F485416

General Info

Members Datasets Scaffolds Average Seq Length
909 299 1818 292

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100010185|Ga0307416_1000101854
Length 274
Sequence VRIEEGVPLARLTTIGTGGPARAFAKPESLAELEEALAWAADRELAVATVGLGSNVLAADDGVDALVLRLGGELASARVEDETLVAGGGAANAVCLHRARAAGLGGFEFACAIPGTAGGGVWMNAGAYGSDWSQILVRARVVYRHSELRHGQVVAEVEYRLVPRSADEIKATVAGLVAQRKATQPTNKRTFGSVFKNPAHELGAGQMLEACGLKGHTIGGALISPMHANFIENAGGATTADALALMAEGRRRALEQFGVELEHEVELLGAIHVT

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 12.43
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100010185 3300032002 Bacteria 6200
2 Ga0070658_10014999 3300005327 Bacteria 6203
3 Ga0070658_10055542 3300005327 Bacteria 3217
4 Ga0070658_10139147 3300005327 Bacteria 2027
5 Ga0070658_10202757 3300005327 Bacteria 1674
6 Ga0070658_10330707 3300005327 Bacteria 1302
7 Ga0070658_10563427 3300005327 Bacteria 986
8 Ga0070683_100005095 3300005329 Bacteria 10922
9 Ga0070683_100043245 3300005329 Bacteria 4152
10 Ga0070683_100085844 3300005329 Bacteria 2951
11 Ga0070683_100135833 3300005329 Bacteria 2329
12 Ga0070683_100151432 3300005329 Bacteria 2199
13 Ga0070683_100243527 3300005329 Bacteria 1710
14 Ga0068869_100075053 3300005334 Bacteria 2511
15 Ga0070680_100008922 3300005336 Bacteria 7690
16 Ga0070680_100014704 3300005336 Bacteria 6120
17 Ga0070680_100088710 3300005336 Bacteria 2559
18 Ga0070680_100092128 3300005336 Bacteria 2509
19 Ga0070680_100206708 3300005336 Bacteria 1656
20 Ga0070682_100002080 3300005337 Bacteria 11128
21 Ga0070682_100028763 3300005337 Bacteria 3344
22 Ga0070682_100067429 3300005337 Bacteria 2279
23 Ga0070682_100280772 3300005337 Unclassified 1214
24 Ga0068868_100041284 3300005338 Bacteria 3594
25 Ga0070660_100000987 3300005339 Bacteria 19063
26 Ga0070660_100001169 3300005339 Bacteria 17754
27 Ga0070660_100002777 3300005339 Bacteria 12017
28 Ga0070660_100054715 3300005339 Bacteria 3082
29 Ga0070660_100149773 3300005339 Bacteria 1876
30 Ga0070691_10073192 3300005341 Bacteria 1665
31 Ga0070691_10100051 3300005341 Unclassified 1439
32 Ga0070687_100237983 3300005343 Bacteria 1124
33 Ga0070661_100113408 3300005344 Unclassified 2025
34 Ga0070668_100313285 3300005347 Bacteria 1319
35 Ga0070668_100447658 3300005347 Bacteria 1110
36 Ga0070675_100119207 3300005354 Bacteria 2241
37 Ga0070671_100083167 3300005355 Bacteria 2676
38 Ga0070673_100188108 3300005364 Bacteria 1772
39 Ga0070673_100435203 3300005364 Unclassified 1178
40 Ga0070659_100004290 3300005366 Bacteria 10177
41 Ga0070659_100111814 3300005366 Bacteria 2205
42 Ga0070667_100079168 3300005367 Bacteria 2809
43 Ga0070703_10049195 3300005406 Bacteria 1341
44 Ga0070709_10051800 3300005434 Bacteria 2577
45 Ga0070714_100137507 3300005435 Bacteria 2189
46 Ga0070714_100194507 3300005435 Bacteria 1853
47 Ga0070714_100308579 3300005435 Bacteria 1477
48 Ga0070701_10012978 3300005438 Bacteria 3777
49 Ga0070711_100010525 3300005439 Bacteria 5726
50 Ga0070700_100195679 3300005441 Unclassified 1416
51 Ga0070708_100021939 3300005445 Bacteria 5410
52 Ga0070708_100215419 3300005445 Bacteria 1800
53 Ga0070663_100025646 3300005455 Bacteria 3982
54 Ga0070663_100146324 3300005455 Bacteria 1808
55 Ga0070663_100171437 3300005455 Unclassified 1678
56 Ga0070678_100004632 3300005456 Bacteria 7819
57 Ga0070678_100021921 3300005456 Bacteria 4222
58 Ga0070678_100088598 3300005456 Bacteria 2366
59 Ga0070681_10004684 3300005458 Bacteria 13081
60 Ga0070681_10017778 3300005458 Bacteria 7104
61 Ga0070681_10072461 3300005458 Bacteria 3407
62 Ga0070681_10079101 3300005458 Bacteria 3245
63 Ga0070681_10134187 3300005458 Bacteria 2406
64 Ga0070681_10173488 3300005458 Unclassified 2078
65 Ga0068867_100203016 3300005459 Unclassified 1588
66 Ga0070685_10004070 3300005466 Bacteria 7387
67 Ga0070706_100329157 3300005467 Bacteria 1425
68 Ga0070706_100559275 3300005467 Unclassified 1064
69 Ga0070707_100041336 3300005468 Bacteria 4412
70 Ga0070707_100141182 3300005468 Unclassified 2344
71 Ga0070707_100216846 3300005468 Bacteria 1865
72 Ga0070698_100133718 3300005471 Bacteria 2434
73 Ga0070699_100245804 3300005518 Bacteria 1598
74 Ga0070679_100001218 3300005530 Bacteria 22619
75 Ga0070679_100004651 3300005530 Bacteria 12668
76 Ga0070679_100007568 3300005530 Bacteria 10159
77 Ga0070679_100015547 3300005530 Bacteria 7312
78 Ga0070679_100088082 3300005530 Bacteria 3091
79 Ga0070679_100125369 3300005530 Bacteria 2550
80 Ga0070679_100173545 3300005530 Bacteria 2128
81 Ga0070679_100206726 3300005530 Bacteria 1927
82 Ga0070684_100000286 3300005535 Bacteria 35165
83 Ga0070684_100002106 3300005535 Bacteria 14655
84 Ga0070684_100013868 3300005535 Bacteria 6511
85 Ga0070684_100035846 3300005535 Bacteria 4249
86 Ga0070684_100060170 3300005535 Bacteria 3321
87 Ga0070684_100110894 3300005535 Bacteria 2460
88 Ga0070684_100281169 3300005535 Bacteria 1525
89 Ga0070684_100302665 3300005535 Bacteria 1467
90 Ga0070697_100283089 3300005536 Bacteria 1423
91 Ga0068853_100025116 3300005539 Bacteria 4999
92 Ga0070672_100203103 3300005543 Unclassified 1658
93 Ga0070686_100170754 3300005544 Bacteria 1538
94 Ga0070695_100151190 3300005545 Bacteria 1620
95 Ga0070696_100088809 3300005546 Bacteria 2197
96 Ga0070693_100009173 3300005547 Bacteria 4913
97 Ga0070693_100136189 3300005547 Bacteria 1541
98 Ga0070704_100015570 3300005549 Bacteria 4780
99 Ga0070704_100049551 3300005549 Unclassified 2947
100 Ga0070704_100091849 3300005549 Bacteria 2265
101 Ga0068855_100037454 3300005563 Bacteria 5766
102 Ga0068855_100041238 3300005563 Bacteria 5472
103 Ga0068855_100095042 3300005563 Bacteria 3435
104 Ga0068855_100188790 3300005563 Bacteria 2326
105 Ga0070664_100021964 3300005564 Bacteria 5262
106 Ga0070664_100046027 3300005564 Bacteria 3685
107 Ga0070664_100088838 3300005564 Bacteria 2672
108 Ga0070664_100123079 3300005564 Bacteria 2273
109 Ga0070664_100133260 3300005564 Bacteria 2183
110 Ga0068857_100042520 3300005577 Bacteria 4032
111 Ga0068857_100055433 3300005577 Bacteria 3518
112 Ga0068857_100177333 3300005577 Bacteria 1939
113 Ga0068857_100232663 3300005577 Bacteria 1686
114 Ga0068857_100385005 3300005577 Unclassified 1303
115 Ga0068856_100021996 3300005614 Bacteria 6200
116 Ga0068856_100032908 3300005614 Bacteria 5078
117 Ga0068856_100121997 3300005614 Bacteria 2608
118 Ga0068856_100698265 3300005614 Bacteria 1035
119 Ga0070702_100014210 3300005615 Bacteria 4036
120 Ga0070702_100014973 3300005615 Bacteria 3948
121 Ga0068852_100050181 3300005616 Bacteria 3574
122 Ga0068864_100014602 3300005618 Bacteria 6524
123 Ga0068864_100377122 3300005618 Bacteria 1343
124 Ga0068861_100125109 3300005719 Bacteria 2079
125 Ga0068861_100334402 3300005719 Unclassified 1323
126 Ga0068851_10032592 3300005834 Bacteria 2592
127 Ga0068851_10060482 3300005834 Bacteria 1939
128 Ga0068851_10158616 3300005834 Unclassified 1241
129 Ga0068870_10112731 3300005840 Unclassified 1555
130 Ga0068870_10129831 3300005840 Bacteria 1462
131 Ga0068858_100016800 3300005842 Bacteria 6873
132 Ga0068860_100052269 3300005843 Bacteria 3886
133 Ga0081455_10005553 3300005937 Bacteria 13807
134 Ga0081455_10021586 3300005937 Bacteria 6035
135 Ga0081455_10041400 3300005937 Bacteria 4051
136 Ga0081455_10184200 3300005937 Bacteria 1578
137 Ga0081540_1012803 3300005983 Bacteria 5488
138 Ga0081539_10000712 3300005985 Bacteria 66647
139 Ga0081539_10002673 3300005985 Bacteria 24252
140 Ga0070717_10076668 3300006028 Bacteria 2798
141 Ga0070717_10084650 3300006028 Bacteria 2668
142 Ga0070717_10344823 3300006028 Bacteria 1331
143 Ga0075432_10012364 3300006058 Bacteria 2900
144 Ga0070716_100046550 3300006173 Bacteria 2441
145 Ga0070716_100300818 3300006173 Bacteria 1116
146 Ga0070712_100004684 3300006175 Bacteria 8456
147 Ga0070712_100036378 3300006175 Bacteria 3350
148 Ga0070712_100039370 3300006175 Bacteria 3235
149 Ga0070712_100089081 3300006175 Bacteria 2256
150 Ga0070712_100167708 3300006175 Bacteria 1701
151 Ga0070712_100312425 3300006175 Unclassified 1275
152 Ga0075367_10100213 3300006178 Bacteria 1770
153 Ga0068871_100316933 3300006358 Bacteria 1372
154 Ga0075428_100088832 3300006844 Bacteria 3371
155 Ga0075428_100261873 3300006844 Bacteria 1862
156 Ga0075428_100524166 3300006844 Unclassified 1267
157 Ga0075428_100537389 3300006844 Bacteria 1250
158 Ga0075433_10008842 3300006852 Bacteria 8036
159 Ga0075433_10022515 3300006852 Bacteria 5288
160 Ga0075433_10032720 3300006852 Bacteria 4455
161 Ga0075433_10192143 3300006852 Bacteria 1816
