F485398

General Info

Members Datasets Scaffolds Average Seq Length
908 595 588 184

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0153696|Ga0495633_0153696_32_682
Length 216
Sequence MPMPLXXXXTRAVSEAKADGKTTIRSSRAMTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLTILIAAIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAAFVTGTLSEKLVNRGQSALTQGIGFFIASLAGGVVVLYAFGITYLALVVGLGFEKAFMGSLAFIPGDALKAVLAALAGRAVMAGYPLLPQRA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
16 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2519899620 Rhizobium sp. Pop5 Isolate Nodule
29 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
30 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
31 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
32 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
33 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
34 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
35 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
36 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
37 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
38 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
39 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
40 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
41 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
42 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
43 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
44 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
45 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
46 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
47 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
48 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
49 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
50 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
51 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
52 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
53 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
54 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
55 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
56 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
57 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
58 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
59 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
60 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
61 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
62 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
63 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
64 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
65 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
66 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
67 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
68 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
69 2643221546 Microbacterium sp. Root53 Isolate Unclassified
70 2643221568 Rhizobium sp. Root564 Isolate Unclassified
71 2643221582 Rhizobium sp. Root651 Isolate Unclassified
72 2643221599 Rhizobium sp. Root708 Isolate Unclassified
73 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
74 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
75 2643221651 Afipia sp. Root123D2 Isolate Unclassified
76 2643221693 Rhizobium sp. Root491 Isolate Unclassified
77 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
78 2718217882 Rhizobium sp. N741 Isolate Nodule
79 2718217927 Rhizobium sp. N324 Isolate Nodule
80 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
81 2718218009 Rhizobium sp. N561 Isolate Nodule
82 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
83 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
84 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
85 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
86 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
87 2718218363 Rhizobium sp. N113 Isolate Nodule
88 2718218365 Rhizobium sp. N731 Isolate Nodule
89 2718218366 Rhizobium sp. N621 Isolate Nodule
90 2718218423 Rhizobium sp. N941 Isolate Nodule
91 2721755514 Rhizobium sp. N6212 Isolate Nodule
92 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
93 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
94 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
95 2721755809 Rhizobium sp. N541 Isolate Nodule
96 2721755810 Rhizobium sp. N871 Isolate Nodule
97 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
98 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
99 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
100 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
101 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
102 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
103 2728369365 Rhizobium sp. N1341 Isolate Nodule
104 2728369397 Rhizobium sp. N1314 Isolate Nodule
105 2738541293 Rhizobium sp. GV031 Isolate Unclassified
106 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
107 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
108 2751185800 Brucella pituitosa AA2 Isolate Unclassified
109 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
110 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
111 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
112 2791355256 Rhizobium sp. M10 Isolate Nodule
113 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
114 2791355260 Rhizobium sp. L9 Isolate Nodule
115 2791355261 Rhizobium sp. J15 Isolate Nodule
116 2791355262 Rhizobium sp. M1 Isolate Nodule
117 2791355263 Rhizobium chutanense C5 Isolate Nodule
118 2791355264 Rhizobium sp. S9 Isolate Nodule
119 2791355265 Rhizobium sp. H4 Isolate Nodule
120 2791355266 Rhizobium sp. L43 Isolate Nodule
121 2791355267 Rhizobium sp. L18 Isolate Nodule
122 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
123 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
124 2802429633 Rhizobium anhuiense J3 Isolate Nodule
125 2802429634 Rhizobium anhuiense S10 Isolate Nodule
126 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
127 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
128 2802429637 Rhizobium anhuiense C15 Isolate Nodule
129 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
130 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
131 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
132 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
133 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
134 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
135 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
136 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
137 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
138 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
139 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
140 2838048938 Rhizobium pisi 27/80 Isolate Nodule
141 2838061910 Rhizobium phaseoli L15 Isolate Nodule
142 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
143 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
144 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
145 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
146 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
147 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
148 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
149 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
150 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
151 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
152 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
153 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
154 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
155 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
156 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
157 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
158 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
159 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
160 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
161 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
162 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
163 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
164 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
165 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
166 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
167 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
168 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
169 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
170 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
171 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
172 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
173 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
174 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
175 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
176 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
177 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
178 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
179 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
180 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
181 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
182 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
183 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
184 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
185 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
186 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
187 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
188 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
189 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
190 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
191 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
192 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
193 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
194 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
195 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
196 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
197 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
198 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
199 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
200 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
201 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
202 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
203 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
204 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
205 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
206 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
207 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
208 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
209 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
210 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
211 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
212 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
213 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
214 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
215 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
216 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
217 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
218 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
219 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
220 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
221 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
222 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
223 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
224 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
225 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
226 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
227 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
228 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
229 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
230 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
231 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
232 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
233 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
234 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
235 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
236 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
237 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
238 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
239 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
240 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
241 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
242 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
243 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
244 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
245 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
246 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
247 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
248 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
249 2933599457 Rhizobium phaseoli M3 Isolate Nodule
250 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
251 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
252 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
253 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
254 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
255 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
256 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
257 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
258 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
259 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
260 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
261 2936381700 Rhizobium chutanense C16 Isolate Unclassified
