F485416
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 299 | 1818 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100010185|Ga0307416_1000101854 |
| Length | 274 |
| Sequence | VRIEEGVPLARLTTIGTGGPARAFAKPESLAELEEALAWAADRELAVATVGLGSNVLAADDGVDALVLRLGGELASARVEDETLVAGGGAANAVCLHRARAAGLGGFEFACAIPGTAGGGVWMNAGAYGSDWSQILVRARVVYRHSELRHGQVVAEVEYRLVPRSADEIKATVAGLVAQRKATQPTNKRTFGSVFKNPAHELGAGQMLEACGLKGHTIGGALISPMHANFIENAGGATTADALALMAEGRRRALEQFGVELEHEVELLGAIHVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 165 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 178 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 181 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 182 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 183 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 12.43 |
| Rhizosphere | 86.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_100010185 | 3300032002 | Bacteria | 6200 |
| 2 | Ga0070658_10014999 | 3300005327 | Bacteria | 6203 |
| 3 | Ga0070658_10055542 | 3300005327 | Bacteria | 3217 |
| 4 | Ga0070658_10139147 | 3300005327 | Bacteria | 2027 |
| 5 | Ga0070658_10202757 | 3300005327 | Bacteria | 1674 |
| 6 | Ga0070658_10330707 | 3300005327 | Bacteria | 1302 |
| 7 | Ga0070658_10563427 | 3300005327 | Bacteria | 986 |
| 8 | Ga0070683_100005095 | 3300005329 | Bacteria | 10922 |
| 9 | Ga0070683_100043245 | 3300005329 | Bacteria | 4152 |
| 10 | Ga0070683_100085844 | 3300005329 | Bacteria | 2951 |
| 11 | Ga0070683_100135833 | 3300005329 | Bacteria | 2329 |
| 12 | Ga0070683_100151432 | 3300005329 | Bacteria | 2199 |
| 13 | Ga0070683_100243527 | 3300005329 | Bacteria | 1710 |
| 14 | Ga0068869_100075053 | 3300005334 | Bacteria | 2511 |
| 15 | Ga0070680_100008922 | 3300005336 | Bacteria | 7690 |
| 16 | Ga0070680_100014704 | 3300005336 | Bacteria | 6120 |
| 17 | Ga0070680_100088710 | 3300005336 | Bacteria | 2559 |
| 18 | Ga0070680_100092128 | 3300005336 | Bacteria | 2509 |
| 19 | Ga0070680_100206708 | 3300005336 | Bacteria | 1656 |
| 20 | Ga0070682_100002080 | 3300005337 | Bacteria | 11128 |
| 21 | Ga0070682_100028763 | 3300005337 | Bacteria | 3344 |
| 22 | Ga0070682_100067429 | 3300005337 | Bacteria | 2279 |
| 23 | Ga0070682_100280772 | 3300005337 | Unclassified | 1214 |
| 24 | Ga0068868_100041284 | 3300005338 | Bacteria | 3594 |
| 25 | Ga0070660_100000987 | 3300005339 | Bacteria | 19063 |
| 26 | Ga0070660_100001169 | 3300005339 | Bacteria | 17754 |
| 27 | Ga0070660_100002777 | 3300005339 | Bacteria | 12017 |
| 28 | Ga0070660_100054715 | 3300005339 | Bacteria | 3082 |
| 29 | Ga0070660_100149773 | 3300005339 | Bacteria | 1876 |
| 30 | Ga0070691_10073192 | 3300005341 | Bacteria | 1665 |
| 31 | Ga0070691_10100051 | 3300005341 | Unclassified | 1439 |
| 32 | Ga0070687_100237983 | 3300005343 | Bacteria | 1124 |
| 33 | Ga0070661_100113408 | 3300005344 | Unclassified | 2025 |
| 34 | Ga0070668_100313285 | 3300005347 | Bacteria | 1319 |
| 35 | Ga0070668_100447658 | 3300005347 | Bacteria | 1110 |
| 36 | Ga0070675_100119207 | 3300005354 | Bacteria | 2241 |
| 37 | Ga0070671_100083167 | 3300005355 | Bacteria | 2676 |
| 38 | Ga0070673_100188108 | 3300005364 | Bacteria | 1772 |
| 39 | Ga0070673_100435203 | 3300005364 | Unclassified | 1178 |
| 40 | Ga0070659_100004290 | 3300005366 | Bacteria | 10177 |
| 41 | Ga0070659_100111814 | 3300005366 | Bacteria | 2205 |
| 42 | Ga0070667_100079168 | 3300005367 | Bacteria | 2809 |
| 43 | Ga0070703_10049195 | 3300005406 | Bacteria | 1341 |
| 44 | Ga0070709_10051800 | 3300005434 | Bacteria | 2577 |
| 45 | Ga0070714_100137507 | 3300005435 | Bacteria | 2189 |
| 46 | Ga0070714_100194507 | 3300005435 | Bacteria | 1853 |
| 47 | Ga0070714_100308579 | 3300005435 | Bacteria | 1477 |
| 48 | Ga0070701_10012978 | 3300005438 | Bacteria | 3777 |
| 49 | Ga0070711_100010525 | 3300005439 | Bacteria | 5726 |
| 50 | Ga0070700_100195679 | 3300005441 | Unclassified | 1416 |
| 51 | Ga0070708_100021939 | 3300005445 | Bacteria | 5410 |
| 52 | Ga0070708_100215419 | 3300005445 | Bacteria | 1800 |
| 53 | Ga0070663_100025646 | 3300005455 | Bacteria | 3982 |
| 54 | Ga0070663_100146324 | 3300005455 | Bacteria | 1808 |
| 55 | Ga0070663_100171437 | 3300005455 | Unclassified | 1678 |
| 56 | Ga0070678_100004632 | 3300005456 | Bacteria | 7819 |
| 57 | Ga0070678_100021921 | 3300005456 | Bacteria | 4222 |
| 58 | Ga0070678_100088598 | 3300005456 | Bacteria | 2366 |
| 59 | Ga0070681_10004684 | 3300005458 | Bacteria | 13081 |
| 60 | Ga0070681_10017778 | 3300005458 | Bacteria | 7104 |
| 61 | Ga0070681_10072461 | 3300005458 | Bacteria | 3407 |
| 62 | Ga0070681_10079101 | 3300005458 | Bacteria | 3245 |
| 63 | Ga0070681_10134187 | 3300005458 | Bacteria | 2406 |
| 64 | Ga0070681_10173488 | 3300005458 | Unclassified | 2078 |
| 65 | Ga0068867_100203016 | 3300005459 | Unclassified | 1588 |
| 66 | Ga0070685_10004070 | 3300005466 | Bacteria | 7387 |
| 67 | Ga0070706_100329157 | 3300005467 | Bacteria | 1425 |
| 68 | Ga0070706_100559275 | 3300005467 | Unclassified | 1064 |
| 69 | Ga0070707_100041336 | 3300005468 | Bacteria | 4412 |
| 70 | Ga0070707_100141182 | 3300005468 | Unclassified | 2344 |
| 71 | Ga0070707_100216846 | 3300005468 | Bacteria | 1865 |
| 72 | Ga0070698_100133718 | 3300005471 | Bacteria | 2434 |
| 73 | Ga0070699_100245804 | 3300005518 | Bacteria | 1598 |
| 74 | Ga0070679_100001218 | 3300005530 | Bacteria | 22619 |
| 75 | Ga0070679_100004651 | 3300005530 | Bacteria | 12668 |
| 76 | Ga0070679_100007568 | 3300005530 | Bacteria | 10159 |
| 77 | Ga0070679_100015547 | 3300005530 | Bacteria | 7312 |
| 78 | Ga0070679_100088082 | 3300005530 | Bacteria | 3091 |
| 79 | Ga0070679_100125369 | 3300005530 | Bacteria | 2550 |
| 80 | Ga0070679_100173545 | 3300005530 | Bacteria | 2128 |
| 81 | Ga0070679_100206726 | 3300005530 | Bacteria | 1927 |
| 82 | Ga0070684_100000286 | 3300005535 | Bacteria | 35165 |
| 83 | Ga0070684_100002106 | 3300005535 | Bacteria | 14655 |
| 84 | Ga0070684_100013868 | 3300005535 | Bacteria | 6511 |
| 85 | Ga0070684_100035846 | 3300005535 | Bacteria | 4249 |
| 86 | Ga0070684_100060170 | 3300005535 | Bacteria | 3321 |
| 87 | Ga0070684_100110894 | 3300005535 | Bacteria | 2460 |
| 88 | Ga0070684_100281169 | 3300005535 | Bacteria | 1525 |
| 89 | Ga0070684_100302665 | 3300005535 | Bacteria | 1467 |
| 90 | Ga0070697_100283089 | 3300005536 | Bacteria | 1423 |
| 91 | Ga0068853_100025116 | 3300005539 | Bacteria | 4999 |
| 92 | Ga0070672_100203103 | 3300005543 | Unclassified | 1658 |
| 93 | Ga0070686_100170754 | 3300005544 | Bacteria | 1538 |
| 94 | Ga0070695_100151190 | 3300005545 | Bacteria | 1620 |
| 95 | Ga0070696_100088809 | 3300005546 | Bacteria | 2197 |
| 96 | Ga0070693_100009173 | 3300005547 | Bacteria | 4913 |
| 97 | Ga0070693_100136189 | 3300005547 | Bacteria | 1541 |
| 98 | Ga0070704_100015570 | 3300005549 | Bacteria | 4780 |
| 99 | Ga0070704_100049551 | 3300005549 | Unclassified | 2947 |
| 100 | Ga0070704_100091849 | 3300005549 | Bacteria | 2265 |
| 101 | Ga0068855_100037454 | 3300005563 | Bacteria | 5766 |
| 102 | Ga0068855_100041238 | 3300005563 | Bacteria | 5472 |
| 103 | Ga0068855_100095042 | 3300005563 | Bacteria | 3435 |
| 104 | Ga0068855_100188790 | 3300005563 | Bacteria | 2326 |
| 105 | Ga0070664_100021964 | 3300005564 | Bacteria | 5262 |
| 106 | Ga0070664_100046027 | 3300005564 | Bacteria | 3685 |
| 107 | Ga0070664_100088838 | 3300005564 | Bacteria | 2672 |
| 108 | Ga0070664_100123079 | 3300005564 | Bacteria | 2273 |
| 109 | Ga0070664_100133260 | 3300005564 | Bacteria | 2183 |
| 110 | Ga0068857_100042520 | 3300005577 | Bacteria | 4032 |
| 111 | Ga0068857_100055433 | 3300005577 | Bacteria | 3518 |
| 112 | Ga0068857_100177333 | 3300005577 | Bacteria | 1939 |
| 113 | Ga0068857_100232663 | 3300005577 | Bacteria | 1686 |
| 114 | Ga0068857_100385005 | 3300005577 | Unclassified | 1303 |
| 115 | Ga0068856_100021996 | 3300005614 | Bacteria | 6200 |
| 116 | Ga0068856_100032908 | 3300005614 | Bacteria | 5078 |
| 117 | Ga0068856_100121997 | 3300005614 | Bacteria | 2608 |
| 118 | Ga0068856_100698265 | 3300005614 | Bacteria | 1035 |
| 119 | Ga0070702_100014210 | 3300005615 | Bacteria | 4036 |
| 120 | Ga0070702_100014973 | 3300005615 | Bacteria | 3948 |
| 121 | Ga0068852_100050181 | 3300005616 | Bacteria | 3574 |
| 122 | Ga0068864_100014602 | 3300005618 | Bacteria | 6524 |
| 123 | Ga0068864_100377122 | 3300005618 | Bacteria | 1343 |
| 124 | Ga0068861_100125109 | 3300005719 | Bacteria | 2079 |
| 125 | Ga0068861_100334402 | 3300005719 | Unclassified | 1323 |
| 126 | Ga0068851_10032592 | 3300005834 | Bacteria | 2592 |
| 127 | Ga0068851_10060482 | 3300005834 | Bacteria | 1939 |
| 128 | Ga0068851_10158616 | 3300005834 | Unclassified | 1241 |
| 129 | Ga0068870_10112731 | 3300005840 | Unclassified | 1555 |
| 130 | Ga0068870_10129831 | 3300005840 | Bacteria | 1462 |
| 131 | Ga0068858_100016800 | 3300005842 | Bacteria | 6873 |
| 132 | Ga0068860_100052269 | 3300005843 | Bacteria | 3886 |
| 133 | Ga0081455_10005553 | 3300005937 | Bacteria | 13807 |
| 134 | Ga0081455_10021586 | 3300005937 | Bacteria | 6035 |
| 135 | Ga0081455_10041400 | 3300005937 | Bacteria | 4051 |
| 136 | Ga0081455_10184200 | 3300005937 | Bacteria | 1578 |
| 137 | Ga0081540_1012803 | 3300005983 | Bacteria | 5488 |
| 138 | Ga0081539_10000712 | 3300005985 | Bacteria | 66647 |
| 139 | Ga0081539_10002673 | 3300005985 | Bacteria | 24252 |
| 140 | Ga0070717_10076668 | 3300006028 | Bacteria | 2798 |
| 141 | Ga0070717_10084650 | 3300006028 | Bacteria | 2668 |
| 142 | Ga0070717_10344823 | 3300006028 | Bacteria | 1331 |
| 143 | Ga0075432_10012364 | 3300006058 | Bacteria | 2900 |
| 144 | Ga0070716_100046550 | 3300006173 | Bacteria | 2441 |
| 145 | Ga0070716_100300818 | 3300006173 | Bacteria | 1116 |
| 146 | Ga0070712_100004684 | 3300006175 | Bacteria | 8456 |
| 147 | Ga0070712_100036378 | 3300006175 | Bacteria | 3350 |
| 148 | Ga0070712_100039370 | 3300006175 | Bacteria | 3235 |
| 149 | Ga0070712_100089081 | 3300006175 | Bacteria | 2256 |
| 150 | Ga0070712_100167708 | 3300006175 | Bacteria | 1701 |
| 151 | Ga0070712_100312425 | 3300006175 | Unclassified | 1275 |
| 152 | Ga0075367_10100213 | 3300006178 | Bacteria | 1770 |
| 153 | Ga0068871_100316933 | 3300006358 | Bacteria | 1372 |
| 154 | Ga0075428_100088832 | 3300006844 | Bacteria | 3371 |
| 155 | Ga0075428_100261873 | 3300006844 | Bacteria | 1862 |
| 156 | Ga0075428_100524166 | 3300006844 | Unclassified | 1267 |
| 157 | Ga0075428_100537389 | 3300006844 | Bacteria | 1250 |
| 158 | Ga0075433_10008842 | 3300006852 | Bacteria | 8036 |
| 159 | Ga0075433_10022515 | 3300006852 | Bacteria | 5288 |
| 160 | Ga0075433_10032720 | 3300006852 | Bacteria | 4455 |
| 161 | Ga0075433_10192143 | 3300006852 | Bacteria | 1816 |
| 162 | Ga0075434_100013022 | 3300006871 | Bacteria | 7898 |
| 163 | Ga0075434_100107931 | 3300006871 | Bacteria | 2794 |
| 164 | Ga0075434_100166640 | 3300006871 | Bacteria | 2223 |
| 165 | Ga0075434_100375839 | 3300006871 | Bacteria | 1442 |
| 166 | Ga0075434_100388395 | 3300006871 | Bacteria | 1417 |