162 Ga0075434_100013022 3300006871 Bacteria 7898
163 Ga0075434_100107931 3300006871 Bacteria 2794
164 Ga0075434_100166640 3300006871 Bacteria 2223
165 Ga0075434_100375839 3300006871 Bacteria 1442
166 Ga0075434_100388395 3300006871 Bacteria 1417
167 Ga0068865_100009909 3300006881 Bacteria 5921
168 Ga0068865_100031618 3300006881 Bacteria 3530
169 Ga0068865_100076755 3300006881 Bacteria 2386
170 Ga0075436_100012021 3300006914 Bacteria 5937
171 Ga0075436_100024460 3300006914 Bacteria 4151
172 Ga0075436_100077116 3300006914 Bacteria 2308
173 Ga0075436_100123089 3300006914 Unclassified 1816
174 Ga0075435_100012599 3300007076 Bacteria 6264
175 Ga0075435_100027092 3300007076 Bacteria 4479
176 Ga0105240_10029379 3300009093 Bacteria 7162
177 Ga0105240_10059378 3300009093 Bacteria 4773
178 Ga0105240_10120718 3300009093 Bacteria 3156
179 Ga0105240_10206823 3300009093 Bacteria 2296
180 Ga0111539_10011337 3300009094 Bacteria 11196
181 Ga0111539_10040887 3300009094 Bacteria 5579
182 Ga0111539_10044887 3300009094 Bacteria 5292
183 Ga0111539_10063304 3300009094 Bacteria 4377
184 Ga0111539_10333887 3300009094 Bacteria 1764
185 Ga0111539_10398611 3300009094 Bacteria 1603
186 Ga0105245_10033516 3300009098 Bacteria 4553
187 Ga0105245_10045484 3300009098 Bacteria 3921
188 Ga0105245_10398926 3300009098 Unclassified 1374
189 Ga0105245_10407954 3300009098 Bacteria 1359
190 Ga0105247_10045020 3300009101 Bacteria 2707
191 Ga0114129_10048125 3300009147 Bacteria 5991
192 Ga0114129_10089957 3300009147 Bacteria 4255
193 Ga0114129_10178559 3300009147 Bacteria 2891
194 Ga0114129_10409961 3300009147 Bacteria 1785
195 Ga0105243_10005927 3300009148 Bacteria 9466
196 Ga0105243_10026222 3300009148 Bacteria 4461
197 Ga0105243_10187977 3300009148 Unclassified 1802
198 Ga0105243_10214490 3300009148 Unclassified 1697
199 Ga0105243_10278918 3300009148 Bacteria 1504
200 Ga0105243_10340682 3300009148 Unclassified 1373
201 Ga0105241_10319467 3300009174 Bacteria 1338
202 Ga0105242_10078749 3300009176 Bacteria 2751
203 Ga0105242_10114080 3300009176 Bacteria 2308
204 Ga0105242_10303793 3300009176 Bacteria 1457
205 Ga0105248_10211114 3300009177 Bacteria 2187
206 Ga0105237_10060611 3300009545 Bacteria 3785
207 Ga0105238_10015630 3300009551 Bacteria 7682
208 Ga0105249_10037426 3300009553 Bacteria 4403
209 Ga0105249_10223565 3300009553 Bacteria 1854
210 Ga0105239_10036761 3300010375 Bacteria 5372
211 Ga0105239_10136164 3300010375 Bacteria 2734
212 Ga0105239_10255997 3300010375 Unclassified 1967
213 Ga0105246_10011293 3300011119 Bacteria 5542
214 Ga0105246_10040253 3300011119 Bacteria 3153
215 Ga0157373_10273610 3300013100 Bacteria 1196
216 Ga0157370_10030380 3300013104 Bacteria 5294
217 Ga0157370_10035597 3300013104 Bacteria 4837
218 Ga0157370_10076192 3300013104 Bacteria 3160
219 Ga0157369_10003190 3300013105 Bacteria 19560
220 Ga0157369_10006794 3300013105 Bacteria 13198
221 Ga0157369_10135804 3300013105 Bacteria 2604
222 Ga0157369_10169134 3300013105 Bacteria 2304
223 Ga0157374_10008984 3300013296 Bacteria 8568
224 Ga0157374_10128899 3300013296 Unclassified 2447
225 Ga0157374_10137631 3300013296 Bacteria 2369
226 Ga0157374_10785813 3300013296 Bacteria 967
227 Ga0163162_10878477 3300013306 Bacteria 1011
228 Ga0157372_10022486 3300013307 Bacteria 6824
229 Ga0157372_10070280 3300013307 Bacteria 3939
230 Ga0157372_10093063 3300013307 Bacteria 3430
231 Ga0157372_10414823 3300013307 Bacteria 1569
232 Ga0157375_10072787 3300013308 Bacteria 3454
233 Ga0157375_10243759 3300013308 Unclassified 1957
234 Ga0163163_10141851 3300014325 Bacteria 2445
235 Ga0163163_10231316 3300014325 Bacteria 1898
236 Ga0157380_10030996 3300014326 Bacteria 4101
237 Ga0157377_10050141 3300014745 Bacteria 2349
238 Ga0157377_10073965 3300014745 Bacteria 1976
239 Ga0157377_10197064 3300014745 Unclassified 1276
240 Ga0157379_10008081 3300014968 Bacteria 9141
241 Ga0157379_10015282 3300014968 Bacteria 6732
242 Ga0157376_10009504 3300014969 Bacteria 7065
243 Ga0157376_10134305 3300014969 Bacteria 2212
244 Ga0157376_10364004 3300014969 Bacteria 1388
245 Ga0206356_11895397 3300020070 Bacteria 3000
246 Ga0206354_10788483 3300020081 Bacteria 2162
247 Ga0206354_11630888 3300020081 Unclassified 1546
248 Ga0206353_11415625 3300020082 Bacteria 7415
249 Ga0206353_11601542 3300020082 Bacteria 3880
250 Ga0207653_10009255 3300025885 Bacteria 3068
251 Ga0207692_10067871 3300025898 Bacteria 1868
252 Ga0207645_10054929 3300025907 Bacteria 2543
253 Ga0207643_10007509 3300025908 Bacteria 5853
254 Ga0207705_10007957 3300025909 Bacteria 7778
255 Ga0207684_10188438 3300025910 Unclassified 1779
256 Ga0207654_10077693 3300025911 Bacteria 1990
257 Ga0207707_10003902 3300025912 Bacteria 13226
258 Ga0207707_10004085 3300025912 Bacteria 12931
259 Ga0207707_10031620 3300025912 Bacteria 4632
260 Ga0207707_10045695 3300025912 Bacteria 3816
261 Ga0207707_10056574 3300025912 Bacteria 3412
262 Ga0207707_10130861 3300025912 Bacteria 2194
263 Ga0207707_10142260 3300025912 Bacteria 2097
264 Ga0207707_10292976 3300025912 Bacteria 1408
265 Ga0207707_10324570 3300025912 Bacteria 1329
266 Ga0207695_10263121 3300025913 Bacteria 1622
267 Ga0207695_10289984 3300025913 Bacteria 1529
268 Ga0207671_10230223 3300025914 Bacteria 1454
269 Ga0207693_10002465 3300025915 Bacteria 16079
270 Ga0207693_10006225 3300025915 Bacteria 9898
271 Ga0207693_10021715 3300025915 Bacteria 5102
272 Ga0207693_10045347 3300025915 Bacteria 3455
273 Ga0207693_10183700 3300025915 Unclassified 1646
274 Ga0207693_10206786 3300025915 Unclassified 1543
275 Ga0207663_10105012 3300025916 Bacteria 1905
276 Ga0207660_10014400 3300025917 Bacteria 5202
277 Ga0207660_10024911 3300025917 Bacteria 4055
278 Ga0207660_10189797 3300025917 Bacteria 1599
279 Ga0207657_10000046 3300025919 Bacteria 113887
280 Ga0207657_10004670 3300025919 Bacteria 14463
281 Ga0207657_10042210 3300025919 Bacteria 4026
282 Ga0207657_10042628 3300025919 Bacteria 4002
283 Ga0207657_10094324 3300025919 Bacteria 2492
284 Ga0207657_10126311 3300025919 Bacteria 2100
285 Ga0207649_10019235 3300025920 Bacteria 3900
286 Ga0207649_10048163 3300025920 Unclassified 2628
287 Ga0207649_10218712 3300025920 Bacteria 1355
288 Ga0207649_10280126 3300025920 Bacteria 1212
289 Ga0207649_10351575 3300025920 Bacteria 1091
290 Ga0207652_10006892 3300025921 Bacteria 9156
291 Ga0207652_10041215 3300025921 Bacteria 3924
292 Ga0207652_10087240 3300025921 Bacteria 2736
293 Ga0207652_10087576 3300025921 Bacteria 2731
294 Ga0207652_10131087 3300025921 Bacteria 2236
295 Ga0207652_10234910 3300025921 Bacteria 1652
296 Ga0207646_10039067 3300025922 Bacteria 4270
297 Ga0207646_10197755 3300025922 Bacteria 1815
298 Ga0207646_10396258 3300025922 Unclassified 1247
299 Ga0207694_10014338 3300025924 Bacteria 5975
300 Ga0207694_10194327 3300025924 Bacteria 1649
301 Ga0207687_10009713 3300025927 Bacteria 6294
302 Ga0207687_10010814 3300025927 Bacteria 5965
303 Ga0207687_10240376 3300025927 Bacteria 1435
304 Ga0207700_10034480 3300025928 Bacteria 3634
305 Ga0207664_10105869 3300025929 Bacteria 2332
306 Ga0207664_10249254 3300025929 Unclassified 1549
307 Ga0207664_10690694 3300025929 Bacteria 918
308 Ga0207690_10341088 3300025932 Unclassified 1182
309 Ga0207706_10072795 3300025933 Bacteria 3022
310 Ga0207706_10109698 3300025933 Bacteria 2428
311 Ga0207686_10322957 3300025934 Unclassified 1154
312 Ga0207709_10004893 3300025935 Bacteria 7666
313 Ga0207709_10027758 3300025935 Bacteria 3266
314 Ga0207709_10120591 3300025935 Bacteria 1770
315 Ga0207709_10203453 3300025935 Unclassified 1416
316 Ga0207709_10290189 3300025935 Bacteria 1212
317 Ga0207709_10449924 3300025935 Unclassified 995
318 Ga0207669_10016875 3300025937 Bacteria 3728
319 Ga0207704_10012479 3300025938 Bacteria 4217
320 Ga0207704_10026920 3300025938 Bacteria 3162
321 Ga0207704_10064600 3300025938 Bacteria 2287
322 Ga0207704_10106511 3300025938 Bacteria 1883
323 Ga0207704_10200501 3300025938 Unclassified 1460
324 Ga0207665_10003617 3300025939 Bacteria 10328
325 Ga0207691_10043160 3300025940 Bacteria 4156
326 Ga0207711_10203594 3300025941 Unclassified 1807
327 Ga0207689_10067839 3300025942 Bacteria 2931
328 Ga0207689_10069438 3300025942 Bacteria 2895
329 Ga0207661_10003778 3300025944 Bacteria 10556
330 Ga0207661_10010487 3300025944 Bacteria 6669
331 Ga0207661_10014601 3300025944 Bacteria 5760
332 Ga0207661_10016038 3300025944 Bacteria 5524
333 Ga0207661_10046285 3300025944 Bacteria 3450
334 Ga0207661_10070805 3300025944 Bacteria 2848