262 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
263 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
264 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
265 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
266 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
267 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
268 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
269 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
270 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
271 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
272 2996887358 Rhizobium sp. R711 Isolate Nodule
273 2996893221 Rhizobium sp. R635 Isolate Nodule
274 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
275 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
276 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
277 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
278 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
279 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
280 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
281 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
282 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
283 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
284 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
285 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
286 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
287 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
288 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
289 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
290 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
291 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
292 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
293 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
294 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
295 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
296 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
297 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
298 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
299 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
300 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
301 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
302 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
303 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
304 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
305 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
306 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
307 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
308 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
309 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
310 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
311 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
312 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
313 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
314 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
315 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
316 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
317 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
318 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
319 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
320 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
321 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
322 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
323 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
324 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
325 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
326 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
327 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
328 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
329 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
330 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
331 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
332 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
333 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
334 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
335 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
336 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
337 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
338 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
339 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
340 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
341 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
342 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
343 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
344 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
345 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
346 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
347 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
348 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
349 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
350 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
351 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
352 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
353 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
354 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
355 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
356 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
357 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
358 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
359 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
360 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
361 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
362 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
365 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
366 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
367 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
368 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
369 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
371 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
372 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
373 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
376 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
396 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
397 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
399 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
400 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
401 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
402 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
404 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
405 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
406 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
407 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
408 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
409 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
410 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
411 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
412 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
413 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
414 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
415 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
416 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
417 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
418 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
419 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
420 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
421 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
422 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
423 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
424 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
425 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
426 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
427 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
428 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
429 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
430 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
431 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
432 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
433 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
434 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
435 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
436 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
439 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
440 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
441 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
442 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
443 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
444 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
445 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
446 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
447 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
448 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
449 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
450 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
451 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
452 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
453 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
454 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
455 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
456 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
457 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
458 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
459 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
460 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
461 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
462 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
463 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
464 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
465 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
466 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
467 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
468 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
469 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
472 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
473 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
474 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
475 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
476 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
477 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
478 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
479 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
480 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
481 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
484 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
485 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
486 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
487 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
488 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
489 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
490 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
491 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
492 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
493 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
494 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
499 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
500 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
501 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
502 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
503 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
504 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
505 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
506 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
507 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
516 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
517 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
518 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
519 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
520 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
522 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
523 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
524 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
525 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
526 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
527 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
528 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
529 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
530 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
531 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
532 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
533 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
534 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
535 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
536 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
537 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
538 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
541 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
542 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
543 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
544 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
545 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
546 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
547 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