| 167 | Ga0068865_100009909 | 3300006881 | Bacteria | 5921 |
| 168 | Ga0068865_100031618 | 3300006881 | Bacteria | 3530 |
| 169 | Ga0068865_100076755 | 3300006881 | Bacteria | 2386 |
| 170 | Ga0075436_100012021 | 3300006914 | Bacteria | 5937 |
| 171 | Ga0075436_100024460 | 3300006914 | Bacteria | 4151 |
| 172 | Ga0075436_100077116 | 3300006914 | Bacteria | 2308 |
| 173 | Ga0075436_100123089 | 3300006914 | Unclassified | 1816 |
| 174 | Ga0075435_100012599 | 3300007076 | Bacteria | 6264 |
| 175 | Ga0075435_100027092 | 3300007076 | Bacteria | 4479 |
| 176 | Ga0105240_10029379 | 3300009093 | Bacteria | 7162 |
| 177 | Ga0105240_10059378 | 3300009093 | Bacteria | 4773 |
| 178 | Ga0105240_10120718 | 3300009093 | Bacteria | 3156 |
| 179 | Ga0105240_10206823 | 3300009093 | Bacteria | 2296 |
| 180 | Ga0111539_10011337 | 3300009094 | Bacteria | 11196 |
| 181 | Ga0111539_10040887 | 3300009094 | Bacteria | 5579 |
| 182 | Ga0111539_10044887 | 3300009094 | Bacteria | 5292 |
| 183 | Ga0111539_10063304 | 3300009094 | Bacteria | 4377 |
| 184 | Ga0111539_10333887 | 3300009094 | Bacteria | 1764 |
| 185 | Ga0111539_10398611 | 3300009094 | Bacteria | 1603 |
| 186 | Ga0105245_10033516 | 3300009098 | Bacteria | 4553 |
| 187 | Ga0105245_10045484 | 3300009098 | Bacteria | 3921 |
| 188 | Ga0105245_10398926 | 3300009098 | Unclassified | 1374 |
| 189 | Ga0105245_10407954 | 3300009098 | Bacteria | 1359 |
| 190 | Ga0105247_10045020 | 3300009101 | Bacteria | 2707 |
| 191 | Ga0114129_10048125 | 3300009147 | Bacteria | 5991 |
| 192 | Ga0114129_10089957 | 3300009147 | Bacteria | 4255 |
| 193 | Ga0114129_10178559 | 3300009147 | Bacteria | 2891 |
| 194 | Ga0114129_10409961 | 3300009147 | Bacteria | 1785 |
| 195 | Ga0105243_10005927 | 3300009148 | Bacteria | 9466 |
| 196 | Ga0105243_10026222 | 3300009148 | Bacteria | 4461 |
| 197 | Ga0105243_10187977 | 3300009148 | Unclassified | 1802 |
| 198 | Ga0105243_10214490 | 3300009148 | Unclassified | 1697 |
| 199 | Ga0105243_10278918 | 3300009148 | Bacteria | 1504 |
| 200 | Ga0105243_10340682 | 3300009148 | Unclassified | 1373 |
| 201 | Ga0105241_10319467 | 3300009174 | Bacteria | 1338 |
| 202 | Ga0105242_10078749 | 3300009176 | Bacteria | 2751 |
| 203 | Ga0105242_10114080 | 3300009176 | Bacteria | 2308 |
| 204 | Ga0105242_10303793 | 3300009176 | Bacteria | 1457 |
| 205 | Ga0105248_10211114 | 3300009177 | Bacteria | 2187 |
| 206 | Ga0105237_10060611 | 3300009545 | Bacteria | 3785 |
| 207 | Ga0105238_10015630 | 3300009551 | Bacteria | 7682 |
| 208 | Ga0105249_10037426 | 3300009553 | Bacteria | 4403 |
| 209 | Ga0105249_10223565 | 3300009553 | Bacteria | 1854 |
| 210 | Ga0105239_10036761 | 3300010375 | Bacteria | 5372 |
| 211 | Ga0105239_10136164 | 3300010375 | Bacteria | 2734 |
| 212 | Ga0105239_10255997 | 3300010375 | Unclassified | 1967 |
| 213 | Ga0105246_10011293 | 3300011119 | Bacteria | 5542 |
| 214 | Ga0105246_10040253 | 3300011119 | Bacteria | 3153 |
| 215 | Ga0157373_10273610 | 3300013100 | Bacteria | 1196 |
| 216 | Ga0157370_10030380 | 3300013104 | Bacteria | 5294 |
| 217 | Ga0157370_10035597 | 3300013104 | Bacteria | 4837 |
| 218 | Ga0157370_10076192 | 3300013104 | Bacteria | 3160 |
| 219 | Ga0157369_10003190 | 3300013105 | Bacteria | 19560 |
| 220 | Ga0157369_10006794 | 3300013105 | Bacteria | 13198 |
| 221 | Ga0157369_10135804 | 3300013105 | Bacteria | 2604 |
| 222 | Ga0157369_10169134 | 3300013105 | Bacteria | 2304 |
| 223 | Ga0157374_10008984 | 3300013296 | Bacteria | 8568 |
| 224 | Ga0157374_10128899 | 3300013296 | Unclassified | 2447 |
| 225 | Ga0157374_10137631 | 3300013296 | Bacteria | 2369 |
| 226 | Ga0157374_10785813 | 3300013296 | Bacteria | 967 |
| 227 | Ga0163162_10878477 | 3300013306 | Bacteria | 1011 |
| 228 | Ga0157372_10022486 | 3300013307 | Bacteria | 6824 |
| 229 | Ga0157372_10070280 | 3300013307 | Bacteria | 3939 |
| 230 | Ga0157372_10093063 | 3300013307 | Bacteria | 3430 |
| 231 | Ga0157372_10414823 | 3300013307 | Bacteria | 1569 |
| 232 | Ga0157375_10072787 | 3300013308 | Bacteria | 3454 |
| 233 | Ga0157375_10243759 | 3300013308 | Unclassified | 1957 |
| 234 | Ga0163163_10141851 | 3300014325 | Bacteria | 2445 |
| 235 | Ga0163163_10231316 | 3300014325 | Bacteria | 1898 |
| 236 | Ga0157380_10030996 | 3300014326 | Bacteria | 4101 |
| 237 | Ga0157377_10050141 | 3300014745 | Bacteria | 2349 |
| 238 | Ga0157377_10073965 | 3300014745 | Bacteria | 1976 |
| 239 | Ga0157377_10197064 | 3300014745 | Unclassified | 1276 |
| 240 | Ga0157379_10008081 | 3300014968 | Bacteria | 9141 |
| 241 | Ga0157379_10015282 | 3300014968 | Bacteria | 6732 |
| 242 | Ga0157376_10009504 | 3300014969 | Bacteria | 7065 |
| 243 | Ga0157376_10134305 | 3300014969 | Bacteria | 2212 |
| 244 | Ga0157376_10364004 | 3300014969 | Bacteria | 1388 |
| 245 | Ga0206356_11895397 | 3300020070 | Bacteria | 3000 |
| 246 | Ga0206354_10788483 | 3300020081 | Bacteria | 2162 |
| 247 | Ga0206354_11630888 | 3300020081 | Unclassified | 1546 |
| 248 | Ga0206353_11415625 | 3300020082 | Bacteria | 7415 |
| 249 | Ga0206353_11601542 | 3300020082 | Bacteria | 3880 |
| 250 | Ga0207653_10009255 | 3300025885 | Bacteria | 3068 |
| 251 | Ga0207692_10067871 | 3300025898 | Bacteria | 1868 |
| 252 | Ga0207645_10054929 | 3300025907 | Bacteria | 2543 |
| 253 | Ga0207643_10007509 | 3300025908 | Bacteria | 5853 |
| 254 | Ga0207705_10007957 | 3300025909 | Bacteria | 7778 |
| 255 | Ga0207684_10188438 | 3300025910 | Unclassified | 1779 |
| 256 | Ga0207654_10077693 | 3300025911 | Bacteria | 1990 |
| 257 | Ga0207707_10003902 | 3300025912 | Bacteria | 13226 |
| 258 | Ga0207707_10004085 | 3300025912 | Bacteria | 12931 |
| 259 | Ga0207707_10031620 | 3300025912 | Bacteria | 4632 |
| 260 | Ga0207707_10045695 | 3300025912 | Bacteria | 3816 |
| 261 | Ga0207707_10056574 | 3300025912 | Bacteria | 3412 |
| 262 | Ga0207707_10130861 | 3300025912 | Bacteria | 2194 |
| 263 | Ga0207707_10142260 | 3300025912 | Bacteria | 2097 |
| 264 | Ga0207707_10292976 | 3300025912 | Bacteria | 1408 |
| 265 | Ga0207707_10324570 | 3300025912 | Bacteria | 1329 |
| 266 | Ga0207695_10263121 | 3300025913 | Bacteria | 1622 |
| 267 | Ga0207695_10289984 | 3300025913 | Bacteria | 1529 |
| 268 | Ga0207671_10230223 | 3300025914 | Bacteria | 1454 |
| 269 | Ga0207693_10002465 | 3300025915 | Bacteria | 16079 |
| 270 | Ga0207693_10006225 | 3300025915 | Bacteria | 9898 |
| 271 | Ga0207693_10021715 | 3300025915 | Bacteria | 5102 |
| 272 | Ga0207693_10045347 | 3300025915 | Bacteria | 3455 |
| 273 | Ga0207693_10183700 | 3300025915 | Unclassified | 1646 |
| 274 | Ga0207693_10206786 | 3300025915 | Unclassified | 1543 |
| 275 | Ga0207663_10105012 | 3300025916 | Bacteria | 1905 |
| 276 | Ga0207660_10014400 | 3300025917 | Bacteria | 5202 |
| 277 | Ga0207660_10024911 | 3300025917 | Bacteria | 4055 |
| 278 | Ga0207660_10189797 | 3300025917 | Bacteria | 1599 |
| 279 | Ga0207657_10000046 | 3300025919 | Bacteria | 113887 |
| 280 | Ga0207657_10004670 | 3300025919 | Bacteria | 14463 |
| 281 | Ga0207657_10042210 | 3300025919 | Bacteria | 4026 |
| 282 | Ga0207657_10042628 | 3300025919 | Bacteria | 4002 |
| 283 | Ga0207657_10094324 | 3300025919 | Bacteria | 2492 |
| 284 | Ga0207657_10126311 | 3300025919 | Bacteria | 2100 |
| 285 | Ga0207649_10019235 | 3300025920 | Bacteria | 3900 |
| 286 | Ga0207649_10048163 | 3300025920 | Unclassified | 2628 |
| 287 | Ga0207649_10218712 | 3300025920 | Bacteria | 1355 |
| 288 | Ga0207649_10280126 | 3300025920 | Bacteria | 1212 |
| 289 | Ga0207649_10351575 | 3300025920 | Bacteria | 1091 |
| 290 | Ga0207652_10006892 | 3300025921 | Bacteria | 9156 |
| 291 | Ga0207652_10041215 | 3300025921 | Bacteria | 3924 |
| 292 | Ga0207652_10087240 | 3300025921 | Bacteria | 2736 |
| 293 | Ga0207652_10087576 | 3300025921 | Bacteria | 2731 |
| 294 | Ga0207652_10131087 | 3300025921 | Bacteria | 2236 |
| 295 | Ga0207652_10234910 | 3300025921 | Bacteria | 1652 |
| 296 | Ga0207646_10039067 | 3300025922 | Bacteria | 4270 |
| 297 | Ga0207646_10197755 | 3300025922 | Bacteria | 1815 |
| 298 | Ga0207646_10396258 | 3300025922 | Unclassified | 1247 |
| 299 | Ga0207694_10014338 | 3300025924 | Bacteria | 5975 |
| 300 | Ga0207694_10194327 | 3300025924 | Bacteria | 1649 |
| 301 | Ga0207687_10009713 | 3300025927 | Bacteria | 6294 |
| 302 | Ga0207687_10010814 | 3300025927 | Bacteria | 5965 |
| 303 | Ga0207687_10240376 | 3300025927 | Bacteria | 1435 |
| 304 | Ga0207700_10034480 | 3300025928 | Bacteria | 3634 |
| 305 | Ga0207664_10105869 | 3300025929 | Bacteria | 2332 |
| 306 | Ga0207664_10249254 | 3300025929 | Unclassified | 1549 |
| 307 | Ga0207664_10690694 | 3300025929 | Bacteria | 918 |
| 308 | Ga0207690_10341088 | 3300025932 | Unclassified | 1182 |
| 309 | Ga0207706_10072795 | 3300025933 | Bacteria | 3022 |
| 310 | Ga0207706_10109698 | 3300025933 | Bacteria | 2428 |
| 311 | Ga0207686_10322957 | 3300025934 | Unclassified | 1154 |
| 312 | Ga0207709_10004893 | 3300025935 | Bacteria | 7666 |
| 313 | Ga0207709_10027758 | 3300025935 | Bacteria | 3266 |
| 314 | Ga0207709_10120591 | 3300025935 | Bacteria | 1770 |
| 315 | Ga0207709_10203453 | 3300025935 | Unclassified | 1416 |
| 316 | Ga0207709_10290189 | 3300025935 | Bacteria | 1212 |
| 317 | Ga0207709_10449924 | 3300025935 | Unclassified | 995 |
| 318 | Ga0207669_10016875 | 3300025937 | Bacteria | 3728 |
| 319 | Ga0207704_10012479 | 3300025938 | Bacteria | 4217 |
| 320 | Ga0207704_10026920 | 3300025938 | Bacteria | 3162 |
| 321 | Ga0207704_10064600 | 3300025938 | Bacteria | 2287 |
| 322 | Ga0207704_10106511 | 3300025938 | Bacteria | 1883 |
| 323 | Ga0207704_10200501 | 3300025938 | Unclassified | 1460 |
| 324 | Ga0207665_10003617 | 3300025939 | Bacteria | 10328 |
| 325 | Ga0207691_10043160 | 3300025940 | Bacteria | 4156 |
| 326 | Ga0207711_10203594 | 3300025941 | Unclassified | 1807 |
| 327 | Ga0207689_10067839 | 3300025942 | Bacteria | 2931 |
| 328 | Ga0207689_10069438 | 3300025942 | Bacteria | 2895 |
| 329 | Ga0207661_10003778 | 3300025944 | Bacteria | 10556 |
| 330 | Ga0207661_10010487 | 3300025944 | Bacteria | 6669 |
| 331 | Ga0207661_10014601 | 3300025944 | Bacteria | 5760 |
| 332 | Ga0207661_10016038 | 3300025944 | Bacteria | 5524 |
| 333 | Ga0207661_10046285 | 3300025944 | Bacteria | 3450 |
| 334 | Ga0207661_10070805 | 3300025944 | Bacteria | 2848 |
| 335 | Ga0207661_10077276 | 3300025944 | Bacteria | 2737 |
| 336 | Ga0207661_10114824 | 3300025944 | Bacteria | 2283 |
| 337 | Ga0207661_10164314 | 3300025944 | Bacteria | 1928 |
| 338 | Ga0207679_10025645 | 3300025945 | Bacteria | 4057 |
| 339 | Ga0207679_10077368 | 3300025945 | Unclassified | 2531 |
| 340 | Ga0207679_10094843 | 3300025945 | Bacteria | 2318 |
| 341 | Ga0207679_10235960 | 3300025945 | Unclassified | 1547 |
| 342 | Ga0207667_10049261 | 3300025949 | Bacteria | 4451 |
| 343 | Ga0207667_10153733 | 3300025949 | Bacteria | 2367 |
| 344 | Ga0207667_10290498 | 3300025949 | Bacteria | 1670 |
| 345 | Ga0207667_10483752 | 3300025949 | Bacteria | 1256 |
| 346 | Ga0207651_10233314 | 3300025960 | Bacteria | 1495 |
| 347 | Ga0207712_10026346 | 3300025961 | Bacteria | 3872 |