335 Ga0207661_10077276 3300025944 Bacteria 2737
336 Ga0207661_10114824 3300025944 Bacteria 2283
337 Ga0207661_10164314 3300025944 Bacteria 1928
338 Ga0207679_10025645 3300025945 Bacteria 4057
339 Ga0207679_10077368 3300025945 Unclassified 2531
340 Ga0207679_10094843 3300025945 Bacteria 2318
341 Ga0207679_10235960 3300025945 Unclassified 1547
342 Ga0207667_10049261 3300025949 Bacteria 4451
343 Ga0207667_10153733 3300025949 Bacteria 2367
344 Ga0207667_10290498 3300025949 Bacteria 1670
345 Ga0207667_10483752 3300025949 Bacteria 1256
346 Ga0207651_10233314 3300025960 Bacteria 1495
347 Ga0207712_10026346 3300025961 Bacteria 3872
348 Ga0207712_10090867 3300025961 Unclassified 2248
349 Ga0207640_10089330 3300025981 Bacteria 2129
350 Ga0207677_10319779 3300026023 Bacteria 1289
351 Ga0207703_10138211 3300026035 Bacteria 2112
352 Ga0207639_10076169 3300026041 Bacteria 2640
353 Ga0207639_10089922 3300026041 Bacteria 2454
354 Ga0207639_10141330 3300026041 Bacteria 2006
355 Ga0207639_10309824 3300026041 Bacteria 1398
356 Ga0207639_10540966 3300026041 Bacteria 1068
357 Ga0207678_10025566 3300026067 Bacteria 5153
358 Ga0207678_10155621 3300026067 Bacteria 1951
359 Ga0207702_10013421 3300026078 Bacteria 6811
360 Ga0207702_10026096 3300026078 Bacteria 4851
361 Ga0207702_10158445 3300026078 Bacteria 2065
362 Ga0207702_10310855 3300026078 Bacteria 1498
363 Ga0207641_10120808 3300026088 Bacteria 2338
364 Ga0207648_10312083 3300026089 Unclassified 1412
365 Ga0207674_10000589 3300026116 Bacteria 47768
366 Ga0207674_10054841 3300026116 Bacteria 4056
367 Ga0207674_10086205 3300026116 Bacteria 3135
368 Ga0207674_10278559 3300026116 Bacteria 1620
369 Ga0207683_10014750 3300026121 Bacteria 6652
370 Ga0207683_10027940 3300026121 Bacteria 4876
371 Ga0207683_10045987 3300026121 Bacteria 3818
372 Ga0207698_10137922 3300026142 Bacteria 2096
373 Ga0207428_10053447 3300027907 Bacteria 3221
374 Ga0207428_10149316 3300027907 Bacteria 1780
375 Ga0268266_10014070 3300028379 Bacteria 6887
376 Ga0268265_10047379 3300028380 Bacteria 3221
377 Ga0268265_10171348 3300028380 Unclassified 1856
378 Ga0268264_10194913 3300028381 Bacteria 1849
379 Ga0265323_10055471 3300028653 Unclassified 1393
380 Ga0265338_10170025 3300028800 Bacteria 1673
381 Ga0265338_10199356 3300028800 Bacteria 1510
382 Ga0265325_10022952 3300031241 Bacteria 3413
383 Ga0265339_10024386 3300031249 Bacteria 3486
384 Ga0265327_10020304 3300031251 Bacteria 4053
385 Ga0265327_10059895 3300031251 Bacteria 1948
386 Ga0307408_100137892 3300031548 Bacteria 1911
387 Ga0307408_100189782 3300031548 Unclassified 1655
388 Ga0265342_10034167 3300031712 Bacteria 3121
389 Ga0307409_100051627 3300031995 Bacteria 3148
390 Ga0307415_100048805 3300032126 Bacteria 2858
391 Ga0373930_0016453 3300034816 Bacteria 1399
392 Ga0373928_0010580 3300035084 Bacteria 1815
393 Ga0373951_0000908 3300035091 Bacteria 7970
394 Ga0373932_0026731 3300035112 Bacteria 1572
395 Ga0373939_0087376 3300035114 Bacteria 1047
396 Ga0373941_0002261 3300035115 Bacteria 4216
397 Ga0373945_0007159 3300035116 Bacteria 3611
398 Ga0373943_0000112 3300035170 Bacteria 30215
399 Ga0373943_0078661 3300035170 Unclassified 1686
400 Ga0373931_0051738 3300035691 Bacteria 2188
401 Ga0373947_0000600 3300035725 Bacteria 21231
402 Ga0373947_0002931 3300035725 Bacteria 10178
403 Ga0373947_0039500 3300035725 Bacteria 2808
404 Ga0373925_0007897 3300037068 Bacteria 7747
405 Ga0373925_0024389 3300037068 Bacteria 4416
406 Ga0395899_0005838 3300037312 Bacteria 9555
407 Ga0395899_0013404 3300037312 Bacteria 6272
408 Ga0395899_0046945 3300037312 Bacteria 3216
409 Ga0395899_0081277 3300037312 Bacteria 2358
410 Ga0395899_0096962 3300037312 Bacteria 2132
411 Ga0395899_0125278 3300037312 Bacteria 1837
412 Ga0395900_0001970 3300037418 Bacteria 23182
413 Ga0395900_0003522 3300037418 Bacteria 16880
414 Ga0395900_0008763 3300037418 Bacteria 10393
415 Ga0395900_0011690 3300037418 Bacteria 8980
416 Ga0395900_0023971 3300037418 Bacteria 6244
417 Ga0395900_0040529 3300037418 Bacteria 4800
418 Ga0395900_0054626 3300037418 Bacteria 4112
419 Ga0395900_0056594 3300037418 Bacteria 4036
420 Ga0395900_0135223 3300037418 Bacteria 2525
421 Ga0395900_0136016 3300037418 Bacteria 2518
422 Ga0395900_0211572 3300037418 Bacteria 1958
423 Ga0395900_0221380 3300037418 Bacteria 1907
424 Ga0395898_0002384 3300037466 Bacteria 22303
425 Ga0395898_0003184 3300037466 Bacteria 18478
426 Ga0395898_0012598 3300037466 Bacteria 8743
427 Ga0395898_0012993 3300037466 Bacteria 8584
428 Ga0395898_0017911 3300037466 Bacteria 7227
429 Ga0395898_0026766 3300037466 Bacteria 5797
430 Ga0395898_0036101 3300037466 Bacteria 4909
431 Ga0395898_0064600 3300037466 Bacteria 3549
432 Ga0395898_0318157 3300037466 Bacteria 1484
433 Ga0395898_0439470 3300037466 Unclassified 1243
434 Ga0395898_0505324 3300037466 Bacteria 1149
435 Ga0395905_0002425 3300037471 Bacteria 20684
436 Ga0395905_0010165 3300037471 Bacteria 9171
437 Ga0395905_0013914 3300037471 Bacteria 7696
438 Ga0395905_0046824 3300037471 Bacteria 4055
439 Ga0395905_0047631 3300037471 Bacteria 4016
440 Ga0395905_0069679 3300037471 Bacteria 3294
441 Ga0395901_0004313 3300038443 Bacteria 14354
442 Ga0395901_0004948 3300038443 Bacteria 13445
443 Ga0395901_0005093 3300038443 Bacteria 13273
444 Ga0395901_0007139 3300038443 Bacteria 11274
445 Ga0395901_0007152 3300038443 Bacteria 11267
446 Ga0395901_0007511 3300038443 Bacteria 11008
447 Ga0395901_0009134 3300038443 Bacteria 10039
448 Ga0395901_0047223 3300038443 Bacteria 4471
449 Ga0395901_0048345 3300038443 Bacteria 4417
450 Ga0395901_0075284 3300038443 Bacteria 3521
451 Ga0395901_0084227 3300038443 Bacteria 3323
452 Ga0395901_0085122 3300038443 Bacteria 3305
453 Ga0395901_0156763 3300038443 Bacteria 2391
454 Ga0395901_0289450 3300038443 Bacteria 1700
455 Ga0395901_0338625 3300038443 Bacteria 1554
456 Ga0436365_1178642 3300039437 Bacteria 4295
457 Ga0436363_1701464 3300039450 Bacteria 1992
458 Ga0439461_0013281 3300041410 Bacteria 1553
459 Ga0451853_1619588 3300041512 Bacteria 2371
460 Ga0451853_1722531 3300041512 Bacteria 2911
461 Ga0466961_0001257 3300044693 Bacteria 15630
462 Ga0466961_0118988 3300044693 Bacteria 1659
463 Ga0466961_0265418 3300044693 Bacteria 1052
464 Ga0466963_0002591 3300044694 Bacteria 10149
465 Ga0466963_0004141 3300044694 Bacteria 8389
466 Ga0466963_0063705 3300044694 Bacteria 2468
467 Ga0466963_0356777 3300044694 Bacteria 1030
468 Ga0466964_0007132 3300044706 Bacteria 4179
469 Ga0466964_0013174 3300044706 Bacteria 3135
470 Ga0466964_0028663 3300044706 Bacteria 2195
471 Ga0466971_0000806 3300044719 Bacteria 12630
472 Ga0466971_0033780 3300044719 Bacteria 2292
473 Ga0466968_0010622 3300044735 Bacteria 3575
474 Ga0466968_0060902 3300044735 Bacteria 1628
475 Ga0466968_0125587 3300044735 Unclassified 1164
476 Ga0466970_0034332 3300044765 Bacteria 2685
477 Ga0466970_0045822 3300044765 Bacteria 2329
478 Ga0466957_0002131 3300044842 Bacteria 10591
479 Ga0466957_0023621 3300044842 Bacteria 3635
480 Ga0466959_0004135 3300045049 Bacteria 9664
481 Ga0466959_0035983 3300045049 Bacteria 3658
482 Ga0466959_0091984 3300045049 Bacteria 2178
483 Ga0451576_0149243 3300045051 Bacteria 2438
484 Ga0451576_0561135 3300045051 Bacteria 1200
485 Ga0466958_0000213 3300045836 Bacteria 21795
486 Ga0466958_0015744 3300045836 Bacteria 4342
487 Ga0466958_0035234 3300045836 Bacteria 2990
488 Ga0466958_0214544 3300045836 Bacteria 1227
489 Ga0466967_0000845 3300045976 Bacteria 16209
490 Ga0466967_0006891 3300045976 Bacteria 8114
491 Ga0466967_0031187 3300045976 Bacteria 4484
492 Ga0466967_0040463 3300045976 Bacteria 4013
493 Ga0466967_0041570 3300045976 Bacteria 3965
494 Ga0466967_0063013 3300045976 Bacteria 3293
495 Ga0466967_0079569 3300045976 Bacteria 2955
496 Ga0466967_0082366 3300045976 Bacteria 2908
497 Ga0466967_0103884 3300045976 Bacteria 2600
498 Ga0466967_0107621 3300045976 Bacteria 2557
499 Ga0466967_0162669 3300045976 Bacteria 2096
500 Ga0466967_0515305 3300045976 Unclassified 1175
501 Ga0466967_0565403 3300045976 Unclassified 1120
502 Ga0495592_0132283 3300046454 Unclassified 1744
503 Ga0495603_0024564 3300046455 Bacteria 3646
504 Ga0495603_0031182 3300046455 Bacteria 3209
505 Ga0495603_0066499 3300046455 Bacteria 2123
506 Ga0495629_0000593 3300046459 Bacteria 29449
507 Ga0495629_0011270 3300046459 Bacteria 6495
508 Ga0495629_0175130 3300046459 Unclassified 1488
509 Ga0495629_0281082 3300046459 Bacteria 1142
510 Ga0495641_0000529 3300046461 Bacteria 32060