548 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
549 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
554 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
555 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
556 8005258706 Rhizobium sp. R693 Isolate Nodule
557 8005275841 Rhizobium sp. N4311 Isolate Nodule
558 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
559 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
560 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
561 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
562 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
563 8005321885 Rhizobium sp. R72 Isolate Nodule
564 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
565 8005382845 Rhizobium sp. R634 Isolate Nodule
566 8005395548 Rhizobium sp. R339 Isolate Nodule
567 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
568 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
569 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
570 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
571 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
572 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
573 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
574 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
575 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
576 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
577 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
578 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
579 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
580 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
581 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
582 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
583 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
584 8018176218 Rhizobium sp. N122 Isolate Nodule
585 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
586 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
587 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
588 8024501048 Rhizobium sp. H4 Isolate Nodule
589 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
590 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
591 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
592 8056382006 Rhizobium croatiense 13T Isolate Nodule
593 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
594 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
595 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.32
Metatranscriptomes 0.44
Isolates 35.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 23.02
Nodule 25.77
Rhizoplane 2.64
Rhizosphere 28.74
Stem 0
Stem Tuber 0
Unclassified 19.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25156J39149_1000019 3300002705 Bacteria 160845
3 JGI25162J39368_1000278 3300002737 Bacteria 48633
4 JGI25162J39368_1000363 3300002737 Bacteria 38689
5 JGI25154J39366_1000055 3300002738 Bacteria 115597
6 JGI25154J39366_1009214 3300002738 Bacteria 1227
7 JGI25158J39367_1000089 3300002739 Bacteria 21244
8 JGI25157J39369_1000024 3300002741 Bacteria 160844
9 JGI25152J39213_1001153 3300002773 Bacteria 12258
10 JGI25152J39213_1003495 3300002773 Bacteria 5337
11 JGI25152J39213_1009407 3300002773 Bacteria 2325
12 JGI25150J39212_1000256 3300002774 Bacteria 28172
13 JGI25150J39212_1003725 3300002774 Bacteria 3518
14 JGI25159J45721_1000250 3300002987 Bacteria 25349
15 JGI25159J45721_1008535 3300002987 Bacteria 2803
16 JGI25151J46595_10000307 3300003187 Bacteria 53542
17 JGI25151J46595_10000916 3300003187 Bacteria 22974
18 JGI25151J46595_10015292 3300003187 Bacteria 3388
19 JGI25151J46595_10028356 3300003187 Bacteria 2230
20 JGI25165J46597_1000482 3300003214 Bacteria 38683
21 JGI25165J46597_1000763 3300003214 Bacteria 24679
22 JGI25165J46597_1004441 3300003214 Bacteria 3010
23 JGI25153J46596_10001761 3300003215 Bacteria 12834
24 JGI25153J46596_10007522 3300003215 Bacteria 5337
25 JGI25153J46596_10007663 3300003215 Bacteria 5264
26 JGI25153J46596_10019683 3300003215 Bacteria 2576
27 JGI25153J46596_10026654 3300003215 Bacteria 2042
28 rootH1_10154698 3300003316 Bacteria 1046
29 rootH2_10084723 3300003320 Bacteria 1744
30 rootL2_10038546 3300003322 Bacteria 9502
31 rootL2_10200840 3300003322 Bacteria 1811
32 rootH1_10092503 3300003323 Bacteria 6769
33 rootH1_10280632 3300003323 Bacteria 1296
34 JGI25160J50197_1000053 3300003354 Bacteria 127632
35 JGI25160J50197_1000632 3300003354 Bacteria 19645
36 JGI25160J50197_1001540 3300003354 Bacteria 11407
37 JGI25160J50197_1010159 3300003354 Bacteria 3424
38 JGI25161J50226_1000039 3300003374 Bacteria 127632
39 JGI25161J50226_1000448 3300003374 Bacteria 19136
40 Ga0055526_1004767 3300003771 Bacteria 8035
41 Ga0055526_1010140 3300003771 Bacteria 4422
42 Ga0055526_1021928 3300003771 Bacteria 2197
43 Ga0055524_1006703 3300003775 Bacteria 4972
44 Ga0055524_1013459 3300003775 Bacteria 3083
45 Ga0055524_1016049 3300003775 Bacteria 2704
46 Ga0055524_1020064 3300003775 Bacteria 2264
47 Ga0055524_1021844 3300003775 Bacteria 2108
48 Ga0055536_1007405 3300003781 Bacteria 4923
49 Ga0055536_1044355 3300003781 Bacteria 1026
50 Ga0055528_1000353 3300003790 Bacteria 37432
51 Ga0055528_1003604 3300003790 Bacteria 7702
52 Ga0055528_1006094 3300003790 Bacteria 5510
53 Ga0055528_1007796 3300003790 Bacteria 4682
54 Ga0055528_1014790 3300003790 Bacteria 2862
55 Ga0055528_1017262 3300003790 Bacteria 2511
56 Ga0055530_10034502 3300003791 Bacteria 1292
57 Ga0055540_1000534 3300003792 Bacteria 28656
58 Ga0055540_1003328 3300003792 Bacteria 7828
59 Ga0055540_1003638 3300003792 Bacteria 7345
60 Ga0055540_1026490 3300003792 Bacteria 1403
61 Ga0055531_10006103 3300003794 Bacteria 6899
62 Ga0058692_1002893 3300003856 Bacteria 5559
63 Ga0058692_1008969 3300003856 Bacteria 2553
64 Ga0055543_1000015 3300004625 Bacteria 177197
65 Ga0055543_1000033 3300004625 Bacteria 129476
66 Ga0055543_1001045 3300004625 Bacteria 12287
67 Ga0065165_1000361 3300005262 Bacteria 74514
68 Ga0065165_1004004 3300005262 Bacteria 9631
69 Ga0065165_1011832 3300005262 Bacteria 3595
70 Ga0065165_1013597 3300005262 Bacteria 3224
71 Ga0070670_100000542 3300005331 Bacteria 30025
72 Ga0070668_100121389 3300005347 Bacteria 2089
73 Ga0070671_100070799 3300005355 Bacteria 2910
74 Ga0070667_100241085 3300005367 Bacteria 1614
75 Ga0070709_10015360 3300005434 Bacteria 4355
76 Ga0070714_100084386 3300005435 Bacteria 2771
77 Ga0070713_100002604 3300005436 Bacteria 11787
78 Ga0070711_100011309 3300005439 Bacteria 5539
79 Ga0070711_100373304 3300005439 Bacteria 1151
80 Ga0070663_100281924 3300005455 Bacteria 1324
81 Ga0070665_100035023 3300005548 Bacteria 5050
82 Ga0070665_100056705 3300005548 Bacteria 3928
83 Ga0068855_100316761 3300005563 Bacteria 1725
84 Ga0068854_100127565 3300005578 Bacteria 1939
85 Ga0068854_100138051 3300005578 Bacteria 1868
86 Ga0068856_100409853 3300005614 Bacteria 1375
87 Ga0070717_10164656 3300006028 Bacteria 1926
88 Ga0075365_10000502 3300006038 Bacteria 14879
89 Ga0075365_10003106 3300006038 Bacteria 8447
90 Ga0075365_10009424 3300006038 Bacteria 5613
91 Ga0075365_10122642 3300006038 Bacteria 1794
92 Ga0075368_10092370 3300006042 Bacteria 1238
93 Ga0075363_100082888 3300006048 Bacteria 1756
94 Ga0075364_10004999 3300006051 Bacteria 7691
95 Ga0075364_10130398 3300006051 Bacteria 1687
96 Ga0075364_10152013 3300006051 Bacteria 1560
97 Ga0075364_10342114 3300006051 Bacteria 1019
98 Ga0070715_10027251 3300006163 Bacteria 2281
99 Ga0070712_100088949 3300006175 Bacteria 2258
100 Ga0075362_10011778 3300006177 Bacteria 3453
101 Ga0075362_10181715 3300006177 Bacteria 1019
102 Ga0075367_10001356 3300006178 Bacteria 10425
103 Ga0075367_10215714 3300006178 Bacteria 1200
104 Ga0075369_10004564 3300006186 Bacteria 5130
105 Ga0075369_10020670 3300006186 Bacteria 2697
106 Ga0075369_10025041 3300006186 Bacteria 2478
107 Ga0075369_10033787 3300006186 Bacteria 2169
108 Ga0075369_10074351 3300006186 Bacteria 1499
109 Ga0075369_10080549 3300006186 Bacteria 1443
110 Ga0075369_10092861 3300006186 Bacteria 1348
111 Ga0075366_10021161 3300006195 Bacteria 3781
112 Ga0075366_10053594 3300006195 Bacteria 2396
113 Ga0075370_10000964 3300006353 Bacteria 11874
114 Ga0075370_10023914 3300006353 Bacteria 3370
115 Ga0075370_10224756 3300006353 Bacteria 1110
116 Ga0075370_10294882 3300006353 Bacteria 964
117 Ga0075370_10302034 3300006353 Bacteria 952
118 Ga0099825_1021094 3300006941 Bacteria 4492
119 Ga0099825_1026021 3300006941 Bacteria 3175
120 Ga0099824_1037221 3300006942 Bacteria 1364
121 Ga0099822_1000065 3300006943 Bacteria 56217
122 Ga0099822_1024033 3300006943 Bacteria 5517
123 Ga0099823_1010048 3300006944 Bacteria 9616
124 Ga0079104_1000210 3300006946 Bacteria 81817
125 Ga0099826_10001594 3300006948 Bacteria 13827
126 Ga0099826_10127939 3300006948 Bacteria 1486
127 Ga0105244_10068388 3300009036 Bacteria 1775
128 Ga0105240_10000027 3300009093 Bacteria 348486
129 Ga0105243_10063806 3300009148 Bacteria 2953
130 Ga0105242_10354548 3300009176 Bacteria 1356
131 Ga0105237_10001405 3300009545 Bacteria 31816
132 Ga0105249_11781244 3300009553 Bacteria 688
133 Ga0123341_1000464 3300009765 Bacteria 24624
134 Ga0123342_1010378 3300009766 Bacteria 10715
135 Ga0123342_1039797 3300009766 Bacteria 1768
136 Ga0105239_10001129 3300010375 Bacteria 36802
137 Ga0105246_10110606 3300011119 Bacteria 2018
138 Ga0157326_1010123 3300012513 Bacteria 1048
139 Ga0157373_10014897 3300013100 Bacteria 5694
140 Ga0157373_10206354 3300013100 Bacteria 1385
141 Ga0157371_10000058 3300013102 Bacteria 171756
142 Ga0157371_10022707 3300013102 Bacteria 4591
143 Ga0157370_10000030 3300013104 Bacteria 145571
144 Ga0157370_10000048 3300013104 Bacteria 124683
145 Ga0157369_10326917 3300013105 Bacteria 1593
146 Ga0157369_10773902 3300013105 Bacteria 987
147 Ga0157378_10902129 3300013297 Bacteria 915
148 Ga0182008_10006529 3300014497 Bacteria 6510
149 Ga0182007_10000937 3300015262 Bacteria 16064
150 Ga0182005_1001754 3300015265 Bacteria 8342
151 Ga0209435_100011 3300025206 Bacteria 413027
152 Ga0209436_100002 3300025208 Bacteria 222172
153 Ga0209436_107046 3300025208 Bacteria 2398
154 Ga0209437_100036 3300025233 Bacteria 469153
155 Ga0209437_100086 3300025233 Bacteria 254578
156 Ga0209437_121846 3300025233 Bacteria 761
157 Ga0207425_1000497 3300025245 Bacteria 24648
158 Ga0207425_1000964 3300025245 Bacteria 13525
159 Ga0207425_1002513 3300025245 Bacteria 6419
160 Ga0207425_1008591 3300025245 Bacteria 2600
161 Ga0207425_1013561 3300025245 Bacteria 1879
162 Ga0209646_1000024 3300025246 Bacteria 413027
163 Ga0209646_1008262 3300025246 Bacteria 1678
164 Ga0209026_1000030 3300025250 Bacteria 329811
165 Ga0209677_100516 3300025253 Bacteria 21521
166 Ga0209148_1027465 3300025254 Bacteria 876
167 Ga0209759_1000011 3300025256 Bacteria 413027
168 Ga0209129_1000658 3300025258 Bacteria 23033
169 Ga0209129_1000890 3300025258 Bacteria 18372
170 Ga0209129_1001153 3300025258 Bacteria 15295
171 Ga0209129_1001378 3300025258 Bacteria 13625
172 Ga0209129_1001657 3300025258 Bacteria 12048
173 Ga0209129_1004287 3300025258 Bacteria 5671
174 Ga0209129_1007173 3300025258 Bacteria 3390
175 Ga0209233_1000056 3300025261 Bacteria 438104
176 Ga0209233_1000110 3300025261 Bacteria 260825
177 Ga0209233_1000298 3300025261 Bacteria 61008
178 Ga0209673_1000091 3300025273 Bacteria 201875
179 Ga0209673_1001285 3300025273 Bacteria 25734
180 Ga0209673_1004117 3300025273 Bacteria 7981
181 Ga0209673_1006399 3300025273 Bacteria 5694
182 Ga0209673_1007139 3300025273 Bacteria 5225
183 Ga0209673_1026900 3300025273 Bacteria 1880
184 Ga0209130_1000015 3300025284 Bacteria 409631
185 Ga0209130_1000038 3300025284 Bacteria 264226
186 Ga0209130_1018765 3300025284 Bacteria 1618
187 Ga0209676_1000019 3300025292 Bacteria 620012
188 Ga0209676_1004595 3300025292 Bacteria 7621
189 Ga0209676_1032015 3300025292 Bacteria 1587
190 Ga0209025_1000575 3300025294 Bacteria 66684
191 Ga0209025_1000664 3300025294 Bacteria 59562
192 Ga0209025_1000880 3300025294 Bacteria 47017
193 Ga0209025_1001375 3300025294 Bacteria 32637
194 Ga0209025_1006816 3300025294 Bacteria 8721
195 Ga0209025_1057108 3300025294 Bacteria 1494
196 Ga0209025_1065679 3300025294 Bacteria 1323
197 Ga0209564_1000398 3300025295 Bacteria 77724
198 Ga0209564_1001741 3300025295 Bacteria 20415
199 Ga0209564_1003865 3300025295 Bacteria 9650
200 Ga0209564_1007416 3300025295 Bacteria 5672
201 Ga0209758_1000191 3300025297 Bacteria 136984
202 Ga0209758_1000549 3300025297 Bacteria 59562
203 Ga0209758_1000740 3300025297 Bacteria 47623
204 Ga0209758_1001295 3300025297 Bacteria 30719
205 Ga0209758_1004280 3300025297 Bacteria 12051
206 Ga0209758_1004315 3300025297 Bacteria 11975
207 Ga0209758_1004324 3300025297 Bacteria 11934
208 Ga0209758_1005815 3300025297 Bacteria 9239
209 Ga0209758_1008829 3300025297 Bacteria 6416
210 Ga0209050_1011433 3300025298 Bacteria 4210
211 Ga0209050_1013123 3300025298 Bacteria 3716
212 Ga0209256_1000870 3300025299 Bacteria 37394
213 Ga0209256_1003603 3300025299 Bacteria 10650
214 Ga0209256_1008014 3300025299 Bacteria 5017
215 Ga0209256_1012400 3300025299 Bacteria 3272
216 Ga0209256_1013008 3300025299 Bacteria 3122
217 Ga0209256_1026173 3300025299 Bacteria 1685
218 Ga0207426_1000063 3300025302 Bacteria 358920
219 Ga0207426_1000081 3300025302 Bacteria 304502
220 Ga0207426_1000144 3300025302 Bacteria 191590
221 Ga0207426_1001195 3300025302 Bacteria 23072
222 Ga0209051_1000205 3300025303 Bacteria 104781
223 Ga0209051_1003436 3300025303 Bacteria 10383
224 Ga0209051_1011156 3300025303 Bacteria 4464
225 Ga0209051_1032300 3300025303 Bacteria 2000
226 Ga0209051_1039676 3300025303 Bacteria 1697
227 Ga0209257_1001929 3300025304 Bacteria 22391
228 Ga0209257_1002628 3300025304 Bacteria 17336
229 Ga0209257_1020482 3300025304 Bacteria 2443
230 Ga0207655_1086908 3300025728 Bacteria 1111
231 Ga0207680_10056809 3300025903 Bacteria 2366
232 Ga0207685_10020520 3300025905 Bacteria 2198