| 348 | Ga0207712_10090867 | 3300025961 | Unclassified | 2248 |
| 349 | Ga0207640_10089330 | 3300025981 | Bacteria | 2129 |
| 350 | Ga0207677_10319779 | 3300026023 | Bacteria | 1289 |
| 351 | Ga0207703_10138211 | 3300026035 | Bacteria | 2112 |
| 352 | Ga0207639_10076169 | 3300026041 | Bacteria | 2640 |
| 353 | Ga0207639_10089922 | 3300026041 | Bacteria | 2454 |
| 354 | Ga0207639_10141330 | 3300026041 | Bacteria | 2006 |
| 355 | Ga0207639_10309824 | 3300026041 | Bacteria | 1398 |
| 356 | Ga0207639_10540966 | 3300026041 | Bacteria | 1068 |
| 357 | Ga0207678_10025566 | 3300026067 | Bacteria | 5153 |
| 358 | Ga0207678_10155621 | 3300026067 | Bacteria | 1951 |
| 359 | Ga0207702_10013421 | 3300026078 | Bacteria | 6811 |
| 360 | Ga0207702_10026096 | 3300026078 | Bacteria | 4851 |
| 361 | Ga0207702_10158445 | 3300026078 | Bacteria | 2065 |
| 362 | Ga0207702_10310855 | 3300026078 | Bacteria | 1498 |
| 363 | Ga0207641_10120808 | 3300026088 | Bacteria | 2338 |
| 364 | Ga0207648_10312083 | 3300026089 | Unclassified | 1412 |
| 365 | Ga0207674_10000589 | 3300026116 | Bacteria | 47768 |
| 366 | Ga0207674_10054841 | 3300026116 | Bacteria | 4056 |
| 367 | Ga0207674_10086205 | 3300026116 | Bacteria | 3135 |
| 368 | Ga0207674_10278559 | 3300026116 | Bacteria | 1620 |
| 369 | Ga0207683_10014750 | 3300026121 | Bacteria | 6652 |
| 370 | Ga0207683_10027940 | 3300026121 | Bacteria | 4876 |
| 371 | Ga0207683_10045987 | 3300026121 | Bacteria | 3818 |
| 372 | Ga0207698_10137922 | 3300026142 | Bacteria | 2096 |
| 373 | Ga0207428_10053447 | 3300027907 | Bacteria | 3221 |
| 374 | Ga0207428_10149316 | 3300027907 | Bacteria | 1780 |
| 375 | Ga0268266_10014070 | 3300028379 | Bacteria | 6887 |
| 376 | Ga0268265_10047379 | 3300028380 | Bacteria | 3221 |
| 377 | Ga0268265_10171348 | 3300028380 | Unclassified | 1856 |
| 378 | Ga0268264_10194913 | 3300028381 | Bacteria | 1849 |
| 379 | Ga0265323_10055471 | 3300028653 | Unclassified | 1393 |
| 380 | Ga0265338_10170025 | 3300028800 | Bacteria | 1673 |
| 381 | Ga0265338_10199356 | 3300028800 | Bacteria | 1510 |
| 382 | Ga0265325_10022952 | 3300031241 | Bacteria | 3413 |
| 383 | Ga0265339_10024386 | 3300031249 | Bacteria | 3486 |
| 384 | Ga0265327_10020304 | 3300031251 | Bacteria | 4053 |
| 385 | Ga0265327_10059895 | 3300031251 | Bacteria | 1948 |
| 386 | Ga0307408_100137892 | 3300031548 | Bacteria | 1911 |
| 387 | Ga0307408_100189782 | 3300031548 | Unclassified | 1655 |
| 388 | Ga0265342_10034167 | 3300031712 | Bacteria | 3121 |
| 389 | Ga0307409_100051627 | 3300031995 | Bacteria | 3148 |
| 390 | Ga0307415_100048805 | 3300032126 | Bacteria | 2858 |
| 391 | Ga0373930_0016453 | 3300034816 | Bacteria | 1399 |
| 392 | Ga0373928_0010580 | 3300035084 | Bacteria | 1815 |
| 393 | Ga0373951_0000908 | 3300035091 | Bacteria | 7970 |
| 394 | Ga0373932_0026731 | 3300035112 | Bacteria | 1572 |
| 395 | Ga0373939_0087376 | 3300035114 | Bacteria | 1047 |
| 396 | Ga0373941_0002261 | 3300035115 | Bacteria | 4216 |
| 397 | Ga0373945_0007159 | 3300035116 | Bacteria | 3611 |
| 398 | Ga0373943_0000112 | 3300035170 | Bacteria | 30215 |
| 399 | Ga0373943_0078661 | 3300035170 | Unclassified | 1686 |
| 400 | Ga0373931_0051738 | 3300035691 | Bacteria | 2188 |
| 401 | Ga0373947_0000600 | 3300035725 | Bacteria | 21231 |
| 402 | Ga0373947_0002931 | 3300035725 | Bacteria | 10178 |
| 403 | Ga0373947_0039500 | 3300035725 | Bacteria | 2808 |
| 404 | Ga0373925_0007897 | 3300037068 | Bacteria | 7747 |
| 405 | Ga0373925_0024389 | 3300037068 | Bacteria | 4416 |
| 406 | Ga0395899_0005838 | 3300037312 | Bacteria | 9555 |
| 407 | Ga0395899_0013404 | 3300037312 | Bacteria | 6272 |
| 408 | Ga0395899_0046945 | 3300037312 | Bacteria | 3216 |
| 409 | Ga0395899_0081277 | 3300037312 | Bacteria | 2358 |
| 410 | Ga0395899_0096962 | 3300037312 | Bacteria | 2132 |
| 411 | Ga0395899_0125278 | 3300037312 | Bacteria | 1837 |
| 412 | Ga0395900_0001970 | 3300037418 | Bacteria | 23182 |
| 413 | Ga0395900_0003522 | 3300037418 | Bacteria | 16880 |
| 414 | Ga0395900_0008763 | 3300037418 | Bacteria | 10393 |
| 415 | Ga0395900_0011690 | 3300037418 | Bacteria | 8980 |
| 416 | Ga0395900_0023971 | 3300037418 | Bacteria | 6244 |
| 417 | Ga0395900_0040529 | 3300037418 | Bacteria | 4800 |
| 418 | Ga0395900_0054626 | 3300037418 | Bacteria | 4112 |
| 419 | Ga0395900_0056594 | 3300037418 | Bacteria | 4036 |
| 420 | Ga0395900_0135223 | 3300037418 | Bacteria | 2525 |
| 421 | Ga0395900_0136016 | 3300037418 | Bacteria | 2518 |
| 422 | Ga0395900_0211572 | 3300037418 | Bacteria | 1958 |
| 423 | Ga0395900_0221380 | 3300037418 | Bacteria | 1907 |
| 424 | Ga0395898_0002384 | 3300037466 | Bacteria | 22303 |
| 425 | Ga0395898_0003184 | 3300037466 | Bacteria | 18478 |
| 426 | Ga0395898_0012598 | 3300037466 | Bacteria | 8743 |
| 427 | Ga0395898_0012993 | 3300037466 | Bacteria | 8584 |
| 428 | Ga0395898_0017911 | 3300037466 | Bacteria | 7227 |
| 429 | Ga0395898_0026766 | 3300037466 | Bacteria | 5797 |
| 430 | Ga0395898_0036101 | 3300037466 | Bacteria | 4909 |
| 431 | Ga0395898_0064600 | 3300037466 | Bacteria | 3549 |
| 432 | Ga0395898_0318157 | 3300037466 | Bacteria | 1484 |
| 433 | Ga0395898_0439470 | 3300037466 | Unclassified | 1243 |
| 434 | Ga0395898_0505324 | 3300037466 | Bacteria | 1149 |
| 435 | Ga0395905_0002425 | 3300037471 | Bacteria | 20684 |
| 436 | Ga0395905_0010165 | 3300037471 | Bacteria | 9171 |
| 437 | Ga0395905_0013914 | 3300037471 | Bacteria | 7696 |
| 438 | Ga0395905_0046824 | 3300037471 | Bacteria | 4055 |
| 439 | Ga0395905_0047631 | 3300037471 | Bacteria | 4016 |
| 440 | Ga0395905_0069679 | 3300037471 | Bacteria | 3294 |
| 441 | Ga0395901_0004313 | 3300038443 | Bacteria | 14354 |
| 442 | Ga0395901_0004948 | 3300038443 | Bacteria | 13445 |
| 443 | Ga0395901_0005093 | 3300038443 | Bacteria | 13273 |
| 444 | Ga0395901_0007139 | 3300038443 | Bacteria | 11274 |
| 445 | Ga0395901_0007152 | 3300038443 | Bacteria | 11267 |
| 446 | Ga0395901_0007511 | 3300038443 | Bacteria | 11008 |
| 447 | Ga0395901_0009134 | 3300038443 | Bacteria | 10039 |
| 448 | Ga0395901_0047223 | 3300038443 | Bacteria | 4471 |
| 449 | Ga0395901_0048345 | 3300038443 | Bacteria | 4417 |
| 450 | Ga0395901_0075284 | 3300038443 | Bacteria | 3521 |
| 451 | Ga0395901_0084227 | 3300038443 | Bacteria | 3323 |
| 452 | Ga0395901_0085122 | 3300038443 | Bacteria | 3305 |
| 453 | Ga0395901_0156763 | 3300038443 | Bacteria | 2391 |
| 454 | Ga0395901_0289450 | 3300038443 | Bacteria | 1700 |
| 455 | Ga0395901_0338625 | 3300038443 | Bacteria | 1554 |
| 456 | Ga0436365_1178642 | 3300039437 | Bacteria | 4295 |
| 457 | Ga0436363_1701464 | 3300039450 | Bacteria | 1992 |
| 458 | Ga0439461_0013281 | 3300041410 | Bacteria | 1553 |
| 459 | Ga0451853_1619588 | 3300041512 | Bacteria | 2371 |
| 460 | Ga0451853_1722531 | 3300041512 | Bacteria | 2911 |
| 461 | Ga0466961_0001257 | 3300044693 | Bacteria | 15630 |
| 462 | Ga0466961_0118988 | 3300044693 | Bacteria | 1659 |
| 463 | Ga0466961_0265418 | 3300044693 | Bacteria | 1052 |
| 464 | Ga0466963_0002591 | 3300044694 | Bacteria | 10149 |
| 465 | Ga0466963_0004141 | 3300044694 | Bacteria | 8389 |
| 466 | Ga0466963_0063705 | 3300044694 | Bacteria | 2468 |
| 467 | Ga0466963_0356777 | 3300044694 | Bacteria | 1030 |
| 468 | Ga0466964_0007132 | 3300044706 | Bacteria | 4179 |
| 469 | Ga0466964_0013174 | 3300044706 | Bacteria | 3135 |
| 470 | Ga0466964_0028663 | 3300044706 | Bacteria | 2195 |
| 471 | Ga0466971_0000806 | 3300044719 | Bacteria | 12630 |
| 472 | Ga0466971_0033780 | 3300044719 | Bacteria | 2292 |
| 473 | Ga0466968_0010622 | 3300044735 | Bacteria | 3575 |
| 474 | Ga0466968_0060902 | 3300044735 | Bacteria | 1628 |
| 475 | Ga0466968_0125587 | 3300044735 | Unclassified | 1164 |
| 476 | Ga0466970_0034332 | 3300044765 | Bacteria | 2685 |
| 477 | Ga0466970_0045822 | 3300044765 | Bacteria | 2329 |
| 478 | Ga0466957_0002131 | 3300044842 | Bacteria | 10591 |
| 479 | Ga0466957_0023621 | 3300044842 | Bacteria | 3635 |
| 480 | Ga0466959_0004135 | 3300045049 | Bacteria | 9664 |
| 481 | Ga0466959_0035983 | 3300045049 | Bacteria | 3658 |
| 482 | Ga0466959_0091984 | 3300045049 | Bacteria | 2178 |
| 483 | Ga0451576_0149243 | 3300045051 | Bacteria | 2438 |
| 484 | Ga0451576_0561135 | 3300045051 | Bacteria | 1200 |
| 485 | Ga0466958_0000213 | 3300045836 | Bacteria | 21795 |
| 486 | Ga0466958_0015744 | 3300045836 | Bacteria | 4342 |
| 487 | Ga0466958_0035234 | 3300045836 | Bacteria | 2990 |
| 488 | Ga0466958_0214544 | 3300045836 | Bacteria | 1227 |
| 489 | Ga0466967_0000845 | 3300045976 | Bacteria | 16209 |
| 490 | Ga0466967_0006891 | 3300045976 | Bacteria | 8114 |
| 491 | Ga0466967_0031187 | 3300045976 | Bacteria | 4484 |
| 492 | Ga0466967_0040463 | 3300045976 | Bacteria | 4013 |
| 493 | Ga0466967_0041570 | 3300045976 | Bacteria | 3965 |
| 494 | Ga0466967_0063013 | 3300045976 | Bacteria | 3293 |
| 495 | Ga0466967_0079569 | 3300045976 | Bacteria | 2955 |
| 496 | Ga0466967_0082366 | 3300045976 | Bacteria | 2908 |
| 497 | Ga0466967_0103884 | 3300045976 | Bacteria | 2600 |
| 498 | Ga0466967_0107621 | 3300045976 | Bacteria | 2557 |
| 499 | Ga0466967_0162669 | 3300045976 | Bacteria | 2096 |
| 500 | Ga0466967_0515305 | 3300045976 | Unclassified | 1175 |
| 501 | Ga0466967_0565403 | 3300045976 | Unclassified | 1120 |
| 502 | Ga0495592_0132283 | 3300046454 | Unclassified | 1744 |
| 503 | Ga0495603_0024564 | 3300046455 | Bacteria | 3646 |
| 504 | Ga0495603_0031182 | 3300046455 | Bacteria | 3209 |
| 505 | Ga0495603_0066499 | 3300046455 | Bacteria | 2123 |
| 506 | Ga0495629_0000593 | 3300046459 | Bacteria | 29449 |
| 507 | Ga0495629_0011270 | 3300046459 | Bacteria | 6495 |
| 508 | Ga0495629_0175130 | 3300046459 | Unclassified | 1488 |
| 509 | Ga0495629_0281082 | 3300046459 | Bacteria | 1142 |
| 510 | Ga0495641_0000529 | 3300046461 | Bacteria | 32060 |
| 511 | Ga0495641_0012570 | 3300046461 | Bacteria | 4722 |
| 512 | Ga0495651_0016198 | 3300046462 | Bacteria | 5774 |
| 513 | Ga0495651_0044071 | 3300046462 | Bacteria | 3458 |
| 514 | Ga0495651_0279756 | 3300046462 | Unclassified | 1128 |
| 515 | Ga0495653_0035219 | 3300046463 | Bacteria | 3952 |
| 516 | Ga0495653_0035557 | 3300046463 | Bacteria | 3930 |
| 517 | Ga0495653_0041954 | 3300046463 | Bacteria | 3568 |
| 518 | Ga0495582_0000056 | 3300046473 | Bacteria | 57084 |
| 519 | Ga0495582_0009950 | 3300046473 | Bacteria | 5235 |
| 520 | Ga0495582_0074001 | 3300046473 | Bacteria | 1886 |
| 521 | Ga0495582_0142819 | 3300046473 | Unclassified | 1357 |
| 522 | Ga0495605_0054430 | 3300046474 | Bacteria | 1938 |
| 523 | Ga0495662_0001726 | 3300046476 | Bacteria | 10911 |
| 524 | Ga0495662_0106926 | 3300046476 | Bacteria | 1370 |
| 525 | Ga0495584_0021606 | 3300046491 | Bacteria | 3268 |
| 526 | Ga0495584_0092941 | 3300046491 | Bacteria | 1522 |
| 527 | Ga0495594_0024875 | 3300046499 | Bacteria | 3218 |
| 528 | Ga0495608_0097646 | 3300046511 | Bacteria | 1896 |
| 529 | Ga0495608_0131194 | 3300046511 | Bacteria | 1603 |
| 530 | Ga0495608_0155018 | 3300046511 | Bacteria | 1458 |
| 531 | Ga0495608_0175839 | 3300046511 | Bacteria | 1356 |