511 Ga0495641_0012570 3300046461 Bacteria 4722
512 Ga0495651_0016198 3300046462 Bacteria 5774
513 Ga0495651_0044071 3300046462 Bacteria 3458
514 Ga0495651_0279756 3300046462 Unclassified 1128
515 Ga0495653_0035219 3300046463 Bacteria 3952
516 Ga0495653_0035557 3300046463 Bacteria 3930
517 Ga0495653_0041954 3300046463 Bacteria 3568
518 Ga0495582_0000056 3300046473 Bacteria 57084
519 Ga0495582_0009950 3300046473 Bacteria 5235
520 Ga0495582_0074001 3300046473 Bacteria 1886
521 Ga0495582_0142819 3300046473 Unclassified 1357
522 Ga0495605_0054430 3300046474 Bacteria 1938
523 Ga0495662_0001726 3300046476 Bacteria 10911
524 Ga0495662_0106926 3300046476 Bacteria 1370
525 Ga0495584_0021606 3300046491 Bacteria 3268
526 Ga0495584_0092941 3300046491 Bacteria 1522
527 Ga0495594_0024875 3300046499 Bacteria 3218
528 Ga0495608_0097646 3300046511 Bacteria 1896
529 Ga0495608_0131194 3300046511 Bacteria 1603
530 Ga0495608_0155018 3300046511 Bacteria 1458
531 Ga0495608_0175839 3300046511 Bacteria 1356
532 Ga0495608_0209026 3300046511 Bacteria 1227
533 Ga0495618_0024979 3300046514 Bacteria 3707
534 Ga0495630_0002187 3300046517 Bacteria 13612
535 Ga0495630_0005694 3300046517 Bacteria 8809
536 Ga0495630_0060446 3300046517 Bacteria 2844
537 Ga0495630_0149966 3300046517 Bacteria 1774
538 Ga0495630_0168340 3300046517 Bacteria 1669
539 Ga0495630_0215366 3300046517 Unclassified 1466
540 Ga0495637_0088975 3300046520 Bacteria 1221
541 Ga0495644_0133162 3300046523 Bacteria 948
542 Ga0495652_0185315 3300046529 Bacteria 1593
543 Ga0495652_0269425 3300046529 Bacteria 1252
544 Ga0495665_0000364 3300046531 Bacteria 22881
545 Ga0495665_0035067 3300046531 Bacteria 2682
546 Ga0495640_0033296 3300046533 Bacteria 3662
547 Ga0495640_0070703 3300046533 Bacteria 2344
548 Ga0495586_0092655 3300046535 Bacteria 1670
549 Ga0495645_0241711 3300046543 Archaea 1204
550 Ga0495645_0295235 3300046543 Bacteria 1061
551 Ga0495667_0005804 3300046559 Bacteria 8365
552 Ga0495667_0029564 3300046559 Bacteria 3688
553 Ga0495667_0031250 3300046559 Bacteria 3575
554 Ga0495667_0099868 3300046559 Bacteria 1878
555 Ga0495656_0062466 3300046615 Bacteria 1629
556 Ga0495634_0040558 3300046642 Bacteria 3165
557 Ga0495634_0067864 3300046642 Unclassified 2358
558 Ga0495634_0088462 3300046642 Bacteria 2014
559 Ga0495634_0096497 3300046642 Bacteria 1914
560 Ga0495635_0036613 3300046663 Bacteria 3401
561 Ga0495635_0066558 3300046663 Bacteria 2471
562 Ga0495588_0034334 3300046674 Bacteria 2567
563 Ga0495657_0058777 3300046675 Bacteria 2552
564 Ga0495599_0051253 3300046678 Bacteria 2586
565 Ga0495623_0107662 3300046679 Bacteria 1692
566 Ga0495646_0036425 3300046680 Bacteria 3048
567 Ga0495646_0082403 3300046680 Bacteria 1872
568 Ga0495647_0104644 3300046681 Bacteria 1175
569 Ga0495658_0000204 3300046683 Bacteria 34365
570 Ga0495613_0000401 3300046689 Bacteria 37127
571 Ga0495613_0064032 3300046689 Bacteria 2690
572 Ga0495613_0389244 3300046689 Bacteria 952
573 Ga0495624_0013229 3300046690 Bacteria 5626
574 Ga0495624_0029068 3300046690 Bacteria 3608
575 Ga0495624_0061784 3300046690 Bacteria 2346
576 Ga0495600_0086665 3300046809 Bacteria 2043
577 Ga0495581_0000517 3300047315 Bacteria 19788
578 Ga0495581_0021502 3300047315 Bacteria 3738
579 Ga0495604_0036305 3300047317 Bacteria 3885
580 Ga0495674_0031365 3300047319 Bacteria 4829
581 Ga0495674_0034483 3300047319 Bacteria 4577
582 Ga0495674_0048160 3300047319 Bacteria 3774
583 Ga0495674_0066260 3300047319 Bacteria 3134
584 Ga0495674_0074637 3300047319 Bacteria 2920
585 Ga0495674_0135288 3300047319 Bacteria 2074
586 Ga0495674_0178429 3300047319 Bacteria 1770
587 Ga0495674_0410430 3300047319 Bacteria 1092
588 Ga0495676_0010819 3300047321 Bacteria 8254
589 Ga0495676_0316275 3300047321 Bacteria 1050
590 Ga0495680_0002808 3300047322 Bacteria 17526
591 Ga0495680_0013957 3300047322 Bacteria 6984
592 Ga0495680_0038791 3300047322 Bacteria 3803
593 Ga0495675_0062935 3300047444 Bacteria 2348
594 Ga0495675_0188841 3300047444 Bacteria 1259
595 Ga0495684_0010094 3300047471 Bacteria 7301
596 Ga0495684_0017192 3300047471 Bacteria 5569
597 Ga0495684_0135499 3300047471 Bacteria 1848
598 Ga0495684_0177550 3300047471 Bacteria 1580
599 Ga0495593_0034877 3300047673 Bacteria 2734
600 Ga0495602_0184682 3300048088 Bacteria 1604
601 Ga0496100_0002141 3300048903 Bacteria 9943
602 Ga0496100_0010573 3300048903 Bacteria 5227
603 Ga0496100_0077276 3300048903 Bacteria 2237
604 Ga0496100_0123490 3300048903 Unclassified 1815
605 Ga0496100_0262368 3300048903 Bacteria 1281
606 Ga0496100_0286640 3300048903 Bacteria 1229
607 Ga0496100_0289149 3300048903 Bacteria 1224
608 Ga0496101_0003246 3300048904 Bacteria 10098
609 Ga0496101_0008450 3300048904 Bacteria 6726
610 Ga0496101_0075035 3300048904 Bacteria 2489
611 Ga0496101_0118588 3300048904 Bacteria 1999
612 Ga0496101_0183115 3300048904 Unclassified 1614
613 Ga0496101_0239683 3300048904 Unclassified 1411
614 Ga0496102_0015240 3300048905 Bacteria 6693
615 Ga0496102_0033547 3300048905 Bacteria 4613
616 Ga0496102_0036696 3300048905 Bacteria 4417
617 Ga0496102_0094414 3300048905 Bacteria 2771
618 Ga0496102_0178052 3300048905 Bacteria 2003
619 Ga0496102_0228980 3300048905 Unclassified 1752
620 Ga0496102_0324263 3300048905 Bacteria 1451
621 Ga0496103_0009929 3300048906 Bacteria 5630
622 Ga0496103_0013183 3300048906 Bacteria 4900
623 Ga0496103_0023476 3300048906 Bacteria 3719
624 Ga0496103_0079968 3300048906 Bacteria 2055
625 Ga0496103_0216196 3300048906 Unclassified 1233
626 Ga0496104_0000571 3300048907 Bacteria 31432
627 Ga0496104_0004078 3300048907 Bacteria 12675
628 Ga0496104_0005220 3300048907 Bacteria 11361
629 Ga0496104_0019739 3300048907 Bacteria 6171
630 Ga0496104_0035179 3300048907 Bacteria 4676
631 Ga0496104_0079281 3300048907 Bacteria 3130
632 Ga0496104_0087676 3300048907 Bacteria 2972
633 Ga0496104_0098240 3300048907 Bacteria 2803
634 Ga0496104_0241462 3300048907 Unclassified 1719
635 Ga0496104_0277031 3300048907 Bacteria 1590
636 Ga0496104_0340039 3300048907 Bacteria 1414
637 Ga0496105_0000961 3300048908 Bacteria 19773
638 Ga0496105_0013879 3300048908 Bacteria 6401
639 Ga0496105_0022313 3300048908 Bacteria 5127
640 Ga0496105_0064809 3300048908 Bacteria 3015
641 Ga0496105_0200031 3300048908 Unclassified 1631
642 Ga0496105_0266436 3300048908 Bacteria 1384
643 Ga0496106_0001809 3300048909 Bacteria 15988
644 Ga0496106_0025369 3300048909 Bacteria 4411
645 Ga0496106_0053774 3300048909 Bacteria 3042
646 Ga0496106_0082099 3300048909 Bacteria 2477
647 Ga0496106_0121176 3300048909 Bacteria 2045
648 Ga0496107_0004439 3300048910 Bacteria 9510
649 Ga0496107_0042383 3300048910 Bacteria 3269
650 Ga0496107_0094240 3300048910 Bacteria 2190
651 Ga0496107_0256036 3300048910 Bacteria 1302
652 Ga0496107_0345997 3300048910 Bacteria 1106
653 Ga0496107_0435332 3300048910 Bacteria 975
654 Ga0496108_0007530 3300048911 Bacteria 8825
655 Ga0496108_0015055 3300048911 Bacteria 6315
656 Ga0496108_0022568 3300048911 Bacteria 5175
657 Ga0496108_0043914 3300048911 Bacteria 3733
658 Ga0496108_0179021 3300048911 Bacteria 1835
659 Ga0496108_0400155 3300048911 Unclassified 1199
660 Ga0496109_0000627 3300048912 Bacteria 29421
661 Ga0496109_0008805 3300048912 Bacteria 8594
662 Ga0496109_0013247 3300048912 Bacteria 7141
663 Ga0496109_0028086 3300048912 Bacteria 5030
664 Ga0496109_0043846 3300048912 Bacteria 4055
665 Ga0496109_0048014 3300048912 Bacteria 3883
666 Ga0496109_0117678 3300048912 Bacteria 2474
667 Ga0496109_0159257 3300048912 Bacteria 2115
668 Ga0496109_0220938 3300048912 Bacteria 1782
669 Ga0496109_0329778 3300048912 Unclassified 1441
670 Ga0496109_0458929 3300048912 Unclassified 1203
671 Ga0496110_0001697 3300048913 Bacteria 16194
672 Ga0496110_0005281 3300048913 Bacteria 10110
673 Ga0496110_0022917 3300048913 Bacteria 5306
674 Ga0496110_0025078 3300048913 Bacteria 5091
675 Ga0496110_0027947 3300048913 Bacteria 4840
676 Ga0496110_0042261 3300048913 Bacteria 3979
677 Ga0496110_0056582 3300048913 Bacteria 3452
678 Ga0496110_0060509 3300048913 Bacteria 3340
679 Ga0496110_0064292 3300048913 Bacteria 3242
680 Ga0496110_0108812 3300048913 Bacteria 2489
681 Ga0496110_0335792 3300048913 Bacteria 1377
682 Ga0496110_0371625 3300048913 Unclassified 1303
683 Ga0496110_0624644 3300048913 Bacteria 976
684 Ga0496111_0000025 3300048914 Bacteria 62100
685 Ga0496111_0009321 3300048914 Bacteria 6546
686 Ga0496111_0017357 3300048914 Bacteria 4976
687 Ga0496111_0021089 3300048914 Bacteria 4545
688 Ga0496111_0059634 3300048914 Bacteria 2765