233 Ga0207699_10011314 3300025906 Bacteria 4501
234 Ga0207695_10000024 3300025913 Bacteria 632311
235 Ga0207671_10000463 3300025914 Bacteria 55685
236 Ga0207693_10016133 3300025915 Bacteria 5975
237 Ga0207693_10133692 3300025915 Bacteria 1950
238 Ga0207663_10011390 3300025916 Bacteria 4775
239 Ga0207663_10163492 3300025916 Bacteria 1574
240 Ga0207650_10000769 3300025925 Bacteria 24619
241 Ga0207664_10337136 3300025929 Bacteria 1333
242 Ga0207644_10074801 3300025931 Bacteria 2487
243 Ga0207644_10725520 3300025931 Bacteria 829
244 Ga0207686_10299507 3300025934 Bacteria 1194
245 Ga0207665_10013305 3300025939 Bacteria 5409
246 Ga0207665_10034806 3300025939 Bacteria 3342
247 Ga0207667_10269816 3300025949 Bacteria 1740
248 Ga0207640_10607119 3300025981 Bacteria 927
249 Ga0207678_10030783 3300026067 Bacteria 4685
250 Ga0207702_10339042 3300026078 Bacteria 1436
251 Ga0209281_1000253 3300027111 Bacteria 105600
252 Ga0209389_1000003 3300027296 Bacteria 268927
253 Ga0209371_1000009 3300027312 Bacteria 963030
254 Ga0209371_1001069 3300027312 Bacteria 20494
255 Ga0209371_1002375 3300027312 Bacteria 10648
256 Ga0209371_1003235 3300027312 Bacteria 8124
257 Ga0209371_1003293 3300027312 Bacteria 8001
258 Ga0209589_1000001 3300027357 Bacteria 794224
259 Ga0209589_1000008 3300027357 Bacteria 259970
260 Ga0209489_100001 3300027361 Bacteria 794224
261 Ga0209489_100022 3300027361 Bacteria 202016
262 Ga0209700_100001 3300027363 Bacteria 794224
263 Ga0209700_100023 3300027363 Bacteria 229662
264 Ga0209282_1001731 3300027666 Bacteria 12202
265 Ga0209282_1222231 3300027666 Bacteria 854
266 Ga0268266_10023667 3300028379 Bacteria 5228
267 Ga0268266_10062041 3300028379 Bacteria 3225
268 Ga0268266_10560462 3300028379 Bacteria 1095
269 Ga0307515_10049930 3300028794 Bacteria 6277
270 Ga0307515_10584330 3300028794 Bacteria 727
271 Ga0268256_1000010 3300030500 Bacteria 963034
272 Ga0268256_1000882 3300030500 Bacteria 20778
273 Ga0268256_1002814 3300030500 Bacteria 8429
274 Ga0307513_10030733 3300031456 Bacteria 6097
275 Ga0307513_10404383 3300031456 Bacteria 1099
276 Ga0307516_10499464 3300031730 Bacteria 871
277 Ga0307405_10004852 3300031731 Bacteria 6419
278 Ga0307406_10013413 3300031901 Bacteria 4694
279 Ga0307412_10001068 3300031911 Bacteria 15676
280 Ga0307414_10934898 3300032004 Bacteria 796
281 Ga0307414_11106635 3300032004 Bacteria 732
282 Ga0307510_10285206 3300033180 Bacteria 1120
283 Ga0439436_0045124 3300041404 Bacteria 1255
284 Ga0439466_0062423 3300041411 Bacteria 1198
285 Ga0439465_0006903 3300041413 Bacteria 3606
286 Ga0439465_0011953 3300041413 Bacteria 2719
287 Ga0439465_0028103 3300041413 Bacteria 1782
288 Ga0439465_0057605 3300041413 Bacteria 1282
289 Ga0451787_614361 3300041441 Bacteria 1089
290 Ga0451793_0099162 3300041452 Bacteria 818
291 Ga0451798_0691597 3300041458 Bacteria 1538
292 Ga0451807_0010051 3300041486 Bacteria 1325
293 Ga0451837_0002636 3300041494 Bacteria 3172
294 Ga0451841_0129660 3300041498 Bacteria 3887
295 Ga0451845_0353633 3300041501 Bacteria 1396
296 Ga0451846_44944 3300041502 Bacteria 1036
297 Ga0451849_0977170 3300041505 Bacteria 759
298 Ga0451851_0555611 3300041507 Bacteria 778
299 Ga0451855_0065115 3300041511 Bacteria 1874
300 Ga0451853_1039407 3300041512 Bacteria 1746
301 Ga0439445_0026045 3300042004 Bacteria 1495
302 Ga0439432_025666 3300042006 Bacteria 1932
303 Ga0439449_0017684 3300042007 Bacteria 2677
304 Ga0439452_049582 3300042010 Bacteria 965
305 Ga0439462_0052010 3300042015 Bacteria 1102
306 Ga0466963_0016998 3300044694 Bacteria 4531
307 Ga0466971_0124325 3300044719 Bacteria 1195
308 Ga0466970_0002877 3300044765 Bacteria 8330
309 Ga0466970_0189686 3300044765 Bacteria 1142
310 Ga0466959_0188384 3300045049 Bacteria 1441
311 Ga0466958_0030702 3300045836 Bacteria 3193
312 Ga0466967_0053049 3300045976 Bacteria 3563
313 Ga0466967_0114229 3300045976 Bacteria 2486
314 Ga0495617_090111 3300046452 Bacteria 1001
315 Ga0495590_0032876 3300046457 Bacteria 1814
316 Ga0495590_0155949 3300046457 Bacteria 829
317 Ga0495629_0064028 3300046459 Bacteria 2567
318 Ga0495638_0001240 3300046460 Bacteria 24046
319 Ga0495651_0058156 3300046462 Bacteria 2967
320 Ga0495650_0042218 3300046471 Bacteria 1943
321 Ga0495650_0196403 3300046471 Bacteria 703
322 Ga0495605_0001485 3300046474 Bacteria 15300
323 Ga0495662_0056244 3300046476 Bacteria 1900
324 Ga0495664_0047959 3300046477 Bacteria 2536
325 Ga0495585_0012481 3300046492 Bacteria 5005
326 Ga0495585_0014204 3300046492 Bacteria 4646
327 Ga0495585_0159006 3300046492 Bacteria 1173
328 Ga0495585_0181081 3300046492 Bacteria 1083
329 Ga0495607_0029512 3300046501 Bacteria 3374
330 Ga0495607_0068146 3300046501 Bacteria 1997
331 Ga0495607_0279184 3300046501 Bacteria 793
332 Ga0495583_0010556 3300046506 Bacteria 5371
333 Ga0495583_0029024 3300046506 Bacteria 2711
334 Ga0495606_0000735 3300046507 Bacteria 50674
335 Ga0495606_0023350 3300046507 Bacteria 4482
336 Ga0495606_0140236 3300046507 Bacteria 1428
337 Ga0495606_0203452 3300046507 Bacteria 1127
338 Ga0495606_0233307 3300046507 Bacteria 1030
339 Ga0495610_0002327 3300046512 Bacteria 16059
340 Ga0495610_0019920 3300046512 Bacteria 3739
341 Ga0495610_0055028 3300046512 Bacteria 1920
342 Ga0495610_0138495 3300046512 Bacteria 1050
343 Ga0495610_0157821 3300046512 Bacteria 962
344 Ga0495616_0196504 3300046513 Bacteria 889
345 Ga0495616_0251129 3300046513 Bacteria 760
346 Ga0495620_0014366 3300046515 Bacteria 4026
347 Ga0495620_0017434 3300046515 Bacteria 3580
348 Ga0495631_0009069 3300046518 Bacteria 4983
349 Ga0495631_0228153 3300046518 Bacteria 794
350 Ga0495632_0009593 3300046519 Bacteria 5820
351 Ga0495632_0010893 3300046519 Bacteria 5345
352 Ga0495643_0036715 3300046522 Bacteria 2691
353 Ga0495643_0051706 3300046522 Bacteria 2208
354 Ga0495643_0078477 3300046522 Bacteria 1723
355 Ga0495648_0102243 3300046524 Bacteria 1579
356 Ga0495652_0123384 3300046529 Bacteria 2062
357 Ga0495654_0000043 3300046530 Bacteria 161913
358 Ga0495654_0050543 3300046530 Bacteria 2031
359 Ga0495654_0293013 3300046530 Bacteria 666
360 Ga0495609_0024551 3300046538 Bacteria 2765
361 Ga0495633_0077541 3300046558 Bacteria 1547
362 Ga0495633_0153696 3300046558 Bacteria 1062
363 Ga0495633_0305152 3300046558 Bacteria 723
364 Ga0495656_0082778 3300046615 Bacteria 1452
365 Ga0495668_0014667 3300046616 Bacteria 4589
366 Ga0495668_0052769 3300046616 Bacteria 2249
367 Ga0495668_0144982 3300046616 Bacteria 1300
368 Ga0495634_0103853 3300046642 Bacteria 1834
369 Ga0495625_0001629 3300046660 Bacteria 26456
370 Ga0495625_0071733 3300046660 Bacteria 2430
371 Ga0495625_0281216 3300046660 Bacteria 1070
372 Ga0495625_0430615 3300046660 Bacteria 818
373 Ga0495661_0139054 3300046665 Bacteria 1323
374 Ga0495661_0442303 3300046665 Bacteria 627
375 Ga0495588_0003015 3300046674 Bacteria 7286
376 Ga0495657_0096284 3300046675 Bacteria 1891
377 Ga0495658_0108801 3300046683 Bacteria 1664
378 Ga0495613_0154420 3300046689 Bacteria 1636
379 Ga0495624_0495709 3300046690 Bacteria 731
380 Ga0495670_0171046 3300046691 Bacteria 1144
381 Ga0495670_0422402 3300046691 Bacteria 721
382 Ga0495671_0016935 3300046692 Bacteria 3885
383 Ga0495671_0149217 3300046692 Bacteria 1138
384 Ga0495660_0026081 3300046810 Bacteria 3315
385 Ga0495660_0074784 3300046810 Bacteria 1789
386 Ga0495604_0009543 3300047317 Bacteria 7675
387 Ga0495636_0057426 3300047318 Bacteria 1639
388 Ga0495636_0130593 3300047318 Bacteria 1117
389 Ga0495683_0059267 3300047323 Bacteria 1900
390 Ga0495683_0286941 3300047323 Bacteria 711
391 Ga0495687_029497 3300047443 Bacteria 2538
392 Ga0495687_064212 3300047443 Bacteria 1500
393 Ga0495687_102316 3300047443 Bacteria 1072
394 Ga0495673_0098147 3300047469 Bacteria 1188
395 Ga0495681_0003362 3300047470 Bacteria 11135
396 Ga0495686_0000709 3300047472 Bacteria 44909
397 Ga0495686_0014984 3300047472 Bacteria 5314
398 Ga0495686_0035588 3300047472 Bacteria 3199
399 Ga0495686_0052733 3300047472 Bacteria 2550
400 Ga0495686_0144460 3300047472 Bacteria 1402
401 Ga0495686_0183045 3300047472 Bacteria 1213
402 Ga0495686_0272523 3300047472 Bacteria 943
403 Ga0495686_0279763 3300047472 Bacteria 928
404 Ga0495686_0284012 3300047472 Bacteria 919
405 Ga0495602_0130352 3300048088 Bacteria 2007
406 Ga0495615_0064244 3300048090 Bacteria 976
407 Ga0495626_0092080 3300048091 Bacteria 1332
408 Ga0495626_0138185 3300048091 Bacteria 1035
409 Ga0496100_0072764 3300048903 Bacteria 2298
410 Ga0496101_0074669 3300048904 Bacteria 2494
411 Ga0496101_0080623 3300048904 Bacteria 2405
412 Ga0496101_0088333 3300048904 Bacteria 2302
413 Ga0496102_0059986 3300048905 Bacteria 3480
414 Ga0496103_0051002 3300048906 Bacteria 2560
415 Ga0496105_0105823 3300048908 Bacteria 2322
416 Ga0496106_0003475 3300048909 Bacteria 11736
417 Ga0496107_0194572 3300048910 Bacteria 1507
418 Ga0496109_0778383 3300048912 Bacteria 895
419 Ga0496113_0176237 3300048916 Bacteria 1694
420 Ga0496113_0261938 3300048916 Bacteria 1381
421 Ga0496114_0180005 3300048917 Bacteria 1846
422 Ga0496116_0000080 3300048919 Bacteria 224530
423 Ga0496116_0012346 3300048919 Bacteria 6983
424 Ga0496116_0014972 3300048919 Bacteria 6154
425 Ga0496116_0015287 3300048919 Bacteria 6071
426 Ga0496116_0016190 3300048919 Bacteria 5851
427 Ga0496116_0017971 3300048919 Bacteria 5468
428 Ga0496116_0119207 3300048919 Bacteria 1531
429 Ga0496116_0133015 3300048919 Bacteria 1414
430 Ga0496116_0254781 3300048919 Bacteria 870
431 Ga0496117_0000002 3300048920 Bacteria 2483758
432 Ga0496117_0001662 3300048920 Bacteria 31159
433 Ga0496117_0007726 3300048920 Bacteria 10396
434 Ga0496117_0026756 3300048920 Bacteria 4506
435 Ga0496117_0061498 3300048920 Bacteria 2581
436 Ga0496117_0061747 3300048920 Bacteria 2573
437 Ga0496117_0085619 3300048920 Bacteria 2051
438 Ga0496117_0108157 3300048920 Bacteria 1740
439 Ga0496117_0139005 3300048920 Bacteria 1458
440 Ga0496117_0142915 3300048920 Bacteria 1430
441 Ga0496118_0000483 3300048921 Bacteria 66119
442 Ga0496118_0001307 3300048921 Bacteria 37899
443 Ga0496118_0022314 3300048921 Bacteria 5540
444 Ga0496118_0040214 3300048921 Bacteria 3720
445 Ga0496118_0043655 3300048921 Bacteria 3520
446 Ga0496118_0060165 3300048921 Bacteria 2822
447 Ga0496118_0064309 3300048921 Bacteria 2693
448 Ga0496119_0013327 3300048922 Bacteria 6568
449 Ga0496119_0025048 3300048922 Bacteria 4177
450 Ga0496119_0040211 3300048922 Bacteria 2994
451 Ga0496119_0052702 3300048922 Bacteria 2490
452 Ga0496119_0077573 3300048922 Bacteria 1924
453 Ga0496119_0094460 3300048922 Bacteria 1691
454 Ga0496119_0162549 3300048922 Bacteria 1185
455 Ga0496119_0191074 3300048922 Bacteria 1067
456 Ga0496120_0000971 3300048923 Bacteria 39060
457 Ga0496120_0006732 3300048923 Bacteria 8735
458 Ga0496120_0066508 3300048923 Bacteria 1993
459 Ga0496121_0000001 3300048924 Bacteria 1830318
460 Ga0496121_0002165 3300048924 Bacteria 30743
461 Ga0496121_0018159 3300048924 Bacteria 7111
462 Ga0496121_0067217 3300048924 Bacteria 2906
463 Ga0496121_0076793 3300048924 Bacteria 2662
464 Ga0496121_0082627 3300048924 Bacteria 2538
465 Ga0496121_0086832 3300048924 Bacteria 2457
466 Ga0496121_0093292 3300048924 Bacteria 2344
467 Ga0496121_0285580 3300048924 Bacteria 1127
468 Ga0496122_0000001 3300048925 Bacteria 1827766
469 Ga0496122_0000009 3300048925 Bacteria 584024
470 Ga0496122_0004617 3300048925 Bacteria 16949
471 Ga0496122_0007697 3300048925 Bacteria 11876
472 Ga0496122_0018033 3300048925 Bacteria 6547
473 Ga0496122_0050249 3300048925 Bacteria 3182
474 Ga0496122_0080521 3300048925 Bacteria 2270
475 Ga0496122_0113305 3300048925 Bacteria 1772
476 Ga0496123_0000001 3300048926 Bacteria 1831497
477 Ga0496123_0000020 3300048926 Bacteria 388748
478 Ga0496123_0004746 3300048926 Bacteria 14067
479 Ga0496123_0022781 3300048926 Bacteria 4815
480 Ga0496123_0034689 3300048926 Bacteria 3609
481 Ga0496123_0045341 3300048926 Bacteria 2996
482 Ga0496123_0058705 3300048926 Bacteria 2493
483 Ga0496123_0067892 3300048926 Bacteria 2249
484 Ga0496124_0000262 3300048927 Bacteria 101572
485 Ga0496124_0007119 3300048927 Bacteria 11978
486 Ga0496124_0013622 3300048927 Bacteria 7927
487 Ga0496124_0018393 3300048927 Bacteria 6545
488 Ga0496124_0023230 3300048927 Bacteria 5666
489 Ga0496124_0043893 3300048927 Bacteria 3840
490 Ga0496124_0046038 3300048927 Bacteria 3738
491 Ga0496124_0053381 3300048927 Bacteria 3426
492 Ga0496124_0074779 3300048927 Bacteria 2799
493 Ga0496124_0096633 3300048927 Bacteria 2399
494 Ga0496124_0136624 3300048927 Bacteria 1940
495 Ga0496124_0411296 3300048927 Bacteria 935
496 Ga0496124_0477709 3300048927 Bacteria 842
497 Ga0496125_0000001 3300048928 Bacteria 1766138
498 Ga0496125_0016520 3300048928 Bacteria 7083
499 Ga0496125_0025331 3300048928 Bacteria 5435
500 Ga0496125_0049495 3300048928 Bacteria 3492
501 Ga0496125_0062822 3300048928 Bacteria 2966
502 Ga0496125_0072436 3300048928 Bacteria 2684
503 Ga0496125_0082734 3300048928 Bacteria 2445
504 Ga0496125_0361205 3300048928 Bacteria 863
505 Ga0496126_0000690 3300048929 Bacteria 61848
506 Ga0496126_0111694 3300048929 Bacteria 2380
507 Ga0496126_0147630 3300048929 Bacteria 2018
508 Ga0496126_0148944 3300048929 Bacteria 2007
509 Ga0496126_0183905 3300048929 Bacteria 1773
510 Ga0496126_0289988 3300048929 Bacteria 1353
511 Ga0496126_0352334 3300048929 Bacteria 1204
512 Ga0495678_038514 3300049459 Bacteria 1934
513 Ga0495678_109196 3300049459 Bacteria 946
514 Ga0501031_0441072 3300049568 Bacteria 841
515 Ga0501033_0196836 3300049570 Bacteria 1441
516 Ga0501034_0976209 3300049571 Bacteria 732
517 Ga0501036_0255306 3300049572 Bacteria 1469
518 Ga0501036_0284127 3300049572 Bacteria 1385
519 Ga0501038_0208423 3300049574 Bacteria 1565
520 Ga0501038_0264297 3300049574 Bacteria 1359
521 Ga0501043_0071995 3300049579 Bacteria 2715
522 Ga0501046_0041285 3300049580 Bacteria 3682
523 Ga0501047_0037789 3300049581 Bacteria 4669
524 Ga0501047_0328419 3300049581 Bacteria 1368
525 Ga0501067_0097078 3300049583 Bacteria 1637
