria 2456
630 Ga0495599_0210363 3300046678 Bacteria 1193
631 Ga0495599_0217191 3300046678 Bacteria 1171
632 Ga0495623_0000030 3300046679 Bacteria 85003
633 Ga0495623_0152356 3300046679 Bacteria 1366
634 Ga0495623_0299034 3300046679 Bacteria 890
635 Ga0495646_0028239 3300046680 Bacteria 3515
636 Ga0495646_0130609 3300046680 Bacteria 1414
637 Ga0495646_0140086 3300046680 Bacteria 1353
638 Ga0495646_0320282 3300046680 Bacteria 817
639 Ga0495647_0010053 3300046681 Bacteria 3217
640 Ga0495647_0055401 3300046681 Bacteria 1552
641 Ga0495658_0012266 3300046683 Bacteria 4334
642 Ga0495658_0336496 3300046683 Bacteria 958
643 Ga0495658_0337066 3300046683 Bacteria 957
644 Ga0495658_0364830 3300046683 Unclassified 919
645 Ga0495613_0012420 3300046689 Bacteria 6327
646 Ga0495613_0149173 3300046689 Bacteria 1668
647 Ga0495613_0167022 3300046689 Bacteria 1563
648 Ga0495613_0212130 3300046689 Bacteria 1361
649 Ga0495613_0386200 3300046689 Bacteria 957
650 Ga0495624_0002753 3300046690 Bacteria 13207
651 Ga0495624_0004809 3300046690 Bacteria 9822
652 Ga0495624_0450836 3300046690 Bacteria 771
653 Ga0495600_0037083 3300046809 Bacteria 3169
654 Ga0495600_0042563 3300046809 Bacteria 2961
655 Ga0495600_0147006 3300046809 Bacteria 1527
656 Ga0495600_0451569 3300046809 Bacteria 795
657 Ga0495600_0928182 3300046809 Bacteria 512
658 Ga0495581_0035436 3300047315 Bacteria 2887
659 Ga0495581_0426533 3300047315 Unclassified 773
660 Ga0495604_0000103 3300047317 Bacteria 71556
661 Ga0495604_0297930 3300047317 Bacteria 1084
662 Ga0495604_0532297 3300047317 Bacteria 759
663 Ga0495636_0409244 3300047318 Bacteria 647
664 Ga0495674_0045217 3300047319 Bacteria 3909
665 Ga0495674_0051543 3300047319 Bacteria 3628
666 Ga0495674_0438607 3300047319 Bacteria 1050
667 Ga0495674_0472270 3300047319 Bacteria 1006
668 Ga0495674_0525063 3300047319 Bacteria 945
669 Ga0495674_1457523 3300047319 Unclassified 508
670 Ga0495676_0005516 3300047321 Bacteria 11599
671 Ga0495676_0054466 3300047321 Bacteria 3180
672 Ga0495676_0399301 3300047321 Bacteria 912
673 Ga0495680_0010394 3300047322 Bacteria 8306
674 Ga0495680_0020217 3300047322 Bacteria 5608
675 Ga0495680_0096752 3300047322 Unclassified 2204
676 Ga0495680_0141195 3300047322 Bacteria 1762
677 Ga0495680_0261093 3300047322 Bacteria 1225
678 Ga0495680_0740958 3300047322 Bacteria 646
679 Ga0495675_0000282 3300047444 Bacteria 36859
680 Ga0495675_0228784 3300047444 Unclassified 1123
681 Ga0495675_0335860 3300047444 Bacteria 891
682 Ga0495684_0028380 3300047471 Bacteria 4297
683 Ga0495684_0088850 3300047471 Bacteria 2341
684 Ga0495684_0236516 3300047471 Bacteria 1334
685 Ga0495684_0315062 3300047471 Bacteria 1120
686 Ga0495684_1068093 3300047471 Bacteria 508
687 Ga0495593_0000807 3300047673 Bacteria 18118
688 Ga0495602_0000080 3300048088 Bacteria 94171
689 Ga0495602_0050967 3300048088 Bacteria 3692
690 Ga0495602_0238376 3300048088 Bacteria 1362
691 Ga0495602_0332925 3300048088 Unclassified 1101
692 Ga0495602_0739391 3300048088 Bacteria 665
693 Ga0495614_0000642 3300048089 Bacteria 14613
694 Ga0496100_0007377 3300048903 Bacteria 6063
695 Ga0496100_0014562 3300048903 Bacteria 4569
696 Ga0496100_0240399 3300048903 Bacteria 1336
697 Ga0496100_0869163 3300048903 Bacteria 708
698 Ga0496100_1273207 3300048903 Unclassified 580
699 Ga0496101_0002103 3300048904 Bacteria 12138
700 Ga0496101_0147545 3300048904 Bacteria 1797
701 Ga0496101_0189027 3300048904 Bacteria 1589
702 Ga0496101_0419822 3300048904 Bacteria 1054
703 Ga0496101_0602494 3300048904 Bacteria 868
704 Ga0496101_1148667 3300048904 Bacteria 609
705 Ga0496101_1193910 3300048904 Bacteria 596
706 Ga0496102_0013820 3300048905 Bacteria 7006
707 Ga0496102_0072684 3300048905 Bacteria 3161
708 Ga0496102_1063559 3300048905 Bacteria 729
709 Ga0496103_0168547 3300048906 Bacteria 1406
710 Ga0496103_0655086 3300048906 Unclassified 667
711 Ga0496104_0009909 3300048907 Bacteria 8507
712 Ga0496104_0044880 3300048907 Bacteria 4154
713 Ga0496104_0048847 3300048907 Bacteria 3990
714 Ga0496104_0064181 3300048907 Bacteria 3484
715 Ga0496104_0119395 3300048907 Bacteria 2531
716 Ga0496104_0127021 3300048907 Bacteria 2449
717 Ga0496104_0758284 3300048907 Bacteria 877
718 Ga0496104_1341198 3300048907 Bacteria 618
719 Ga0496105_0011626 3300048908 Bacteria 6964
720 Ga0496105_0013058 3300048908 Bacteria 6583
721 Ga0496105_0065979 3300048908 Bacteria 2987
722 Ga0496105_0152098 3300048908 Bacteria 1902
723 Ga0496105_0330004 3300048908 Bacteria 1221
724 Ga0496105_0693303 3300048908 Bacteria 782