| 532 | Ga0495608_0209026 | 3300046511 | Bacteria | 1227 |
| 533 | Ga0495618_0024979 | 3300046514 | Bacteria | 3707 |
| 534 | Ga0495630_0002187 | 3300046517 | Bacteria | 13612 |
| 535 | Ga0495630_0005694 | 3300046517 | Bacteria | 8809 |
| 536 | Ga0495630_0060446 | 3300046517 | Bacteria | 2844 |
| 537 | Ga0495630_0149966 | 3300046517 | Bacteria | 1774 |
| 538 | Ga0495630_0168340 | 3300046517 | Bacteria | 1669 |
| 539 | Ga0495630_0215366 | 3300046517 | Unclassified | 1466 |
| 540 | Ga0495637_0088975 | 3300046520 | Bacteria | 1221 |
| 541 | Ga0495644_0133162 | 3300046523 | Bacteria | 948 |
| 542 | Ga0495652_0185315 | 3300046529 | Bacteria | 1593 |
| 543 | Ga0495652_0269425 | 3300046529 | Bacteria | 1252 |
| 544 | Ga0495665_0000364 | 3300046531 | Bacteria | 22881 |
| 545 | Ga0495665_0035067 | 3300046531 | Bacteria | 2682 |
| 546 | Ga0495640_0033296 | 3300046533 | Bacteria | 3662 |
| 547 | Ga0495640_0070703 | 3300046533 | Bacteria | 2344 |
| 548 | Ga0495586_0092655 | 3300046535 | Bacteria | 1670 |
| 549 | Ga0495645_0241711 | 3300046543 | Archaea | 1204 |
| 550 | Ga0495645_0295235 | 3300046543 | Bacteria | 1061 |
| 551 | Ga0495667_0005804 | 3300046559 | Bacteria | 8365 |
| 552 | Ga0495667_0029564 | 3300046559 | Bacteria | 3688 |
| 553 | Ga0495667_0031250 | 3300046559 | Bacteria | 3575 |
| 554 | Ga0495667_0099868 | 3300046559 | Bacteria | 1878 |
| 555 | Ga0495656_0062466 | 3300046615 | Bacteria | 1629 |
| 556 | Ga0495634_0040558 | 3300046642 | Bacteria | 3165 |
| 557 | Ga0495634_0067864 | 3300046642 | Unclassified | 2358 |
| 558 | Ga0495634_0088462 | 3300046642 | Bacteria | 2014 |
| 559 | Ga0495634_0096497 | 3300046642 | Bacteria | 1914 |
| 560 | Ga0495635_0036613 | 3300046663 | Bacteria | 3401 |
| 561 | Ga0495635_0066558 | 3300046663 | Bacteria | 2471 |
| 562 | Ga0495588_0034334 | 3300046674 | Bacteria | 2567 |
| 563 | Ga0495657_0058777 | 3300046675 | Bacteria | 2552 |
| 564 | Ga0495599_0051253 | 3300046678 | Bacteria | 2586 |
| 565 | Ga0495623_0107662 | 3300046679 | Bacteria | 1692 |
| 566 | Ga0495646_0036425 | 3300046680 | Bacteria | 3048 |
| 567 | Ga0495646_0082403 | 3300046680 | Bacteria | 1872 |
| 568 | Ga0495647_0104644 | 3300046681 | Bacteria | 1175 |
| 569 | Ga0495658_0000204 | 3300046683 | Bacteria | 34365 |
| 570 | Ga0495613_0000401 | 3300046689 | Bacteria | 37127 |
| 571 | Ga0495613_0064032 | 3300046689 | Bacteria | 2690 |
| 572 | Ga0495613_0389244 | 3300046689 | Bacteria | 952 |
| 573 | Ga0495624_0013229 | 3300046690 | Bacteria | 5626 |
| 574 | Ga0495624_0029068 | 3300046690 | Bacteria | 3608 |
| 575 | Ga0495624_0061784 | 3300046690 | Bacteria | 2346 |
| 576 | Ga0495600_0086665 | 3300046809 | Bacteria | 2043 |
| 577 | Ga0495581_0000517 | 3300047315 | Bacteria | 19788 |
| 578 | Ga0495581_0021502 | 3300047315 | Bacteria | 3738 |
| 579 | Ga0495604_0036305 | 3300047317 | Bacteria | 3885 |
| 580 | Ga0495674_0031365 | 3300047319 | Bacteria | 4829 |
| 581 | Ga0495674_0034483 | 3300047319 | Bacteria | 4577 |
| 582 | Ga0495674_0048160 | 3300047319 | Bacteria | 3774 |
| 583 | Ga0495674_0066260 | 3300047319 | Bacteria | 3134 |
| 584 | Ga0495674_0074637 | 3300047319 | Bacteria | 2920 |
| 585 | Ga0495674_0135288 | 3300047319 | Bacteria | 2074 |
| 586 | Ga0495674_0178429 | 3300047319 | Bacteria | 1770 |
| 587 | Ga0495674_0410430 | 3300047319 | Bacteria | 1092 |
| 588 | Ga0495676_0010819 | 3300047321 | Bacteria | 8254 |
| 589 | Ga0495676_0316275 | 3300047321 | Bacteria | 1050 |
| 590 | Ga0495680_0002808 | 3300047322 | Bacteria | 17526 |
| 591 | Ga0495680_0013957 | 3300047322 | Bacteria | 6984 |
| 592 | Ga0495680_0038791 | 3300047322 | Bacteria | 3803 |
| 593 | Ga0495675_0062935 | 3300047444 | Bacteria | 2348 |
| 594 | Ga0495675_0188841 | 3300047444 | Bacteria | 1259 |
| 595 | Ga0495684_0010094 | 3300047471 | Bacteria | 7301 |
| 596 | Ga0495684_0017192 | 3300047471 | Bacteria | 5569 |
| 597 | Ga0495684_0135499 | 3300047471 | Bacteria | 1848 |
| 598 | Ga0495684_0177550 | 3300047471 | Bacteria | 1580 |
| 599 | Ga0495593_0034877 | 3300047673 | Bacteria | 2734 |
| 600 | Ga0495602_0184682 | 3300048088 | Bacteria | 1604 |
| 601 | Ga0496100_0002141 | 3300048903 | Bacteria | 9943 |
| 602 | Ga0496100_0010573 | 3300048903 | Bacteria | 5227 |
| 603 | Ga0496100_0077276 | 3300048903 | Bacteria | 2237 |
| 604 | Ga0496100_0123490 | 3300048903 | Unclassified | 1815 |
| 605 | Ga0496100_0262368 | 3300048903 | Bacteria | 1281 |
| 606 | Ga0496100_0286640 | 3300048903 | Bacteria | 1229 |
| 607 | Ga0496100_0289149 | 3300048903 | Bacteria | 1224 |
| 608 | Ga0496101_0003246 | 3300048904 | Bacteria | 10098 |
| 609 | Ga0496101_0008450 | 3300048904 | Bacteria | 6726 |
| 610 | Ga0496101_0075035 | 3300048904 | Bacteria | 2489 |
| 611 | Ga0496101_0118588 | 3300048904 | Bacteria | 1999 |
| 612 | Ga0496101_0183115 | 3300048904 | Unclassified | 1614 |
| 613 | Ga0496101_0239683 | 3300048904 | Unclassified | 1411 |
| 614 | Ga0496102_0015240 | 3300048905 | Bacteria | 6693 |
| 615 | Ga0496102_0033547 | 3300048905 | Bacteria | 4613 |
| 616 | Ga0496102_0036696 | 3300048905 | Bacteria | 4417 |
| 617 | Ga0496102_0094414 | 3300048905 | Bacteria | 2771 |
| 618 | Ga0496102_0178052 | 3300048905 | Bacteria | 2003 |
| 619 | Ga0496102_0228980 | 3300048905 | Unclassified | 1752 |
| 620 | Ga0496102_0324263 | 3300048905 | Bacteria | 1451 |
| 621 | Ga0496103_0009929 | 3300048906 | Bacteria | 5630 |
| 622 | Ga0496103_0013183 | 3300048906 | Bacteria | 4900 |
| 623 | Ga0496103_0023476 | 3300048906 | Bacteria | 3719 |
| 624 | Ga0496103_0079968 | 3300048906 | Bacteria | 2055 |
| 625 | Ga0496103_0216196 | 3300048906 | Unclassified | 1233 |
| 626 | Ga0496104_0000571 | 3300048907 | Bacteria | 31432 |
| 627 | Ga0496104_0004078 | 3300048907 | Bacteria | 12675 |
| 628 | Ga0496104_0005220 | 3300048907 | Bacteria | 11361 |
| 629 | Ga0496104_0019739 | 3300048907 | Bacteria | 6171 |
| 630 | Ga0496104_0035179 | 3300048907 | Bacteria | 4676 |
| 631 | Ga0496104_0079281 | 3300048907 | Bacteria | 3130 |
| 632 | Ga0496104_0087676 | 3300048907 | Bacteria | 2972 |
| 633 | Ga0496104_0098240 | 3300048907 | Bacteria | 2803 |
| 634 | Ga0496104_0241462 | 3300048907 | Unclassified | 1719 |
| 635 | Ga0496104_0277031 | 3300048907 | Bacteria | 1590 |
| 636 | Ga0496104_0340039 | 3300048907 | Bacteria | 1414 |
| 637 | Ga0496105_0000961 | 3300048908 | Bacteria | 19773 |
| 638 | Ga0496105_0013879 | 3300048908 | Bacteria | 6401 |
| 639 | Ga0496105_0022313 | 3300048908 | Bacteria | 5127 |
| 640 | Ga0496105_0064809 | 3300048908 | Bacteria | 3015 |
| 641 | Ga0496105_0200031 | 3300048908 | Unclassified | 1631 |
| 642 | Ga0496105_0266436 | 3300048908 | Bacteria | 1384 |
| 643 | Ga0496106_0001809 | 3300048909 | Bacteria | 15988 |
| 644 | Ga0496106_0025369 | 3300048909 | Bacteria | 4411 |
| 645 | Ga0496106_0053774 | 3300048909 | Bacteria | 3042 |
| 646 | Ga0496106_0082099 | 3300048909 | Bacteria | 2477 |
| 647 | Ga0496106_0121176 | 3300048909 | Bacteria | 2045 |
| 648 | Ga0496107_0004439 | 3300048910 | Bacteria | 9510 |
| 649 | Ga0496107_0042383 | 3300048910 | Bacteria | 3269 |
| 650 | Ga0496107_0094240 | 3300048910 | Bacteria | 2190 |
| 651 | Ga0496107_0256036 | 3300048910 | Bacteria | 1302 |
| 652 | Ga0496107_0345997 | 3300048910 | Bacteria | 1106 |
| 653 | Ga0496107_0435332 | 3300048910 | Bacteria | 975 |
| 654 | Ga0496108_0007530 | 3300048911 | Bacteria | 8825 |
| 655 | Ga0496108_0015055 | 3300048911 | Bacteria | 6315 |
| 656 | Ga0496108_0022568 | 3300048911 | Bacteria | 5175 |
| 657 | Ga0496108_0043914 | 3300048911 | Bacteria | 3733 |
| 658 | Ga0496108_0179021 | 3300048911 | Bacteria | 1835 |
| 659 | Ga0496108_0400155 | 3300048911 | Unclassified | 1199 |
| 660 | Ga0496109_0000627 | 3300048912 | Bacteria | 29421 |
| 661 | Ga0496109_0008805 | 3300048912 | Bacteria | 8594 |
| 662 | Ga0496109_0013247 | 3300048912 | Bacteria | 7141 |
| 663 | Ga0496109_0028086 | 3300048912 | Bacteria | 5030 |
| 664 | Ga0496109_0043846 | 3300048912 | Bacteria | 4055 |
| 665 | Ga0496109_0048014 | 3300048912 | Bacteria | 3883 |
| 666 | Ga0496109_0117678 | 3300048912 | Bacteria | 2474 |
| 667 | Ga0496109_0159257 | 3300048912 | Bacteria | 2115 |
| 668 | Ga0496109_0220938 | 3300048912 | Bacteria | 1782 |
| 669 | Ga0496109_0329778 | 3300048912 | Unclassified | 1441 |
| 670 | Ga0496109_0458929 | 3300048912 | Unclassified | 1203 |
| 671 | Ga0496110_0001697 | 3300048913 | Bacteria | 16194 |
| 672 | Ga0496110_0005281 | 3300048913 | Bacteria | 10110 |
| 673 | Ga0496110_0022917 | 3300048913 | Bacteria | 5306 |
| 674 | Ga0496110_0025078 | 3300048913 | Bacteria | 5091 |
| 675 | Ga0496110_0027947 | 3300048913 | Bacteria | 4840 |
| 676 | Ga0496110_0042261 | 3300048913 | Bacteria | 3979 |
| 677 | Ga0496110_0056582 | 3300048913 | Bacteria | 3452 |
| 678 | Ga0496110_0060509 | 3300048913 | Bacteria | 3340 |
| 679 | Ga0496110_0064292 | 3300048913 | Bacteria | 3242 |
| 680 | Ga0496110_0108812 | 3300048913 | Bacteria | 2489 |
| 681 | Ga0496110_0335792 | 3300048913 | Bacteria | 1377 |
| 682 | Ga0496110_0371625 | 3300048913 | Unclassified | 1303 |
| 683 | Ga0496110_0624644 | 3300048913 | Bacteria | 976 |
| 684 | Ga0496111_0000025 | 3300048914 | Bacteria | 62100 |
| 685 | Ga0496111_0009321 | 3300048914 | Bacteria | 6546 |
| 686 | Ga0496111_0017357 | 3300048914 | Bacteria | 4976 |
| 687 | Ga0496111_0021089 | 3300048914 | Bacteria | 4545 |
| 688 | Ga0496111_0059634 | 3300048914 | Bacteria | 2765 |
| 689 | Ga0496111_0096630 | 3300048914 | Bacteria | 2168 |
| 690 | Ga0496111_0140340 | 3300048914 | Unclassified | 1791 |
| 691 | Ga0496112_0000682 | 3300048915 | Bacteria | 23689 |
| 692 | Ga0496112_0001024 | 3300048915 | Bacteria | 20548 |
| 693 | Ga0496112_0015247 | 3300048915 | Bacteria | 7165 |
| 694 | Ga0496112_0098785 | 3300048915 | Bacteria | 2888 |
| 695 | Ga0496112_0105101 | 3300048915 | Bacteria | 2793 |
| 696 | Ga0496112_0159028 | 3300048915 | Bacteria | 2226 |
| 697 | Ga0496113_0053493 | 3300048916 | Bacteria | 3019 |
| 698 | Ga0496113_0166023 | 3300048916 | Bacteria | 1746 |
| 699 | Ga0496113_0197122 | 3300048916 | Bacteria | 1600 |
| 700 | Ga0496114_0001762 | 3300048917 | Bacteria | 16435 |
| 701 | Ga0496114_0001903 | 3300048917 | Bacteria | 15881 |
| 702 | Ga0496114_0007861 | 3300048917 | Bacteria | 8436 |
| 703 | Ga0496114_0016390 | 3300048917 | Bacteria | 5970 |
| 704 | Ga0496114_0024485 | 3300048917 | Bacteria | 4929 |
| 705 | Ga0496114_0042179 | 3300048917 | Bacteria | 3782 |
| 706 | Ga0496114_0093406 | 3300048917 | Bacteria | 2558 |
| 707 | Ga0496114_0247627 | 3300048917 | Bacteria | 1568 |
| 708 | Ga0496114_0269823 | 3300048917 | Bacteria | 1499 |
| 709 | Ga0496114_0295282 | 3300048917 | Unclassified | 1430 |
| 710 | Ga0496115_0040733 | 3300048918 | Bacteria | 3694 |
| 711 | Ga0496115_0060979 | 3300048918 | Bacteria | 3040 |
| 712 | Ga0496115_0197105 | 3300048918 | Bacteria | 1664 |
| 713 | Ga0496115_0236775 | 3300048918 | Bacteria | 1505 |
| 714 | Ga0501031_0002836 | 3300049568 | Bacteria | 11064 |
| 715 | Ga0501031_0017768 | 3300049568 | Bacteria | 4625 |