526 Ga0501068_0137844 3300049584 Bacteria 1529
527 Ga0501070_0090792 3300049586 Bacteria 2528
528 Ga0501080_0023253 3300049742 Bacteria 5747
529 Ga0501083_0013991 3300049744 Bacteria 5606
530 Ga0501083_0053730 3300049744 Bacteria 2704
531 Ga0501035_0044052 3300049822 Bacteria 4020
532 Ga0501035_0396818 3300049822 Bacteria 1148
533 Ga0501044_0063679 3300049823 Bacteria 3766
534 nmdc:mga03683_28724_c1 3300050489 Bacteria 2214
535 nmdc:mga03683_50247_c1 3300050489 Bacteria 1738
536 nmdc:mga00v17_127673_c1 3300050491 Bacteria 1624
537 nmdc:mga00v17_30517_c1 3300050491 Bacteria 3173
538 nmdc:mga00v17_371750_c1 3300050491 Bacteria 929
539 nmdc:mga00v17_45280_c1 3300050491 Bacteria 2657
540 nmdc:mga0yw44_223802_c1 3300050492 Bacteria 1248
541 nmdc:mga0yw44_441_c1 3300050492 Bacteria 14578
542 nmdc:mga0k408_69746_c1 3300050493 Bacteria 2052
543 nmdc:mga0k408_83224_c1 3300050493 Bacteria 1876
544 nmdc:mga06z11_109368_c1 3300050494 Bacteria 1528
545 nmdc:mga06z11_12014_c1 3300050494 Bacteria 3754
546 nmdc:mga07m45_14767_c1 3300050496 Bacteria 4169
547 nmdc:mga07m45_324190_c1 3300050496 Bacteria 895
548 nmdc:mga0sz30_16824_c1 3300050516 Bacteria 2909
549 nmdc:mga0sz30_17862_c1 3300050516 Bacteria 2833
550 nmdc:mga0sz30_41677_c1 3300050516 Bacteria 1930
551 nmdc:mga0sz30_93509_c1 3300050516 Bacteria 743
552 nmdc:mga0sz30_93702_c1 3300050516 Bacteria 1308
553 Ga0495619_0069308 3300053085 Bacteria 2357
554 Ga0500578_0043620 3300053086 Bacteria 2878
555 Ga0500578_0057512 3300053086 Bacteria 2486
556 Ga0500643_047498 3300053087 Bacteria 1237
557 Ga0500651_0125666 3300053093 Bacteria 1554
558 Ga0500560_004509 3300053107 Bacteria 2973
559 Ga0500569_004752 3300053109 Bacteria 2878
560 Ga0500594_0003638 3300053118 Bacteria 3399
561 Ga0500594_0034381 3300053118 Bacteria 1354
562 Ga0500594_0070082 3300053118 Bacteria 1029
563 Ga0500618_000665 3300053125 Bacteria 20266
564 Ga0500618_001239 3300053125 Bacteria 11938
565 Ga0500618_006475 3300053125 Bacteria 3431
566 Ga0500618_010149 3300053125 Bacteria 2535
567 Ga0500658_0002853 3300053134 Bacteria 6630
568 Ga0500658_0004815 3300053134 Bacteria 5034
569 Ga0500559_0026508 3300053136 Bacteria 2470
570 Ga0500568_0006681 3300053139 Bacteria 5765
571 Ga0500568_0012248 3300053139 Bacteria 3950
572 Ga0500590_021794 3300053148 Bacteria 3324
573 Ga0500604_0019584 3300053151 Bacteria 1896
574 Ga0500616_0000777 3300053153 Bacteria 36725
575 Ga0500616_0001268 3300053153 Bacteria 25214
576 Ga0500616_0004445 3300053153 Bacteria 9991
577 Ga0500622_0003948 3300053156 Bacteria 9580
578 Ga0500622_0157240 3300053156 Bacteria 1069
579 Ga0500624_000965 3300053157 Bacteria 5901
580 Ga0500627_0283195 3300053158 Bacteria 727
581 Ga0500633_0022800 3300053160 Bacteria 1923
582 Ga0500634_0142874 3300053161 Bacteria 1131
583 Ga0500636_0000023 3300053177 Bacteria 89900
584 Ga0500636_0008459 3300053177 Bacteria 5969
585 Ga0587073_0125378 3300059492 Bacteria 698
586 Ga0587069_016708 3300059642 Bacteria 1052
587 Ga0587072_042288 3300059643 Bacteria 889
588 Ga0501082_0452051 3300060353 Bacteria 1122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006943 Ga0099822_1024033 Ga0099822_10240334 150
2 3300025916 Ga0207663_10011390 Ga0207663_100113903 151
3 3300044765 Ga0466970_0189686 Ga0466970_0189686_141_722 154
4 3300048926 Ga0496123_0067892 Ga0496123_0067892_758_1396 156
5 3300049568 Ga0501031_0441072 Ga0501031_0441072_46_567 166
6 3300049570 Ga0501033_0196836 Ga0501033_0196836_402_923 166
7 3300049572 Ga0501036_0284127 Ga0501036_0284127_822_1343 166
8 3300049574 Ga0501038_0208423 Ga0501038_0208423_1009_1530 166
9 3300049581 Ga0501047_0037789 Ga0501047_0037789_1651_2172 166
10 3300049586 Ga0501070_0090792 Ga0501070_0090792_1876_2397 166
11 3300049822 Ga0501035_0044052 Ga0501035_0044052_1949_2470 166
12 3300046492 Ga0495585_0012481 Ga0495585_0012481_1256_1819 170
13 3300046616 Ga0495668_0144982 Ga0495668_0144982_238_801 170
14 3300046660 Ga0495625_0071733 Ga0495625_0071733_1359_1922 170
15 3300046665 Ga0495661_0139054 Ga0495661_0139054_716_1279 170
16 iso_pu_bacteria 2751185800 2753357000 170
17 iso_pu_bacteria 2758568016 2758640522 170
18 3300005331 Ga0070670_100000542 Ga0070670_10000054220 171
19 3300006038 Ga0075365_10003106 Ga0075365_100031064 171
20 3300025925 Ga0207650_10000769 Ga0207650_1000076920 171
21 3300046492 Ga0495585_0181081 Ga0495585_0181081_414_977 171
22 3300046506 Ga0495583_0010556 Ga0495583_0010556_3407_3970 171
23 3300046512 Ga0495610_0157821 Ga0495610_0157821_306_869 171
24 3300046513 Ga0495616_0196504 Ga0495616_0196504_200_763 171
25 3300046518 Ga0495631_0228153 Ga0495631_0228153_68_631 171
26 3300046519 Ga0495632_0009593 Ga0495632_0009593_3964_4533 171
27 3300046558 Ga0495633_0077541 Ga0495633_0077541_40_603 171
28 3300046615 Ga0495656_0082778 Ga0495656_0082778_847_1410 171
29 3300046691 Ga0495670_0422402 Ga0495670_0422402_37_600 171
30 3300047469 Ga0495673_0098147 Ga0495673_0098147_171_734 171
31 3300047472 Ga0495686_0183045 Ga0495686_0183045_554_1123 171
32 3300048922 Ga0496119_0040211 Ga0496119_0040211_420_998 171
33 3300050492 nmdc:mga0yw44_441_c1 nmdc:mga0yw44_441_c1_7809_8372 171
34 3300006941 Ga0099825_1026021 Ga0099825_10260213 172
35 3300006942 Ga0099824_1037221 Ga0099824_10372212 172
36 3300006943 Ga0099822_1000065 Ga0099822_100006517 172
37 3300027357 Ga0209589_1000001 Ga0209589_1000001549 172
38 3300027361 Ga0209489_100001 Ga0209489_100001549 172
39 3300027363 Ga0209700_100001 Ga0209700_100001549 172
40 3300046471 Ga0495650_0042218 Ga0495650_0042218_551_1114 172
41 3300046507 Ga0495606_0233307 Ga0495606_0233307_339_962 172
42 3300046512 Ga0495610_0002327 Ga0495610_0002327_5277_5855 172
43 3300046530 Ga0495654_0293013 Ga0495654_0293013_51_629 172
44 3300047472 Ga0495686_0014984 Ga0495686_0014984_1220_1798 172
45 3300047472 Ga0495686_0284012 Ga0495686_0284012_188_811 172
46 3300046457 Ga0495590_0032876 Ga0495590_0032876_194_769 173
47 3300046507 Ga0495606_0203452 Ga0495606_0203452_428_1003 173
48 3300048924 Ga0496121_0093292 Ga0496121_0093292_225_800 173
49 iso_pu_bacteria 2643221651 2644288041 173
50 iso_pu_bacteria 2728368998 2728754793 173
51 iso_pu_bacteria 2841974524 2841980674 173
52 iso_pu_bacteria 2847930680 2847934152 173
53 iso_pu_bacteria 2906643746 2906647309 173
54 iso_pu_bacteria 2919450847 2919453107 173
55 iso_pu_bacteria 2935648319 2935652554 173
56 iso_pu_bacteria 2935656913 2935661136 173
57 iso_pu_bacteria 2936011229 2936015193 173
58 iso_pu_bacteria 2936019824 2936023338 173
59 iso_pu_bacteria 2936028420 2936032209 173
60 iso_pu_bacteria 2936046547 2936050070 173
61 iso_pu_bacteria 2936055302 2936061828 173
62 iso_pu_bacteria 8001845381 8001850517 173
63 3300003781 Ga0055536_1007405 Ga0055536_10074054 174
64 3300025292 Ga0209676_1000019 Ga0209676_1000019369 174
65 3300048926 Ga0496123_0058705 Ga0496123_0058705_425_964 174
66 3300053136 Ga0500559_0026508 Ga0500559_0026508_26_589 174
67 3300031456 Ga0307513_10404383 Ga0307513_104043832 175
68 3300006946 Ga0079104_1000210 Ga0079104_100021069 176
69 3300027111 Ga0209281_1000253 Ga0209281_100025388 176
70 3300031456 Ga0307513_10030733 Ga0307513_100307335 176
71 3300041413 Ga0439465_0057605 Ga0439465_0057605_469_1044 176
72 3300046512 Ga0495610_0055028 Ga0495610_0055028_384_959 176
73 3300046522 Ga0495643_0078477 Ga0495643_0078477_292_867 176
74 3300047443 Ga0495687_029497 Ga0495687_029497_1405_1968 176
75 3300048920 Ga0496117_0061747 Ga0496117_0061747_1563_2138 176
76 3300048921 Ga0496118_0060165 Ga0496118_0060165_851_1426 176
77 3300048925 Ga0496122_0050249 Ga0496122_0050249_369_944 176
78 3300048927 Ga0496124_0136624 Ga0496124_0136624_1349_1924 176
79 3300048928 Ga0496125_0049495 Ga0496125_0049495_2445_3020 176
80 3300049571 Ga0501034_0976209 Ga0501034_0976209_99_668 176
81 3300049572 Ga0501036_0255306 Ga0501036_0255306_603_1172 176
82 3300049579 Ga0501043_0071995 Ga0501043_0071995_321_890 176
83 3300049580 Ga0501046_0041285 Ga0501046_0041285_518_1087 176
84 3300049581 Ga0501047_0328419 Ga0501047_0328419_29_598 176
85 3300049583 Ga0501067_0097078 Ga0501067_0097078_436_1005 176
86 3300049584 Ga0501068_0137844 Ga0501068_0137844_469_1038 176
87 3300049744 Ga0501083_0013991 Ga0501083_0013991_4769_5338 176
88 3300050516 nmdc:mga0sz30_41677_c1 nmdc:mga0sz30_41677_c1_1314_1889 176
89 3300053156 Ga0500622_0157240 Ga0500622_0157240_344_910 176
90 3300060353 Ga0501082_0452051 Ga0501082_0452051_442_1011 176
91 3300005434 Ga0070709_10015360 Ga0070709_100153604 177
92 3300005435 Ga0070714_100084386 Ga0070714_1000843862 177
93 3300005436 Ga0070713_100002604 Ga0070713_1000026044 177
94 3300005439 Ga0070711_100011309 Ga0070711_1000113097 177
95 3300005439 Ga0070711_100373304 Ga0070711_1003733041 177
96 3300006028 Ga0070717_10164656 Ga0070717_101646561 177
97 3300006163 Ga0070715_10027251 Ga0070715_100272512 177
98 3300006175 Ga0070712_100088949 Ga0070712_1000889492 177
99 3300006186 Ga0075369_10074351 Ga0075369_100743512 177
100 3300006941 Ga0099825_1021094 Ga0099825_10210944 177
101 3300006944 Ga0099823_1010048 Ga0099823_10100488 177
102 3300009176 Ga0105242_10354548 Ga0105242_103545482 177
103 3300013297 Ga0157378_10902129 Ga0157378_109021292 177
104 3300025905 Ga0207685_10020520 Ga0207685_100205201 177
105 3300025906 Ga0207699_10011314 Ga0207699_100113142 177
106 3300025915 Ga0207693_10016133 Ga0207693_100161333 177
107 3300025915 Ga0207693_10133692 Ga0207693_101336922 177
108 3300025916 Ga0207663_10163492 Ga0207663_101634922 177
109 3300025929 Ga0207664_10337136 Ga0207664_103371362 177
110 3300025934 Ga0207686_10299507 Ga0207686_102995072 177
111 3300025939 Ga0207665_10013305 Ga0207665_100133053 177
112 3300025939 Ga0207665_10034806 Ga0207665_100348062 177
113 3300027296 Ga0209389_1000003 Ga0209389_1000003164 177
114 3300027357 Ga0209589_1000008 Ga0209589_1000008212 177
115 3300027361 Ga0209489_100022 Ga0209489_100022140 177
116 3300027363 Ga0209700_100023 Ga0209700_100023164 177
117 3300046471 Ga0495650_0196403 Ga0495650_0196403_11_577 177
118 3300047472 Ga0495686_0000709 Ga0495686_0000709_1837_2400 177
119 3300048929 Ga0496126_0352334 Ga0496126_0352334_616_1170 177
120 3300050516 nmdc:mga0sz30_93509_c1 nmdc:mga0sz30_93509_c1_58_648 177
121 3300053125 Ga0500618_010149 Ga0500618_010149_897_1526 177
122 3300002773 JGI25152J39213_1009407 JGI25152J39213_10094073 178
123 3300003187 JGI25151J46595_10000307 JGI25151J46595_100003076 178
124 3300003187 JGI25151J46595_10028356 JGI25151J46595_100283563 178
125 3300003215 JGI25153J46596_10007663 JGI25153J46596_100076633 178
126 3300003215 JGI25153J46596_10019683 JGI25153J46596_100196832 178
127 3300003354 JGI25160J50197_1000632 JGI25160J50197_100063217 178
128 3300003771 Ga0055526_1004767 Ga0055526_10047676 178
129 3300003775 Ga0055524_1013459 Ga0055524_10134591 178
130 3300003790 Ga0055528_1003604 Ga0055528_10036047 178
131 3300003790 Ga0055528_1014790 Ga0055528_10147904 178
132 3300003792 Ga0055540_1026490 Ga0055540_10264902 178
133 3300004625 Ga0055543_1001045 Ga0055543_10010455 178
134 3300005262 Ga0065165_1013597 Ga0065165_10135974 178
135 3300006038 Ga0075365_10009424 Ga0075365_100094244 178
136 3300006038 Ga0075365_10122642 Ga0075365_101226422 178
137 3300006042 Ga0075368_10092370 Ga0075368_100923701 178
138 3300006051 Ga0075364_10130398 Ga0075364_101303983 178
139 3300006051 Ga0075364_10152013 Ga0075364_101520132 178
140 3300006177 Ga0075362_10011778 Ga0075362_100117783 178
141 3300006178 Ga0075367_10215714 Ga0075367_102157142 178
142 3300006186 Ga0075369_10004564 Ga0075369_100045643 178
143 3300006186 Ga0075369_10025041 Ga0075369_100250413 178
144 3300006195 Ga0075366_10021161 Ga0075366_100211613 178
145 3300006353 Ga0075370_10000964 Ga0075370_100009649 178
146 3300025245 Ga0207425_1002513 Ga0207425_10025137 178
147 3300025245 Ga0207425_1008591 Ga0207425_10085913 178
148 3300025258 Ga0209129_1001378 Ga0209129_10013784 178
149 3300025258 Ga0209129_1004287 Ga0209129_10042876 178
150 3300025258 Ga0209129_1007173 Ga0209129_10071734 178
151 3300025273 Ga0209673_1006399 Ga0209673_10063994 178
152 3300025273 Ga0209673_1026900 Ga0209673_10269003 178
153 3300025294 Ga0209025_1000880 Ga0209025_100088034 178
154 3300025294 Ga0209025_1001375 Ga0209025_100137525 178
155 3300025295 Ga0209564_1001741 Ga0209564_100174118 178
156 3300025297 Ga0209758_1001295 Ga0209758_10012955 178
157 3300025297 Ga0209758_1004315 Ga0209758_100431510 178
158 3300025297 Ga0209758_1004324 Ga0209758_10043245 178
159 3300025297 Ga0209758_1005815 Ga0209758_10058155 178
160 3300025299 Ga0209256_1003603 Ga0209256_10036037 178
161 3300025299 Ga0209256_1026173 Ga0209256_10261733 178
162 3300025302 Ga0207426_1000063 Ga0207426_100006317 178
163 3300025303 Ga0209051_1039676 Ga0209051_10396762 178
164 3300028794 Ga0307515_10584330 Ga0307515_105843301 178
165 3300041413 Ga0439465_0028103 Ga0439465_0028103_337_900 178
166 3300041441 Ga0451787_614361 Ga0451787_614361_352_915 178
167 3300041458 Ga0451798_0691597 Ga0451798_0691597_127_693 178
168 3300041486 Ga0451807_0010051 Ga0451807_0010051_249_812 178
169 3300041494 Ga0451837_0002636 Ga0451837_0002636_1287_1853 178
170 3300041498 Ga0451841_0129660 Ga0451841_0129660_3237_3803 178
171 3300041501 Ga0451845_0353633 Ga0451845_0353633_185_751 178
172 3300041502 Ga0451846_44944 Ga0451846_44944_181_747 178
173 3300041505 Ga0451849_0977170 Ga0451849_0977170_109_675 178
174 3300041507 Ga0451851_0555611 Ga0451851_0555611_166_732 178
175 3300041511 Ga0451855_0065115 Ga0451855_0065115_1101_1670 178
176 3300041512 Ga0451853_1039407 Ga0451853_1039407_23_589 178
177 3300042004 Ga0439445_0026045 Ga0439445_0026045_423_989 178
178 3300042006 Ga0439432_025666 Ga0439432_025666_71_634 178
179 3300042007 Ga0439449_0017684 Ga0439449_0017684_697_1263 178
180 3300042010 Ga0439452_049582 Ga0439452_049582_359_925 178
181 3300042015 Ga0439462_0052010 Ga0439462_0052010_345_911 178
182 3300046452 Ga0495617_090111 Ga0495617_090111_366_932 178