725 Ga0496106_0011132 3300048909 Bacteria 6653
726 Ga0496106_0640458 3300048909 Bacteria 850
727 Ga0496106_1304809 3300048909 Unclassified 563
728 Ga0496107_0133618 3300048910 Bacteria 1833
729 Ga0496107_0170221 3300048910 Bacteria 1616
730 Ga0496107_0592427 3300048910 Bacteria 820
731 Ga0496107_0686372 3300048910 Bacteria 754
732 Ga0496107_0885026 3300048910 Unclassified 651
733 Ga0496107_0971834 3300048910 Bacteria 617
734 Ga0496108_0022798 3300048911 Bacteria 5151
735 Ga0496108_0068223 3300048911 Bacteria 3000
736 Ga0496108_0070458 3300048911 Bacteria 2950
737 Ga0496108_0240292 3300048911 Bacteria 1575
738 Ga0496109_0018098 3300048912 Bacteria 6187
739 Ga0496109_0032643 3300048912 Bacteria 4681
740 Ga0496109_0077215 3300048912 Bacteria 3064
741 Ga0496110_0015617 3300048913 Bacteria 6324
742 Ga0496110_0027540 3300048913 Bacteria 4873
743 Ga0496110_0063764 3300048913 Bacteria 3256
744 Ga0496110_0209955 3300048913 Bacteria 1770
745 Ga0496110_1109425 3300048913 Bacteria 699
746 Ga0496111_0051238 3300048914 Bacteria 2980
747 Ga0496111_0098022 3300048914 Bacteria 2152
748 Ga0496111_0101276 3300048914 Bacteria 2116
749 Ga0496111_0576730 3300048914 Bacteria 825
750 Ga0496111_0711185 3300048914 Bacteria 730
751 Ga0496112_0001848 3300048915 Bacteria 16642
752 Ga0496112_0036826 3300048915 Bacteria 4773
753 Ga0496112_0094398 3300048915 Bacteria 2962
754 Ga0496112_0172870 3300048915 Bacteria 2125
755 Ga0496112_0338230 3300048915 Bacteria 1449
756 Ga0496112_0529835 3300048915 Bacteria 1112
757 Ga0496112_1220975 3300048915 Bacteria 668
758 Ga0496112_1873200 3300048915 Bacteria 511
759 Ga0496113_0102368 3300048916 Bacteria 2220
760 Ga0496113_0110515 3300048916 Bacteria 2139
761 Ga0496113_0112489 3300048916 Bacteria 2121
762 Ga0496113_0287134 3300048916 Bacteria 1316
763 Ga0496113_0760299 3300048916 Bacteria 771
764 Ga0496114_0004422 3300048917 Bacteria 10907
765 Ga0496114_0079244 3300048917 Bacteria 2772
766 Ga0496114_0181882 3300048917 Bacteria 1836
767 Ga0496114_0409711 3300048917 Bacteria 1200
768 Ga0496114_0501558 3300048917 Bacteria 1074
769 Ga0496114_0503776 3300048917 Bacteria 1071
770 Ga0496114_0556920 3300048917 Bacteria 1013
771 Ga0496115_0012415 3300048918 Bacteria 6410
772 Ga0496115_0038699 3300048918 Bacteria 3785
773 Ga0496115_0174335 3300048918 Bacteria 1778
774 Ga0496115_0839361 3300048918 Bacteria 712
775 Ga0496115_0872471 3300048918 Unclassified 695
776 Ga0501032_0041040 3300049569 Unclassified 3144
777 Ga0501032_0287616 3300049569 Bacteria 1064
778 Ga0501033_1108793 3300049570 Bacteria 526
779 Ga0501034_1556560 3300049571 Bacteria 534
780 Ga0501036_0147697 3300049572 Bacteria 1983
781 Ga0501036_0172526 3300049572 Bacteria 1822
782 Ga0501037_0020619 3300049573 Bacteria 4866
783 Ga0501038_0005915 3300049574 Bacteria 11308
784 Ga0501039_0048024 3300049575 Bacteria 3299
785 Ga0501039_0139907 3300049575 Bacteria 1901
786 Ga0501039_0223959 3300049575 Bacteria 1478
787 Ga0501040_0027966 3300049576 Bacteria 3799
788 Ga0501040_0151602 3300049576 Bacteria 1635
789 Ga0501040_0939912 3300049576 Bacteria 626
790 Ga0501041_0040823 3300049577 Bacteria 2818
791 Ga0501041_0076368 3300049577 Bacteria 2061
792 Ga0501041_0376191 3300049577 Bacteria 898
793 Ga0501041_0691491 3300049577 Bacteria 652
794 Ga0501042_0116784 3300049578 Bacteria 1921
795 Ga0501042_0192183 3300049578 Bacteria 1472
796 Ga0501043_0096192 3300049579 Bacteria 2327
797 Ga0501043_0363087 3300049579 Bacteria 1099
798 Ga0501043_0973759 3300049579 Bacteria 605
799 Ga0501046_0032235 3300049580 Bacteria 4243
800 Ga0501046_0558371 3300049580 Bacteria 815
801 Ga0501046_0677640 3300049580 Bacteria 728
802 Ga0501047_0052962 3300049581 Bacteria 3923
803 Ga0501048_0018588 3300049582 Bacteria 5109
804 Ga0501048_0146736 3300049582 Bacteria 1668
805 Ga0501048_0497021 3300049582 Bacteria 874
806 Ga0501067_0027298 3300049583 Bacteria 3163
807 Ga0501067_0258899 3300049583 Unclassified 969
808 Ga0501067_0850095 3300049583 Bacteria 514
809 Ga0501068_0025740 3300049584 Bacteria 3462
810 Ga0501068_0237721 3300049584 Bacteria 1159
811 Ga0501068_0512500 3300049584 Bacteria 778
812 Ga0501068_0686776 3300049584 Bacteria 669
813 Ga0501069_0004410 3300049585 Bacteria 7266
814 Ga0501069_0007201 3300049585 Bacteria 5831
815 Ga0501069_0028911 3300049585 Bacteria 3041
816 Ga0501069_0084754 3300049585 Unclassified 1788
817 Ga0501069_0349361 3300049585 Bacteria 871
818 Ga0501070_0052967 3300049586 Unclassified 3367
819 Ga0501070_0094716 3300049586 Bacteria 2471