689 Ga0496111_0096630 3300048914 Bacteria 2168
690 Ga0496111_0140340 3300048914 Unclassified 1791
691 Ga0496112_0000682 3300048915 Bacteria 23689
692 Ga0496112_0001024 3300048915 Bacteria 20548
693 Ga0496112_0015247 3300048915 Bacteria 7165
694 Ga0496112_0098785 3300048915 Bacteria 2888
695 Ga0496112_0105101 3300048915 Bacteria 2793
696 Ga0496112_0159028 3300048915 Bacteria 2226
697 Ga0496113_0053493 3300048916 Bacteria 3019
698 Ga0496113_0166023 3300048916 Bacteria 1746
699 Ga0496113_0197122 3300048916 Bacteria 1600
700 Ga0496114_0001762 3300048917 Bacteria 16435
701 Ga0496114_0001903 3300048917 Bacteria 15881
702 Ga0496114_0007861 3300048917 Bacteria 8436
703 Ga0496114_0016390 3300048917 Bacteria 5970
704 Ga0496114_0024485 3300048917 Bacteria 4929
705 Ga0496114_0042179 3300048917 Bacteria 3782
706 Ga0496114_0093406 3300048917 Bacteria 2558
707 Ga0496114_0247627 3300048917 Bacteria 1568
708 Ga0496114_0269823 3300048917 Bacteria 1499
709 Ga0496114_0295282 3300048917 Unclassified 1430
710 Ga0496115_0040733 3300048918 Bacteria 3694
711 Ga0496115_0060979 3300048918 Bacteria 3040
712 Ga0496115_0197105 3300048918 Bacteria 1664
713 Ga0496115_0236775 3300048918 Bacteria 1505
714 Ga0501031_0002836 3300049568 Bacteria 11064
715 Ga0501031_0017768 3300049568 Bacteria 4625
716 Ga0501032_0075615 3300049569 Bacteria 2243
717 Ga0501032_0114185 3300049569 Bacteria 1786
718 Ga0501033_0007191 3300049570 Bacteria 8688
719 Ga0501033_0027422 3300049570 Bacteria 4283
720 Ga0501033_0065676 3300049570 Bacteria 2669
721 Ga0501033_0088107 3300049570 Bacteria 2271
722 Ga0501034_0199999 3300049571 Bacteria 1957
723 Ga0501036_0012624 3300049572 Bacteria 7006
724 Ga0501036_0113734 3300049572 Unclassified 2287
725 Ga0501036_0131125 3300049572 Bacteria 2116
726 Ga0501037_0004757 3300049573 Bacteria 9874
727 Ga0501037_0055474 3300049573 Bacteria 2897
728 Ga0501037_0056883 3300049573 Bacteria 2856
729 Ga0501037_0111132 3300049573 Unclassified 1974
730 Ga0501037_0221647 3300049573 Unclassified 1330
731 Ga0501038_0025085 3300049574 Bacteria 5314
732 Ga0501038_0103840 3300049574 Bacteria 2363
733 Ga0501038_0116457 3300049574 Bacteria 2208
734 Ga0501039_0026847 3300049575 Bacteria 4425
735 Ga0501039_0031443 3300049575 Bacteria 4092
736 Ga0501039_0058587 3300049575 Bacteria 2983
737 Ga0501039_0540606 3300049575 Bacteria 914
738 Ga0501040_0004225 3300049576 Bacteria 9349
739 Ga0501040_0006707 3300049576 Bacteria 7467
740 Ga0501040_0051156 3300049576 Bacteria 2827
741 Ga0501040_0051564 3300049576 Bacteria 2815
742 Ga0501040_0118448 3300049576 Unclassified 1857
743 Ga0501040_0255651 3300049576 Bacteria 1250
744 Ga0501041_0022506 3300049577 Bacteria 3773
745 Ga0501041_0036129 3300049577 Bacteria 2994
746 Ga0501041_0052622 3300049577 Bacteria 2482
747 Ga0501041_0066014 3300049577 Bacteria 2217
748 Ga0501041_0134209 3300049577 Unclassified 1542
749 Ga0501042_0001269 3300049578 Bacteria 14695
750 Ga0501042_0111581 3300049578 Bacteria 1969
751 Ga0501042_0212918 3300049578 Unclassified 1394
752 Ga0501043_0040443 3300049579 Bacteria 3664
753 Ga0501043_0076526 3300049579 Bacteria 2629
754 Ga0501046_0018637 3300049580 Bacteria 5769
755 Ga0501046_0122421 3300049580 Bacteria 1978
756 Ga0501046_0133594 3300049580 Bacteria 1880
757 Ga0501047_0035031 3300049581 Bacteria 4848
758 Ga0501047_0040099 3300049581 Bacteria 4529
759 Ga0501048_0003992 3300049582 Bacteria 11203
760 Ga0501048_0004624 3300049582 Bacteria 10472
761 Ga0501048_0022506 3300049582 Bacteria 4608
762 Ga0501048_0142960 3300049582 Bacteria 1692
763 Ga0501067_0006469 3300049583 Bacteria 6494
764 Ga0501067_0009510 3300049583 Bacteria 5383
765 Ga0501067_0027413 3300049583 Bacteria 3156
766 Ga0501067_0130097 3300049583 Unclassified 1401
767 Ga0501068_0011088 3300049584 Bacteria 5074
768 Ga0501068_0024085 3300049584 Bacteria 3573
769 Ga0501068_0064431 3300049584 Bacteria 2230
770 Ga0501069_0002808 3300049585 Bacteria 8905
771 Ga0501069_0075272 3300049585 Unclassified 1896
772 Ga0501069_0084623 3300049585 Bacteria 1789
773 Ga0501069_0201518 3300049585 Unclassified 1153
774 Ga0501070_0016720 3300049586 Bacteria 6160
775 Ga0501070_0018287 3300049586 Bacteria 5879
776 Ga0501070_0104028 3300049586 Bacteria 2348
777 Ga0501070_0161197 3300049586 Bacteria 1849
778 Ga0501070_0201304 3300049586 Bacteria 1635
779 Ga0501070_0442958 3300049586 Bacteria 1048
780 Ga0501071_0008934 3300049587 Bacteria 6647
781 Ga0501071_0010714 3300049587 Bacteria 6148
782 Ga0501071_0035465 3300049587 Bacteria 3552
783 Ga0501071_0039658 3300049587 Bacteria 3369
784 Ga0501071_0054932 3300049587 Bacteria 2874
785 Ga0501071_0420380 3300049587 Unclassified 1021
786 Ga0501072_0001727 3300049588 Bacteria 16281
787 Ga0501072_0002225 3300049588 Bacteria 14491
788 Ga0501072_0017112 3300049588 Bacteria 5570
789 Ga0501072_0020437 3300049588 Bacteria 5130
790 Ga0501072_0023758 3300049588 Bacteria 4761
791 Ga0501072_0117538 3300049588 Bacteria 2118
792 Ga0501072_0181709 3300049588 Bacteria 1678
793 Ga0501073_0012804 3300049589 Bacteria 6116
794 Ga0501073_0015813 3300049589 Bacteria 5468
795 Ga0501074_0006671 3300049590 Bacteria 8338
796 Ga0501074_0018234 3300049590 Bacteria 5099
797 Ga0501074_0045956 3300049590 Bacteria 3158
798 Ga0501074_0068661 3300049590 Unclassified 2548
799 Ga0501074_0075114 3300049590 Bacteria 2426
800 Ga0501074_0085228 3300049590 Bacteria 2264
801 Ga0501074_0104690 3300049590 Unclassified 2026
802 Ga0501075_0005199 3300049591 Bacteria 8900
803 Ga0501075_0022115 3300049591 Bacteria 4643
804 Ga0501075_0025704 3300049591 Bacteria 4326
805 Ga0501075_0057919 3300049591 Bacteria 2917
806 Ga0501075_0106103 3300049591 Bacteria 2135
807 Ga0501075_0316317 3300049591 Bacteria 1190
808 Ga0501075_0449562 3300049591 Unclassified 982
809 Ga0501076_0000834 3300049592 Bacteria 20025
810 Ga0501076_0003822 3300049592 Bacteria 10607
811 Ga0501076_0008714 3300049592 Bacteria 7448
812 Ga0501076_0011656 3300049592 Bacteria 6559
813 Ga0501076_0014431 3300049592 Bacteria 5951
814 Ga0501076_0154369 3300049592 Unclassified 1868
815 Ga0501077_0003475 3300049593 Bacteria 9463
816 Ga0501077_0009651 3300049593 Bacteria 5999
817 Ga0501077_0010250 3300049593 Bacteria 5833
818 Ga0501077_0045036 3300049593 Bacteria 2802
819 Ga0501077_0078980 3300049593 Bacteria 2085
820 Ga0501077_0109569 3300049593 Bacteria 1749
821 Ga0501077_0160342 3300049593 Bacteria 1428
822 Ga0501079_0006508 3300049741 Bacteria 8774
823 Ga0501079_0035313 3300049741 Bacteria 3848
824 Ga0501079_0064935 3300049741 Bacteria 2815
825 Ga0501079_0100673 3300049741 Bacteria 2240
826 Ga0501079_0183348 3300049741 Bacteria 1634
827 Ga0501079_0358244 3300049741 Unclassified 1143
828 Ga0501079_0387723 3300049741 Unclassified 1095
829 Ga0501080_0007957 3300049742 Bacteria 9606
830 Ga0501080_0017900 3300049742 Bacteria 6559
831 Ga0501080_0024243 3300049742 Bacteria 5625
832 Ga0501080_0039727 3300049742 Bacteria 4391
833 Ga0501080_0060872 3300049742 Bacteria 3515
834 Ga0501080_0684746 3300049742 Bacteria 905
835 Ga0501081_0005843 3300049743 Bacteria 7964
836 Ga0501081_0012576 3300049743 Bacteria 5565
837 Ga0501081_0017634 3300049743 Bacteria 4730
838 Ga0501081_0041920 3300049743 Bacteria 3136
839 Ga0501081_0041975 3300049743 Bacteria 3134
840 Ga0501083_0012338 3300049744 Bacteria 5979
841 Ga0501083_0019786 3300049744 Bacteria 4684
842 Ga0501083_0021887 3300049744 Bacteria 4439
843 Ga0501083_0038176 3300049744 Bacteria 3266
844 Ga0501035_0008332 3300049822 Bacteria 9652
845 Ga0501035_0014191 3300049822 Bacteria 7352
846 Ga0501035_0056136 3300049822 Unclassified 3515
847 Ga0501035_0114670 3300049822 Bacteria 2359
848 Ga0501035_0347331 3300049822 Bacteria 1242
849 Ga0501044_0097329 3300049823 Bacteria 2964
850 Ga0501044_0158269 3300049823 Bacteria 2244
851 Ga0501044_0489463 3300049823 Unclassified 1132
852 Ga0501045_0009365 3300049824 Bacteria 6848
853 Ga0501045_0019112 3300049824 Bacteria 4880
854 Ga0501045_0020864 3300049824 Bacteria 4683
855 Ga0501045_0031561 3300049824 Bacteria 3837
856 Ga0501045_0036920 3300049824 Bacteria 3550
857 Ga0501045_0052158 3300049824 Bacteria 2985
858 nmdc:mga00v17_44846_c1 3300050491 Bacteria 2668
859 nmdc:mga05p37_131358_c1 3300050507 Unclassified 3072
860 nmdc:mga05p37_335168_c1 3300050507 Bacteria 1785
861 nmdc:mga05p37_572913_c1 3300050507 Bacteria 1280
862 nmdc:mga06r32_655215_c1 3300050510 Bacteria 1018
863 nmdc:mga08y16_11536_c1 3300050511 Bacteria 9286
864 nmdc:mga08y16_161059_c1 3300050511 Bacteria 2331