183 3300046457 Ga0495590_0155949 Ga0495590_0155949_168_734 178
184 3300046474 Ga0495605_0001485 Ga0495605_0001485_8495_9061 178
185 3300046492 Ga0495585_0014204 Ga0495585_0014204_2886_3452 178
186 3300046492 Ga0495585_0159006 Ga0495585_0159006_179_745 178
187 3300046501 Ga0495607_0029512 Ga0495607_0029512_1719_2285 178
188 3300046506 Ga0495583_0029024 Ga0495583_0029024_1685_2251 178
189 3300046507 Ga0495606_0023350 Ga0495606_0023350_1147_1713 178
190 3300046512 Ga0495610_0019920 Ga0495610_0019920_1300_1866 178
191 3300046512 Ga0495610_0138495 Ga0495610_0138495_371_937 178
192 3300046515 Ga0495620_0014366 Ga0495620_0014366_1173_1739 178
193 3300046515 Ga0495620_0017434 Ga0495620_0017434_1360_1926 178
194 3300046518 Ga0495631_0009069 Ga0495631_0009069_3045_3611 178
195 3300046519 Ga0495632_0010893 Ga0495632_0010893_3765_4331 178
196 3300046522 Ga0495643_0036715 Ga0495643_0036715_1251_1817 178
197 3300046522 Ga0495643_0051706 Ga0495643_0051706_467_1033 178
198 3300046524 Ga0495648_0102243 Ga0495648_0102243_584_1150 178
199 3300046530 Ga0495654_0050543 Ga0495654_0050543_323_889 178
200 3300046538 Ga0495609_0024551 Ga0495609_0024551_1023_1589 178
201 3300046616 Ga0495668_0014667 Ga0495668_0014667_2593_3159 178
202 3300046616 Ga0495668_0052769 Ga0495668_0052769_1119_1685 178
203 3300046660 Ga0495625_0001629 Ga0495625_0001629_13263_13829 178
204 3300046660 Ga0495625_0281216 Ga0495625_0281216_53_619 178
205 3300046691 Ga0495670_0171046 Ga0495670_0171046_68_634 178
206 3300046692 Ga0495671_0016935 Ga0495671_0016935_411_977 178
207 3300046810 Ga0495660_0026081 Ga0495660_0026081_898_1464 178
208 3300047318 Ga0495636_0057426 Ga0495636_0057426_143_709 178
209 3300047318 Ga0495636_0130593 Ga0495636_0130593_246_812 178
210 3300047323 Ga0495683_0059267 Ga0495683_0059267_964_1530 178
211 3300047323 Ga0495683_0286941 Ga0495683_0286941_16_582 178
212 3300047443 Ga0495687_102316 Ga0495687_102316_159_725 178
213 3300047472 Ga0495686_0035588 Ga0495686_0035588_2276_2842 178
214 3300047472 Ga0495686_0279763 Ga0495686_0279763_317_883 178
215 3300048090 Ga0495615_0064244 Ga0495615_0064244_338_904 178
216 3300048091 Ga0495626_0092080 Ga0495626_0092080_202_768 178
217 3300048091 Ga0495626_0138185 Ga0495626_0138185_131_697 178
218 3300048924 Ga0496121_0067217 Ga0496121_0067217_1191_1835 178
219 3300049459 Ga0495678_038514 Ga0495678_038514_1099_1665 178
220 3300050489 nmdc:mga03683_50247_c1 nmdc:mga03683_50247_c1_808_1374 178
221 3300050491 nmdc:mga00v17_371750_c1 nmdc:mga00v17_371750_c1_293_856 178
222 3300050491 nmdc:mga00v17_45280_c1 nmdc:mga00v17_45280_c1_897_1463 178
223 3300050492 nmdc:mga0yw44_223802_c1 nmdc:mga0yw44_223802_c1_168_734 178
224 3300050493 nmdc:mga0k408_69746_c1 nmdc:mga0k408_69746_c1_1004_1570 178
225 3300050494 nmdc:mga06z11_12014_c1 nmdc:mga06z11_12014_c1_1625_2191 178
226 3300050496 nmdc:mga07m45_14767_c1 nmdc:mga07m45_14767_c1_3298_3864 178
227 3300050516 nmdc:mga0sz30_17862_c1 nmdc:mga0sz30_17862_c1_611_1177 178
228 3300053086 Ga0500578_0043620 Ga0500578_0043620_1245_1811 178
229 3300053086 Ga0500578_0057512 Ga0500578_0057512_636_1202 178
230 3300053093 Ga0500651_0125666 Ga0500651_0125666_307_873 178
231 3300053109 Ga0500569_004752 Ga0500569_004752_1598_2164 178
232 3300053118 Ga0500594_0003638 Ga0500594_0003638_1240_1806 178
233 3300053118 Ga0500594_0034381 Ga0500594_0034381_451_1017 178
234 3300053134 Ga0500658_0002853 Ga0500658_0002853_6035_6601 178
235 3300053139 Ga0500568_0006681 Ga0500568_0006681_1419_1985 178
236 3300053153 Ga0500616_0004445 Ga0500616_0004445_8230_8796 178
237 3300053158 Ga0500627_0283195 Ga0500627_0283195_50_616 178
238 iso_pu_bacteria 2643221546 2643752701 178
239 3300002987 JGI25159J45721_1000250 JGI25159J45721_10002507 179
240 3300003214 JGI25165J46597_1004441 JGI25165J46597_10044412 179
241 3300003354 JGI25160J50197_1000053 JGI25160J50197_100005341 179
242 3300003374 JGI25161J50226_1000039 JGI25161J50226_100003941 179
243 3300004625 Ga0055543_1000015 Ga0055543_1000015147 179
244 3300005262 Ga0065165_1000361 Ga0065165_100036176 179
245 3300005367 Ga0070667_100241085 Ga0070667_1002410852 179
246 3300005548 Ga0070665_100056705 Ga0070665_1000567053 179
247 3300005563 Ga0068855_100316761 Ga0068855_1003167611 179
248 3300005578 Ga0068854_100138051 Ga0068854_1001380514 179
249 3300009036 Ga0105244_10068388 Ga0105244_100683883 179
250 3300009093 Ga0105240_10000027 Ga0105240_1000002779 179
251 3300009545 Ga0105237_10001405 Ga0105237_1000140529 179
252 3300010375 Ga0105239_10001129 Ga0105239_1000112935 179
253 3300013104 Ga0157370_10000048 Ga0157370_1000004859 179
254 3300013105 Ga0157369_10326917 Ga0157369_103269173 179
255 3300014497 Ga0182008_10006529 Ga0182008_100065296 179
256 3300015262 Ga0182007_10000937 Ga0182007_100009373 179
257 3300015265 Ga0182005_1001754 Ga0182005_10017548 179
258 3300025208 Ga0209436_107046 Ga0209436_1070463 179
259 3300025233 Ga0209437_121846 Ga0209437_1218462 179
260 3300025253 Ga0209677_100516 Ga0209677_10051618 179
261 3300025261 Ga0209233_1000298 Ga0209233_100029818 179
262 3300025284 Ga0209130_1000038 Ga0209130_100003841 179
263 3300025302 Ga0207426_1000081 Ga0207426_100008181 179
264 3300025728 Ga0207655_1086908 Ga0207655_10869082 179
265 3300025913 Ga0207695_10000024 Ga0207695_10000024551 179
266 3300025914 Ga0207671_10000463 Ga0207671_1000046326 179
267 3300025949 Ga0207667_10269816 Ga0207667_102698163 179
268 3300025981 Ga0207640_10607119 Ga0207640_106071191 179
269 3300028379 Ga0268266_10062041 Ga0268266_100620413 179
270 3300048903 Ga0496100_0072764 Ga0496100_0072764_186_800 179
271 3300048904 Ga0496101_0080623 Ga0496101_0080623_1052_1666 179
272 3300048905 Ga0496102_0059986 Ga0496102_0059986_1311_1925 179
273 3300048906 Ga0496103_0051002 Ga0496103_0051002_944_1558 179
274 3300048910 Ga0496107_0194572 Ga0496107_0194572_744_1358 179
275 3300048916 Ga0496113_0176237 Ga0496113_0176237_52_666 179
276 3300048919 Ga0496116_0015287 Ga0496116_0015287_4101_4715 179
277 3300048920 Ga0496117_0001662 Ga0496117_0001662_25918_26532 179
278 3300048921 Ga0496118_0001307 Ga0496118_0001307_23081_23695 179
279 3300048922 Ga0496119_0013327 Ga0496119_0013327_4570_5184 179
280 3300048923 Ga0496120_0006732 Ga0496120_0006732_3441_4055 179
281 3300048924 Ga0496121_0002165 Ga0496121_0002165_4587_5201 179
282 3300048926 Ga0496123_0022781 Ga0496123_0022781_1491_2105 179
283 3300048927 Ga0496124_0000262 Ga0496124_0000262_50694_51257 179
284 3300048927 Ga0496124_0018393 Ga0496124_0018393_3915_4529 179
285 3300048928 Ga0496125_0025331 Ga0496125_0025331_4549_5163 179
286 3300047472 Ga0495686_0144460 Ga0495686_0144460_575_1150 180
287 iso_pu_bacteria 2509276021 2509388204 181
288 iso_pu_bacteria 2509276033 2509443796 181
289 iso_pu_bacteria 2510065019 2510131688 181
290 iso_pu_bacteria 2510461069 2510841433 181
291 iso_pu_bacteria 2510917022 2511137395 181
292 iso_pu_bacteria 2510917026 2511170421 181
293 iso_pu_bacteria 2510917028 2511183626 181
294 iso_pu_bacteria 2510917030 2511196147 181
295 iso_pu_bacteria 2513237085 2513579202 181
296 iso_pu_bacteria 2513237088 2513598715 181
297 iso_pu_bacteria 2513237138 2513866292 181
298 iso_pu_bacteria 2513237144 2513907912 181
299 iso_pu_bacteria 2513237146 2513927571 181
300 iso_pu_bacteria 2513237162 2514020818 181
301 iso_pu_bacteria 2515075009 2515110624 181
302 iso_pu_bacteria 2515154113 2515639080 181
303 iso_pu_bacteria 2515154114 2515645930 181
304 iso_pu_bacteria 2515154116 2515661501 181
305 iso_pu_bacteria 2515154134 2515742894 181
306 iso_pu_bacteria 2516653077 2517039326 181
307 iso_pu_bacteria 2516653085 2517079546 181
308 iso_pu_bacteria 2517093000 2517093496 181
309 iso_pu_bacteria 2517287029 2517405197 181
310 iso_pu_bacteria 2519899620 2520379956 181
311 iso_pu_bacteria 2524023209 2524457693 181
312 iso_pu_bacteria 2529292951 2530647610 181
313 iso_pu_bacteria 2534681796 2535515268 181
314 iso_pu_bacteria 2537561587 2537874404 181
315 iso_pu_bacteria 2554235003 2554246775 181
316 iso_pu_bacteria 2558860242 2559294002 181
317 iso_pu_bacteria 2558860983 2561467265 181
318 iso_pu_bacteria 2582581294 2585204049 181
319 iso_pu_bacteria 2582581298 2585225686 181
320 iso_pu_bacteria 2582581299 2585229161 181
321 iso_pu_bacteria 2582581304 2585257007 181
322 iso_pu_bacteria 2582581307 2585275264 181
323 iso_pu_bacteria 2582581308 2585281992 181
324 iso_pu_bacteria 2582581315 2585325805 181
325 iso_pu_bacteria 2582581316 2585329973 181
326 iso_pu_bacteria 2582581867 2585403900 181
327 iso_pu_bacteria 2585427526 2585528492 181
328 iso_pu_bacteria 2585427527 2585536357 181
329 iso_pu_bacteria 2585427528 2585539891 181
330 iso_pu_bacteria 2585427529 2585548039 181
331 iso_pu_bacteria 2585427530 2585554230 181
332 iso_pu_bacteria 2585427531 2585560293 181
333 iso_pu_bacteria 2585427590 2585824393 181
334 iso_pu_bacteria 2585427593 2585837872 181
335 iso_pu_bacteria 2585427594 2585844446 181
336 iso_pu_bacteria 2585427608 2585901439 181
337 iso_pu_bacteria 2585427609 2585905522 181
338 iso_pu_bacteria 2585427633 2585994660 181
339 iso_pu_bacteria 2585427634 2585999144 181
340 iso_pu_bacteria 2585428125 2587979363 181
341 iso_pu_bacteria 2599185170 2599419001 181
342 iso_pu_bacteria 2599185210 2599603674 181
343 iso_pu_bacteria 2599185236 2599719383 181
344 iso_pu_bacteria 2600254933 2600374881 181
345 iso_pu_bacteria 2600255279 2601609021 181
346 iso_pu_bacteria 2600255308 2601745796 181
347 iso_pu_bacteria 2615840624 2616295859 181
348 iso_pu_bacteria 2615840626 2616306149 181
349 iso_pu_bacteria 2615840698 2616553594 181
350 iso_pu_bacteria 2617270742 2617382645 181
351 iso_pu_bacteria 2643221568 2643856203 181
352 iso_pu_bacteria 2643221582 2643921007 181
353 iso_pu_bacteria 2643221599 2644007522 181
354 iso_pu_bacteria 2643221634 2644190777 181
355 iso_pu_bacteria 2643221643 2644241378 181
356 iso_pu_bacteria 2643221693 2644519083 181
357 iso_pu_bacteria 2667528174 2671112544 181
358 iso_pu_bacteria 2718217882 2719179758 181
359 iso_pu_bacteria 2718217927 2719384368 181
360 iso_pu_bacteria 2718217997 2719664112 181
361 iso_pu_bacteria 2718218009 2719730428 181
362 iso_pu_bacteria 2718218199 2720490531 181
363 iso_pu_bacteria 2718218232 2720611911 181
364 iso_pu_bacteria 2718218233 2720618765 181
365 iso_pu_bacteria 2718218235 2720630165 181
366 iso_pu_bacteria 2718218269 2720773860 181
367 iso_pu_bacteria 2718218363 2721145851 181
368 iso_pu_bacteria 2718218365 2721157388 181
369 iso_pu_bacteria 2718218366 2721162730 181
370 iso_pu_bacteria 2718218423 2721398082 181
371 iso_pu_bacteria 2721755514 2722838900 181
372 iso_pu_bacteria 2721755556 2723025530 181
373 iso_pu_bacteria 2721755684 2723559115 181
374 iso_pu_bacteria 2721755685 2723565720 181
375 iso_pu_bacteria 2721755809 2724036892 181
376 iso_pu_bacteria 2721755810 2724043184 181
377 iso_pu_bacteria 2721755819 2724088467 181
378 iso_pu_bacteria 2721755822 2724102985 181
379 iso_pu_bacteria 2721755823 2724108843 181
380 iso_pu_bacteria 2728369352 2730106466 181
381 iso_pu_bacteria 2728369365 2730162995 181
382 iso_pu_bacteria 2728369397 2730297020 181
383 iso_pu_bacteria 2738541293 2738802378 181
384 iso_pu_bacteria 2738541317 2738945791 181
385 iso_pu_bacteria 2738541333 2739034750 181
386 iso_pu_bacteria 2765235942 2766065027 181
387 iso_pu_bacteria 2775507266 2778174347 181
388 iso_pu_bacteria 2791355256 2793295026 181
389 iso_pu_bacteria 2791355259 2793315238 181
390 iso_pu_bacteria 2791355260 2793320093 181
391 iso_pu_bacteria 2791355261 2793328280 181
392 iso_pu_bacteria 2791355262 2793332623 181
393 iso_pu_bacteria 2791355263 2793342921 181
394 iso_pu_bacteria 2791355264 2793350593 181
395 iso_pu_bacteria 2791355265 2793353191 181
396 iso_pu_bacteria 2791355266 2793360996 181
397 iso_pu_bacteria 2791355267 2793364879 181
398 iso_pu_bacteria 2802429605 2805927390 181
399 iso_pu_bacteria 2802429606 2805936430 181
400 iso_pu_bacteria 2802429633 2806044047 181
401 iso_pu_bacteria 2802429634 2806052136 181
402 iso_pu_bacteria 2802429635 2806058437 181
403 iso_pu_bacteria 2802429636 2806066934 181
404 iso_pu_bacteria 2802429637 2806074677 181
405 iso_pu_bacteria 2808606387 2808986222 181
406 iso_pu_bacteria 2818991439 2819556352 181
407 iso_pu_bacteria 2818991448 2819608226 181
408 iso_pu_bacteria 2818991453 2819639578 181
409 iso_pu_bacteria 2818991461 2819684529 181
410 iso_pu_bacteria 2821123053 2821123815 181
411 iso_pu_bacteria 2838016132 2838021798 181
412 iso_pu_bacteria 2838022645 2838026505 181
413 iso_pu_bacteria 2838029111 2838029119 181
414 iso_pu_bacteria 2838035591 2838037311 181
415 iso_pu_bacteria 2838048938 2838054589 181
416 iso_pu_bacteria 2838061910 2838067521 181
417 iso_pu_bacteria 2838068647 2838074060 181
418 iso_pu_bacteria 2838661181 2838663502 181
419 iso_pu_bacteria 2838668709 2838673257 181
420 iso_pu_bacteria 2838675328 2838677079 181
421 iso_pu_bacteria 2838686498 2838692550 181
422 iso_pu_bacteria 2838694306 2838695178 181
423 iso_pu_bacteria 2838701080 2838704059 181
424 iso_pu_bacteria 2838707686 2838708554 181
425 iso_pu_bacteria 2838714209 2838715966 181
426 iso_pu_bacteria 2838719591 2838720232 181
427 iso_pu_bacteria 2838724970 2838726719 181
428 iso_pu_bacteria 2838729681 2838732622 181
429 iso_pu_bacteria 2838736955 2838739155 181
430 iso_pu_bacteria 2838742623 2838745517 181
431 iso_pu_bacteria 2841840854 2841843053 181
432 iso_pu_bacteria 2841846520 2841847166 181
433 iso_pu_bacteria 2841851746 2841855161 181
434 iso_pu_bacteria 2841859092 2841860301 181
435 iso_pu_bacteria 2842077413 2842080212 181
436 iso_pu_bacteria 2842110456 2842112413 181
437 iso_pu_bacteria 2842118031 2842120831 181
438 iso_pu_bacteria 2842124991 2842126804 181
439 iso_pu_bacteria 2842130223 2842131972 181
440 iso_pu_bacteria 2842140634 2842142835 181
441 iso_pu_bacteria 2842146304 2842148149 181
442 iso_pu_bacteria 2842152218 2842152858 181
443 iso_pu_bacteria 2842156927 2842161809 181