820 Ga0501070_0741972 3300049586 Bacteria 774
821 Ga0501071_0000255 3300049587 Bacteria 24900
822 Ga0501071_0103180 3300049587 Bacteria 2103
823 Ga0501071_0474439 3300049587 Bacteria 958
824 Ga0501072_0004415 3300049588 Bacteria 10685
825 Ga0501072_0055862 3300049588 Bacteria 3111
826 Ga0501072_0324001 3300049588 Bacteria 1224
827 Ga0501073_0038144 3300049589 Bacteria 3410
828 Ga0501073_0465028 3300049589 Bacteria 874
829 Ga0501074_0016778 3300049590 Bacteria 5314
830 Ga0501074_0108216 3300049590 Bacteria 1989
831 Ga0501074_0111407 3300049590 Bacteria 1958
832 Ga0501075_0040548 3300049591 Bacteria 3487
833 Ga0501075_0120633 3300049591 Bacteria 1995
834 Ga0501075_0504120 3300049591 Bacteria 923
835 Ga0501076_0036235 3300049592 Bacteria 3864
836 Ga0501076_0123664 3300049592 Bacteria 2095
837 Ga0501076_0171107 3300049592 Unclassified 1770
838 Ga0501077_0012818 3300049593 Bacteria 5254
839 Ga0501077_0018228 3300049593 Bacteria 4441
840 Ga0501077_0041068 3300049593 Bacteria 2945
841 Ga0501077_0861851 3300049593 Bacteria 582
842 Ga0501079_0013247 3300049741 Bacteria 6287
843 Ga0501079_0325558 3300049741 Bacteria 1203
844 Ga0501080_0039769 3300049742 Bacteria 4388
845 Ga0501080_0053707 3300049742 Bacteria 3752
846 Ga0501080_0053907 3300049742 Bacteria 3745
847 Ga0501081_0019102 3300049743 Bacteria 4558
848 Ga0501081_0179394 3300049743 Bacteria 1531
849 Ga0501081_0672760 3300049743 Bacteria 776
850 Ga0501083_0022810 3300049744 Bacteria 4342
851 Ga0501083_0097494 3300049744 Bacteria 1940
852 Ga0501035_0236155 3300049822 Bacteria 1557
853 Ga0501035_0443933 3300049822 Bacteria 1074
854 Ga0501044_0589941 3300049823 Bacteria 1005
855 Ga0501044_0715477 3300049823 Bacteria 886
856 Ga0501045_0033228 3300049824 Bacteria 3740
857 Ga0501045_0182542 3300049824 Unclassified 1563
858 Ga0501045_0281045 3300049824 Bacteria 1239
859 Ga0501045_0599692 3300049824 Bacteria 815
860 nmdc:mga03683_613972_c1 3300050489 Bacteria 533
861 nmdc:mga05p37_27961_c1 3300050507 Bacteria 2241
862 nmdc:mga05p37_311677_c1 3300050507 Bacteria 1865
863 nmdc:mga08y16_612892_c1 3300050511 Bacteria 1096
864 nmdc:mga08y16_70993_c1 3300050511 Bacteria 3630
865 nmdc:mga0n895_36635_c1 3300050512 Bacteria 4738
866 nmdc:mga0rr50_271854_c1 3300050513 Bacteria 1412
867 nmdc:mga0a205_262270_c1 3300050515 Bacteria 1605
868 nmdc:mga0a205_576977_c1 3300050515 Bacteria 979
869 nmdc:mga0a205_760324_c1 3300050515 Bacteria 817
870 nmdc:mga0a205_808339_c1 3300050515 Bacteria 785
871 Ga0495601_0000163 3300053077 Bacteria 36562
872 Ga0495601_0015952 3300053077 Bacteria 4546
873 Ga0495601_0031573 3300053077 Bacteria 3292
874 Ga0495601_0213512 3300053077 Bacteria 1260
875 Ga0495601_0464869 3300053077 Bacteria 818
876 Ga0495601_0797739 3300053077 Bacteria 599
877 Ga0495601_1085239 3300053077 Bacteria 501
878 Ga0495612_0120804 3300053078 Bacteria 1127
879 Ga0495595_0006135 3300053084 Bacteria 4886
880 Ga0495595_0035071 3300053084 Bacteria 2272
881 Ga0495595_0052842 3300053084 Bacteria 1886
882 Ga0495595_0135861 3300053084 Bacteria 1204
883 Ga0495595_0234899 3300053084 Bacteria 916
884 Ga0495619_0000493 3300053085 Bacteria 26439
885 Ga0495619_0079060 3300053085 Bacteria 2212
886 Ga0495619_0096967 3300053085 Bacteria 2003
887 Ga0495619_0108391 3300053085 Bacteria 1896
888 Ga0495619_0177257 3300053085 Bacteria 1474
889 Ga0495619_0345180 3300053085 Bacteria 1030
890 Ga0495619_0427392 3300053085 Bacteria 914
891 Ga0495619_0461135 3300053085 Bacteria 875
892 Ga0500566_0198571 3300053094 Bacteria 1015
893 Ga0501084_0000979 3300054114 Bacteria 22169
894 Ga0501084_0022006 3300054114 Bacteria 5318
895 Ga0501084_0147038 3300054114 Bacteria 1985
896 Ga0501084_0186127 3300054114 Bacteria 1752
897 Ga0501082_0010371 3300060353 Bacteria 8024
898 Ga0501082_0352523 3300060353 Bacteria 1283
899 Ga0501082_0546992 3300060353 Bacteria 1012
900 Ga0466962_0001338 3300061719 Bacteria 11387
901 Ga0466962_0008088 3300061719 Bacteria 5042
902 Ga0466962_0021355 3300061719 Bacteria 3109
903 Ga0466962_0041156 3300061719 Bacteria 2211
904 Ga0466962_0046818 3300061719 Bacteria 2066
905 Ga0466962_0064202 3300061719 Bacteria 1753
906 Ga0466962_0299755 3300061719 Bacteria 795
907 Ga0530510_0028568 3300061734 Bacteria 4000
908 Ga0530510_0473528 3300061734 Bacteria 948
909 Ga0530510_0477071 3300061734 Bacteria 944
910 Ga0495592_0380051
911 Ga0070658_10044395
912 Ga0070658_10122757
913 Ga0070658_10515143
914 Ga0070658_10528988
915 Ga0070676_10147072
916 Ga0070683_100175213
917 Ga0070683_100632167
918 Ga0070683_101320943