865 nmdc:mga08y16_237767_c1 3300050511 Bacteria 1883
866 nmdc:mga0n895_11302_c1 3300050512 Bacteria 7956
867 nmdc:mga0n895_365757_c1 3300050512 Bacteria 1460
868 nmdc:mga0n895_39210_c1 3300050512 Bacteria 4595
869 nmdc:mga0n895_50037_c1 3300050512 Bacteria 4096
870 nmdc:mga0n895_95008_c1 3300050512 Unclassified 2985
871 nmdc:mga0n895_9898_c1 3300050512 Bacteria 8383
872 nmdc:mga0rr50_44863_c1 3300050513 Bacteria 3245
873 nmdc:mga0rr50_4672_c1 3300050513 Bacteria 8072
874 nmdc:mga08x19_19817_c1 3300050514 Bacteria 4134
875 nmdc:mga08x19_24507_c1 3300050514 Bacteria 3751
876 nmdc:mga0a205_148913_c1 3300050515 Bacteria 2241
877 nmdc:mga0a205_45043_c1 3300050515 Bacteria 4254
878 nmdc:mga0a205_8555_c1 3300050515 Bacteria 9308
879 Ga0495601_0034467 3300053077 Bacteria 3159
880 Ga0495601_0078583 3300053077 Bacteria 2114
881 Ga0495601_0139877 3300053077 Bacteria 1579
882 Ga0495601_0149931 3300053077 Bacteria 1522
883 Ga0495601_0218470 3300053077 Bacteria 1245
884 Ga0495655_0016543 3300053083 Bacteria 1590
885 Ga0495595_0019008 3300053084 Bacteria 2976
886 Ga0495619_0000860 3300053085 Bacteria 19904
887 Ga0495619_0001914 3300053085 Bacteria 13865
888 Ga0495619_0014380 3300053085 Bacteria 4997
889 Ga0495619_0137466 3300053085 Unclassified 1681
890 Ga0501084_0004414 3300054114 Bacteria 11476
891 Ga0501084_0013953 3300054114 Bacteria 6650
892 Ga0501084_0092595 3300054114 Bacteria 2537
893 Ga0501084_0094576 3300054114 Bacteria 2509
894 Ga0501084_0100271 3300054114 Bacteria 2431
895 Ga0501084_0133956 3300054114 Bacteria 2086
896 Ga0501084_0508202 3300054114 Bacteria 1019
897 Ga0501082_0004996 3300060353 Bacteria 11580
898 Ga0501082_0011334 3300060353 Bacteria 7663
899 Ga0501082_0064008 3300060353 Bacteria 3166
900 Ga0501082_0105056 3300060353 Bacteria 2443
901 Ga0501082_0317216 3300060353 Bacteria 1358
902 Ga0501082_0327253 3300060353 Bacteria 1335
903 Ga0466962_0004266 3300061719 Bacteria 6848
904 Ga0530510_0004794 3300061734 Bacteria 9367
905 Ga0530510_0024059 3300061734 Bacteria 4344
906 Ga0530510_0028662 3300061734 Bacteria 3992
907 Ga0530510_0080271 3300061734 Unclassified 2374
908 Ga0530510_0139089 3300061734 Bacteria 1788
909 Ga0530510_0329862 3300061734 Bacteria 1145
910 Ga0307416_100010185
911 Ga0070658_10014999
912 Ga0070658_10055542
913 Ga0070658_10139147
914 Ga0070658_10202757
915 Ga0070658_10330707
916 Ga0070658_10563427
917 Ga0070683_100005095
918 Ga0070683_100043245
919 Ga0070683_100085844
920 Ga0070683_100135833
921 Ga0070683_100151432
922 Ga0070683_100243527
923 Ga0068869_100075053
924 Ga0070680_100008922
925 Ga0070680_100014704
926 Ga0070680_100088710
927 Ga0070680_100092128
928 Ga0070680_100206708
929 Ga0070682_100002080
930 Ga0070682_100028763
931 Ga0070682_100067429
932 Ga0070682_100280772
933 Ga0068868_100041284
934 Ga0070660_100000987
935 Ga0070660_100001169
936 Ga0070660_100002777
937 Ga0070660_100054715
938 Ga0070660_100149773
939 Ga0070691_10073192
940 Ga0070691_10100051
941 Ga0070687_100237983
942 Ga0070661_100113408
943 Ga0070668_100313285
944 Ga0070668_100447658
945 Ga0070675_100119207
946 Ga0070671_100083167
947 Ga0070673_100188108
948 Ga0070673_100435203
949 Ga0070659_100004290
950 Ga0070659_100111814
951 Ga0070667_100079168
952 Ga0070703_10049195
953 Ga0070709_10051800
954 Ga0070714_100137507
955 Ga0070714_100194507
956 Ga0070714_100308579
957 Ga0070701_10012978
958 Ga0070711_100010525
959 Ga0070700_100195679
960 Ga0070708_100021939
961 Ga0070708_100215419
962 Ga0070663_100025646
963 Ga0070663_100146324
964 Ga0070663_100171437
965 Ga0070678_100004632
966 Ga0070678_100021921
967 Ga0070678_100088598
968 Ga0070681_10004684
969 Ga0070681_10017778
970 Ga0070681_10072461
971 Ga0070681_10079101
972 Ga0070681_10134187
973 Ga0070681_10173488
974 Ga0068867_100203016
975 Ga0070685_10004070
976 Ga0070706_100329157
977 Ga0070706_100559275
978 Ga0070707_100041336
979 Ga0070707_100141182
980 Ga0070707_100216846
981 Ga0070698_100133718
982 Ga0070699_100245804
983 Ga0070679_100001218
984 Ga0070679_100004651
985 Ga0070679_100007568
986 Ga0070679_100015547
987 Ga0070679_100088082
988 Ga0070679_100125369
989 Ga0070679_100173545
990 Ga0070679_100206726
991 Ga0070684_100000286
992 Ga0070684_100002106
993 Ga0070684_100013868
994 Ga0070684_100035846
995 Ga0070684_100060170
996 Ga0070684_100110894
997 Ga0070684_100281169
998 Ga0070684_100302665
999 Ga0070697_100283089
1000 Ga0068853_100025116
1001 Ga0070672_100203103
1002 Ga0070686_100170754
1003 Ga0070695_100151190
1004 Ga0070696_100088809
1005 Ga0070693_100009173
1006 Ga0070693_100136189
1007 Ga0070704_100015570
1008 Ga0070704_100049551
1009 Ga0070704_100091849
1010 Ga0068855_100037454
1011 Ga0068855_100041238
1012 Ga0068855_100095042
1013 Ga0068855_100188790
1014 Ga0070664_100021964
1015 Ga0070664_100046027
1016 Ga0070664_100088838
1017 Ga0070664_100123079
1018 Ga0070664_100133260
1019 Ga0068857_100042520
1020 Ga0068857_100055433
1021 Ga0068857_100177333
1022 Ga0068857_100232663
1023 Ga0068857_100385005
1024 Ga0068856_100021996
1025 Ga0068856_100032908
1026 Ga0068856_100121997
1027 Ga0068856_100698265
1028 Ga0070702_100014210
1029 Ga0070702_100014973
1030 Ga0068852_100050181
1031 Ga0068864_100014602
1032 Ga0068864_100377122
1033 Ga0068861_100125109
1034 Ga0068861_100334402
1035 Ga0068851_10032592
1036 Ga0068851_10060482
1037 Ga0068851_10158616
1038 Ga0068870_10112731
1039 Ga0068870_10129831
1040 Ga0068858_100016800
1041 Ga0068860_100052269
1042 Ga0081455_10005553
1043 Ga0081455_10021586
1044 Ga0081455_10041400
1045 Ga0081455_10184200
1046 Ga0081540_1012803
1047 Ga0081539_10000712
1048 Ga0081539_10002673
1049 Ga0070717_10076668
1050 Ga0070717_10084650
1051 Ga0070717_10344823
1052 Ga0075432_10012364
1053 Ga0070716_100046550
1054 Ga0070716_100300818
1055 Ga0070712_100004684
1056 Ga0070712_100036378
1057 Ga0070712_100039370
1058 Ga0070712_100089081
1059 Ga0070712_100167708
1060 Ga0070712_100312425
1061 Ga0075367_10100213
1062 Ga0068871_100316933
1063 Ga0075428_100088832
1064 Ga0075428_100261873
1065 Ga0075428_100524166
1066 Ga0075428_100537389
1067 Ga0075433_10008842
1068 Ga0075433_10022515
1069 Ga0075433_10032720
1070 Ga0075433_10192143
1071 Ga0075434_100013022
1072 Ga0075434_100107931
1073 Ga0075434_100166640
1074 Ga0075434_100375839
1075 Ga0075434_100388395
1076 Ga0068865_100009909
1077 Ga0068865_100031618
1078 Ga0068865_100076755
1079 Ga0075436_100012021
1080 Ga0075436_100024460
1081 Ga0075436_100077116
1082 Ga0075436_100123089
1083 Ga0075435_100012599
1084 Ga0075435_100027092
1085 Ga0105240_10029379
1086 Ga0105240_10059378
1087 Ga0105240_10120718
1088 Ga0105240_10206823
1089 Ga0111539_10011337
1090 Ga0111539_10040887
1091 Ga0111539_10044887
1092 Ga0111539_10063304
1093 Ga0111539_10333887
1094 Ga0111539_10398611
1095 Ga0105245_10033516
1096 Ga0105245_10045484
1097 Ga0105245_10398926
1098 Ga0105245_10407954
1099 Ga0105247_10045020
1100 Ga0114129_10048125
1101 Ga0114129_10089957
1102 Ga0114129_10178559
1103 Ga0114129_10409961
1104 Ga0105243_10005927
1105 Ga0105243_10026222
1106 Ga0105243_10187977
1107 Ga0105243_10214490
1108 Ga0105243_10278918
1109 Ga0105243_10340682
1110 Ga0105241_10319467
1111 Ga0105242_10078749
1112 Ga0105242_10114080
1113 Ga0105242_10303793
1114 Ga0105248_10211114
1115 Ga0105237_10060611
1116 Ga0105238_10015630
1117 Ga0105249_10037426
1118 Ga0105249_10223565
1119 Ga0105239_10036761
1120 Ga0105239_10136164
1121 Ga0105239_10255997
1122 Ga0105246_10011293
1123 Ga0105246_10040253
1124 Ga0157373_10273610
1125 Ga0157370_10030380
1126 Ga0157370_10035597
1127 Ga0157370_10076192
1128 Ga0157369_10003190
1129 Ga0157369_10006794
1130 Ga0157369_10135804
1131 Ga0157369_10169134
1132 Ga0157374_10008984
1133 Ga0157374_10128899
1134 Ga0157374_10137631
1135 Ga0157374_10785813
1136 Ga0163162_10878477
1137 Ga0157372_10022486
1138 Ga0157372_10070280
1139 Ga0157372_10093063
1140 Ga0157372_10414823
1141 Ga0157375_10072787
1142 Ga0157375_10243759
1143 Ga0163163_10141851
1144 Ga0163163_10231316
1145 Ga0157380_10030996
1146 Ga0157377_10050141
1147 Ga0157377_10073965
1148 Ga0157377_10197064
1149 Ga0157379_10008081
1150 Ga0157379_10015282
1151 Ga0157376_10009504
1152 Ga0157376_10134305
1153 Ga0157376_10364004
1154 Ga0206356_11895397
1155 Ga0206354_10788483
1156 Ga0206354_11630888
1157 Ga0206353_11415625
1158 Ga0206353_11601542
1159 Ga0207653_10009255
1160 Ga0207692_10067871
1161 Ga0207645_10054929
1162 Ga0207643_10007509
1163 Ga0207705_10007957
1164 Ga0207684_10188438
1165 Ga0207654_10077693
1166 Ga0207707_10003902