| 716 | Ga0501032_0075615 | 3300049569 | Bacteria | 2243 |
| 717 | Ga0501032_0114185 | 3300049569 | Bacteria | 1786 |
| 718 | Ga0501033_0007191 | 3300049570 | Bacteria | 8688 |
| 719 | Ga0501033_0027422 | 3300049570 | Bacteria | 4283 |
| 720 | Ga0501033_0065676 | 3300049570 | Bacteria | 2669 |
| 721 | Ga0501033_0088107 | 3300049570 | Bacteria | 2271 |
| 722 | Ga0501034_0199999 | 3300049571 | Bacteria | 1957 |
| 723 | Ga0501036_0012624 | 3300049572 | Bacteria | 7006 |
| 724 | Ga0501036_0113734 | 3300049572 | Unclassified | 2287 |
| 725 | Ga0501036_0131125 | 3300049572 | Bacteria | 2116 |
| 726 | Ga0501037_0004757 | 3300049573 | Bacteria | 9874 |
| 727 | Ga0501037_0055474 | 3300049573 | Bacteria | 2897 |
| 728 | Ga0501037_0056883 | 3300049573 | Bacteria | 2856 |
| 729 | Ga0501037_0111132 | 3300049573 | Unclassified | 1974 |
| 730 | Ga0501037_0221647 | 3300049573 | Unclassified | 1330 |
| 731 | Ga0501038_0025085 | 3300049574 | Bacteria | 5314 |
| 732 | Ga0501038_0103840 | 3300049574 | Bacteria | 2363 |
| 733 | Ga0501038_0116457 | 3300049574 | Bacteria | 2208 |
| 734 | Ga0501039_0026847 | 3300049575 | Bacteria | 4425 |
| 735 | Ga0501039_0031443 | 3300049575 | Bacteria | 4092 |
| 736 | Ga0501039_0058587 | 3300049575 | Bacteria | 2983 |
| 737 | Ga0501039_0540606 | 3300049575 | Bacteria | 914 |
| 738 | Ga0501040_0004225 | 3300049576 | Bacteria | 9349 |
| 739 | Ga0501040_0006707 | 3300049576 | Bacteria | 7467 |
| 740 | Ga0501040_0051156 | 3300049576 | Bacteria | 2827 |
| 741 | Ga0501040_0051564 | 3300049576 | Bacteria | 2815 |
| 742 | Ga0501040_0118448 | 3300049576 | Unclassified | 1857 |
| 743 | Ga0501040_0255651 | 3300049576 | Bacteria | 1250 |
| 744 | Ga0501041_0022506 | 3300049577 | Bacteria | 3773 |
| 745 | Ga0501041_0036129 | 3300049577 | Bacteria | 2994 |
| 746 | Ga0501041_0052622 | 3300049577 | Bacteria | 2482 |
| 747 | Ga0501041_0066014 | 3300049577 | Bacteria | 2217 |
| 748 | Ga0501041_0134209 | 3300049577 | Unclassified | 1542 |
| 749 | Ga0501042_0001269 | 3300049578 | Bacteria | 14695 |
| 750 | Ga0501042_0111581 | 3300049578 | Bacteria | 1969 |
| 751 | Ga0501042_0212918 | 3300049578 | Unclassified | 1394 |
| 752 | Ga0501043_0040443 | 3300049579 | Bacteria | 3664 |
| 753 | Ga0501043_0076526 | 3300049579 | Bacteria | 2629 |
| 754 | Ga0501046_0018637 | 3300049580 | Bacteria | 5769 |
| 755 | Ga0501046_0122421 | 3300049580 | Bacteria | 1978 |
| 756 | Ga0501046_0133594 | 3300049580 | Bacteria | 1880 |
| 757 | Ga0501047_0035031 | 3300049581 | Bacteria | 4848 |
| 758 | Ga0501047_0040099 | 3300049581 | Bacteria | 4529 |
| 759 | Ga0501048_0003992 | 3300049582 | Bacteria | 11203 |
| 760 | Ga0501048_0004624 | 3300049582 | Bacteria | 10472 |
| 761 | Ga0501048_0022506 | 3300049582 | Bacteria | 4608 |
| 762 | Ga0501048_0142960 | 3300049582 | Bacteria | 1692 |
| 763 | Ga0501067_0006469 | 3300049583 | Bacteria | 6494 |
| 764 | Ga0501067_0009510 | 3300049583 | Bacteria | 5383 |
| 765 | Ga0501067_0027413 | 3300049583 | Bacteria | 3156 |
| 766 | Ga0501067_0130097 | 3300049583 | Unclassified | 1401 |
| 767 | Ga0501068_0011088 | 3300049584 | Bacteria | 5074 |
| 768 | Ga0501068_0024085 | 3300049584 | Bacteria | 3573 |
| 769 | Ga0501068_0064431 | 3300049584 | Bacteria | 2230 |
| 770 | Ga0501069_0002808 | 3300049585 | Bacteria | 8905 |
| 771 | Ga0501069_0075272 | 3300049585 | Unclassified | 1896 |
| 772 | Ga0501069_0084623 | 3300049585 | Bacteria | 1789 |
| 773 | Ga0501069_0201518 | 3300049585 | Unclassified | 1153 |
| 774 | Ga0501070_0016720 | 3300049586 | Bacteria | 6160 |
| 775 | Ga0501070_0018287 | 3300049586 | Bacteria | 5879 |
| 776 | Ga0501070_0104028 | 3300049586 | Bacteria | 2348 |
| 777 | Ga0501070_0161197 | 3300049586 | Bacteria | 1849 |
| 778 | Ga0501070_0201304 | 3300049586 | Bacteria | 1635 |
| 779 | Ga0501070_0442958 | 3300049586 | Bacteria | 1048 |
| 780 | Ga0501071_0008934 | 3300049587 | Bacteria | 6647 |
| 781 | Ga0501071_0010714 | 3300049587 | Bacteria | 6148 |
| 782 | Ga0501071_0035465 | 3300049587 | Bacteria | 3552 |
| 783 | Ga0501071_0039658 | 3300049587 | Bacteria | 3369 |
| 784 | Ga0501071_0054932 | 3300049587 | Bacteria | 2874 |
| 785 | Ga0501071_0420380 | 3300049587 | Unclassified | 1021 |
| 786 | Ga0501072_0001727 | 3300049588 | Bacteria | 16281 |
| 787 | Ga0501072_0002225 | 3300049588 | Bacteria | 14491 |
| 788 | Ga0501072_0017112 | 3300049588 | Bacteria | 5570 |
| 789 | Ga0501072_0020437 | 3300049588 | Bacteria | 5130 |
| 790 | Ga0501072_0023758 | 3300049588 | Bacteria | 4761 |
| 791 | Ga0501072_0117538 | 3300049588 | Bacteria | 2118 |
| 792 | Ga0501072_0181709 | 3300049588 | Bacteria | 1678 |
| 793 | Ga0501073_0012804 | 3300049589 | Bacteria | 6116 |
| 794 | Ga0501073_0015813 | 3300049589 | Bacteria | 5468 |
| 795 | Ga0501074_0006671 | 3300049590 | Bacteria | 8338 |
| 796 | Ga0501074_0018234 | 3300049590 | Bacteria | 5099 |
| 797 | Ga0501074_0045956 | 3300049590 | Bacteria | 3158 |
| 798 | Ga0501074_0068661 | 3300049590 | Unclassified | 2548 |
| 799 | Ga0501074_0075114 | 3300049590 | Bacteria | 2426 |
| 800 | Ga0501074_0085228 | 3300049590 | Bacteria | 2264 |
| 801 | Ga0501074_0104690 | 3300049590 | Unclassified | 2026 |
| 802 | Ga0501075_0005199 | 3300049591 | Bacteria | 8900 |
| 803 | Ga0501075_0022115 | 3300049591 | Bacteria | 4643 |
| 804 | Ga0501075_0025704 | 3300049591 | Bacteria | 4326 |
| 805 | Ga0501075_0057919 | 3300049591 | Bacteria | 2917 |
| 806 | Ga0501075_0106103 | 3300049591 | Bacteria | 2135 |
| 807 | Ga0501075_0316317 | 3300049591 | Bacteria | 1190 |
| 808 | Ga0501075_0449562 | 3300049591 | Unclassified | 982 |
| 809 | Ga0501076_0000834 | 3300049592 | Bacteria | 20025 |
| 810 | Ga0501076_0003822 | 3300049592 | Bacteria | 10607 |
| 811 | Ga0501076_0008714 | 3300049592 | Bacteria | 7448 |
| 812 | Ga0501076_0011656 | 3300049592 | Bacteria | 6559 |
| 813 | Ga0501076_0014431 | 3300049592 | Bacteria | 5951 |
| 814 | Ga0501076_0154369 | 3300049592 | Unclassified | 1868 |
| 815 | Ga0501077_0003475 | 3300049593 | Bacteria | 9463 |
| 816 | Ga0501077_0009651 | 3300049593 | Bacteria | 5999 |
| 817 | Ga0501077_0010250 | 3300049593 | Bacteria | 5833 |
| 818 | Ga0501077_0045036 | 3300049593 | Bacteria | 2802 |
| 819 | Ga0501077_0078980 | 3300049593 | Bacteria | 2085 |
| 820 | Ga0501077_0109569 | 3300049593 | Bacteria | 1749 |
| 821 | Ga0501077_0160342 | 3300049593 | Bacteria | 1428 |
| 822 | Ga0501079_0006508 | 3300049741 | Bacteria | 8774 |
| 823 | Ga0501079_0035313 | 3300049741 | Bacteria | 3848 |
| 824 | Ga0501079_0064935 | 3300049741 | Bacteria | 2815 |
| 825 | Ga0501079_0100673 | 3300049741 | Bacteria | 2240 |
| 826 | Ga0501079_0183348 | 3300049741 | Bacteria | 1634 |
| 827 | Ga0501079_0358244 | 3300049741 | Unclassified | 1143 |
| 828 | Ga0501079_0387723 | 3300049741 | Unclassified | 1095 |
| 829 | Ga0501080_0007957 | 3300049742 | Bacteria | 9606 |
| 830 | Ga0501080_0017900 | 3300049742 | Bacteria | 6559 |
| 831 | Ga0501080_0024243 | 3300049742 | Bacteria | 5625 |
| 832 | Ga0501080_0039727 | 3300049742 | Bacteria | 4391 |
| 833 | Ga0501080_0060872 | 3300049742 | Bacteria | 3515 |
| 834 | Ga0501080_0684746 | 3300049742 | Bacteria | 905 |
| 835 | Ga0501081_0005843 | 3300049743 | Bacteria | 7964 |
| 836 | Ga0501081_0012576 | 3300049743 | Bacteria | 5565 |
| 837 | Ga0501081_0017634 | 3300049743 | Bacteria | 4730 |
| 838 | Ga0501081_0041920 | 3300049743 | Bacteria | 3136 |
| 839 | Ga0501081_0041975 | 3300049743 | Bacteria | 3134 |
| 840 | Ga0501083_0012338 | 3300049744 | Bacteria | 5979 |
| 841 | Ga0501083_0019786 | 3300049744 | Bacteria | 4684 |
| 842 | Ga0501083_0021887 | 3300049744 | Bacteria | 4439 |
| 843 | Ga0501083_0038176 | 3300049744 | Bacteria | 3266 |
| 844 | Ga0501035_0008332 | 3300049822 | Bacteria | 9652 |
| 845 | Ga0501035_0014191 | 3300049822 | Bacteria | 7352 |
| 846 | Ga0501035_0056136 | 3300049822 | Unclassified | 3515 |
| 847 | Ga0501035_0114670 | 3300049822 | Bacteria | 2359 |
| 848 | Ga0501035_0347331 | 3300049822 | Bacteria | 1242 |
| 849 | Ga0501044_0097329 | 3300049823 | Bacteria | 2964 |
| 850 | Ga0501044_0158269 | 3300049823 | Bacteria | 2244 |
| 851 | Ga0501044_0489463 | 3300049823 | Unclassified | 1132 |
| 852 | Ga0501045_0009365 | 3300049824 | Bacteria | 6848 |
| 853 | Ga0501045_0019112 | 3300049824 | Bacteria | 4880 |
| 854 | Ga0501045_0020864 | 3300049824 | Bacteria | 4683 |
| 855 | Ga0501045_0031561 | 3300049824 | Bacteria | 3837 |
| 856 | Ga0501045_0036920 | 3300049824 | Bacteria | 3550 |
| 857 | Ga0501045_0052158 | 3300049824 | Bacteria | 2985 |
| 858 | nmdc:mga00v17_44846_c1 | 3300050491 | Bacteria | 2668 |
| 859 | nmdc:mga05p37_131358_c1 | 3300050507 | Unclassified | 3072 |
| 860 | nmdc:mga05p37_335168_c1 | 3300050507 | Bacteria | 1785 |
| 861 | nmdc:mga05p37_572913_c1 | 3300050507 | Bacteria | 1280 |
| 862 | nmdc:mga06r32_655215_c1 | 3300050510 | Bacteria | 1018 |
| 863 | nmdc:mga08y16_11536_c1 | 3300050511 | Bacteria | 9286 |
| 864 | nmdc:mga08y16_161059_c1 | 3300050511 | Bacteria | 2331 |
| 865 | nmdc:mga08y16_237767_c1 | 3300050511 | Bacteria | 1883 |
| 866 | nmdc:mga0n895_11302_c1 | 3300050512 | Bacteria | 7956 |
| 867 | nmdc:mga0n895_365757_c1 | 3300050512 | Bacteria | 1460 |
| 868 | nmdc:mga0n895_39210_c1 | 3300050512 | Bacteria | 4595 |
| 869 | nmdc:mga0n895_50037_c1 | 3300050512 | Bacteria | 4096 |
| 870 | nmdc:mga0n895_95008_c1 | 3300050512 | Unclassified | 2985 |
| 871 | nmdc:mga0n895_9898_c1 | 3300050512 | Bacteria | 8383 |
| 872 | nmdc:mga0rr50_44863_c1 | 3300050513 | Bacteria | 3245 |
| 873 | nmdc:mga0rr50_4672_c1 | 3300050513 | Bacteria | 8072 |
| 874 | nmdc:mga08x19_19817_c1 | 3300050514 | Bacteria | 4134 |
| 875 | nmdc:mga08x19_24507_c1 | 3300050514 | Bacteria | 3751 |
| 876 | nmdc:mga0a205_148913_c1 | 3300050515 | Bacteria | 2241 |
| 877 | nmdc:mga0a205_45043_c1 | 3300050515 | Bacteria | 4254 |
| 878 | nmdc:mga0a205_8555_c1 | 3300050515 | Bacteria | 9308 |
| 879 | Ga0495601_0034467 | 3300053077 | Bacteria | 3159 |
| 880 | Ga0495601_0078583 | 3300053077 | Bacteria | 2114 |
| 881 | Ga0495601_0139877 | 3300053077 | Bacteria | 1579 |
| 882 | Ga0495601_0149931 | 3300053077 | Bacteria | 1522 |
| 883 | Ga0495601_0218470 | 3300053077 | Bacteria | 1245 |
| 884 | Ga0495655_0016543 | 3300053083 | Bacteria | 1590 |
| 885 | Ga0495595_0019008 | 3300053084 | Bacteria | 2976 |
| 886 | Ga0495619_0000860 | 3300053085 | Bacteria | 19904 |
| 887 | Ga0495619_0001914 | 3300053085 | Bacteria | 13865 |
| 888 | Ga0495619_0014380 | 3300053085 | Bacteria | 4997 |
| 889 | Ga0495619_0137466 | 3300053085 | Unclassified | 1681 |
| 890 | Ga0501084_0004414 | 3300054114 | Bacteria | 11476 |
| 891 | Ga0501084_0013953 | 3300054114 | Bacteria | 6650 |
| 892 | Ga0501084_0092595 | 3300054114 | Bacteria | 2537 |
| 893 | Ga0501084_0094576 | 3300054114 | Bacteria | 2509 |
| 894 | Ga0501084_0100271 | 3300054114 | Bacteria | 2431 |
| 895 | Ga0501084_0133956 | 3300054114 | Bacteria | 2086 |
| 896 | Ga0501084_0508202 | 3300054114 | Bacteria | 1019 |
| 897 | Ga0501082_0004996 | 3300060353 | Bacteria | 11580 |