444 iso_pu_bacteria 2842163707 2842169184 181
445 iso_pu_bacteria 2842170452 2842172211 181
446 iso_pu_bacteria 2842175837 2842176477 181
447 iso_pu_bacteria 2842180545 2842185426 181
448 iso_pu_bacteria 2842187318 2842189075 181
449 iso_pu_bacteria 2842198810 2842203163 181
450 iso_pu_bacteria 2842205361 2842206740 181
451 iso_pu_bacteria 2842211629 2842213388 181
452 iso_pu_bacteria 2842224351 2842224994 181
453 iso_pu_bacteria 2842229732 2842233364 181
454 iso_pu_bacteria 2842237096 2842237966 181
455 iso_pu_bacteria 2842243621 2842248632 181
456 iso_pu_bacteria 2842257432 2842261775 181
457 iso_pu_bacteria 2842264693 2842267249 181
458 iso_pu_bacteria 2842271015 2842277161 181
459 iso_pu_bacteria 2842278818 2842280567 181
460 iso_pu_bacteria 2842285085 2842289518 181
461 iso_pu_bacteria 2842291075 2842293871 181
462 iso_pu_bacteria 2842298080 2842300692 181
463 iso_pu_bacteria 2842304105 2842306281 181
464 iso_pu_bacteria 2842311132 2842315960 181
465 iso_pu_bacteria 2842317721 2842322323 181
466 iso_pu_bacteria 2842357229 2842358190 181
467 iso_pu_bacteria 2842363717 2842369491 181
468 iso_pu_bacteria 2842370503 2842371252 181
469 iso_pu_bacteria 2842377471 2842380267 181
470 iso_pu_bacteria 2842384541 2842387339 181
471 iso_pu_bacteria 2842402390 2842406866 181
472 iso_pu_bacteria 2842409023 2842413637 181
473 iso_pu_bacteria 2842415677 2842420400 181
474 iso_pu_bacteria 2842422224 2842427688 181
475 iso_pu_bacteria 2842428310 2842431499 181
476 iso_pu_bacteria 2842434925 2842437834 181
477 iso_pu_bacteria 2842441272 2842444649 181
478 iso_pu_bacteria 2842447887 2842450406 181
479 iso_pu_bacteria 2842462802 2842465523 181
480 iso_pu_bacteria 2842469257 2842472333 181
481 iso_pu_bacteria 2842475841 2842476451 181
482 iso_pu_bacteria 2842482326 2842482528 181
483 iso_pu_bacteria 2842489311 2842495093 181
484 iso_pu_bacteria 2842495871 2842501013 181
485 iso_pu_bacteria 2842502639 2842502647 181
486 iso_pu_bacteria 2842509118 2842509379 181
487 iso_pu_bacteria 2842515876 2842517086 181
488 iso_pu_bacteria 2844454524 2844455776 181
489 iso_pu_bacteria 2852387548 2852388700 181
490 iso_pu_bacteria 2854896431 2854898456 181
491 iso_pu_bacteria 2854916844 2854917768 181
492 iso_pu_bacteria 2857516855 2857524060 181
493 iso_pu_bacteria 2857531043 2857531377 181
494 iso_pu_bacteria 2899792073 2899792366 181
495 iso_pu_bacteria 2899803654 2899805964 181
496 iso_pu_bacteria 2899845264 2899846639 181
497 iso_pu_bacteria 2913308742 2913310526 181
498 iso_pu_bacteria 2919100787 2919101162 181
499 iso_pu_bacteria 2919114240 2919116170 181
500 iso_pu_bacteria 2919166419 2919167030 181
501 iso_pu_bacteria 2919171160 2919171881 181
502 iso_pu_bacteria 2919408235 2919408976 181
503 iso_pu_bacteria 2923556063 2923557374 181
504 iso_pu_bacteria 2926754445 2926757124 181
505 iso_pu_bacteria 2926760298 2926761345 181
506 iso_pu_bacteria 2929138655 2929139116 181
507 iso_pu_bacteria 2933006813 2933007503 181
508 iso_pu_bacteria 2933011516 2933012271 181
509 iso_pu_bacteria 2933016740 2933023279 181
510 iso_pu_bacteria 2933570622 2933573350 181
511 iso_pu_bacteria 2933586486 2933587742 181
512 iso_pu_bacteria 2933594066 2933594716 181
513 iso_pu_bacteria 2933599457 2933604428 181
514 iso_pu_bacteria 2935894831 2935895701 181
515 iso_pu_bacteria 2935901341 2935907342 181
516 iso_pu_bacteria 2936367885 2936368726 181
517 iso_pu_bacteria 2936375103 2936377197 181
518 iso_pu_bacteria 2978969890 2978973445 181
519 iso_pu_bacteria 2979089926 2979093373 181
520 iso_pu_bacteria 2979095461 2979099242 181
521 iso_pu_bacteria 2979100975 2979105344 181
522 iso_pu_bacteria 2984509177 2984512800 181
523 iso_pu_bacteria 2984518228 2984520837 181
524 iso_pu_bacteria 2984537506 2984540131 181
525 iso_pu_bacteria 2984587000 2984591728 181
526 iso_pu_bacteria 2984601300 2984602324 181
527 iso_pu_bacteria 2996336353 2996338219 181
528 iso_pu_bacteria 2996887358 2996892008 181
529 iso_pu_bacteria 2996893221 2996893642 181
530 iso_pu_bacteria 3005409236 3005411401 181
531 iso_pu_bacteria 3005416602 3005422634 181
532 iso_pu_bacteria 3005445848 3005446352 181
533 iso_pu_bacteria 3005452660 3005453022 181
534 iso_pu_bacteria 8003570095 8003570201 181
535 iso_pu_bacteria 8005258706 8005263669 181
536 iso_pu_bacteria 8005275841 8005279083 181
537 iso_pu_bacteria 8005282627 8005283830 181
538 iso_pu_bacteria 8005289223 8005291904 181
539 iso_pu_bacteria 8005307578 8005308860 181
540 iso_pu_bacteria 8005314921 8005321829 181
541 iso_pu_bacteria 8005321885 8005326535 181
542 iso_pu_bacteria 8005376324 8005377233 181
543 iso_pu_bacteria 8005430974 8005433125 181
544 iso_pu_bacteria 8005460587 8005461266 181
545 iso_pu_bacteria 8005484373 8005485966 181
546 iso_pu_bacteria 8005497431 8005498857 181
547 iso_pu_bacteria 8005542996 8005543950 181
548 iso_pu_bacteria 8005556819 8005559261 181
549 iso_pu_bacteria 8005563573 8005569824 181
550 iso_pu_bacteria 8005570704 8005577126 181
551 iso_pu_bacteria 8005619151 8005620044 181
552 iso_pu_bacteria 8005626139 8005628649 181
553 iso_pu_bacteria 8005645114 8005646654 181
554 iso_pu_bacteria 8005668836 8005670269 181
555 iso_pu_bacteria 8005682033 8005684934 181
556 iso_pu_bacteria 8005695170 8005698000 181
557 iso_pu_bacteria 8018127388 8018133316 181
558 iso_pu_bacteria 8018163183 8018167886 181
559 iso_pu_bacteria 8018176218 8018180454 181
560 iso_pu_bacteria 8023680758 8023684017 181
561 iso_pu_bacteria 8024486573 8024487730 181
562 iso_pu_bacteria 8024501048 8024502549 181
563 iso_pu_bacteria 8046767195 8046769806 181
564 iso_pu_bacteria 8054460903 8054461448 181
565 iso_pu_bacteria 8056382006 8056386153 181
566 iso_pu_bacteria 8056875544 8056879288 181
567 iso_pu_bacteria 8057575449 8057577428 181
568 iso_pu_bacteria 8057874678 8057881154 181
569 iso_pu_bacteria 2510461076 2510897981 182
570 iso_pu_bacteria 2513237084 2513571265 182
571 iso_pu_bacteria 2513237093 2513632360 182
572 iso_pu_bacteria 2513237103 2513711686 182
573 iso_pu_bacteria 2724679232 2725950738 182
574 iso_pu_bacteria 2838042994 2838047282 182
575 iso_pu_bacteria 2838680041 2838680789 182
576 iso_pu_bacteria 2841864319 2841866613 182
577 iso_pu_bacteria 2842192696 2842193098 182
578 iso_pu_bacteria 2842217011 2842218584 182
579 iso_pu_bacteria 2842250916 2842253215 182
580 iso_pu_bacteria 2842341865 2842342865 182
581 iso_pu_bacteria 2842395702 2842400755 182
582 iso_pu_bacteria 2936381700 2936383844 182
583 iso_pu_bacteria 8005301065 8005304035 182
584 iso_pu_bacteria 8005382845 8005387098 182
585 iso_pu_bacteria 8005395548 8005401859 182
586 iso_pu_bacteria 8005688590 8005690460 182
587 iso_pu_bacteria 8024479707 8024480498 182
588 iso_pu_bacteria 8056375014 8056379077 182
589 iso_pu_bacteria 639633055 639646883 183
590 3300053156 Ga0500622_0003948 Ga0500622_0003948_4350_4916 184
591 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006149 185
592 3300002705 JGI25156J39149_1000019 JGI25156J39149_100001996 185
593 3300002737 JGI25162J39368_1000278 JGI25162J39368_100027829 185
594 3300002737 JGI25162J39368_1000363 JGI25162J39368_100036319 185
595 3300002738 JGI25154J39366_1000055 JGI25154J39366_100005592 185
596 3300002738 JGI25154J39366_1009214 JGI25154J39366_10092141 185
597 3300002739 JGI25158J39367_1000089 JGI25158J39367_100008915 185
598 3300002741 JGI25157J39369_1000024 JGI25157J39369_100002466 185
599 3300002773 JGI25152J39213_1001153 JGI25152J39213_10011535 185
600 3300002773 JGI25152J39213_1003495 JGI25152J39213_10034953 185
601 3300002774 JGI25150J39212_1000256 JGI25150J39212_10002562 185
602 3300002774 JGI25150J39212_1003725 JGI25150J39212_10037252 185
603 3300002987 JGI25159J45721_1008535 JGI25159J45721_10085353 185
604 3300003187 JGI25151J46595_10000916 JGI25151J46595_1000091622 185
605 3300003187 JGI25151J46595_10015292 JGI25151J46595_100152923 185
606 3300003214 JGI25165J46597_1000482 JGI25165J46597_100048219 185
607 3300003214 JGI25165J46597_1000763 JGI25165J46597_100076315 185
608 3300003215 JGI25153J46596_10001761 JGI25153J46596_100017615 185
609 3300003215 JGI25153J46596_10007522 JGI25153J46596_100075223 185
610 3300003215 JGI25153J46596_10026654 JGI25153J46596_100266543 185
611 3300003316 rootH1_10154698 rootH1_101546982 185
612 3300003320 rootH2_10084723 rootH2_100847231 185
613 3300003322 rootL2_10038546 rootL2_100385466 185
614 3300003322 rootL2_10200840 rootL2_102008403 185
615 3300003323 rootH1_10092503 rootH1_100925033 185
616 3300003323 rootH1_10280632 rootH1_102806322 185
617 3300003354 JGI25160J50197_1001540 JGI25160J50197_10015407 185
618 3300003354 JGI25160J50197_1010159 JGI25160J50197_10101592 185
619 3300003374 JGI25161J50226_1000448 JGI25161J50226_100044810 185
620 3300003771 Ga0055526_1010140 Ga0055526_10101405 185
621 3300003771 Ga0055526_1021928 Ga0055526_10219282 185
622 3300003775 Ga0055524_1006703 Ga0055524_10067035 185
623 3300003775 Ga0055524_1016049 Ga0055524_10160494 185
624 3300003775 Ga0055524_1020064 Ga0055524_10200641 185
625 3300003775 Ga0055524_1021844 Ga0055524_10218442 185
626 3300003781 Ga0055536_1044355 Ga0055536_10443551 185
627 3300003790 Ga0055528_1000353 Ga0055528_100035329 185
628 3300003790 Ga0055528_1006094 Ga0055528_10060945 185
629 3300003790 Ga0055528_1007796 Ga0055528_10077961 185
630 3300003790 Ga0055528_1017262 Ga0055528_10172623 185
631 3300003791 Ga0055530_10034502 Ga0055530_100345022 185
632 3300003792 Ga0055540_1000534 Ga0055540_100053421 185
633 3300003792 Ga0055540_1003328 Ga0055540_100332810 185
634 3300003792 Ga0055540_1003638 Ga0055540_10036386 185
635 3300003794 Ga0055531_10006103 Ga0055531_100061031 185
636 3300003856 Ga0058692_1002893 Ga0058692_10028935 185
637 3300003856 Ga0058692_1008969 Ga0058692_10089692 185
638 3300004625 Ga0055543_1000033 Ga0055543_100003311 185
639 3300005262 Ga0065165_1004004 Ga0065165_10040044 185
640 3300005262 Ga0065165_1011832 Ga0065165_10118323 185
641 3300005347 Ga0070668_100121389 Ga0070668_1001213892 185
642 3300005355 Ga0070671_100070799 Ga0070671_1000707993 185
643 3300005455 Ga0070663_100281924 Ga0070663_1002819242 185
644 3300005548 Ga0070665_100035023 Ga0070665_1000350234 185
645 3300005578 Ga0068854_100127565 Ga0068854_1001275653 185
646 3300005614 Ga0068856_100409853 Ga0068856_1004098532 185
647 3300006038 Ga0075365_10000502 Ga0075365_1000050210 185
648 3300006048 Ga0075363_100082888 Ga0075363_1000828883 185
649 3300006051 Ga0075364_10004999 Ga0075364_100049994 185
650 3300006051 Ga0075364_10342114 Ga0075364_103421142 185
651 3300006177 Ga0075362_10181715 Ga0075362_101817152 185
652 3300006178 Ga0075367_10001356 Ga0075367_100013567 185
653 3300006186 Ga0075369_10020670 Ga0075369_100206703 185
654 3300006186 Ga0075369_10033787 Ga0075369_100337871 185
655 3300006186 Ga0075369_10080549 Ga0075369_100805492 185
656 3300006186 Ga0075369_10092861 Ga0075369_100928612 185
657 3300006195 Ga0075366_10053594 Ga0075366_100535942 185
658 3300006353 Ga0075370_10023914 Ga0075370_100239144 185
659 3300006353 Ga0075370_10224756 Ga0075370_102247562 185
660 3300006353 Ga0075370_10294882 Ga0075370_102948821 185
661 3300006353 Ga0075370_10302034 Ga0075370_103020342 185
662 3300006948 Ga0099826_10001594 Ga0099826_1000159416 185
663 3300006948 Ga0099826_10127939 Ga0099826_101279392 185
664 3300009148 Ga0105243_10063806 Ga0105243_100638064 185
665 3300009553 Ga0105249_11781244 Ga0105249_117812441 185
666 3300009765 Ga0123341_1000464 Ga0123341_100046416 185
667 3300009766 Ga0123342_1010378 Ga0123342_10103788 185
668 3300009766 Ga0123342_1039797 Ga0123342_10397973 185
669 3300011119 Ga0105246_10110606 Ga0105246_101106063 185
670 3300012513 Ga0157326_1010123 Ga0157326_10101231 185
671 3300013100 Ga0157373_10014897 Ga0157373_100148972 185
672 3300013100 Ga0157373_10206354 Ga0157373_102063543 185
673 3300013102 Ga0157371_10000058 Ga0157371_10000058148 185
674 3300013102 Ga0157371_10022707 Ga0157371_100227074 185
675 3300013104 Ga0157370_10000030 Ga0157370_1000003070 185
676 3300013105 Ga0157369_10773902 Ga0157369_107739021 185
677 3300025206 Ga0209435_100011 Ga0209435_100011147 185
678 3300025208 Ga0209436_100002 Ga0209436_10000236 185
679 3300025233 Ga0209437_100036 Ga0209437_100036203 185
680 3300025233 Ga0209437_100086 Ga0209437_10008645 185
681 3300025245 Ga0207425_1000497 Ga0207425_100049723 185
682 3300025245 Ga0207425_1000964 Ga0207425_100096411 185
683 3300025245 Ga0207425_1013561 Ga0207425_10135612 185
684 3300025246 Ga0209646_1000024 Ga0209646_1000024264 185
685 3300025246 Ga0209646_1008262 Ga0209646_10082623 185
686 3300025250 Ga0209026_1000030 Ga0209026_1000030264 185
687 3300025254 Ga0209148_1027465 Ga0209148_10274652 185
688 3300025256 Ga0209759_1000011 Ga0209759_1000011147 185
689 3300025258 Ga0209129_1000658 Ga0209129_100065823 185
690 3300025258 Ga0209129_1000890 Ga0209129_100089017 185
691 3300025258 Ga0209129_1001153 Ga0209129_10011537 185
692 3300025258 Ga0209129_1001657 Ga0209129_100165710 185
693 3300025261 Ga0209233_1000056 Ga0209233_1000056389 185
694 3300025261 Ga0209233_1000110 Ga0209233_1000110203 185
695 3300025273 Ga0209673_1000091 Ga0209673_100009158 185
696 3300025273 Ga0209673_1001285 Ga0209673_100128521 185
697 3300025273 Ga0209673_1004117 Ga0209673_10041176 185
698 3300025273 Ga0209673_1007139 Ga0209673_10071395 185
699 3300025284 Ga0209130_1000015 Ga0209130_1000015290 185
700 3300025284 Ga0209130_1018765 Ga0209130_10187652 185
701 3300025292 Ga0209676_1004595 Ga0209676_10045953 185
702 3300025292 Ga0209676_1032015 Ga0209676_10320152 185
703 3300025294 Ga0209025_1000575 Ga0209025_100057564 185
704 3300025294 Ga0209025_1000664 Ga0209025_100066460 185
705 3300025294 Ga0209025_1006816 Ga0209025_10068163 185
706 3300025294 Ga0209025_1057108 Ga0209025_10571082 185
707 3300025294 Ga0209025_1065679 Ga0209025_10656792 185
708 3300025295 Ga0209564_1000398 Ga0209564_100039852 185
709 3300025295 Ga0209564_1003865 Ga0209564_10038657 185
710 3300025295 Ga0209564_1007416 Ga0209564_10074167 185