1167 Ga0207707_10004085
1168 Ga0207707_10031620
1169 Ga0207707_10045695
1170 Ga0207707_10056574
1171 Ga0207707_10130861
1172 Ga0207707_10142260
1173 Ga0207707_10292976
1174 Ga0207707_10324570
1175 Ga0207695_10263121
1176 Ga0207695_10289984
1177 Ga0207671_10230223
1178 Ga0207693_10002465
1179 Ga0207693_10006225
1180 Ga0207693_10021715
1181 Ga0207693_10045347
1182 Ga0207693_10183700
1183 Ga0207693_10206786
1184 Ga0207663_10105012
1185 Ga0207660_10014400
1186 Ga0207660_10024911
1187 Ga0207660_10189797
1188 Ga0207657_10000046
1189 Ga0207657_10004670
1190 Ga0207657_10042210
1191 Ga0207657_10042628
1192 Ga0207657_10094324
1193 Ga0207657_10126311
1194 Ga0207649_10019235
1195 Ga0207649_10048163
1196 Ga0207649_10218712
1197 Ga0207649_10280126
1198 Ga0207649_10351575
1199 Ga0207652_10006892
1200 Ga0207652_10041215
1201 Ga0207652_10087240
1202 Ga0207652_10087576
1203 Ga0207652_10131087
1204 Ga0207652_10234910
1205 Ga0207646_10039067
1206 Ga0207646_10197755
1207 Ga0207646_10396258
1208 Ga0207694_10014338
1209 Ga0207694_10194327
1210 Ga0207687_10009713
1211 Ga0207687_10010814
1212 Ga0207687_10240376
1213 Ga0207700_10034480
1214 Ga0207664_10105869
1215 Ga0207664_10249254
1216 Ga0207664_10690694
1217 Ga0207690_10341088
1218 Ga0207706_10072795
1219 Ga0207706_10109698
1220 Ga0207686_10322957
1221 Ga0207709_10004893
1222 Ga0207709_10027758
1223 Ga0207709_10120591
1224 Ga0207709_10203453
1225 Ga0207709_10290189
1226 Ga0207709_10449924
1227 Ga0207669_10016875
1228 Ga0207704_10012479
1229 Ga0207704_10026920
1230 Ga0207704_10064600
1231 Ga0207704_10106511
1232 Ga0207704_10200501
1233 Ga0207665_10003617
1234 Ga0207691_10043160
1235 Ga0207711_10203594
1236 Ga0207689_10067839
1237 Ga0207689_10069438
1238 Ga0207661_10003778
1239 Ga0207661_10010487
1240 Ga0207661_10014601
1241 Ga0207661_10016038
1242 Ga0207661_10046285
1243 Ga0207661_10070805
1244 Ga0207661_10077276
1245 Ga0207661_10114824
1246 Ga0207661_10164314
1247 Ga0207679_10025645
1248 Ga0207679_10077368
1249 Ga0207679_10094843
1250 Ga0207679_10235960
1251 Ga0207667_10049261
1252 Ga0207667_10153733
1253 Ga0207667_10290498
1254 Ga0207667_10483752
1255 Ga0207651_10233314
1256 Ga0207712_10026346
1257 Ga0207712_10090867
1258 Ga0207640_10089330
1259 Ga0207677_10319779
1260 Ga0207703_10138211
1261 Ga0207639_10076169
1262 Ga0207639_10089922
1263 Ga0207639_10141330
1264 Ga0207639_10309824
1265 Ga0207639_10540966
1266 Ga0207678_10025566
1267 Ga0207678_10155621
1268 Ga0207702_10013421
1269 Ga0207702_10026096
1270 Ga0207702_10158445
1271 Ga0207702_10310855
1272 Ga0207641_10120808
1273 Ga0207648_10312083
1274 Ga0207674_10000589
1275 Ga0207674_10054841
1276 Ga0207674_10086205
1277 Ga0207674_10278559
1278 Ga0207683_10014750
1279 Ga0207683_10027940
1280 Ga0207683_10045987
1281 Ga0207698_10137922
1282 Ga0207428_10053447
1283 Ga0207428_10149316
1284 Ga0268266_10014070
1285 Ga0268265_10047379
1286 Ga0268265_10171348
1287 Ga0268264_10194913
1288 Ga0265323_10055471
1289 Ga0265338_10170025
1290 Ga0265338_10199356
1291 Ga0265325_10022952
1292 Ga0265339_10024386
1293 Ga0265327_10020304
1294 Ga0265327_10059895
1295 Ga0307408_100137892
1296 Ga0307408_100189782
1297 Ga0265342_10034167
1298 Ga0307409_100051627
1299 Ga0307415_100048805
1300 Ga0373930_0016453
1301 Ga0373928_0010580
1302 Ga0373951_0000908
1303 Ga0373932_0026731
1304 Ga0373939_0087376
1305 Ga0373941_0002261
1306 Ga0373945_0007159
1307 Ga0373943_0000112
1308 Ga0373943_0078661
1309 Ga0373931_0051738
1310 Ga0373947_0000600
1311 Ga0373947_0002931
1312 Ga0373947_0039500
1313 Ga0373925_0007897
1314 Ga0373925_0024389
1315 Ga0395899_0005838
1316 Ga0395899_0013404
1317 Ga0395899_0046945
1318 Ga0395899_0081277
1319 Ga0395899_0096962
1320 Ga0395899_0125278
1321 Ga0395900_0001970
1322 Ga0395900_0003522
1323 Ga0395900_0008763
1324 Ga0395900_0011690
1325 Ga0395900_0023971
1326 Ga0395900_0040529
1327 Ga0395900_0054626
1328 Ga0395900_0056594
1329 Ga0395900_0135223
1330 Ga0395900_0136016
1331 Ga0395900_0211572
1332 Ga0395900_0221380
1333 Ga0395898_0002384
1334 Ga0395898_0003184
1335 Ga0395898_0012598
1336 Ga0395898_0012993
1337 Ga0395898_0017911
1338 Ga0395898_0026766
1339 Ga0395898_0036101
1340 Ga0395898_0064600
1341 Ga0395898_0318157
1342 Ga0395898_0439470
1343 Ga0395898_0505324
1344 Ga0395905_0002425
1345 Ga0395905_0010165
1346 Ga0395905_0013914
1347 Ga0395905_0046824
1348 Ga0395905_0047631
1349 Ga0395905_0069679
1350 Ga0395901_0004313
1351 Ga0395901_0004948
1352 Ga0395901_0005093
1353 Ga0395901_0007139
1354 Ga0395901_0007152
1355 Ga0395901_0007511
1356 Ga0395901_0009134
1357 Ga0395901_0047223
1358 Ga0395901_0048345
1359 Ga0395901_0075284
1360 Ga0395901_0084227
1361 Ga0395901_0085122
1362 Ga0395901_0156763
1363 Ga0395901_0289450
1364 Ga0395901_0338625
1365 Ga0436365_1178642
1366 Ga0436363_1701464
1367 Ga0439461_0013281
1368 Ga0451853_1619588
1369 Ga0451853_1722531
1370 Ga0466961_0001257
1371 Ga0466961_0118988
1372 Ga0466961_0265418
1373 Ga0466963_0002591
1374 Ga0466963_0004141
1375 Ga0466963_0063705
1376 Ga0466963_0356777
1377 Ga0466964_0007132
1378 Ga0466964_0013174
1379 Ga0466964_0028663
1380 Ga0466971_0000806
1381 Ga0466971_0033780
1382 Ga0466968_0010622
1383 Ga0466968_0060902
1384 Ga0466968_0125587
1385 Ga0466970_0034332
1386 Ga0466970_0045822
1387 Ga0466957_0002131
1388 Ga0466957_0023621
1389 Ga0466959_0004135
1390 Ga0466959_0035983
1391 Ga0466959_0091984
1392 Ga0451576_0149243
1393 Ga0451576_0561135
1394 Ga0466958_0000213
1395 Ga0466958_0015744
1396 Ga0466958_0035234
1397 Ga0466958_0214544
1398 Ga0466967_0000845
1399 Ga0466967_0006891
1400 Ga0466967_0031187
1401 Ga0466967_0040463
1402 Ga0466967_0041570
1403 Ga0466967_0063013
1404 Ga0466967_0079569
1405 Ga0466967_0082366
1406 Ga0466967_0103884
1407 Ga0466967_0107621
1408 Ga0466967_0162669
1409 Ga0466967_0515305
1410 Ga0466967_0565403
1411 Ga0495592_0132283
1412 Ga0495603_0024564
1413 Ga0495603_0031182
1414 Ga0495603_0066499
1415 Ga0495629_0000593
1416 Ga0495629_0011270
1417 Ga0495629_0175130
1418 Ga0495629_0281082
1419 Ga0495641_0000529
1420 Ga0495641_0012570
1421 Ga0495651_0016198
1422 Ga0495651_0044071
1423 Ga0495651_0279756
1424 Ga0495653_0035219
1425 Ga0495653_0035557
1426 Ga0495653_0041954
1427 Ga0495582_0000056
1428 Ga0495582_0009950
1429 Ga0495582_0074001
1430 Ga0495582_0142819
1431 Ga0495605_0054430
1432 Ga0495662_0001726
1433 Ga0495662_0106926
1434 Ga0495584_0021606
1435 Ga0495584_0092941
1436 Ga0495594_0024875
1437 Ga0495608_0097646
1438 Ga0495608_0131194
1439 Ga0495608_0155018
1440 Ga0495608_0175839
1441 Ga0495608_0209026
1442 Ga0495618_0024979
1443 Ga0495630_0002187
1444 Ga0495630_0005694
1445 Ga0495630_0060446
1446 Ga0495630_0149966
1447 Ga0495630_0168340
1448 Ga0495630_0215366
1449 Ga0495637_0088975
1450 Ga0495644_0133162
1451 Ga0495652_0185315
1452 Ga0495652_0269425
1453 Ga0495665_0000364
1454 Ga0495665_0035067
1455 Ga0495640_0033296
1456 Ga0495640_0070703
1457 Ga0495586_0092655
1458 Ga0495645_0241711
1459 Ga0495645_0295235
1460 Ga0495667_0005804
1461 Ga0495667_0029564
1462 Ga0495667_0031250
1463 Ga0495667_0099868
1464 Ga0495656_0062466
1465 Ga0495634_0040558
1466 Ga0495634_0067864
1467 Ga0495634_0088462
1468 Ga0495634_0096497
1469 Ga0495635_0036613
1470 Ga0495635_0066558
1471 Ga0495588_0034334
1472 Ga0495657_0058777
1473 Ga0495599_0051253
1474 Ga0495623_0107662
1475 Ga0495646_0036425
1476 Ga0495646_0082403
1477 Ga0495647_0104644
1478 Ga0495658_0000204
1479 Ga0495613_0000401
1480 Ga0495613_0064032
1481 Ga0495613_0389244
1482 Ga0495624_0013229
1483 Ga0495624_0029068
1484 Ga0495624_0061784
1485 Ga0495600_0086665
1486 Ga0495581_0000517
1487 Ga0495581_0021502
1488 Ga0495604_0036305
1489 Ga0495674_0031365
1490 Ga0495674_0034483
1491 Ga0495674_0048160
1492 Ga0495674_0066260
1493 Ga0495674_0074637
1494 Ga0495674_0135288
1495 Ga0495674_0178429
1496 Ga0495674_0410430
1497 Ga0495676_0010819
1498 Ga0495676_0316275
1499 Ga0495680_0002808
1500 Ga0495680_0013957
1501 Ga0495680_0038791
1502 Ga0495675_0062935
1503 Ga0495675_0188841
1504 Ga0495684_0010094
1505 Ga0495684_0017192
1506 Ga0495684_0135499
1507 Ga0495684_0177550
1508 Ga0495593_0034877
1509 Ga0495602_0184682
1510 Ga0496100_0002141
1511 Ga0496100_0010573
1512 Ga0496100_0077276
1513 Ga0496100_0123490
1514 Ga0496100_0262368
1515 Ga0496100_0286640
1516 Ga0496100_0289149
1517 Ga0496101_0003246
1518 Ga0496101_0008450
1519 Ga0496101_0075035
1520 Ga0496101_0118588
1521 Ga0496101_0183115
1522 Ga0496101_0239683
1523 Ga0496102_0015240
1524 Ga0496102_0033547
1525 Ga0496102_0036696