919 Ga0070683_101406161
920 Ga0070690_100772180
921 Ga0070670_100331849
922 Ga0070680_100017427
923 Ga0070680_100100954
924 Ga0070680_100141281
925 Ga0070682_100193090
926 Ga0070682_100428020
927 Ga0070660_101114452
928 Ga0070660_101514059
929 Ga0070691_10003297
930 Ga0070691_10106161
931 Ga0070661_100273140
932 Ga0070661_100288695
933 Ga0070661_100748239
934 Ga0070668_100636256
935 Ga0070675_100410503
936 Ga0070675_100981198
937 Ga0070671_101191739
938 Ga0070673_101254533
939 Ga0070659_100035344
940 Ga0070659_100377317
941 Ga0070709_10013994
942 Ga0070709_10059358
943 Ga0070709_10079845
944 Ga0070709_10298990
945 Ga0070709_10616801
946 Ga0070714_100006571
947 Ga0070714_100018726
948 Ga0070714_100021410
949 Ga0070714_100024680
950 Ga0070714_100089592
951 Ga0070714_100168279
952 Ga0070714_100217596
953 Ga0070714_100635790
954 Ga0070714_100903528
955 Ga0070714_101933995
956 Ga0070714_102372707
957 Ga0070713_100000665
958 Ga0070713_100003272
959 Ga0070713_100088784
960 Ga0070713_100317293
961 Ga0070713_101252079
962 Ga0070713_101457887
963 Ga0070713_101838984
964 Ga0070710_10005614
965 Ga0070710_10017125
966 Ga0070710_11103591
967 Ga0070711_100003012
968 Ga0070711_100157689
969 Ga0070711_100165876
970 Ga0070711_100517865
971 Ga0070711_100752871
972 Ga0070711_100752873
973 Ga0070700_100035388
974 Ga0070694_100827684
975 Ga0070694_101218275
976 Ga0070708_101492004
977 Ga0070678_101477111
978 Ga0070662_100145972
979 Ga0070681_10159545
980 Ga0070681_10172802
981 Ga0070681_10247448
982 Ga0070681_10409027
983 Ga0070681_10527471
984 Ga0070681_10758832
985 Ga0070681_11241019
986 Ga0070706_100309744
987 Ga0070707_100001128
988 Ga0070707_100236323
989 Ga0070707_100292878
990 Ga0070698_100218758
991 Ga0070699_100147402
992 Ga0070699_100421020
993 Ga0070699_101757010
994 Ga0070699_101877367
995 Ga0070679_100027058
996 Ga0070679_100056618
997 Ga0070679_100093701
998 Ga0070679_100304361
999 Ga0070679_100454624
1000 Ga0070679_100979094
1001 Ga0070679_100983132
1002 Ga0070684_100039997
1003 Ga0070684_100080081
1004 Ga0070684_100091374
1005 Ga0070684_100155070
1006 Ga0070697_100075331
1007 Ga0070697_100291644
1008 Ga0068853_101017515
1009 Ga0070686_100186324
1010 Ga0070695_100336921
1011 Ga0070696_100409068
1012 Ga0070696_101135120
1013 Ga0070696_101229899
1014 Ga0070693_100034992
1015 Ga0070693_100624307
1016 Ga0068855_100435518
1017 Ga0068855_100512356
1018 Ga0068855_102185358
1019 Ga0070664_100335279
1020 Ga0070664_101041477
1021 Ga0068857_101706091
1022 Ga0068854_100143605
1023 Ga0068854_102144527
1024 Ga0068856_100032269
1025 Ga0068856_100178555
1026 Ga0068856_101033386
1027 Ga0068856_101166972
1028 Ga0070702_100181288
1029 Ga0070702_100247249
1030 Ga0068852_100432879
1031 Ga0068864_100554753
1032 Ga0068861_100028909
1033 Ga0068861_101526338
1034 Ga0068851_11012902
1035 Ga0068870_10525230
1036 Ga0068870_10968959
1037 Ga0068863_100253539
1038 Ga0068863_100850875
1039 Ga0068862_100231587
1040 Ga0081455_10080411
1041 Ga0081455_10253218
1042 Ga0070717_10004499
1043 Ga0070717_10006185
1044 Ga0070717_10007203
1045 Ga0070717_10048414
1046 Ga0070717_10071076
1047 Ga0070717_10327682
1048 Ga0070717_10573047
1049 Ga0070717_10672763
1050 Ga0070717_10933892
1051 Ga0070717_10982947
1052 Ga0075365_10440972
1053 Ga0075363_100571199
1054 Ga0075432_10000679
1055 Ga0070715_10000827
1056 Ga0070716_100000663
1057 Ga0070716_100016673
1058 Ga0070716_100153010
1059 Ga0070716_101159383
1060 Ga0070712_100518931
1061 Ga0070712_100843397
1062 Ga0070712_101503096
1063 Ga0070712_101652676
1064 Ga0075362_10689156
1065 Ga0097621_101303333
1066 Ga0068871_100103360
1067 Ga0075428_100123242
1068 Ga0075428_100393181
1069 Ga0075431_100188959
1070 Ga0075433_10047201
1071 Ga0075433_10510479
1072 Ga0075433_10638010
1073 Ga0075434_100015565
1074 Ga0075434_100072472
1075 Ga0075434_101163200
1076 Ga0075429_100038332
1077 Ga0068865_101164905
1078 Ga0075436_101139093
1079 Ga0105251_10467878
1080 Ga0105240_10141561
1081 Ga0105240_10316562
1082 Ga0105240_10338374
1083 Ga0105240_10611884
1084 Ga0105240_11432469
1085 Ga0111539_10165764
1086 Ga0111539_10262132
1087 Ga0105245_10004034
1088 Ga0105245_10515291
1089 Ga0105245_11197322
1090 Ga0105245_12777298
1091 Ga0105247_10036142
1092 Ga0114129_10063673
1093 Ga0114129_10648011
1094 Ga0105243_10025030
1095 Ga0105241_11432051
1096 Ga0105242_10687791
1097 Ga0105248_10103121
1098 Ga0105248_11503081
1099 Ga0105237_10232057
1100 Ga0105237_10309328
1101 Ga0105237_11742852
1102 Ga0105238_10857318
1103 Ga0105249_10511302
1104 Ga0099796_10590025