711 3300025297 Ga0209758_1000191 Ga0209758_100019145 185
712 3300025297 Ga0209758_1000549 Ga0209758_100054960 185
713 3300025297 Ga0209758_1000740 Ga0209758_100074024 185
714 3300025297 Ga0209758_1004280 Ga0209758_100428010 185
715 3300025297 Ga0209758_1008829 Ga0209758_10088296 185
716 3300025298 Ga0209050_1011433 Ga0209050_10114333 185
717 3300025298 Ga0209050_1013123 Ga0209050_10131232 185
718 3300025299 Ga0209256_1000870 Ga0209256_10008706 185
719 3300025299 Ga0209256_1008014 Ga0209256_10080145 185
720 3300025299 Ga0209256_1012400 Ga0209256_10124002 185
721 3300025299 Ga0209256_1013008 Ga0209256_10130085 185
722 3300025302 Ga0207426_1000144 Ga0207426_100014460 185
723 3300025302 Ga0207426_1001195 Ga0207426_10011953 185
724 3300025303 Ga0209051_1000205 Ga0209051_100020526 185
725 3300025303 Ga0209051_1003436 Ga0209051_10034362 185
726 3300025303 Ga0209051_1011156 Ga0209051_10111563 185
727 3300025303 Ga0209051_1032300 Ga0209051_10323003 185
728 3300025304 Ga0209257_1001929 Ga0209257_10019296 185
729 3300025304 Ga0209257_1002628 Ga0209257_10026284 185
730 3300025304 Ga0209257_1020482 Ga0209257_10204822 185
731 3300025903 Ga0207680_10056809 Ga0207680_100568092 185
732 3300025931 Ga0207644_10074801 Ga0207644_100748013 185
733 3300025931 Ga0207644_10725520 Ga0207644_107255202 185
734 3300026067 Ga0207678_10030783 Ga0207678_100307837 185
735 3300026078 Ga0207702_10339042 Ga0207702_103390422 185
736 3300027312 Ga0209371_1000009 Ga0209371_1000009292 185
737 3300027312 Ga0209371_1001069 Ga0209371_100106916 185
738 3300027312 Ga0209371_1002375 Ga0209371_10023758 185
739 3300027312 Ga0209371_1003235 Ga0209371_10032358 185
740 3300027312 Ga0209371_1003293 Ga0209371_10032935 185
741 3300027666 Ga0209282_1001731 Ga0209282_10017319 185
742 3300027666 Ga0209282_1222231 Ga0209282_12222312 185
743 3300028379 Ga0268266_10023667 Ga0268266_100236674 185
744 3300028379 Ga0268266_10560462 Ga0268266_105604622 185
745 3300028794 Ga0307515_10049930 Ga0307515_100499301 185
746 3300030500 Ga0268256_1000010 Ga0268256_1000010291 185
747 3300030500 Ga0268256_1000882 Ga0268256_100088217 185
748 3300030500 Ga0268256_1002814 Ga0268256_10028146 185
749 3300031730 Ga0307516_10499464 Ga0307516_104994642 185
750 3300031731 Ga0307405_10004852 Ga0307405_100048522 185
751 3300031901 Ga0307406_10013413 Ga0307406_100134134 185
752 3300031911 Ga0307412_10001068 Ga0307412_100010688 185
753 3300032004 Ga0307414_10934898 Ga0307414_109348982 185
754 3300032004 Ga0307414_11106635 Ga0307414_111066351 185
755 3300033180 Ga0307510_10285206 Ga0307510_102852061 185
756 3300041404 Ga0439436_0045124 Ga0439436_0045124_283_849 185
757 3300041411 Ga0439466_0062423 Ga0439466_0062423_487_1050 185
758 3300041413 Ga0439465_0006903 Ga0439465_0006903_1415_1990 185
759 3300041413 Ga0439465_0011953 Ga0439465_0011953_1321_1887 185
760 3300041452 Ga0451793_0099162 Ga0451793_0099162_136_732 185
761 3300044694 Ga0466963_0016998 Ga0466963_0016998_2277_2834 185
762 3300044719 Ga0466971_0124325 Ga0466971_0124325_63_620 185
763 3300044765 Ga0466970_0002877 Ga0466970_0002877_4990_5547 185
764 3300045049 Ga0466959_0188384 Ga0466959_0188384_304_861 185
765 3300045836 Ga0466958_0030702 Ga0466958_0030702_1232_1789 185
766 3300045976 Ga0466967_0053049 Ga0466967_0053049_1690_2247 185
767 3300045976 Ga0466967_0114229 Ga0466967_0114229_617_1174 185
768 3300046459 Ga0495629_0064028 Ga0495629_0064028_1014_1577 185
769 3300046460 Ga0495638_0001240 Ga0495638_0001240_1306_1872 185
770 3300046462 Ga0495651_0058156 Ga0495651_0058156_658_1221 185
771 3300046476 Ga0495662_0056244 Ga0495662_0056244_925_1488 185
772 3300046477 Ga0495664_0047959 Ga0495664_0047959_1237_1800 185
773 3300046501 Ga0495607_0068146 Ga0495607_0068146_1283_1852 185
774 3300046501 Ga0495607_0279184 Ga0495607_0279184_11_616 185
775 3300046507 Ga0495606_0000735 Ga0495606_0000735_28849_29412 185
776 3300046507 Ga0495606_0140236 Ga0495606_0140236_47_610 185
777 3300046513 Ga0495616_0251129 Ga0495616_0251129_55_618 185
778 3300046529 Ga0495652_0123384 Ga0495652_0123384_316_879 185
779 3300046530 Ga0495654_0000043 Ga0495654_0000043_144939_145502 185
780 3300046558 Ga0495633_0153696 Ga0495633_0153696_32_682 185
781 3300046558 Ga0495633_0305152 Ga0495633_0305152_28_678 185
782 3300046642 Ga0495634_0103853 Ga0495634_0103853_966_1529 185
783 3300046660 Ga0495625_0430615 Ga0495625_0430615_126_689 185
784 3300046665 Ga0495661_0442303 Ga0495661_0442303_12_617 185
785 3300046674 Ga0495588_0003015 Ga0495588_0003015_1816_2379 185
786 3300046675 Ga0495657_0096284 Ga0495657_0096284_689_1252 185
787 3300046683 Ga0495658_0108801 Ga0495658_0108801_921_1484 185
788 3300046689 Ga0495613_0154420 Ga0495613_0154420_862_1425 185
789 3300046690 Ga0495624_0495709 Ga0495624_0495709_96_659 185
790 3300046692 Ga0495671_0149217 Ga0495671_0149217_23_586 185
791 3300046810 Ga0495660_0074784 Ga0495660_0074784_737_1303 185
792 3300047317 Ga0495604_0009543 Ga0495604_0009543_4124_4687 185
793 3300047443 Ga0495687_064212 Ga0495687_064212_817_1455 185
794 3300047470 Ga0495681_0003362 Ga0495681_0003362_9140_9784 185
795 3300047472 Ga0495686_0052733 Ga0495686_0052733_123_686 185
796 3300047472 Ga0495686_0272523 Ga0495686_0272523_170_733 185
797 3300048088 Ga0495602_0130352 Ga0495602_0130352_1000_1563 185
798 3300048904 Ga0496101_0074669 Ga0496101_0074669_951_1535 185
799 3300048904 Ga0496101_0088333 Ga0496101_0088333_1536_2099 185
800 3300048908 Ga0496105_0105823 Ga0496105_0105823_262_825 185
801 3300048909 Ga0496106_0003475 Ga0496106_0003475_9718_10281 185
802 3300048912 Ga0496109_0778383 Ga0496109_0778383_124_687 185
803 3300048916 Ga0496113_0261938 Ga0496113_0261938_304_867 185
804 3300048917 Ga0496114_0180005 Ga0496114_0180005_401_964 185
805 3300048919 Ga0496116_0000080 Ga0496116_0000080_169997_170560 185
806 3300048919 Ga0496116_0012346 Ga0496116_0012346_4061_4624 185
807 3300048919 Ga0496116_0014972 Ga0496116_0014972_4062_4625 185
808 3300048919 Ga0496116_0016190 Ga0496116_0016190_821_1405 185
809 3300048919 Ga0496116_0017971 Ga0496116_0017971_4864_5427 185
810 3300048919 Ga0496116_0119207 Ga0496116_0119207_330_893 185
811 3300048919 Ga0496116_0133015 Ga0496116_0133015_742_1305 185
812 3300048919 Ga0496116_0254781 Ga0496116_0254781_266_829 185
813 3300048920 Ga0496117_0000002 Ga0496117_0000002_1812377_1812940 185
814 3300048920 Ga0496117_0007726 Ga0496117_0007726_3807_4370 185
815 3300048920 Ga0496117_0026756 Ga0496117_0026756_3866_4450 185
816 3300048920 Ga0496117_0061498 Ga0496117_0061498_804_1367 185
817 3300048920 Ga0496117_0085619 Ga0496117_0085619_185_751 185
818 3300048920 Ga0496117_0108157 Ga0496117_0108157_535_1098 185
819 3300048920 Ga0496117_0139005 Ga0496117_0139005_279_842 185
820 3300048920 Ga0496117_0142915 Ga0496117_0142915_601_1158 185
821 3300048921 Ga0496118_0000483 Ga0496118_0000483_40671_41234 185
822 3300048921 Ga0496118_0022314 Ga0496118_0022314_714_1277 185
823 3300048921 Ga0496118_0040214 Ga0496118_0040214_3077_3640 185
824 3300048921 Ga0496118_0043655 Ga0496118_0043655_1473_2057 185
825 3300048921 Ga0496118_0064309 Ga0496118_0064309_614_1180 185
826 3300048922 Ga0496119_0025048 Ga0496119_0025048_234_797 185
827 3300048922 Ga0496119_0052702 Ga0496119_0052702_990_1547 185
828 3300048922 Ga0496119_0077573 Ga0496119_0077573_598_1161 185
829 3300048922 Ga0496119_0094460 Ga0496119_0094460_556_1119 185
830 3300048922 Ga0496119_0162549 Ga0496119_0162549_302_865 185
831 3300048922 Ga0496119_0191074 Ga0496119_0191074_479_1042 185
832 3300048923 Ga0496120_0000971 Ga0496120_0000971_2690_3253 185
833 3300048923 Ga0496120_0066508 Ga0496120_0066508_714_1277 185
834 3300048924 Ga0496121_0000001 Ga0496121_0000001_581326_581889 185
835 3300048924 Ga0496121_0018159 Ga0496121_0018159_4215_4778 185
836 3300048924 Ga0496121_0076793 Ga0496121_0076793_1306_1869 185
837 3300048924 Ga0496121_0082627 Ga0496121_0082627_357_920 185
838 3300048924 Ga0496121_0086832 Ga0496121_0086832_1663_2226 185
839 3300048924 Ga0496121_0285580 Ga0496121_0285580_130_693 185
840 3300048925 Ga0496122_0000001 Ga0496122_0000001_1183167_1183730 185
841 3300048925 Ga0496122_0000009 Ga0496122_0000009_357608_358171 185
842 3300048925 Ga0496122_0004617 Ga0496122_0004617_3278_3841 185
843 3300048925 Ga0496122_0007697 Ga0496122_0007697_8954_9517 185
844 3300048925 Ga0496122_0018033 Ga0496122_0018033_1509_2093 185
845 3300048925 Ga0496122_0080521 Ga0496122_0080521_1696_2259 185
846 3300048925 Ga0496122_0113305 Ga0496122_0113305_16_579 185
847 3300048926 Ga0496123_0000001 Ga0496123_0000001_1186898_1187461 185
848 3300048926 Ga0496123_0000020 Ga0496123_0000020_162060_162623 185
849 3300048926 Ga0496123_0004746 Ga0496123_0004746_9965_10528 185
850 3300048926 Ga0496123_0034689 Ga0496123_0034689_1346_1930 185
851 3300048926 Ga0496123_0045341 Ga0496123_0045341_922_1485 185
852 3300048927 Ga0496124_0007119 Ga0496124_0007119_1309_1893 185
853 3300048927 Ga0496124_0013622 Ga0496124_0013622_1357_1920 185
854 3300048927 Ga0496124_0023230 Ga0496124_0023230_4269_4832 185
855 3300048927 Ga0496124_0043893 Ga0496124_0043893_1924_2487 185
856 3300048927 Ga0496124_0046038 Ga0496124_0046038_1814_2377 185
857 3300048927 Ga0496124_0053381 Ga0496124_0053381_2414_2977 185
858 3300048927 Ga0496124_0074779 Ga0496124_0074779_732_1295 185
859 3300048927 Ga0496124_0096633 Ga0496124_0096633_1135_1698 185
860 3300048927 Ga0496124_0411296 Ga0496124_0411296_178_741 185
861 3300048927 Ga0496124_0477709 Ga0496124_0477709_240_803 185
862 3300048928 Ga0496125_0000001 Ga0496125_0000001_692330_692893 185
863 3300048928 Ga0496125_0016520 Ga0496125_0016520_2960_3523 185
864 3300048928 Ga0496125_0062822 Ga0496125_0062822_63_626 185
865 3300048928 Ga0496125_0072436 Ga0496125_0072436_1670_2233 185
866 3300048928 Ga0496125_0082734 Ga0496125_0082734_295_858 185
867 3300048928 Ga0496125_0361205 Ga0496125_0361205_228_803 185
868 3300048929 Ga0496126_0000690 Ga0496126_0000690_7814_8377 185
869 3300048929 Ga0496126_0111694 Ga0496126_0111694_1671_2234 185
870 3300048929 Ga0496126_0147630 Ga0496126_0147630_248_811 185
871 3300048929 Ga0496126_0148944 Ga0496126_0148944_397_960 185
872 3300048929 Ga0496126_0183905 Ga0496126_0183905_1130_1693 185
873 3300048929 Ga0496126_0289988 Ga0496126_0289988_710_1273 185
874 3300049459 Ga0495678_109196 Ga0495678_109196_60_623 185
875 3300049574 Ga0501038_0264297 Ga0501038_0264297_378_941 185
876 3300049742 Ga0501080_0023253 Ga0501080_0023253_3988_4551 185
877 3300049744 Ga0501083_0053730 Ga0501083_0053730_1086_1649 185
878 3300049822 Ga0501035_0396818 Ga0501035_0396818_82_645 185
879 3300049823 Ga0501044_0063679 Ga0501044_0063679_1038_1601 185
880 3300050489 nmdc:mga03683_28724_c1 nmdc:mga03683_28724_c1_305_868 185
881 3300050491 nmdc:mga00v17_127673_c1 nmdc:mga00v17_127673_c1_305_868 185
882 3300050491 nmdc:mga00v17_30517_c1 nmdc:mga00v17_30517_c1_121_684 185
883 3300050493 nmdc:mga0k408_83224_c1 nmdc:mga0k408_83224_c1_337_900 185
884 3300050494 nmdc:mga06z11_109368_c1 nmdc:mga06z11_109368_c1_753_1316 185
885 3300050496 nmdc:mga07m45_324190_c1 nmdc:mga07m45_324190_c1_141_704 185
886 3300050516 nmdc:mga0sz30_16824_c1 nmdc:mga0sz30_16824_c1_1042_1605 185
887 3300050516 nmdc:mga0sz30_93702_c1 nmdc:mga0sz30_93702_c1_44_607 185
888 3300053085 Ga0495619_0069308 Ga0495619_0069308_1540_2103 185
889 3300053087 Ga0500643_047498 Ga0500643_047498_122_685 185
890 3300053107 Ga0500560_004509 Ga0500560_004509_826_1389 185
891 3300053118 Ga0500594_0070082 Ga0500594_0070082_259_822 185
892 3300053125 Ga0500618_000665 Ga0500618_000665_4303_4866 185
893 3300053125 Ga0500618_001239 Ga0500618_001239_7344_7907 185
894 3300053125 Ga0500618_006475 Ga0500618_006475_735_1304 185
895 3300053134 Ga0500658_0004815 Ga0500658_0004815_4278_4841 185
896 3300053139 Ga0500568_0012248 Ga0500568_0012248_2010_2573 185
897 3300053148 Ga0500590_021794 Ga0500590_021794_2505_3068 185
898 3300053151 Ga0500604_0019584 Ga0500604_0019584_18_581 185
899 3300053153 Ga0500616_0000777 Ga0500616_0000777_7644_8234 185
900 3300053153 Ga0500616_0001268 Ga0500616_0001268_8466_9032 185
901 3300053157 Ga0500624_000965 Ga0500624_000965_2828_3391 185
902 3300053160 Ga0500633_0022800 Ga0500633_0022800_436_999 185
903 3300053161 Ga0500634_0142874 Ga0500634_0142874_503_1066 185
904 3300053177 Ga0500636_0000023 Ga0500636_0000023_46426_46989 185
905 3300053177 Ga0500636_0008459 Ga0500636_0008459_1031_1594 185
906 3300059492 Ga0587073_0125378 Ga0587073_0125378_106_669 185
907 3300059642 Ga0587069_016708 Ga0587069_016708_64_684 185
908 3300059643 Ga0587072_042288 Ga0587072_042288_62_625 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02632

BioY

BioY family

58

207

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.8585 1 176
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.8148 1 176
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.688 1 179
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6542 1 185
4m5c-assembly1.cif.gz_A crystal structure of an truncated transition metal transporter 0.6504 1 176
ID Description Score Start End Superfamily
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8949 1 179 1.10.1760.20
af_Q2FVX1_1_181_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8665 1 179 1.10.1760.20
4dveA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8597 4 176 1.10.1760.20
af_Q54D94_113_302_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8072 4 176 1.10.1760.20
4dveA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7851 4 176 1.10.1760.20
ID Description Score Start End GO Terms
AF-F0L7A8-F1-model_v4 deleted 0.9639 48 185
AF-F0L7A8-F1-model_v4 deleted 0.9373 48 185
AF-A0A182CYW8-F1-model_v4 Substrate-specific component BioY of biotin ECF transporter 0.9359 1 179 GO:0005886
GO:0015225
AF-A0A7X6EK39-F1-model_v4 deleted 0.9346 5 136
AF-A0A3S4MVE2-F1-model_v4 deleted 0.9317 1 181

Feature Viewer

pLDDT pTM Quality
91.79 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map