| 898 | Ga0501082_0011334 | 3300060353 | Bacteria | 7663 |
| 899 | Ga0501082_0064008 | 3300060353 | Bacteria | 3166 |
| 900 | Ga0501082_0105056 | 3300060353 | Bacteria | 2443 |
| 901 | Ga0501082_0317216 | 3300060353 | Bacteria | 1358 |
| 902 | Ga0501082_0327253 | 3300060353 | Bacteria | 1335 |
| 903 | Ga0466962_0004266 | 3300061719 | Bacteria | 6848 |
| 904 | Ga0530510_0004794 | 3300061734 | Bacteria | 9367 |
| 905 | Ga0530510_0024059 | 3300061734 | Bacteria | 4344 |
| 906 | Ga0530510_0028662 | 3300061734 | Bacteria | 3992 |
| 907 | Ga0530510_0080271 | 3300061734 | Unclassified | 2374 |
| 908 | Ga0530510_0139089 | 3300061734 | Bacteria | 1788 |
| 909 | Ga0530510_0329862 | 3300061734 | Bacteria | 1145 |
| 910 | Ga0307416_100010185 | |||
| 911 | Ga0070658_10014999 | |||
| 912 | Ga0070658_10055542 | |||
| 913 | Ga0070658_10139147 | |||
| 914 | Ga0070658_10202757 | |||
| 915 | Ga0070658_10330707 | |||
| 916 | Ga0070658_10563427 | |||
| 917 | Ga0070683_100005095 | |||
| 918 | Ga0070683_100043245 | |||
| 919 | Ga0070683_100085844 | |||
| 920 | Ga0070683_100135833 | |||
| 921 | Ga0070683_100151432 | |||
| 922 | Ga0070683_100243527 | |||
| 923 | Ga0068869_100075053 | |||
| 924 | Ga0070680_100008922 | |||
| 925 | Ga0070680_100014704 | |||
| 926 | Ga0070680_100088710 | |||
| 927 | Ga0070680_100092128 | |||
| 928 | Ga0070680_100206708 | |||
| 929 | Ga0070682_100002080 | |||
| 930 | Ga0070682_100028763 | |||
| 931 | Ga0070682_100067429 | |||
| 932 | Ga0070682_100280772 | |||
| 933 | Ga0068868_100041284 | |||
| 934 | Ga0070660_100000987 | |||
| 935 | Ga0070660_100001169 | |||
| 936 | Ga0070660_100002777 | |||
| 937 | Ga0070660_100054715 | |||
| 938 | Ga0070660_100149773 | |||
| 939 | Ga0070691_10073192 | |||
| 940 | Ga0070691_10100051 | |||
| 941 | Ga0070687_100237983 | |||
| 942 | Ga0070661_100113408 | |||
| 943 | Ga0070668_100313285 | |||
| 944 | Ga0070668_100447658 | |||
| 945 | Ga0070675_100119207 | |||
| 946 | Ga0070671_100083167 | |||
| 947 | Ga0070673_100188108 | |||
| 948 | Ga0070673_100435203 | |||
| 949 | Ga0070659_100004290 | |||
| 950 | Ga0070659_100111814 | |||
| 951 | Ga0070667_100079168 | |||
| 952 | Ga0070703_10049195 | |||
| 953 | Ga0070709_10051800 | |||
| 954 | Ga0070714_100137507 | |||
| 955 | Ga0070714_100194507 | |||
| 956 | Ga0070714_100308579 | |||
| 957 | Ga0070701_10012978 | |||
| 958 | Ga0070711_100010525 | |||
| 959 | Ga0070700_100195679 | |||
| 960 | Ga0070708_100021939 | |||
| 961 | Ga0070708_100215419 | |||
| 962 | Ga0070663_100025646 | |||
| 963 | Ga0070663_100146324 | |||
| 964 | Ga0070663_100171437 | |||
| 965 | Ga0070678_100004632 | |||
| 966 | Ga0070678_100021921 | |||
| 967 | Ga0070678_100088598 | |||
| 968 | Ga0070681_10004684 | |||
| 969 | Ga0070681_10017778 | |||
| 970 | Ga0070681_10072461 | |||
| 971 | Ga0070681_10079101 | |||
| 972 | Ga0070681_10134187 | |||
| 973 | Ga0070681_10173488 | |||
| 974 | Ga0068867_100203016 | |||
| 975 | Ga0070685_10004070 | |||
| 976 | Ga0070706_100329157 | |||
| 977 | Ga0070706_100559275 | |||
| 978 | Ga0070707_100041336 | |||
| 979 | Ga0070707_100141182 | |||
| 980 | Ga0070707_100216846 | |||
| 981 | Ga0070698_100133718 | |||
| 982 | Ga0070699_100245804 | |||
| 983 | Ga0070679_100001218 | |||
| 984 | Ga0070679_100004651 | |||
| 985 | Ga0070679_100007568 | |||
| 986 | Ga0070679_100015547 | |||
| 987 | Ga0070679_100088082 | |||
| 988 | Ga0070679_100125369 | |||
| 989 | Ga0070679_100173545 | |||
| 990 | Ga0070679_100206726 | |||
| 991 | Ga0070684_100000286 | |||
| 992 | Ga0070684_100002106 | |||
| 993 | Ga0070684_100013868 | |||
| 994 | Ga0070684_100035846 | |||
| 995 | Ga0070684_100060170 | |||
| 996 | Ga0070684_100110894 | |||
| 997 | Ga0070684_100281169 | |||
| 998 | Ga0070684_100302665 | |||
| 999 | Ga0070697_100283089 | |||
| 1000 | Ga0068853_100025116 | |||
| 1001 | Ga0070672_100203103 | |||
| 1002 | Ga0070686_100170754 | |||
| 1003 | Ga0070695_100151190 | |||
| 1004 | Ga0070696_100088809 | |||
| 1005 | Ga0070693_100009173 | |||
| 1006 | Ga0070693_100136189 | |||
| 1007 | Ga0070704_100015570 | |||
| 1008 | Ga0070704_100049551 | |||
| 1009 | Ga0070704_100091849 | |||
| 1010 | Ga0068855_100037454 | |||
| 1011 | Ga0068855_100041238 | |||
| 1012 | Ga0068855_100095042 | |||
| 1013 | Ga0068855_100188790 | |||
| 1014 | Ga0070664_100021964 | |||
| 1015 | Ga0070664_100046027 | |||
| 1016 | Ga0070664_100088838 | |||
| 1017 | Ga0070664_100123079 | |||
| 1018 | Ga0070664_100133260 | |||
| 1019 | Ga0068857_100042520 | |||
| 1020 | Ga0068857_100055433 | |||
| 1021 | Ga0068857_100177333 | |||
| 1022 | Ga0068857_100232663 | |||
| 1023 | Ga0068857_100385005 | |||
| 1024 | Ga0068856_100021996 | |||
| 1025 | Ga0068856_100032908 | |||
| 1026 | Ga0068856_100121997 | |||
| 1027 | Ga0068856_100698265 | |||
| 1028 | Ga0070702_100014210 | |||
| 1029 | Ga0070702_100014973 | |||
| 1030 | Ga0068852_100050181 | |||
| 1031 | Ga0068864_100014602 | |||
| 1032 | Ga0068864_100377122 | |||
| 1033 | Ga0068861_100125109 | |||
| 1034 | Ga0068861_100334402 | |||
| 1035 | Ga0068851_10032592 | |||
| 1036 | Ga0068851_10060482 | |||
| 1037 | Ga0068851_10158616 | |||
| 1038 | Ga0068870_10112731 | |||
| 1039 | Ga0068870_10129831 | |||
| 1040 | Ga0068858_100016800 | |||
| 1041 | Ga0068860_100052269 | |||
| 1042 | Ga0081455_10005553 | |||
| 1043 | Ga0081455_10021586 | |||
| 1044 | Ga0081455_10041400 | |||
| 1045 | Ga0081455_10184200 | |||
| 1046 | Ga0081540_1012803 | |||
| 1047 | Ga0081539_10000712 | |||
| 1048 | Ga0081539_10002673 | |||
| 1049 | Ga0070717_10076668 | |||
| 1050 | Ga0070717_10084650 | |||
| 1051 | Ga0070717_10344823 | |||
| 1052 | Ga0075432_10012364 | |||
| 1053 | Ga0070716_100046550 | |||
| 1054 | Ga0070716_100300818 | |||
| 1055 | Ga0070712_100004684 | |||
| 1056 | Ga0070712_100036378 | |||
| 1057 | Ga0070712_100039370 | |||
| 1058 | Ga0070712_100089081 | |||
| 1059 | Ga0070712_100167708 | |||
| 1060 | Ga0070712_100312425 | |||
| 1061 | Ga0075367_10100213 | |||
| 1062 | Ga0068871_100316933 | |||
| 1063 | Ga0075428_100088832 | |||
| 1064 | Ga0075428_100261873 | |||
| 1065 | Ga0075428_100524166 | |||
| 1066 | Ga0075428_100537389 | |||
| 1067 | Ga0075433_10008842 | |||
| 1068 | Ga0075433_10022515 | |||
| 1069 | Ga0075433_10032720 | |||
| 1070 | Ga0075433_10192143 | |||
| 1071 | Ga0075434_100013022 | |||
| 1072 | Ga0075434_100107931 | |||
| 1073 | Ga0075434_100166640 | |||
| 1074 | Ga0075434_100375839 | |||
| 1075 | Ga0075434_100388395 | |||
| 1076 | Ga0068865_100009909 | |||
| 1077 | Ga0068865_100031618 | |||
| 1078 | Ga0068865_100076755 | |||
| 1079 | Ga0075436_100012021 | |||
| 1080 | Ga0075436_100024460 | |||
| 1081 | Ga0075436_100077116 | |||
| 1082 | Ga0075436_100123089 | |||
| 1083 | Ga0075435_100012599 | |||
| 1084 | Ga0075435_100027092 | |||
| 1085 | Ga0105240_10029379 | |||
| 1086 | Ga0105240_10059378 | |||
| 1087 | Ga0105240_10120718 | |||
| 1088 | Ga0105240_10206823 | |||
| 1089 | Ga0111539_10011337 | |||
| 1090 | Ga0111539_10040887 | |||
| 1091 | Ga0111539_10044887 | |||
| 1092 | Ga0111539_10063304 | |||
| 1093 | Ga0111539_10333887 | |||
| 1094 | Ga0111539_10398611 | |||
| 1095 | Ga0105245_10033516 | |||
| 1096 | Ga0105245_10045484 | |||
| 1097 | Ga0105245_10398926 | |||
| 1098 | Ga0105245_10407954 | |||
| 1099 | Ga0105247_10045020 | |||
| 1100 | Ga0114129_10048125 | |||
| 1101 | Ga0114129_10089957 | |||
| 1102 | Ga0114129_10178559 | |||
| 1103 | Ga0114129_10409961 | |||
| 1104 | Ga0105243_10005927 | |||
| 1105 | Ga0105243_10026222 | |||
| 1106 | Ga0105243_10187977 | |||
| 1107 | Ga0105243_10214490 | |||
| 1108 | Ga0105243_10278918 | |||
| 1109 | Ga0105243_10340682 | |||
| 1110 | Ga0105241_10319467 | |||
| 1111 | Ga0105242_10078749 | |||
| 1112 | Ga0105242_10114080 | |||
| 1113 | Ga0105242_10303793 | |||
| 1114 | Ga0105248_10211114 | |||
| 1115 | Ga0105237_10060611 | |||
| 1116 | Ga0105238_10015630 | |||
| 1117 | Ga0105249_10037426 | |||
| 1118 | Ga0105249_10223565 | |||
| 1119 | Ga0105239_10036761 | |||
| 1120 | Ga0105239_10136164 | |||
| 1121 | Ga0105239_10255997 | |||
| 1122 | Ga0105246_10011293 | |||
| 1123 | Ga0105246_10040253 | |||
| 1124 | Ga0157373_10273610 | |||
| 1125 | Ga0157370_10030380 | |||
| 1126 | Ga0157370_10035597 | |||
| 1127 | Ga0157370_10076192 | |||
| 1128 | Ga0157369_10003190 | |||
| 1129 | Ga0157369_10006794 | |||
| 1130 | Ga0157369_10135804 | |||
| 1131 | Ga0157369_10169134 | |||
| 1132 | Ga0157374_10008984 | |||
| 1133 | Ga0157374_10128899 | |||
| 1134 | Ga0157374_10137631 | |||
| 1135 | Ga0157374_10785813 | |||
| 1136 | Ga0163162_10878477 | |||
| 1137 | Ga0157372_10022486 | |||
| 1138 | Ga0157372_10070280 | |||
| 1139 | Ga0157372_10093063 | |||
| 1140 | Ga0157372_10414823 | |||
| 1141 | Ga0157375_10072787 | |||
| 1142 | Ga0157375_10243759 | |||
| 1143 | Ga0163163_10141851 | |||
| 1144 | Ga0163163_10231316 | |||
| 1145 | Ga0157380_10030996 | |||
| 1146 | Ga0157377_10050141 | |||
| 1147 | Ga0157377_10073965 | |||
| 1148 | Ga0157377_10197064 | |||
| 1149 | Ga0157379_10008081 | |||
| 1150 | Ga0157379_10015282 | |||
| 1151 | Ga0157376_10009504 | |||
| 1152 | Ga0157376_10134305 | |||
| 1153 | Ga0157376_10364004 | |||
| 1154 | Ga0206356_11895397 | |||
| 1155 | Ga0206354_10788483 | |||
| 1156 | Ga0206354_11630888 | |||
| 1157 | Ga0206353_11415625 | |||
| 1158 | Ga0206353_11601542 | |||
| 1159 | Ga0207653_10009255 | |||
| 1160 | Ga0207692_10067871 | |||
| 1161 | Ga0207645_10054929 | |||
| 1162 | Ga0207643_10007509 | |||
| 1163 | Ga0207705_10007957 | |||
| 1164 | Ga0207684_10188438 | |||
| 1165 | Ga0207654_10077693 | |||
| 1166 | Ga0207707_10003902 | |||
| 1167 | Ga0207707_10004085 | |||
| 1168 | Ga0207707_10031620 | |||
| 1169 | Ga0207707_10045695 | |||
| 1170 | Ga0207707_10056574 | |||
| 1171 | Ga0207707_10130861 | |||
| 1172 | Ga0207707_10142260 | |||
| 1173 | Ga0207707_10292976 | |||
| 1174 | Ga0207707_10324570 | |||
| 1175 | Ga0207695_10263121 | |||
| 1176 | Ga0207695_10289984 | |||
| 1177 | Ga0207671_10230223 | |||
| 1178 | Ga0207693_10002465 | |||
| 1179 | Ga0207693_10006225 | |||
| 1180 | Ga0207693_10021715 | |||
| 1181 | Ga0207693_10045347 | |||
| 1182 | Ga0207693_10183700 | |||
| 1183 | Ga0207693_10206786 | |||
| 1184 | Ga0207663_10105012 | |||
| 1185 | Ga0207660_10014400 | |||
| 1186 | Ga0207660_10024911 | |||
| 1187 | Ga0207660_10189797 | |||
| 1188 | Ga0207657_10000046 | |||
| 1189 | Ga0207657_10004670 | |||
| 1190 | Ga0207657_10042210 | |||
| 1191 | Ga0207657_10042628 | |||
| 1192 | Ga0207657_10094324 | |||
| 1193 | Ga0207657_10126311 | |||
| 1194 | Ga0207649_10019235 | |||
| 1195 | Ga0207649_10048163 | |||
| 1196 | Ga0207649_10218712 | |||
| 1197 | Ga0207649_10280126 | |||
| 1198 | Ga0207649_10351575 | |||
| 1199 | Ga0207652_10006892 | |||
| 1200 | Ga0207652_10041215 | |||
| 1201 | Ga0207652_10087240 | |||
| 1202 | Ga0207652_10087576 | |||
| 1203 | Ga0207652_10131087 | |||
| 1204 | Ga0207652_10234910 | |||
| 1205 | Ga0207646_10039067 | |||
| 1206 | Ga0207646_10197755 | |||
| 1207 | Ga0207646_10396258 | |||
| 1208 | Ga0207694_10014338 | |||
| 1209 | Ga0207694_10194327 | |||