1105 Ga0105239_10034836
1106 Ga0105239_10474213
1107 Ga0105246_10556353
1108 Ga0157373_10034934
1109 Ga0157373_10259228
1110 Ga0157373_10652694
1111 Ga0157373_11251760
1112 Ga0157371_10954246
1113 Ga0157370_10142668
1114 Ga0157370_10510318
1115 Ga0157370_10543607
1116 Ga0157369_10003691
1117 Ga0157369_10110278
1118 Ga0157369_10192968
1119 Ga0157369_10299755
1120 Ga0157369_11877808
1121 Ga0157369_12658762
1122 Ga0157374_10006679
1123 Ga0157374_10367072
1124 Ga0157374_10473095
1125 Ga0163162_10269355
1126 Ga0163162_10601374
1127 Ga0157372_10479504
1128 Ga0157372_10886001
1129 Ga0157372_11075517
1130 Ga0157372_11737139
1131 Ga0157375_10356336
1132 Ga0182008_10546385
1133 Ga0157377_10022167
1134 Ga0157379_10575949
1135 Ga0157379_10649141
1136 Ga0157376_10040289
1137 Ga0157376_11040707
1138 Ga0157376_11211765
1139 Ga0182006_1238395
1140 Ga0206356_10507006
1141 Ga0206356_10820228
1142 Ga0206352_10411163
1143 Ga0206354_10452674
1144 Ga0206354_10625982
1145 Ga0206353_10335697
1146 Ga0206353_10669165
1147 Ga0206353_11395614
1148 Ga0206353_11950027
1149 Ga0207692_10016300
1150 Ga0207710_10300252
1151 Ga0207688_10010611
1152 Ga0207685_10014224
1153 Ga0207685_10092708
1154 Ga0207699_10016756
1155 Ga0207699_10016833
1156 Ga0207699_10023034
1157 Ga0207699_10042106
1158 Ga0207699_10133514
1159 Ga0207699_10862541
1160 Ga0207645_10427267
1161 Ga0207643_10017811
1162 Ga0207705_10579597
1163 Ga0207705_10819387
1164 Ga0207684_10102190
1165 Ga0207684_10579532
1166 Ga0207654_11187282
1167 Ga0207707_10033045
1168 Ga0207707_10341224
1169 Ga0207707_10389194
1170 Ga0207707_10481572
1171 Ga0207707_10606472
1172 Ga0207707_11497584
1173 Ga0207695_10686866
1174 Ga0207695_10920486
1175 Ga0207695_11330436
1176 Ga0207671_10629333
1177 Ga0207693_10002222
1178 Ga0207693_10014582
1179 Ga0207693_10124112
1180 Ga0207693_10238612
1181 Ga0207693_10956475
1182 Ga0207663_10012957
1183 Ga0207663_10049683
1184 Ga0207663_10163046
1185 Ga0207663_11511964
1186 Ga0207660_10367144
1187 Ga0207660_10487603
1188 Ga0207657_10002895
1189 Ga0207649_10302439
1190 Ga0207649_10450156
1191 Ga0207649_10571844
1192 Ga0207649_10640482
1193 Ga0207649_10827551
1194 Ga0207652_10097627
1195 Ga0207652_10185900
1196 Ga0207652_10214505
1197 Ga0207652_10288949
1198 Ga0207652_11023483
1199 Ga0207652_11532898
1200 Ga0207646_10004762
1201 Ga0207646_10225185
1202 Ga0207646_10520686
1203 Ga0207646_10724533
1204 Ga0207694_10182801
1205 Ga0207687_10002673
1206 Ga0207687_10426819
1207 Ga0207687_10806445
1208 Ga0207687_11668601
1209 Ga0207700_10000039
1210 Ga0207700_10031669
1211 Ga0207700_10039117
1212 Ga0207700_10055842
1213 Ga0207664_10005419
1214 Ga0207664_10005888
1215 Ga0207664_10012720
1216 Ga0207664_10042598
1217 Ga0207664_10052460
1218 Ga0207664_10165502
1219 Ga0207664_10195155
1220 Ga0207664_10200706
1221 Ga0207664_10358981
1222 Ga0207664_10410561
1223 Ga0207664_10770972
1224 Ga0207664_11311534
1225 Ga0207664_11820136
1226 Ga0207644_11092596
1227 Ga0207690_10137563
1228 Ga0207690_10214523
1229 Ga0207690_11304649
1230 Ga0207690_11605830
1231 Ga0207706_10022328
1232 Ga0207686_10612027
1233 Ga0207709_10127255
1234 Ga0207665_10000562
1235 Ga0207665_10098939
1236 Ga0207665_10215708
1237 Ga0207665_11144015
1238 Ga0207711_10353822
1239 Ga0207711_10413675
1240 Ga0207661_10051353
1241 Ga0207661_10195790
1242 Ga0207661_10891694
1243 Ga0207661_11126848
1244 Ga0207679_10150754
1245 Ga0207679_10253078
1246 Ga0207679_11673611
1247 Ga0207667_10571403
1248 Ga0207667_10585123
1249 Ga0207667_10926996
1250 Ga0207712_10823697
1251 Ga0207712_11722232
1252 Ga0207668_10171576
1253 Ga0207639_10578495
1254 Ga0207708_10064612
1255 Ga0207702_10141358
1256 Ga0207702_10281837
1257 Ga0207702_11073481
1258 Ga0207641_10784247
1259 Ga0207676_10500286
1260 Ga0207683_11391410
1261 Ga0207698_10148731
1262 Ga0207698_11214937
1263 Ga0207428_10026849
1264 Ga0265319_1044499
1265 Ga0265338_10013750
1266 Ga0265338_10269062
1267 Ga0265320_10417376
1268 Ga0265340_10150508
1269 Ga0265327_10378016
1270 Ga0307409_101057621
1271 Ga0373926_0026255
1272 Ga0373934_0115427
1273 Ga0373934_0151337
1274 Ga0373953_0287258
1275 Ga0373954_0299716
1276 Ga0373957_0158130
1277 Ga0373943_0001293
1278 Ga0373955_0589098
1279 Ga0373942_0143196
1280 Ga0373942_0185210
1281 Ga0373961_0193688
1282 Ga0373924_0217957
1283 Ga0373931_0039463
1284 Ga0373935_0135845
1285 Ga0373935_0731020
1286 Ga0373927_0014230
1287 Ga0373933_0414377
1288 Ga0373947_0004518
1289 Ga0373937_0016365
1290 Ga0373937_0073117
1291 Ga0373937_0153734
1292 Ga0373937_1746589