1526 Ga0496102_0094414
1527 Ga0496102_0178052
1528 Ga0496102_0228980
1529 Ga0496102_0324263
1530 Ga0496103_0009929
1531 Ga0496103_0013183
1532 Ga0496103_0023476
1533 Ga0496103_0079968
1534 Ga0496103_0216196
1535 Ga0496104_0000571
1536 Ga0496104_0004078
1537 Ga0496104_0005220
1538 Ga0496104_0019739
1539 Ga0496104_0035179
1540 Ga0496104_0079281
1541 Ga0496104_0087676
1542 Ga0496104_0098240
1543 Ga0496104_0241462
1544 Ga0496104_0277031
1545 Ga0496104_0340039
1546 Ga0496105_0000961
1547 Ga0496105_0013879
1548 Ga0496105_0022313
1549 Ga0496105_0064809
1550 Ga0496105_0200031
1551 Ga0496105_0266436
1552 Ga0496106_0001809
1553 Ga0496106_0025369
1554 Ga0496106_0053774
1555 Ga0496106_0082099
1556 Ga0496106_0121176
1557 Ga0496107_0004439
1558 Ga0496107_0042383
1559 Ga0496107_0094240
1560 Ga0496107_0256036
1561 Ga0496107_0345997
1562 Ga0496107_0435332
1563 Ga0496108_0007530
1564 Ga0496108_0015055
1565 Ga0496108_0022568
1566 Ga0496108_0043914
1567 Ga0496108_0179021
1568 Ga0496108_0400155
1569 Ga0496109_0000627
1570 Ga0496109_0008805
1571 Ga0496109_0013247
1572 Ga0496109_0028086
1573 Ga0496109_0043846
1574 Ga0496109_0048014
1575 Ga0496109_0117678
1576 Ga0496109_0159257
1577 Ga0496109_0220938
1578 Ga0496109_0329778
1579 Ga0496109_0458929
1580 Ga0496110_0001697
1581 Ga0496110_0005281
1582 Ga0496110_0022917
1583 Ga0496110_0025078
1584 Ga0496110_0027947
1585 Ga0496110_0042261
1586 Ga0496110_0056582
1587 Ga0496110_0060509
1588 Ga0496110_0064292
1589 Ga0496110_0108812
1590 Ga0496110_0335792
1591 Ga0496110_0371625
1592 Ga0496110_0624644
1593 Ga0496111_0000025
1594 Ga0496111_0009321
1595 Ga0496111_0017357
1596 Ga0496111_0021089
1597 Ga0496111_0059634
1598 Ga0496111_0096630
1599 Ga0496111_0140340
1600 Ga0496112_0000682
1601 Ga0496112_0001024
1602 Ga0496112_0015247
1603 Ga0496112_0098785
1604 Ga0496112_0105101
1605 Ga0496112_0159028
1606 Ga0496113_0053493
1607 Ga0496113_0166023
1608 Ga0496113_0197122
1609 Ga0496114_0001762
1610 Ga0496114_0001903
1611 Ga0496114_0007861
1612 Ga0496114_0016390
1613 Ga0496114_0024485
1614 Ga0496114_0042179
1615 Ga0496114_0093406
1616 Ga0496114_0247627
1617 Ga0496114_0269823
1618 Ga0496114_0295282
1619 Ga0496115_0040733
1620 Ga0496115_0060979
1621 Ga0496115_0197105
1622 Ga0496115_0236775
1623 Ga0501031_0002836
1624 Ga0501031_0017768
1625 Ga0501032_0075615
1626 Ga0501032_0114185
1627 Ga0501033_0007191
1628 Ga0501033_0027422
1629 Ga0501033_0065676
1630 Ga0501033_0088107
1631 Ga0501034_0199999
1632 Ga0501036_0012624
1633 Ga0501036_0113734
1634 Ga0501036_0131125
1635 Ga0501037_0004757
1636 Ga0501037_0055474
1637 Ga0501037_0056883
1638 Ga0501037_0111132
1639 Ga0501037_0221647
1640 Ga0501038_0025085
1641 Ga0501038_0103840
1642 Ga0501038_0116457
1643 Ga0501039_0026847
1644 Ga0501039_0031443
1645 Ga0501039_0058587
1646 Ga0501039_0540606
1647 Ga0501040_0004225
1648 Ga0501040_0006707
1649 Ga0501040_0051156
1650 Ga0501040_0051564
1651 Ga0501040_0118448
1652 Ga0501040_0255651
1653 Ga0501041_0022506
1654 Ga0501041_0036129
1655 Ga0501041_0052622
1656 Ga0501041_0066014
1657 Ga0501041_0134209
1658 Ga0501042_0001269
1659 Ga0501042_0111581
1660 Ga0501042_0212918
1661 Ga0501043_0040443
1662 Ga0501043_0076526
1663 Ga0501046_0018637
1664 Ga0501046_0122421
1665 Ga0501046_0133594
1666 Ga0501047_0035031
1667 Ga0501047_0040099
1668 Ga0501048_0003992
1669 Ga0501048_0004624
1670 Ga0501048_0022506
1671 Ga0501048_0142960
1672 Ga0501067_0006469
1673 Ga0501067_0009510
1674 Ga0501067_0027413
1675 Ga0501067_0130097
1676 Ga0501068_0011088
1677 Ga0501068_0024085
1678 Ga0501068_0064431
1679 Ga0501069_0002808
1680 Ga0501069_0075272
1681 Ga0501069_0084623
1682 Ga0501069_0201518
1683 Ga0501070_0016720
1684 Ga0501070_0018287
1685 Ga0501070_0104028
1686 Ga0501070_0161197
1687 Ga0501070_0201304
1688 Ga0501070_0442958
1689 Ga0501071_0008934
1690 Ga0501071_0010714
1691 Ga0501071_0035465
1692 Ga0501071_0039658
1693 Ga0501071_0054932
1694 Ga0501071_0420380
1695 Ga0501072_0001727
1696 Ga0501072_0002225
1697 Ga0501072_0017112
1698 Ga0501072_0020437
1699 Ga0501072_0023758
1700 Ga0501072_0117538
1701 Ga0501072_0181709
1702 Ga0501073_0012804
1703 Ga0501073_0015813
1704 Ga0501074_0006671
1705 Ga0501074_0018234
1706 Ga0501074_0045956
1707 Ga0501074_0068661
1708 Ga0501074_0075114
1709 Ga0501074_0085228
1710 Ga0501074_0104690
1711 Ga0501075_0005199
1712 Ga0501075_0022115
1713 Ga0501075_0025704
1714 Ga0501075_0057919
1715 Ga0501075_0106103
1716 Ga0501075_0316317
1717 Ga0501075_0449562
1718 Ga0501076_0000834
1719 Ga0501076_0003822
1720 Ga0501076_0008714
1721 Ga0501076_0011656
1722 Ga0501076_0014431
1723 Ga0501076_0154369
1724 Ga0501077_0003475
1725 Ga0501077_0009651
1726 Ga0501077_0010250
1727 Ga0501077_0045036
1728 Ga0501077_0078980
1729 Ga0501077_0109569
1730 Ga0501077_0160342
1731 Ga0501079_0006508
1732 Ga0501079_0035313
1733 Ga0501079_0064935
1734 Ga0501079_0100673
1735 Ga0501079_0183348
1736 Ga0501079_0358244
1737 Ga0501079_0387723
1738 Ga0501080_0007957
1739 Ga0501080_0017900
1740 Ga0501080_0024243
1741 Ga0501080_0039727
1742 Ga0501080_0060872
1743 Ga0501080_0684746
1744 Ga0501081_0005843
1745 Ga0501081_0012576
1746 Ga0501081_0017634
1747 Ga0501081_0041920
1748 Ga0501081_0041975
1749 Ga0501083_0012338
1750 Ga0501083_0019786
1751 Ga0501083_0021887
1752 Ga0501083_0038176
1753 Ga0501035_0008332
1754 Ga0501035_0014191
1755 Ga0501035_0056136
1756 Ga0501035_0114670
1757 Ga0501035_0347331
1758 Ga0501044_0097329
1759 Ga0501044_0158269
1760 Ga0501044_0489463
1761 Ga0501045_0009365
1762 Ga0501045_0019112
1763 Ga0501045_0020864
1764 Ga0501045_0031561
1765 Ga0501045_0036920
1766 Ga0501045_0052158
1767 nmdc:mga00v17_44846_c1
1768 nmdc:mga05p37_131358_c1
1769 nmdc:mga05p37_335168_c1
1770 nmdc:mga05p37_572913_c1
1771 nmdc:mga06r32_655215_c1
1772 nmdc:mga08y16_11536_c1
1773 nmdc:mga08y16_161059_c1
1774 nmdc:mga08y16_237767_c1
1775 nmdc:mga0n895_11302_c1
1776 nmdc:mga0n895_365757_c1
1777 nmdc:mga0n895_39210_c1
1778 nmdc:mga0n895_50037_c1
1779 nmdc:mga0n895_95008_c1
1780 nmdc:mga0n895_9898_c1
1781 nmdc:mga0rr50_44863_c1
1782 nmdc:mga0rr50_4672_c1
1783 nmdc:mga08x19_19817_c1
1784 nmdc:mga08x19_24507_c1
1785 nmdc:mga0a205_148913_c1
1786 nmdc:mga0a205_45043_c1
1787 nmdc:mga0a205_8555_c1
1788 Ga0495601_0034467
1789 Ga0495601_0078583
1790 Ga0495601_0139877
1791 Ga0495601_0149931
1792 Ga0495601_0218470
1793 Ga0495655_0016543
1794 Ga0495595_0019008
1795 Ga0495619_0000860
1796 Ga0495619_0001914
1797 Ga0495619_0014380
1798 Ga0495619_0137466
1799 Ga0501084_0004414
1800 Ga0501084_0013953
1801 Ga0501084_0092595
1802 Ga0501084_0094576
1803 Ga0501084_0100271
1804 Ga0501084_0133956
1805 Ga0501084_0508202
1806 Ga0501082_0004996
1807 Ga0501082_0011334
1808 Ga0501082_0064008
1809 Ga0501082_0105056
1810 Ga0501082_0317216
1811 Ga0501082_0327253
1812 Ga0466962_0004266
1813 Ga0530510_0004794
1814 Ga0530510_0024059
1815 Ga0530510_0028662
1816 Ga0530510_0080271
1817 Ga0530510_0139089
1818 Ga0530510_0329862

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

168

268

0.96

PF01565

FAD_binding_4

FAD binding domain

21

152

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9424 1 286
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9298 1 287
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9283 2 290
2gqu-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus 0.928 1 284
2gqu-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus 0.9247 1 284
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9602 205 287 3.90.78.10
af_I1NID0_30_136_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9402 20 50 3.30.43.10
af_C0PHW4_38_147_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.922 20 50 3.30.43.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9141 75 199 3.30.465.10
af_I1MG67_25_124_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9018 20 48 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A538E6V2-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9826 1 291 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A538FJ94-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.982 1 291 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A538E6V2-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9793 1 291 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A538FJ94-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9786 1 291 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A538DWA8-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9765 1 291 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949

Map