| 1210 | Ga0207687_10009713 | |||
| 1211 | Ga0207687_10010814 | |||
| 1212 | Ga0207687_10240376 | |||
| 1213 | Ga0207700_10034480 | |||
| 1214 | Ga0207664_10105869 | |||
| 1215 | Ga0207664_10249254 | |||
| 1216 | Ga0207664_10690694 | |||
| 1217 | Ga0207690_10341088 | |||
| 1218 | Ga0207706_10072795 | |||
| 1219 | Ga0207706_10109698 | |||
| 1220 | Ga0207686_10322957 | |||
| 1221 | Ga0207709_10004893 | |||
| 1222 | Ga0207709_10027758 | |||
| 1223 | Ga0207709_10120591 | |||
| 1224 | Ga0207709_10203453 | |||
| 1225 | Ga0207709_10290189 | |||
| 1226 | Ga0207709_10449924 | |||
| 1227 | Ga0207669_10016875 | |||
| 1228 | Ga0207704_10012479 | |||
| 1229 | Ga0207704_10026920 | |||
| 1230 | Ga0207704_10064600 | |||
| 1231 | Ga0207704_10106511 | |||
| 1232 | Ga0207704_10200501 | |||
| 1233 | Ga0207665_10003617 | |||
| 1234 | Ga0207691_10043160 | |||
| 1235 | Ga0207711_10203594 | |||
| 1236 | Ga0207689_10067839 | |||
| 1237 | Ga0207689_10069438 | |||
| 1238 | Ga0207661_10003778 | |||
| 1239 | Ga0207661_10010487 | |||
| 1240 | Ga0207661_10014601 | |||
| 1241 | Ga0207661_10016038 | |||
| 1242 | Ga0207661_10046285 | |||
| 1243 | Ga0207661_10070805 | |||
| 1244 | Ga0207661_10077276 | |||
| 1245 | Ga0207661_10114824 | |||
| 1246 | Ga0207661_10164314 | |||
| 1247 | Ga0207679_10025645 | |||
| 1248 | Ga0207679_10077368 | |||
| 1249 | Ga0207679_10094843 | |||
| 1250 | Ga0207679_10235960 | |||
| 1251 | Ga0207667_10049261 | |||
| 1252 | Ga0207667_10153733 | |||
| 1253 | Ga0207667_10290498 | |||
| 1254 | Ga0207667_10483752 | |||
| 1255 | Ga0207651_10233314 | |||
| 1256 | Ga0207712_10026346 | |||
| 1257 | Ga0207712_10090867 | |||
| 1258 | Ga0207640_10089330 | |||
| 1259 | Ga0207677_10319779 | |||
| 1260 | Ga0207703_10138211 | |||
| 1261 | Ga0207639_10076169 | |||
| 1262 | Ga0207639_10089922 | |||
| 1263 | Ga0207639_10141330 | |||
| 1264 | Ga0207639_10309824 | |||
| 1265 | Ga0207639_10540966 | |||
| 1266 | Ga0207678_10025566 | |||
| 1267 | Ga0207678_10155621 | |||
| 1268 | Ga0207702_10013421 | |||
| 1269 | Ga0207702_10026096 | |||
| 1270 | Ga0207702_10158445 | |||
| 1271 | Ga0207702_10310855 | |||
| 1272 | Ga0207641_10120808 | |||
| 1273 | Ga0207648_10312083 | |||
| 1274 | Ga0207674_10000589 | |||
| 1275 | Ga0207674_10054841 | |||
| 1276 | Ga0207674_10086205 | |||
| 1277 | Ga0207674_10278559 | |||
| 1278 | Ga0207683_10014750 | |||
| 1279 | Ga0207683_10027940 | |||
| 1280 | Ga0207683_10045987 | |||
| 1281 | Ga0207698_10137922 | |||
| 1282 | Ga0207428_10053447 | |||
| 1283 | Ga0207428_10149316 | |||
| 1284 | Ga0268266_10014070 | |||
| 1285 | Ga0268265_10047379 | |||
| 1286 | Ga0268265_10171348 | |||
| 1287 | Ga0268264_10194913 | |||
| 1288 | Ga0265323_10055471 | |||
| 1289 | Ga0265338_10170025 | |||
| 1290 | Ga0265338_10199356 | |||
| 1291 | Ga0265325_10022952 | |||
| 1292 | Ga0265339_10024386 | |||
| 1293 | Ga0265327_10020304 | |||
| 1294 | Ga0265327_10059895 | |||
| 1295 | Ga0307408_100137892 | |||
| 1296 | Ga0307408_100189782 | |||
| 1297 | Ga0265342_10034167 | |||
| 1298 | Ga0307409_100051627 | |||
| 1299 | Ga0307415_100048805 | |||
| 1300 | Ga0373930_0016453 | |||
| 1301 | Ga0373928_0010580 | |||
| 1302 | Ga0373951_0000908 | |||
| 1303 | Ga0373932_0026731 | |||
| 1304 | Ga0373939_0087376 | |||
| 1305 | Ga0373941_0002261 | |||
| 1306 | Ga0373945_0007159 | |||
| 1307 | Ga0373943_0000112 | |||
| 1308 | Ga0373943_0078661 | |||
| 1309 | Ga0373931_0051738 | |||
| 1310 | Ga0373947_0000600 | |||
| 1311 | Ga0373947_0002931 | |||
| 1312 | Ga0373947_0039500 | |||
| 1313 | Ga0373925_0007897 | |||
| 1314 | Ga0373925_0024389 | |||
| 1315 | Ga0395899_0005838 | |||
| 1316 | Ga0395899_0013404 | |||
| 1317 | Ga0395899_0046945 | |||
| 1318 | Ga0395899_0081277 | |||
| 1319 | Ga0395899_0096962 | |||
| 1320 | Ga0395899_0125278 | |||
| 1321 | Ga0395900_0001970 | |||
| 1322 | Ga0395900_0003522 | |||
| 1323 | Ga0395900_0008763 | |||
| 1324 | Ga0395900_0011690 | |||
| 1325 | Ga0395900_0023971 | |||
| 1326 | Ga0395900_0040529 | |||
| 1327 | Ga0395900_0054626 | |||
| 1328 | Ga0395900_0056594 | |||
| 1329 | Ga0395900_0135223 | |||
| 1330 | Ga0395900_0136016 | |||
| 1331 | Ga0395900_0211572 | |||
| 1332 | Ga0395900_0221380 | |||
| 1333 | Ga0395898_0002384 | |||
| 1334 | Ga0395898_0003184 | |||
| 1335 | Ga0395898_0012598 | |||
| 1336 | Ga0395898_0012993 | |||
| 1337 | Ga0395898_0017911 | |||
| 1338 | Ga0395898_0026766 | |||
| 1339 | Ga0395898_0036101 | |||
| 1340 | Ga0395898_0064600 | |||
| 1341 | Ga0395898_0318157 | |||
| 1342 | Ga0395898_0439470 | |||
| 1343 | Ga0395898_0505324 | |||
| 1344 | Ga0395905_0002425 | |||
| 1345 | Ga0395905_0010165 | |||
| 1346 | Ga0395905_0013914 | |||
| 1347 | Ga0395905_0046824 | |||
| 1348 | Ga0395905_0047631 | |||
| 1349 | Ga0395905_0069679 | |||
| 1350 | Ga0395901_0004313 | |||
| 1351 | Ga0395901_0004948 | |||
| 1352 | Ga0395901_0005093 | |||
| 1353 | Ga0395901_0007139 | |||
| 1354 | Ga0395901_0007152 | |||
| 1355 | Ga0395901_0007511 | |||
| 1356 | Ga0395901_0009134 | |||
| 1357 | Ga0395901_0047223 | |||
| 1358 | Ga0395901_0048345 | |||
| 1359 | Ga0395901_0075284 | |||
| 1360 | Ga0395901_0084227 | |||
| 1361 | Ga0395901_0085122 | |||
| 1362 | Ga0395901_0156763 | |||
| 1363 | Ga0395901_0289450 | |||
| 1364 | Ga0395901_0338625 | |||
| 1365 | Ga0436365_1178642 | |||
| 1366 | Ga0436363_1701464 | |||
| 1367 | Ga0439461_0013281 | |||
| 1368 | Ga0451853_1619588 | |||
| 1369 | Ga0451853_1722531 | |||
| 1370 | Ga0466961_0001257 | |||
| 1371 | Ga0466961_0118988 | |||
| 1372 | Ga0466961_0265418 | |||
| 1373 | Ga0466963_0002591 | |||
| 1374 | Ga0466963_0004141 | |||
| 1375 | Ga0466963_0063705 | |||
| 1376 | Ga0466963_0356777 | |||
| 1377 | Ga0466964_0007132 | |||
| 1378 | Ga0466964_0013174 | |||
| 1379 | Ga0466964_0028663 | |||
| 1380 | Ga0466971_0000806 | |||
| 1381 | Ga0466971_0033780 | |||
| 1382 | Ga0466968_0010622 | |||
| 1383 | Ga0466968_0060902 | |||
| 1384 | Ga0466968_0125587 | |||
| 1385 | Ga0466970_0034332 | |||
| 1386 | Ga0466970_0045822 | |||
| 1387 | Ga0466957_0002131 | |||
| 1388 | Ga0466957_0023621 | |||
| 1389 | Ga0466959_0004135 | |||
| 1390 | Ga0466959_0035983 | |||
| 1391 | Ga0466959_0091984 | |||
| 1392 | Ga0451576_0149243 | |||
| 1393 | Ga0451576_0561135 | |||
| 1394 | Ga0466958_0000213 | |||
| 1395 | Ga0466958_0015744 | |||
| 1396 | Ga0466958_0035234 | |||
| 1397 | Ga0466958_0214544 | |||
| 1398 | Ga0466967_0000845 | |||
| 1399 | Ga0466967_0006891 | |||
| 1400 | Ga0466967_0031187 | |||
| 1401 | Ga0466967_0040463 | |||
| 1402 | Ga0466967_0041570 | |||
| 1403 | Ga0466967_0063013 | |||
| 1404 | Ga0466967_0079569 | |||
| 1405 | Ga0466967_0082366 | |||
| 1406 | Ga0466967_0103884 | |||
| 1407 | Ga0466967_0107621 | |||
| 1408 | Ga0466967_0162669 | |||
| 1409 | Ga0466967_0515305 | |||
| 1410 | Ga0466967_0565403 | |||
| 1411 | Ga0495592_0132283 | |||
| 1412 | Ga0495603_0024564 | |||
| 1413 | Ga0495603_0031182 | |||
| 1414 | Ga0495603_0066499 | |||
| 1415 | Ga0495629_0000593 | |||
| 1416 | Ga0495629_0011270 | |||
| 1417 | Ga0495629_0175130 | |||
| 1418 | Ga0495629_0281082 | |||
| 1419 | Ga0495641_0000529 | |||
| 1420 | Ga0495641_0012570 | |||
| 1421 | Ga0495651_0016198 | |||
| 1422 | Ga0495651_0044071 | |||
| 1423 | Ga0495651_0279756 | |||
| 1424 | Ga0495653_0035219 | |||
| 1425 | Ga0495653_0035557 | |||
| 1426 | Ga0495653_0041954 | |||
| 1427 | Ga0495582_0000056 | |||
| 1428 | Ga0495582_0009950 | |||
| 1429 | Ga0495582_0074001 | |||
| 1430 | Ga0495582_0142819 | |||
| 1431 | Ga0495605_0054430 | |||
| 1432 | Ga0495662_0001726 | |||
| 1433 | Ga0495662_0106926 | |||
| 1434 | Ga0495584_0021606 | |||
| 1435 | Ga0495584_0092941 | |||
| 1436 | Ga0495594_0024875 | |||
| 1437 | Ga0495608_0097646 | |||
| 1438 | Ga0495608_0131194 | |||
| 1439 | Ga0495608_0155018 | |||
| 1440 | Ga0495608_0175839 | |||
| 1441 | Ga0495608_0209026 | |||
| 1442 | Ga0495618_0024979 | |||
| 1443 | Ga0495630_0002187 | |||
| 1444 | Ga0495630_0005694 | |||
| 1445 | Ga0495630_0060446 | |||
| 1446 | Ga0495630_0149966 | |||
| 1447 | Ga0495630_0168340 | |||
| 1448 | Ga0495630_0215366 | |||
| 1449 | Ga0495637_0088975 | |||
| 1450 | Ga0495644_0133162 | |||
| 1451 | Ga0495652_0185315 | |||
| 1452 | Ga0495652_0269425 | |||
| 1453 | Ga0495665_0000364 | |||
| 1454 | Ga0495665_0035067 | |||
| 1455 | Ga0495640_0033296 | |||
| 1456 | Ga0495640_0070703 | |||
| 1457 | Ga0495586_0092655 | |||
| 1458 | Ga0495645_0241711 | |||
| 1459 | Ga0495645_0295235 | |||
| 1460 | Ga0495667_0005804 | |||
| 1461 | Ga0495667_0029564 | |||
| 1462 | Ga0495667_0031250 | |||
| 1463 | Ga0495667_0099868 | |||
| 1464 | Ga0495656_0062466 | |||
| 1465 | Ga0495634_0040558 | |||
| 1466 | Ga0495634_0067864 | |||
| 1467 | Ga0495634_0088462 | |||
| 1468 | Ga0495634_0096497 | |||
| 1469 | Ga0495635_0036613 | |||
| 1470 | Ga0495635_0066558 | |||
| 1471 | Ga0495588_0034334 | |||
| 1472 | Ga0495657_0058777 | |||
| 1473 | Ga0495599_0051253 | |||
| 1474 | Ga0495623_0107662 | |||
| 1475 | Ga0495646_0036425 | |||
| 1476 | Ga0495646_0082403 | |||
| 1477 | Ga0495647_0104644 | |||
| 1478 | Ga0495658_0000204 | |||
| 1479 | Ga0495613_0000401 | |||
| 1480 | Ga0495613_0064032 | |||
| 1481 | Ga0495613_0389244 | |||
| 1482 | Ga0495624_0013229 | |||
| 1483 | Ga0495624_0029068 | |||
| 1484 | Ga0495624_0061784 | |||
| 1485 | Ga0495600_0086665 | |||
| 1486 | Ga0495581_0000517 | |||
| 1487 | Ga0495581_0021502 | |||
| 1488 | Ga0495604_0036305 | |||
| 1489 | Ga0495674_0031365 | |||
| 1490 | Ga0495674_0034483 | |||
| 1491 | Ga0495674_0048160 | |||
| 1492 | Ga0495674_0066260 | |||
| 1493 | Ga0495674_0074637 | |||
| 1494 | Ga0495674_0135288 | |||
| 1495 | Ga0495674_0178429 | |||
| 1496 | Ga0495674_0410430 | |||
| 1497 | Ga0495676_0010819 | |||
| 1498 | Ga0495676_0316275 | |||
| 1499 | Ga0495680_0002808 | |||
| 1500 | Ga0495680_0013957 | |||
| 1501 | Ga0495680_0038791 | |||
| 1502 | Ga0495675_0062935 | |||
| 1503 | Ga0495675_0188841 | |||
| 1504 | Ga0495684_0010094 | |||
| 1505 | Ga0495684_0017192 | |||
| 1506 | Ga0495684_0135499 | |||
| 1507 | Ga0495684_0177550 | |||
| 1508 | Ga0495593_0034877 | |||
| 1509 | Ga0495602_0184682 | |||
| 1510 | Ga0496100_0002141 | |||
| 1511 | Ga0496100_0010573 | |||
| 1512 | Ga0496100_0077276 | |||
| 1513 | Ga0496100_0123490 | |||
| 1514 | Ga0496100_0262368 | |||
| 1515 | Ga0496100_0286640 | |||
| 1516 | Ga0496100_0289149 | |||
| 1517 | Ga0496101_0003246 | |||
| 1518 | Ga0496101_0008450 | |||
| 1519 | Ga0496101_0075035 | |||
| 1520 | Ga0496101_0118588 | |||
| 1521 | Ga0496101_0183115 | |||
| 1522 | Ga0496101_0239683 | |||
| 1523 | Ga0496102_0015240 | |||
| 1524 | Ga0496102_0033547 | |||
| 1525 | Ga0496102_0036696 | |||
| 1526 | Ga0496102_0094414 | |||
| 1527 | Ga0496102_0178052 | |||
| 1528 | Ga0496102_0228980 | |||
| 1529 | Ga0496102_0324263 | |||
| 1530 | Ga0496103_0009929 | |||
| 1531 | Ga0496103_0013183 | |||
| 1532 | Ga0496103_0023476 | |||
| 1533 | Ga0496103_0079968 | |||
| 1534 | Ga0496103_0216196 | |||
| 1535 | Ga0496104_0000571 | |||
| 1536 | Ga0496104_0004078 | |||
| 1537 | Ga0496104_0005220 | |||
| 1538 | Ga0496104_0019739 | |||