1293 Ga0373925_0008872
1294 Ga0395899_0118777
1295 Ga0395899_0277241
1296 Ga0395899_0350796
1297 Ga0395899_0411306
1298 Ga0395900_0052091
1299 Ga0395900_0486521
1300 Ga0395900_0656083
1301 Ga0395900_0718574
1302 Ga0395900_1442136
1303 Ga0395898_0144505
1304 Ga0395898_0250624
1305 Ga0395898_0293322
1306 Ga0395898_0327817
1307 Ga0395898_0940102
1308 Ga0395905_0026568
1309 Ga0395905_0152208
1310 Ga0395905_0311865
1311 Ga0395901_0060380
1312 Ga0395901_0076808
1313 Ga0395901_0619852
1314 Ga0395901_0661751
1315 Ga0395901_0852558
1316 Ga0436360_1070180
1317 Ga0451804_1163253
1318 Ga0451839_1184555
1319 Ga0439440_0090678
1320 Ga0466969_0002408
1321 Ga0466969_0009754
1322 Ga0466969_0070464
1323 Ga0466965_0092389
1324 Ga0466965_0211414
1325 Ga0466965_0241202
1326 Ga0466966_0028183
1327 Ga0466966_0300071
1328 Ga0466966_0800140
1329 Ga0466961_0000819
1330 Ga0466961_0003296
1331 Ga0466961_0015491
1332 Ga0466961_0030502
1333 Ga0466961_0049913
1334 Ga0466961_0467256
1335 Ga0466961_0617625
1336 Ga0466963_0000590
1337 Ga0466963_0001319
1338 Ga0466963_0003019
1339 Ga0466963_0004719
1340 Ga0466963_0005067
1341 Ga0466963_0005412
1342 Ga0466963_0005809
1343 Ga0466963_0015937
1344 Ga0466963_0024000
1345 Ga0466963_0036952
1346 Ga0466963_0051616
1347 Ga0466963_0066808
1348 Ga0466963_0125438
1349 Ga0466963_0131834
1350 Ga0466963_0348661
1351 Ga0466963_0509068
1352 Ga0466964_0009732
1353 Ga0466964_0029973
1354 Ga0466964_0038677
1355 Ga0466964_0057120
1356 Ga0466964_0178001
1357 Ga0466964_0231836
1358 Ga0466964_0371619
1359 Ga0466964_0372387
1360 Ga0466964_0416237
1361 Ga0466964_0541631
1362 Ga0466971_0000170
1363 Ga0466971_0000741
1364 Ga0466971_0017475
1365 Ga0466971_0037187
1366 Ga0466971_0077275
1367 Ga0466971_0078463
1368 Ga0466971_0093363
1369 Ga0466971_0162452
1370 Ga0466968_0000750
1371 Ga0466968_0010254
1372 Ga0466968_0018495
1373 Ga0466968_0067811
1374 Ga0466968_0077865
1375 Ga0466968_0091380
1376 Ga0466968_0415079
1377 Ga0466970_0031167
1378 Ga0466970_0061998
1379 Ga0466970_0147511
1380 Ga0466957_0005810
1381 Ga0466957_0010943
1382 Ga0466957_0015689
1383 Ga0466957_0022184
1384 Ga0466957_0024594
1385 Ga0466957_0045057
1386 Ga0466957_0099236
1387 Ga0466957_0165181
1388 Ga0466957_0171504
1389 Ga0466960_0042993
1390 Ga0466960_0252129
1391 Ga0466960_0612556
1392 Ga0466959_0001145
1393 Ga0466959_0001155
1394 Ga0466959_0016502
1395 Ga0466959_0019407
1396 Ga0466959_0077801
1397 Ga0466958_0002655
1398 Ga0466958_0007781
1399 Ga0466958_0011391
1400 Ga0466958_0018485
1401 Ga0466958_0024049
1402 Ga0466958_0052170
1403 Ga0466958_0057358
1404 Ga0466958_0065315
1405 Ga0466958_0076959
1406 Ga0466958_0207868
1407 Ga0466958_0292168
1408 Ga0466958_0345097
1409 Ga0466958_0553382
1410 Ga0466967_0005947
1411 Ga0466967_0007577
1412 Ga0466967_0007820
1413 Ga0466967_0017648
1414 Ga0466967_0019995
1415 Ga0466967_0022573
1416 Ga0466967_0030309
1417 Ga0466967_0055033
1418 Ga0466967_0066203
1419 Ga0466967_0139315
1420 Ga0466967_0206745
1421 Ga0466967_0299389
1422 Ga0466967_0315158
1423 Ga0466967_0354291
1424 Ga0466967_0431011
1425 Ga0466967_0504585
1426 Ga0466967_0511499
1427 Ga0466967_0539089
1428 Ga0466967_0650252
1429 Ga0466967_1081540
1430 Ga0466967_1399607
1431 Ga0466967_1499800
1432 Ga0466967_1508444
1433 Ga0466967_1850952
1434 Ga0495592_0000198
1435 Ga0495592_0011866
1436 Ga0495592_0043169
1437 Ga0495592_0831752
1438 Ga0495603_0106906
1439 Ga0495603_0562667
1440 Ga0495629_0026822
1441 Ga0495629_0460966
1442 Ga0495629_0556107
1443 Ga0495641_0005676
1444 Ga0495641_0020462
1445 Ga0495641_0021139
1446 Ga0495651_0000064
1447 Ga0495651_0184859
1448 Ga0495651_0274558
1449 Ga0495651_0297503
1450 Ga0495651_0392996
1451 Ga0495653_0006068
1452 Ga0495653_0008425
1453 Ga0495653_0061444
1454 Ga0495653_0078976
1455 Ga0495653_0176850
1456 Ga0495582_0003230
1457 Ga0495582_0037242
1458 Ga0495582_0072614
1459 Ga0495582_0110523
1460 Ga0495582_0283631
1461 Ga0495582_0341394
1462 Ga0495582_0645027
1463 Ga0495639_0000865
1464 Ga0495639_0489985
1465 Ga0495662_0023948
1466 Ga0495662_0336113
1467 Ga0495664_0059305
1468 Ga0495664_0183041
1469 Ga0495664_0937769
1470 Ga0495585_0342844
1471 Ga0495594_0188830
1472 Ga0495596_0169800
1473 Ga0495608_0003922
1474 Ga0495608_0016954
1475 Ga0495608_0087954
1476 Ga0495608_0264131
1477 Ga0495618_0081756
1478 Ga0495618_0395243
1479 Ga0495618_0463277
1480 Ga0495628_0000069
1481 Ga0495628_0020750
1482 Ga0495628_0268316
1483 Ga0495630_0026623
1484 Ga0495630_0065332
1485 Ga0495630_0412040
1486 Ga0495630_0747509
1487 Ga0495630_0796266
1488 Ga0495644_0415529
1489 Ga0495663_0028750
1490 Ga0495666_0000935
1491 Ga0495652_0000356
1492 Ga0495652_0006105
1493 Ga0495652_0016953
1494 Ga0495652_0126713
1495 Ga0495652_0141181
1496 Ga0495652_0234556
1497 Ga0495652_0350183
1498 Ga0495652_0799592
1499 Ga0495652_1049234
1500 Ga0495652_1138091
1501 Ga0495665_0000569
1502 Ga0495665_0656059
1503 Ga0495640_0098538
1504 Ga0495640_0372316
1505 Ga0495586_0187570
1506 Ga0495586_0289647
1507 Ga0495587_0003524
1508 Ga0495587_0222887
1509 Ga0495609_0323313
1510 Ga0495645_0000085
1511 Ga0495645_0040397
1512 Ga0495645_0059698
1513 Ga0495645_0237988
1514 Ga0495667_0077684
1515 Ga0495667_0105251
1516 Ga0495667_0656348
1517 Ga0495656_0706626
1518 Ga0495634_0102840
1519 Ga0495634_0129715
1520 Ga0495634_0135841
1521 Ga0495634_0264458
1522 Ga0495634_0298419
1523 Ga0495634_0618498
1524 Ga0495635_0088166
1525 Ga0495635_0339720
1526 Ga0495635_0580867
1527 Ga0495635_0617381
1528 Ga0495635_0772591
1529 Ga0495635_1083902
1530 Ga0495659_0242144
1531 Ga0495657_0011016
1532 Ga0495657_0013391
1533 Ga0495657_0043961
1534 Ga0495657_0389883
1535 Ga0495657_0704875
1536 Ga0495599_0000716
1537 Ga0495599_0005564
1538 Ga0495599_0056515
1539 Ga0495599_0210363
1540 Ga0495599_0217191
1541 Ga0495623_0000030
1542 Ga0495623_0152356
1543 Ga0495623_0299034
1544 Ga0495646_0028239
1545 Ga0495646_0130609
1546 Ga0495646_0140086
1547 Ga0495646_0320282
1548 Ga0495647_0010053
1549 Ga0495647_0055401
1550 Ga0495658_0012266
1551 Ga0495658_0336496
1552 Ga0495658_0337066
1553 Ga0495658_0364830
1554 Ga0495613_0012420
1555 Ga0495613_0149173
1556 Ga0495613_0167022
1557 Ga0495613_0212130
1558 Ga0495613_0386200
1559 Ga0495624_0002753
1560 Ga0495624_0004809
1561 Ga0495624_0450836
1562 Ga0495600_0037083
1563 Ga0495600_0042563
1564 Ga0495600_0147006
1565 Ga0495600_0451569
1566 Ga0495600_0928182
1567 Ga0495581_0035436
1568 Ga0495581_0426533
1569 Ga0495604_0000103
1570 Ga0495604_0297930
1571 Ga0495604_0532297
1572 Ga0495636_0409244
1573 Ga0495674_0045217
1574 Ga0495674_0051543
1575 Ga0495674_0438607
1576 Ga0495674_0472270
1577 Ga0495674_0525063
1578 Ga0495674_1457523
1579 Ga0495676_0005516
1580 Ga0495676_0054466
1581 Ga0495676_0399301
1582 Ga0495680_0010394
1583 Ga0495680_0020217
1584 Ga0495680_0096752
1585 Ga0495680_0141195
1586 Ga0495680_0261093
1587 Ga0495680_0740958
1588 Ga0495675_0000282
1589 Ga0495675_0228784
1590 Ga0495675_0335860
1591 Ga0495684_0028380
1592 Ga0495684_0088850
1593 Ga0495684_0236516
1594 Ga0495684_0315062
1595 Ga0495684_1068093
1596 Ga0495593_0000807
1597 Ga0495602_0000080
1598 Ga0495602_0050967
1599 Ga0495602_0238376
1600 Ga0495602_0332925
1601 Ga0495602_0739391
1602 Ga0495614_0000642
1603 Ga0496100_0007377
1604 Ga0496100_0014562
1605 Ga0496100_0240399
1606 Ga0496100_0869163
1607 Ga0496100_1273207
1608 Ga0496101_0002103
1609 Ga0496101_0147545
1610 Ga0496101_0189027
1611 Ga0496101_0419822
1612 Ga0496101_0602494
1613 Ga0496101_1148667
1614 Ga0496101_1193910
1615 Ga0496102_0013820
1616 Ga0496102_0072684
1617 Ga0496102_1063559
1618 Ga0496103_0168547
1619 Ga0496103_0655086
1620 Ga0496104_0009909
1621 Ga0496104_0044880
1622 Ga0496104_0048847
1623 Ga0496104_0064181
1624 Ga0496104_0119395
1625 Ga0496104_0127021
1626 Ga0496104_0758284
1627 Ga0496104_1341198
1628 Ga0496105_0011626
1629 Ga0496105_0013058
1630 Ga0496105_0065979
1631 Ga0496105_0152098
1632 Ga0496105_0330004
1633 Ga0496105_0693303
1634 Ga0496106_0011132
1635 Ga0496106_0640458
1636 Ga0496106_1304809
1637 Ga0496107_0133618
1638 Ga0496107_0170221
1639 Ga0496107_0592427
1640 Ga0496107_0686372
1641 Ga0496107_0885026
1642 Ga0496107_0971834
1643 Ga0496108_0022798
1644 Ga0496108_0068223
1645 Ga0496108_0070458
1646 Ga0496108_0240292
1647 Ga0496109_0018098
1648 Ga0496109_0032643
1649 Ga0496109_0077215
1650 Ga0496110_0015617
1651 Ga0496110_0027540
1652 Ga0496110_0063764
1653 Ga0496110_0209955
1654 Ga0496110_1109425
1655 Ga0496111_0051238
1656 Ga0496111_0098022
1657 Ga0496111_0101276
1658 Ga0496111_0576730
1659 Ga0496111_0711185
1660 Ga0496112_0001848
1661 Ga0496112_0036826
1662 Ga0496112_0094398
1663 Ga0496112_0172870
1664 Ga0496112_0338230
1665 Ga0496112_0529835
1666 Ga0496112_1220975
1667 Ga0496112_1873200
1668 Ga0496113_0102368
1669 Ga0496113_0110515
1670 Ga0496113_0112489
1671 Ga0496113_0287134
1672 Ga0496113_0760299
1673 Ga0496114_0004422
1674 Ga0496114_0079244
1675 Ga0496114_0181882
1676 Ga0496114_0409711
1677 Ga0496114_0501558
1678 Ga0496114_0503776
1679 Ga0496114_0556920
1680 Ga0496115_0012415
1681 Ga0496115_0038699
1682 Ga0496115_0174335
1683 Ga0496115_0839361
1684 Ga0496115_0872471
1685 Ga0501032_0041040
1686 Ga0501032_0287616
1687 Ga0501033_1108793
1688 Ga0501034_1556560
1689 Ga0501036_0147697
1690 Ga0501036_0172526
1691 Ga0501037_0020619
1692 Ga0501038_0005915
1693 Ga0501039_0048024
1694 Ga0501039_0139907
1695 Ga0501039_0223959
1696 Ga0501040_0027966
1697 Ga0501040_0151602
1698 Ga0501040_0939912
1699 Ga0501041_0040823
1700 Ga0501041_0076368
1701 Ga0501041_0376191
1702 Ga0501041_0691491
1703 Ga0501042_0116784
1704 Ga0501042_0192183
1705 Ga0501043_0096192
1706 Ga0501043_0363087
1707 Ga0501043_0973759
1708 Ga0501046_0032235
1709 Ga0501046_0558371
1710 Ga0501046_0677640
1711 Ga0501047_0052962
1712 Ga0501048_0018588
1713 Ga0501048_0146736
1714 Ga0501048_0497021
1715 Ga0501067_0027298
1716 Ga0501067_0258899
1717 Ga0501067_0850095
1718 Ga0501068_0025740
1719 Ga0501068_0237721
1720 Ga0501068_0512500
1721 Ga0501068_0686776
1722 Ga0501069_0004410
1723 Ga0501069_0007201
1724 Ga0501069_0028911
1725 Ga0501069_0084754
1726 Ga0501069_0349361
1727 Ga0501070_0052967
1728 Ga0501070_0094716
1729 Ga0501070_0741972
1730 Ga0501071_0000255
1731 Ga0501071_0103180
1732 Ga0501071_0474439
1733 Ga0501072_0004415
1734 Ga0501072_0055862
1735 Ga0501072_0324001
1736 Ga0501073_0038144
1737 Ga0501073_0465028
1738 Ga0501074_0016778
1739 Ga0501074_0108216
1740 Ga0501074_0111407
1741 Ga0501075_0040548
1742 Ga0501075_0120633
1743 Ga0501075_0504120
1744 Ga0501076_0036235
1745 Ga0501076_0123664
1746 Ga0501076_0171107
1747 Ga0501077_0012818
1748 Ga0501077_0018228
1749 Ga0501077_0041068
1750 Ga0501077_0861851
1751 Ga0501079_0013247
1752 Ga0501079_0325558
1753 Ga0501080_0039769
1754 Ga0501080_0053707
1755 Ga0501080_0053907
1756 Ga0501081_0019102
1757 Ga0501081_0179394
1758 Ga0501081_0672760
1759 Ga0501083_0022810
1760 Ga0501083_0097494
1761 Ga0501035_0236155
1762 Ga0501035_0443933
1763 Ga0501044_0589941
1764 Ga0501044_0715477
1765 Ga0501045_0033228
1766 Ga0501045_0182542
1767 Ga0501045_0281045
1768 Ga0501045_0599692
1769 nmdc:mga03683_613972_c1
1770 nmdc:mga05p37_27961_c1
1771 nmdc:mga05p37_311677_c1
1772 nmdc:mga08y16_612892_c1
1773 nmdc:mga08y16_70993_c1
1774 nmdc:mga0n895_36635_c1
1775 nmdc:mga0rr50_271854_c1
1776 nmdc:mga0a205_262270_c1
1777 nmdc:mga0a205_576977_c1
1778 nmdc:mga0a205_760324_c1
1779 nmdc:mga0a205_808339_c1
1780 Ga0495601_0000163
1781 Ga0495601_0015952
1782 Ga0495601_0031573
1783 Ga0495601_0213512
1784 Ga0495601_0464869
1785 Ga0495601_0797739
1786 Ga0495601_1085239
1787 Ga0495612_0120804
1788 Ga0495595_0006135
1789 Ga0495595_0035071
1790 Ga0495595_0052842
1791 Ga0495595_0135861
1792 Ga0495595_0234899
1793 Ga0495619_0000493
1794 Ga0495619_0079060
1795 Ga0495619_0096967
1796 Ga0495619_0108391
1797 Ga0495619_0177257
1798 Ga0495619_0345180
1799 Ga0495619_0427392
1800 Ga0495619_0461135
1801 Ga0500566_0198571
1802 Ga0501084_0000979
1803 Ga0501084_0022006
1804 Ga0501084_0147038
1805 Ga0501084_0186127
1806 Ga0501082_0010371
1807 Ga0501082_0352523
1808 Ga0501082_0546992
1809 Ga0466962_0001338
1810 Ga0466962_0008088
1811 Ga0466962_0021355
1812 Ga0466962_0041156
1813 Ga0466962_0046818
1814 Ga0466962_0064202
1815 Ga0466962_0299755
1816 Ga0530510_0028568
1817 Ga0530510_0473528
1818 Ga0530510_0477071

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

36

82

0.98

PF12840

HTH_20

Helix-turn-helix domain

34

83

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9387 36 91
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.9369 40 92
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.9353 40 92
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9324 39 94
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9318 23 103
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9526 24 103 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9496 47 91 3.30.230.130
2v9vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9467 48 90 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9462 22 103 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9451 33 90 1.10.10.10
ID Description Score Start End GO Terms
AF-T1BH43-F1-model_v4 Bacterial regulatory protein, ArsR domain protein 0.9837 20 93 GO:0003700
AF-A0A553ZX70-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9834 19 99 GO:0003677
GO:0003700
GO:0046685
AF-A0A2N2PVB9-F1-model_v4 Transcriptional regulator 0.9833 19 103 GO:0003700
AF-A0A2M7A764-F1-model_v4 Transcriptional regulator 0.9808 17 105 GO:0003700
AF-A0A535RW99-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9791 19 103 GO:0003700

Map