| 1539 | Ga0496104_0035179 | |||
| 1540 | Ga0496104_0079281 | |||
| 1541 | Ga0496104_0087676 | |||
| 1542 | Ga0496104_0098240 | |||
| 1543 | Ga0496104_0241462 | |||
| 1544 | Ga0496104_0277031 | |||
| 1545 | Ga0496104_0340039 | |||
| 1546 | Ga0496105_0000961 | |||
| 1547 | Ga0496105_0013879 | |||
| 1548 | Ga0496105_0022313 | |||
| 1549 | Ga0496105_0064809 | |||
| 1550 | Ga0496105_0200031 | |||
| 1551 | Ga0496105_0266436 | |||
| 1552 | Ga0496106_0001809 | |||
| 1553 | Ga0496106_0025369 | |||
| 1554 | Ga0496106_0053774 | |||
| 1555 | Ga0496106_0082099 | |||
| 1556 | Ga0496106_0121176 | |||
| 1557 | Ga0496107_0004439 | |||
| 1558 | Ga0496107_0042383 | |||
| 1559 | Ga0496107_0094240 | |||
| 1560 | Ga0496107_0256036 | |||
| 1561 | Ga0496107_0345997 | |||
| 1562 | Ga0496107_0435332 | |||
| 1563 | Ga0496108_0007530 | |||
| 1564 | Ga0496108_0015055 | |||
| 1565 | Ga0496108_0022568 | |||
| 1566 | Ga0496108_0043914 | |||
| 1567 | Ga0496108_0179021 | |||
| 1568 | Ga0496108_0400155 | |||
| 1569 | Ga0496109_0000627 | |||
| 1570 | Ga0496109_0008805 | |||
| 1571 | Ga0496109_0013247 | |||
| 1572 | Ga0496109_0028086 | |||
| 1573 | Ga0496109_0043846 | |||
| 1574 | Ga0496109_0048014 | |||
| 1575 | Ga0496109_0117678 | |||
| 1576 | Ga0496109_0159257 | |||
| 1577 | Ga0496109_0220938 | |||
| 1578 | Ga0496109_0329778 | |||
| 1579 | Ga0496109_0458929 | |||
| 1580 | Ga0496110_0001697 | |||
| 1581 | Ga0496110_0005281 | |||
| 1582 | Ga0496110_0022917 | |||
| 1583 | Ga0496110_0025078 | |||
| 1584 | Ga0496110_0027947 | |||
| 1585 | Ga0496110_0042261 | |||
| 1586 | Ga0496110_0056582 | |||
| 1587 | Ga0496110_0060509 | |||
| 1588 | Ga0496110_0064292 | |||
| 1589 | Ga0496110_0108812 | |||
| 1590 | Ga0496110_0335792 | |||
| 1591 | Ga0496110_0371625 | |||
| 1592 | Ga0496110_0624644 | |||
| 1593 | Ga0496111_0000025 | |||
| 1594 | Ga0496111_0009321 | |||
| 1595 | Ga0496111_0017357 | |||
| 1596 | Ga0496111_0021089 | |||
| 1597 | Ga0496111_0059634 | |||
| 1598 | Ga0496111_0096630 | |||
| 1599 | Ga0496111_0140340 | |||
| 1600 | Ga0496112_0000682 | |||
| 1601 | Ga0496112_0001024 | |||
| 1602 | Ga0496112_0015247 | |||
| 1603 | Ga0496112_0098785 | |||
| 1604 | Ga0496112_0105101 | |||
| 1605 | Ga0496112_0159028 | |||
| 1606 | Ga0496113_0053493 | |||
| 1607 | Ga0496113_0166023 | |||
| 1608 | Ga0496113_0197122 | |||
| 1609 | Ga0496114_0001762 | |||
| 1610 | Ga0496114_0001903 | |||
| 1611 | Ga0496114_0007861 | |||
| 1612 | Ga0496114_0016390 | |||
| 1613 | Ga0496114_0024485 | |||
| 1614 | Ga0496114_0042179 | |||
| 1615 | Ga0496114_0093406 | |||
| 1616 | Ga0496114_0247627 | |||
| 1617 | Ga0496114_0269823 | |||
| 1618 | Ga0496114_0295282 | |||
| 1619 | Ga0496115_0040733 | |||
| 1620 | Ga0496115_0060979 | |||
| 1621 | Ga0496115_0197105 | |||
| 1622 | Ga0496115_0236775 | |||
| 1623 | Ga0501031_0002836 | |||
| 1624 | Ga0501031_0017768 | |||
| 1625 | Ga0501032_0075615 | |||
| 1626 | Ga0501032_0114185 | |||
| 1627 | Ga0501033_0007191 | |||
| 1628 | Ga0501033_0027422 | |||
| 1629 | Ga0501033_0065676 | |||
| 1630 | Ga0501033_0088107 | |||
| 1631 | Ga0501034_0199999 | |||
| 1632 | Ga0501036_0012624 | |||
| 1633 | Ga0501036_0113734 | |||
| 1634 | Ga0501036_0131125 | |||
| 1635 | Ga0501037_0004757 | |||
| 1636 | Ga0501037_0055474 | |||
| 1637 | Ga0501037_0056883 | |||
| 1638 | Ga0501037_0111132 | |||
| 1639 | Ga0501037_0221647 | |||
| 1640 | Ga0501038_0025085 | |||
| 1641 | Ga0501038_0103840 | |||
| 1642 | Ga0501038_0116457 | |||
| 1643 | Ga0501039_0026847 | |||
| 1644 | Ga0501039_0031443 | |||
| 1645 | Ga0501039_0058587 | |||
| 1646 | Ga0501039_0540606 | |||
| 1647 | Ga0501040_0004225 | |||
| 1648 | Ga0501040_0006707 | |||
| 1649 | Ga0501040_0051156 | |||
| 1650 | Ga0501040_0051564 | |||
| 1651 | Ga0501040_0118448 | |||
| 1652 | Ga0501040_0255651 | |||
| 1653 | Ga0501041_0022506 | |||
| 1654 | Ga0501041_0036129 | |||
| 1655 | Ga0501041_0052622 | |||
| 1656 | Ga0501041_0066014 | |||
| 1657 | Ga0501041_0134209 | |||
| 1658 | Ga0501042_0001269 | |||
| 1659 | Ga0501042_0111581 | |||
| 1660 | Ga0501042_0212918 | |||
| 1661 | Ga0501043_0040443 | |||
| 1662 | Ga0501043_0076526 | |||
| 1663 | Ga0501046_0018637 | |||
| 1664 | Ga0501046_0122421 | |||
| 1665 | Ga0501046_0133594 | |||
| 1666 | Ga0501047_0035031 | |||
| 1667 | Ga0501047_0040099 | |||
| 1668 | Ga0501048_0003992 | |||
| 1669 | Ga0501048_0004624 | |||
| 1670 | Ga0501048_0022506 | |||
| 1671 | Ga0501048_0142960 | |||
| 1672 | Ga0501067_0006469 | |||
| 1673 | Ga0501067_0009510 | |||
| 1674 | Ga0501067_0027413 | |||
| 1675 | Ga0501067_0130097 | |||
| 1676 | Ga0501068_0011088 | |||
| 1677 | Ga0501068_0024085 | |||
| 1678 | Ga0501068_0064431 | |||
| 1679 | Ga0501069_0002808 | |||
| 1680 | Ga0501069_0075272 | |||
| 1681 | Ga0501069_0084623 | |||
| 1682 | Ga0501069_0201518 | |||
| 1683 | Ga0501070_0016720 | |||
| 1684 | Ga0501070_0018287 | |||
| 1685 | Ga0501070_0104028 | |||
| 1686 | Ga0501070_0161197 | |||
| 1687 | Ga0501070_0201304 | |||
| 1688 | Ga0501070_0442958 | |||
| 1689 | Ga0501071_0008934 | |||
| 1690 | Ga0501071_0010714 | |||
| 1691 | Ga0501071_0035465 | |||
| 1692 | Ga0501071_0039658 | |||
| 1693 | Ga0501071_0054932 | |||
| 1694 | Ga0501071_0420380 | |||
| 1695 | Ga0501072_0001727 | |||
| 1696 | Ga0501072_0002225 | |||
| 1697 | Ga0501072_0017112 | |||
| 1698 | Ga0501072_0020437 | |||
| 1699 | Ga0501072_0023758 | |||
| 1700 | Ga0501072_0117538 | |||
| 1701 | Ga0501072_0181709 | |||
| 1702 | Ga0501073_0012804 | |||
| 1703 | Ga0501073_0015813 | |||
| 1704 | Ga0501074_0006671 | |||
| 1705 | Ga0501074_0018234 | |||
| 1706 | Ga0501074_0045956 | |||
| 1707 | Ga0501074_0068661 | |||
| 1708 | Ga0501074_0075114 | |||
| 1709 | Ga0501074_0085228 | |||
| 1710 | Ga0501074_0104690 | |||
| 1711 | Ga0501075_0005199 | |||
| 1712 | Ga0501075_0022115 | |||
| 1713 | Ga0501075_0025704 | |||
| 1714 | Ga0501075_0057919 | |||
| 1715 | Ga0501075_0106103 | |||
| 1716 | Ga0501075_0316317 | |||
| 1717 | Ga0501075_0449562 | |||
| 1718 | Ga0501076_0000834 | |||
| 1719 | Ga0501076_0003822 | |||
| 1720 | Ga0501076_0008714 | |||
| 1721 | Ga0501076_0011656 | |||
| 1722 | Ga0501076_0014431 | |||
| 1723 | Ga0501076_0154369 | |||
| 1724 | Ga0501077_0003475 | |||
| 1725 | Ga0501077_0009651 | |||
| 1726 | Ga0501077_0010250 | |||
| 1727 | Ga0501077_0045036 | |||
| 1728 | Ga0501077_0078980 | |||
| 1729 | Ga0501077_0109569 | |||
| 1730 | Ga0501077_0160342 | |||
| 1731 | Ga0501079_0006508 | |||
| 1732 | Ga0501079_0035313 | |||
| 1733 | Ga0501079_0064935 | |||
| 1734 | Ga0501079_0100673 | |||
| 1735 | Ga0501079_0183348 | |||
| 1736 | Ga0501079_0358244 | |||
| 1737 | Ga0501079_0387723 | |||
| 1738 | Ga0501080_0007957 | |||
| 1739 | Ga0501080_0017900 | |||
| 1740 | Ga0501080_0024243 | |||
| 1741 | Ga0501080_0039727 | |||
| 1742 | Ga0501080_0060872 | |||
| 1743 | Ga0501080_0684746 | |||
| 1744 | Ga0501081_0005843 | |||
| 1745 | Ga0501081_0012576 | |||
| 1746 | Ga0501081_0017634 | |||
| 1747 | Ga0501081_0041920 | |||
| 1748 | Ga0501081_0041975 | |||
| 1749 | Ga0501083_0012338 | |||
| 1750 | Ga0501083_0019786 | |||
| 1751 | Ga0501083_0021887 | |||
| 1752 | Ga0501083_0038176 | |||
| 1753 | Ga0501035_0008332 | |||
| 1754 | Ga0501035_0014191 | |||
| 1755 | Ga0501035_0056136 | |||
| 1756 | Ga0501035_0114670 | |||
| 1757 | Ga0501035_0347331 | |||
| 1758 | Ga0501044_0097329 | |||
| 1759 | Ga0501044_0158269 | |||
| 1760 | Ga0501044_0489463 | |||
| 1761 | Ga0501045_0009365 | |||
| 1762 | Ga0501045_0019112 | |||
| 1763 | Ga0501045_0020864 | |||
| 1764 | Ga0501045_0031561 | |||
| 1765 | Ga0501045_0036920 | |||
| 1766 | Ga0501045_0052158 | |||
| 1767 | nmdc:mga00v17_44846_c1 | |||
| 1768 | nmdc:mga05p37_131358_c1 | |||
| 1769 | nmdc:mga05p37_335168_c1 | |||
| 1770 | nmdc:mga05p37_572913_c1 | |||
| 1771 | nmdc:mga06r32_655215_c1 | |||
| 1772 | nmdc:mga08y16_11536_c1 | |||
| 1773 | nmdc:mga08y16_161059_c1 | |||
| 1774 | nmdc:mga08y16_237767_c1 | |||
| 1775 | nmdc:mga0n895_11302_c1 | |||
| 1776 | nmdc:mga0n895_365757_c1 | |||
| 1777 | nmdc:mga0n895_39210_c1 | |||
| 1778 | nmdc:mga0n895_50037_c1 | |||
| 1779 | nmdc:mga0n895_95008_c1 | |||
| 1780 | nmdc:mga0n895_9898_c1 | |||
| 1781 | nmdc:mga0rr50_44863_c1 | |||
| 1782 | nmdc:mga0rr50_4672_c1 | |||
| 1783 | nmdc:mga08x19_19817_c1 | |||
| 1784 | nmdc:mga08x19_24507_c1 | |||
| 1785 | nmdc:mga0a205_148913_c1 | |||
| 1786 | nmdc:mga0a205_45043_c1 | |||
| 1787 | nmdc:mga0a205_8555_c1 | |||
| 1788 | Ga0495601_0034467 | |||
| 1789 | Ga0495601_0078583 | |||
| 1790 | Ga0495601_0139877 | |||
| 1791 | Ga0495601_0149931 | |||
| 1792 | Ga0495601_0218470 | |||
| 1793 | Ga0495655_0016543 | |||
| 1794 | Ga0495595_0019008 | |||
| 1795 | Ga0495619_0000860 | |||
| 1796 | Ga0495619_0001914 | |||
| 1797 | Ga0495619_0014380 | |||
| 1798 | Ga0495619_0137466 | |||
| 1799 | Ga0501084_0004414 | |||
| 1800 | Ga0501084_0013953 | |||
| 1801 | Ga0501084_0092595 | |||
| 1802 | Ga0501084_0094576 | |||
| 1803 | Ga0501084_0100271 | |||
| 1804 | Ga0501084_0133956 | |||
| 1805 | Ga0501084_0508202 | |||
| 1806 | Ga0501082_0004996 | |||
| 1807 | Ga0501082_0011334 | |||
| 1808 | Ga0501082_0064008 | |||
| 1809 | Ga0501082_0105056 | |||
| 1810 | Ga0501082_0317216 | |||
| 1811 | Ga0501082_0327253 | |||
| 1812 | Ga0466962_0004266 | |||
| 1813 | Ga0530510_0004794 | |||
| 1814 | Ga0530510_0024059 | |||
| 1815 | Ga0530510_0028662 | |||
| 1816 | Ga0530510_0080271 | |||
| 1817 | Ga0530510_0139089 | |||
| 1818 | Ga0530510_0329862 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9424 | 1 | 286 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9298 | 1 | 287 |
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.9283 | 2 | 290 |
| 2gqu-assembly1.cif.gz_A | crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus | 0.928 | 1 | 284 |
| 2gqu-assembly1.cif.gz_A | crystal structure of udp-n-acetylenolpyruvylglucosamine reductase (murb) from thermus caldophilus | 0.9247 | 1 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9602 | 205 | 287 | 3.90.78.10 |
| af_I1NID0_30_136_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9402 | 20 | 50 | 3.30.43.10 |
| af_C0PHW4_38_147_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.922 | 20 | 50 | 3.30.43.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9141 | 75 | 199 | 3.30.465.10 |
| af_I1MG67_25_124_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9018 | 20 | 48 | 3.30.43.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538E6V2-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9826 | 1 | 291 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A538FJ94-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.982 | 1 | 291 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A538E6V2-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9793 | 1 | 291 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A538FJ94-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9786 | 1 | 291 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A538DWA8-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9765 | 1 | 291 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |