F485387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 908 | 390 | 1816 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10254688|Ga0105248_102546881 |
| Length | 293 |
| Sequence | LLRARFSADNGALARSQKSHSSPAIVTDLRHIAAHPRIVAIMNSSSKVAIVTGAGTGIGKAVATAMLKDGYKVVLAGRRSEPLEKAIAESGAPNGAALAVPTDVSDVASVGRLFARARETFGRLDVLFNNAGVGAPAKNLEDLTFEQWKNVVDINLTGVFLCIQEAFRMMKDQNPRGGRIINNGSISAHAPRPNSAPYTSTKHAITGLTKSASLDGRKYDIACGQIDIGNAHTEMAARMAAGVPQANGQIAIEPLMDVAHVASSVLYMASLPLDANVQFLTVMATKMPFVGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 367 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 368 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 369 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 382 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 383 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 384 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 385 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 386 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 387 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 388 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 389 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 390 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 0.33 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 0 |
| Rhizoplane | 2.86 |
| Rhizosphere | 90.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10254688 | 3300009177 | Bacteria | 1976 |
| 2 | JGI25162J39368_1000677 | 3300002737 | Bacteria | 23881 |
| 3 | JGI25165J46597_1000279 | 3300003214 | Bacteria | 65487 |
| 4 | JGI25153J46596_10000049 | 3300003215 | Bacteria | 141434 |
| 5 | Ga0055538_1000107 | 3300003751 | Bacteria | 65487 |
| 6 | Ga0055539_1000156 | 3300003752 | Bacteria | 65659 |
| 7 | Ga0055533_1000157 | 3300003756 | Bacteria | 65487 |
| 8 | Ga0055525_1000210 | 3300003759 | Bacteria | 65487 |
| 9 | Ga0055541_1000103 | 3300003841 | Bacteria | 65632 |
| 10 | Ga0070658_10177940 | 3300005327 | Bacteria | 1789 |
| 11 | Ga0070658_10255410 | 3300005327 | Bacteria | 1487 |
| 12 | Ga0070676_10075811 | 3300005328 | Bacteria | 2029 |
| 13 | Ga0070683_100459504 | 3300005329 | Bacteria | 1215 |
| 14 | Ga0070683_100472380 | 3300005329 | Bacteria | 1197 |
| 15 | Ga0070690_100008036 | 3300005330 | Bacteria | 6057 |
| 16 | Ga0070690_100105317 | 3300005330 | Bacteria | 1875 |
| 17 | Ga0070670_100002419 | 3300005331 | Bacteria | 15382 |
| 18 | Ga0070670_100011166 | 3300005331 | Bacteria | 7676 |
| 19 | Ga0070670_100067519 | 3300005331 | Bacteria | 3068 |
| 20 | Ga0070670_100191672 | 3300005331 | Bacteria | 1775 |
| 21 | Ga0070670_100211844 | 3300005331 | Bacteria | 1685 |
| 22 | Ga0070677_10063535 | 3300005333 | Bacteria | 1531 |
| 23 | Ga0068869_100005562 | 3300005334 | Bacteria | 7929 |
| 24 | Ga0068869_100049340 | 3300005334 | Bacteria | 3046 |
| 25 | Ga0068869_100058468 | 3300005334 | Bacteria | 2819 |
| 26 | Ga0068869_100067101 | 3300005334 | Bacteria | 2646 |
| 27 | Ga0068869_100175887 | 3300005334 | Bacteria | 1675 |
| 28 | Ga0070666_10008875 | 3300005335 | Bacteria | 6250 |
| 29 | Ga0070666_10031098 | 3300005335 | Bacteria | 3523 |
| 30 | Ga0070680_100007729 | 3300005336 | Bacteria | 8193 |
| 31 | Ga0070680_100102787 | 3300005336 | Bacteria | 2373 |
| 32 | Ga0070680_100106543 | 3300005336 | Bacteria | 2331 |
| 33 | Ga0070682_100056675 | 3300005337 | Bacteria | 2465 |
| 34 | Ga0070682_100120994 | 3300005337 | Bacteria | 1757 |
| 35 | Ga0068868_100001910 | 3300005338 | Bacteria | 14309 |
| 36 | Ga0070660_100015113 | 3300005339 | Bacteria | 5570 |
| 37 | Ga0070660_100022206 | 3300005339 | Bacteria | 4689 |
| 38 | Ga0070660_100044579 | 3300005339 | Bacteria | 3393 |
| 39 | Ga0070660_100071029 | 3300005339 | Bacteria | 2717 |
| 40 | Ga0070660_100188933 | 3300005339 | Bacteria | 1668 |
| 41 | Ga0070660_100252183 | 3300005339 | Bacteria | 1439 |
| 42 | Ga0070689_100018449 | 3300005340 | Bacteria | 5140 |
| 43 | Ga0070689_100027860 | 3300005340 | Bacteria | 4263 |
| 44 | Ga0070689_100225616 | 3300005340 | Bacteria | 1538 |
| 45 | Ga0070691_10093133 | 3300005341 | Bacteria | 1488 |
| 46 | Ga0070661_100005984 | 3300005344 | Bacteria | 8373 |
| 47 | Ga0070692_10029816 | 3300005345 | Bacteria | 2723 |
| 48 | Ga0070668_100007508 | 3300005347 | Bacteria | 8094 |
| 49 | Ga0070668_100013975 | 3300005347 | Bacteria | 6001 |
| 50 | Ga0070668_100064104 | 3300005347 | Bacteria | 2849 |
| 51 | Ga0070669_100037586 | 3300005353 | Bacteria | 3512 |
| 52 | Ga0070669_100090969 | 3300005353 | Bacteria | 2288 |
| 53 | Ga0070675_100003484 | 3300005354 | Bacteria | 11933 |
| 54 | Ga0070675_100004908 | 3300005354 | Bacteria | 10202 |
| 55 | Ga0070675_100062020 | 3300005354 | Bacteria | 3088 |
| 56 | Ga0070671_100010727 | 3300005355 | Bacteria | 7356 |
| 57 | Ga0070671_100079399 | 3300005355 | Bacteria | 2743 |
| 58 | Ga0070671_100082786 | 3300005355 | Bacteria | 2683 |
| 59 | Ga0070671_100084866 | 3300005355 | Bacteria | 2648 |
| 60 | Ga0070674_100058884 | 3300005356 | Bacteria | 2672 |
| 61 | Ga0070673_100002794 | 3300005364 | Bacteria | 10729 |
| 62 | Ga0070673_100004318 | 3300005364 | Bacteria | 8979 |
| 63 | Ga0070673_100058588 | 3300005364 | Bacteria | 3045 |
| 64 | Ga0070673_100090418 | 3300005364 | Bacteria | 2501 |
| 65 | Ga0070688_100010654 | 3300005365 | Bacteria | 5077 |
| 66 | Ga0070688_100052211 | 3300005365 | Bacteria | 2553 |
| 67 | Ga0070659_100000521 | 3300005366 | Bacteria | 28233 |
| 68 | Ga0070659_100000918 | 3300005366 | Bacteria | 21572 |
| 69 | Ga0070659_100142242 | 3300005366 | Bacteria | 1953 |
| 70 | Ga0070667_100030504 | 3300005367 | Bacteria | 4497 |
| 71 | Ga0070667_100034074 | 3300005367 | Bacteria | 4260 |
| 72 | Ga0070667_100067831 | 3300005367 | Bacteria | 3034 |
| 73 | Ga0070667_100073829 | 3300005367 | Bacteria | 2909 |
| 74 | Ga0070667_100101027 | 3300005367 | Bacteria | 2491 |
| 75 | Ga0070709_10006162 | 3300005434 | Bacteria | 6526 |
| 76 | Ga0070709_10036148 | 3300005434 | Bacteria | 3007 |
| 77 | Ga0070714_100008197 | 3300005435 | Bacteria | 8145 |
| 78 | Ga0070714_100011039 | 3300005435 | Bacteria | 7156 |
| 79 | Ga0070714_100026716 | 3300005435 | Bacteria | 4773 |
| 80 | Ga0070714_100030876 | 3300005435 | Bacteria | 4464 |
| 81 | Ga0070714_100056991 | 3300005435 | Bacteria | 3343 |
| 82 | Ga0070714_100137774 | 3300005435 | Bacteria | 2188 |
| 83 | Ga0070713_100014794 | 3300005436 | Bacteria | 5807 |
| 84 | Ga0070713_100019908 | 3300005436 | Bacteria | 5136 |
| 85 | Ga0070713_100082505 | 3300005436 | Bacteria | 2745 |
| 86 | Ga0070713_100197847 | 3300005436 | Bacteria | 1814 |
| 87 | Ga0070713_100201314 | 3300005436 | Bacteria | 1798 |
| 88 | Ga0070713_100269329 | 3300005436 | Bacteria | 1559 |
| 89 | Ga0070710_10010155 | 3300005437 | Bacteria | 4620 |
| 90 | Ga0070710_10021330 | 3300005437 | Bacteria | 3374 |
| 91 | Ga0070710_10161679 | 3300005437 | Bacteria | 1389 |
| 92 | Ga0070711_100007691 | 3300005439 | Bacteria | 6561 |
| 93 | Ga0070711_100026517 | 3300005439 | Bacteria | 3797 |
| 94 | Ga0070705_100087474 | 3300005440 | Bacteria | 1932 |
| 95 | Ga0070705_100130056 | 3300005440 | Bacteria | 1641 |
| 96 | Ga0070705_100177226 | 3300005440 | Bacteria | 1440 |
| 97 | Ga0070700_100270656 | 3300005441 | Bacteria | 1227 |
| 98 | Ga0070694_100019288 | 3300005444 | Bacteria | 4335 |
| 99 | Ga0070708_100048502 | 3300005445 | Bacteria | 3754 |
| 100 | Ga0070663_100006780 | 3300005455 | Bacteria | 6920 |
| 101 | Ga0070663_100072886 | 3300005455 | Bacteria | 2503 |
| 102 | Ga0070663_100309799 | 3300005455 | Bacteria | 1266 |
| 103 | Ga0070678_100072385 | 3300005456 | Bacteria | 2583 |
| 104 | Ga0070678_100135265 | 3300005456 | Bacteria | 1965 |
| 105 | Ga0070678_100157257 | 3300005456 | Bacteria | 1837 |
| 106 | Ga0070662_100046188 | 3300005457 | Bacteria | 3129 |
| 107 | Ga0070662_100120038 | 3300005457 | Bacteria | 2014 |
| 108 | Ga0070681_10022240 | 3300005458 | Bacteria | 6365 |
| 109 | Ga0070681_10037937 | 3300005458 | Bacteria | 4832 |
| 110 | Ga0070681_10155525 | 3300005458 | Bacteria | 2212 |
| 111 | Ga0068867_100042904 | 3300005459 | Bacteria | 3310 |
| 112 | Ga0070685_10016642 | 3300005466 | Bacteria | 3922 |
| 113 | Ga0070685_10088569 | 3300005466 | Bacteria | 1869 |
| 114 | Ga0070685_10099244 | 3300005466 | Bacteria | 1776 |
| 115 | Ga0070685_10444864 | 3300005466 | Bacteria | 906 |
| 116 | Ga0070706_100018927 | 3300005467 | Bacteria | 6352 |
| 117 | Ga0070706_100080508 | 3300005467 | Bacteria | 3016 |
| 118 | Ga0070706_100623569 | 3300005467 | Bacteria | 1001 |
| 119 | Ga0070707_100011054 | 3300005468 | Bacteria | 8406 |
| 120 | Ga0070698_100001751 | 3300005471 | Bacteria | 24215 |
| 121 | Ga0070698_100200359 | 3300005471 | Bacteria | 1932 |
| 122 | Ga0070698_100359090 | 3300005471 | Bacteria | 1388 |
| 123 | Ga0070698_100518701 | 3300005471 | Bacteria | 1130 |
| 124 | Ga0070699_100056330 | 3300005518 | Bacteria | 3404 |
| 125 | Ga0070699_100156264 | 3300005518 | Bacteria | 2018 |
| 126 | Ga0070699_100748796 | 3300005518 | Bacteria | 893 |
| 127 | Ga0070679_100043058 | 3300005530 | Bacteria | 4497 |
| 128 | Ga0070679_100105346 | 3300005530 | Bacteria | 2806 |
| 129 | Ga0070679_100478765 | 3300005530 | Bacteria | 1189 |
| 130 | Ga0070684_100005198 | 3300005535 | Bacteria | 9951 |
| 131 | Ga0070684_100092893 | 3300005535 | Bacteria | 2685 |
| 132 | Ga0070684_100359470 | 3300005535 | Bacteria | 1340 |
| 133 | Ga0070684_100427788 | 3300005535 | Bacteria | 1222 |
| 134 | Ga0070697_100001259 | 3300005536 | Bacteria | 19142 |
| 135 | Ga0070697_100195077 | 3300005536 | Bacteria | 1719 |
| 136 | Ga0068853_100001224 | 3300005539 | Bacteria | 18321 |
| 137 | Ga0068853_100202723 | 3300005539 | Bacteria | 1806 |
| 138 | Ga0068853_100290221 | 3300005539 | Bacteria | 1510 |
| 139 | Ga0070672_100002370 | 3300005543 | Bacteria | 11932 |
| 140 | Ga0070672_100035278 | 3300005543 | Bacteria | 3802 |
| 141 | Ga0070672_100094974 | 3300005543 | Bacteria | 2411 |
| 142 | Ga0070695_100041604 | 3300005545 | Bacteria | 2913 |
| 143 | Ga0070695_100512325 | 3300005545 | Bacteria | 929 |
| 144 | Ga0070696_100022591 | 3300005546 | Bacteria | 4274 |
| 145 | Ga0070696_100186877 | 3300005546 | Bacteria | 1540 |
| 146 | Ga0070693_100003501 | 3300005547 | Bacteria | 7324 |
| 147 | Ga0070693_100007123 | 3300005547 | Bacteria | 5453 |
| 148 | Ga0070693_100060288 | 3300005547 | Bacteria | 2202 |
| 149 | Ga0070665_100000290 | 3300005548 | Bacteria | 79561 |
| 150 | Ga0070665_100164829 | 3300005548 | Bacteria | 2218 |
| 151 | Ga0070665_100240450 | 3300005548 | Bacteria | 1811 |
| 152 | Ga0070665_100244752 | 3300005548 | Bacteria | 1794 |
| 153 | Ga0070704_100202390 | 3300005549 | Bacteria | 1603 |
| 154 | Ga0070704_100224600 | 3300005549 | Bacteria | 1529 |
| 155 | Ga0068855_100006531 | 3300005563 | Bacteria | 14182 |
| 156 | Ga0068855_100018773 | 3300005563 | Bacteria | 8313 |
| 157 | Ga0068855_100170940 | 3300005563 | Bacteria | 2461 |
| 158 | Ga0068855_100202443 | 3300005563 | Bacteria | 2234 |
| 159 | Ga0070664_100004429 | 3300005564 | Bacteria | 11284 |
| 160 | Ga0070664_100308171 | 3300005564 | Bacteria | 1432 |
| 161 | Ga0068857_100091109 | 3300005577 | Bacteria | 2729 |
| 162 | Ga0068857_100171808 | 3300005577 | Bacteria | 1970 |
| 163 | Ga0068857_100372454 | 3300005577 | Bacteria | 1325 |
| 164 | Ga0068854_100011366 | 3300005578 | Bacteria | 5792 |
| 165 | Ga0068854_100037729 | 3300005578 | Bacteria | 3393 |
| 166 | Ga0068854_100253963 | 3300005578 | Bacteria | 1405 |
| 167 | Ga0068856_100000936 | 3300005614 | Bacteria | 31246 |
| 168 | Ga0068856_100106498 | 3300005614 | Bacteria | 2798 |
| 169 | Ga0068856_100106960 | 3300005614 | Bacteria | 2793 |
| 170 | Ga0068856_100129343 | 3300005614 | Bacteria | 2529 |
| 171 | Ga0068856_100214013 | 3300005614 | Bacteria | 1942 |
| 172 | Ga0070702_100002951 | 3300005615 | Bacteria | 7497 |
| 173 | Ga0070702_100011425 | 3300005615 | Bacteria | 4417 |
| 174 | Ga0070702_100041427 | 3300005615 | Bacteria | 2583 |
| 175 | Ga0070702_100122473 | 3300005615 | Bacteria | 1630 |
| 176 | Ga0068852_100028228 | 3300005616 | Bacteria | 4588 |
| 177 | Ga0068852_100045456 | 3300005616 | Bacteria | 3735 |
| 178 | Ga0068852_100112310 | 3300005616 | Bacteria | 2479 |
| 179 | Ga0068852_100128229 | 3300005616 | Bacteria | 2333 |
| 180 | Ga0068852_100186122 | 3300005616 | Bacteria | 1956 |
| 181 | Ga0068852_100418407 | 3300005616 | Bacteria | 1321 |
| 182 | Ga0068852_100437244 | 3300005616 | Bacteria | 1293 |
| 183 | Ga0068859_100002129 | 3300005617 | Bacteria | 20157 |
| 184 | Ga0068859_100267159 | 3300005617 | Bacteria | 1802 |
| 185 | Ga0068859_100726996 | 3300005617 | Bacteria | 1082 |
| 186 | Ga0068864_100000793 | 3300005618 | Bacteria | 26522 |
| 187 | Ga0068864_100010430 | 3300005618 | Bacteria | 7676 |
| 188 | Ga0068864_100040189 | 3300005618 | Bacteria | 4001 |
| 189 | Ga0068864_100041441 | 3300005618 | Bacteria | 3938 |
| 190 | Ga0068864_100049918 | 3300005618 | Bacteria | 3600 |
| 191 | Ga0068864_100147587 | 3300005618 | Bacteria | 2127 |
| 192 | Ga0068864_100229991 | 3300005618 | Bacteria | 1714 |
| 193 | Ga0068866_10000648 | 3300005718 | Bacteria | 15778 |
| 194 | Ga0068866_10007669 | 3300005718 | Bacteria | 4525 |
| 195 | Ga0068866_10077193 | 3300005718 | Bacteria | 1778 |
| 196 | Ga0068866_10088871 | 3300005718 | Bacteria | 1678 |
| 197 | Ga0068861_100060896 | 3300005719 | Bacteria | 2895 |
| 198 | Ga0068861_100087193 | 3300005719 | Bacteria | 2456 |
| 199 | Ga0068861_100158832 | 3300005719 | Bacteria | 1863 |
| 200 | Ga0068851_10092005 | 3300005834 | Bacteria | 1598 |
| 201 | Ga0068851_10095896 | 3300005834 | Bacteria | 1568 |
| 202 | Ga0068870_10004071 | 3300005840 | Bacteria | 6250 |
| 203 | Ga0068870_10038362 | 3300005840 | Bacteria | 2473 |
| 204 | Ga0068870_10109485 | 3300005840 | Bacteria | 1575 |
| 205 | Ga0068863_100009664 | 3300005841 | Bacteria | 9410 |
| 206 | Ga0068863_100023553 | 3300005841 | Bacteria | 5878 |
| 207 | Ga0068863_100024304 | 3300005841 | Bacteria | 5779 |
| 208 | Ga0068863_100061508 | 3300005841 | Bacteria | 3550 |
| 209 | Ga0068863_100069934 | 3300005841 | Bacteria | 3319 |
| 210 | Ga0068863_100082283 | 3300005841 | Bacteria | 3050 |
| 211 | Ga0068863_100088533 | 3300005841 | Bacteria | 2934 |
| 212 | Ga0068863_100358807 | 3300005841 | Bacteria | 1420 |
| 213 | Ga0068863_100590539 | 3300005841 | Bacteria | 1099 |
| 214 | Ga0068858_100035770 | 3300005842 | Bacteria | 4605 |
| 215 | Ga0068858_100292577 | 3300005842 | Bacteria | 1553 |
| 216 | Ga0068860_100011333 | 3300005843 | Bacteria | 8785 |
| 217 | Ga0068860_100022797 | 3300005843 | Bacteria | 6055 |
| 218 | Ga0068860_100080512 | 3300005843 | Bacteria | 3097 |
| 219 | Ga0068862_100023073 | 3300005844 | Bacteria | 5211 |
| 220 | Ga0068862_100186624 | 3300005844 | Bacteria | 1863 |
| 221 | Ga0068862_100826221 | 3300005844 | Bacteria | 906 |
| 222 | Ga0081538_10011028 | 3300005981 | Bacteria | 7350 |
| 223 | Ga0081538_10109875 | 3300005981 | Bacteria | 1357 |
| 224 | Ga0081539_10090817 | 3300005985 | Bacteria | 1579 |
| 225 | Ga0070717_10015403 | 3300006028 | Bacteria | 5907 |
| 226 | Ga0070717_10022019 | 3300006028 | Bacteria | 5030 |
| 227 | Ga0070717_10065019 | 3300006028 | Bacteria | 3031 |
| 228 | Ga0070717_10065808 | 3300006028 | Bacteria | 3013 |
| 229 | Ga0070717_10129563 | 3300006028 | Bacteria | 2168 |
| 230 | Ga0070717_10329888 | 3300006028 | Bacteria | 1361 |
| 231 | Ga0070716_100015979 | 3300006173 | Bacteria | 3867 |
| 232 | Ga0070716_100356247 | 3300006173 | Bacteria | 1037 |
| 233 | Ga0070712_100023796 | 3300006175 | Bacteria | 4050 |
| 234 | Ga0070712_100025129 | 3300006175 | Bacteria | 3956 |
| 235 | Ga0070712_100037153 | 3300006175 | Bacteria | 3318 |
| 236 | Ga0070712_100054851 | 3300006175 | Bacteria | 2788 |
| 237 | Ga0070712_100152112 | 3300006175 | Bacteria | 1778 |
| 238 | Ga0097621_100027514 | 3300006237 | Bacteria | 4473 |
| 239 | Ga0097621_100046036 | 3300006237 | Bacteria | 3527 |
| 240 | Ga0097621_100222436 | 3300006237 | Bacteria | 1645 |
| 241 | Ga0097621_100379874 | 3300006237 | Bacteria | 1262 |
| 242 | Ga0097621_100410948 | 3300006237 | Bacteria | 1213 |
| 243 | Ga0068871_100023795 | 3300006358 | Bacteria | 4743 |
| 244 | Ga0068871_100044208 | 3300006358 | Bacteria | 3580 |
| 245 | Ga0068871_100059015 | 3300006358 | Bacteria | 3125 |
| 246 | Ga0068871_100060034 | 3300006358 | Bacteria | 3100 |
| 247 | Ga0068871_100079734 | 3300006358 | Bacteria | 2709 |
| 248 | Ga0068871_100245852 | 3300006358 | Bacteria | 1557 |
| 249 | Ga0075428_100246242 | 3300006844 | Bacteria | 1927 |
| 250 | Ga0075428_100368365 | 3300006844 | Bacteria | 1541 |
| 251 | Ga0075430_100027317 | 3300006846 | Bacteria | 4850 |
| 252 | Ga0075431_100062269 | 3300006847 | Bacteria | 3850 |
| 253 | Ga0075431_100089470 | 3300006847 | Bacteria | 3177 |
| 254 | Ga0075433_10043588 | 3300006852 | Bacteria | 3895 |
| 255 | Ga0075434_100042650 | 3300006871 | Bacteria | 4499 |
| 256 | Ga0075429_100667506 | 3300006880 | Bacteria | 911 |
| 257 | Ga0068865_100134894 | 3300006881 | Bacteria | 1853 |
| 258 | Ga0068865_100204543 | 3300006881 | Bacteria | 1535 |
| 259 | Ga0075436_100121509 | 3300006914 | Bacteria | 1828 |
| 260 | Ga0097620_100002129 | 3300006931 | Bacteria | 20157 |
| 261 | Ga0097620_100267136 | 3300006931 | Bacteria | 1802 |
| 262 | Ga0097620_100727009 | 3300006931 | Bacteria | 1082 |
| 263 | Ga0075435_100109361 | 3300007076 | Bacteria | 2297 |
| 264 | Ga0099794_10081185 | 3300007265 | Bacteria | 1600 |
| 265 | Ga0099794_10145397 | 3300007265 | Bacteria | 1202 |
| 266 | Ga0105240_10007389 | 3300009093 | Bacteria | 15976 |
| 267 | Ga0105240_10039790 | 3300009093 | Bacteria | 6018 |
| 268 | Ga0105240_10082256 | 3300009093 | Bacteria | 3955 |
| 269 | Ga0105240_10153453 | 3300009093 | Bacteria | 2741 |
| 270 | Ga0111539_10059711 | 3300009094 | Bacteria | 4521 |
| 271 | Ga0111539_10214581 | 3300009094 | Bacteria | 2242 |
| 272 | Ga0105245_10001578 | 3300009098 | Bacteria | 20699 |
| 273 | Ga0105245_10016018 | 3300009098 | Bacteria | 6533 |
| 274 | Ga0105245_10048069 | 3300009098 | Bacteria | 3816 |
| 275 | Ga0105247_10028121 | 3300009101 | Bacteria | 3401 |
| 276 | Ga0105247_10116692 | 3300009101 | Bacteria | 1725 |
| 277 | Ga0114129_10001780 | 3300009147 | Bacteria | 29349 |
| 278 | Ga0114129_10004894 | 3300009147 | Bacteria | 18905 |
| 279 | Ga0114129_10060825 | 3300009147 | Bacteria | 5280 |
| 280 | Ga0105243_10032143 | 3300009148 | Bacteria | 4052 |
| 281 | Ga0105243_10163522 | 3300009148 | Bacteria | 1921 |
| 282 | Ga0105243_10185727 | 3300009148 | Bacteria | 1812 |
| 283 | Ga0105243_10194537 | 3300009148 | Bacteria | 1774 |
| 284 | Ga0105243_10213838 | 3300009148 | Bacteria | 1699 |
| 285 | Ga0105241_10002518 | 3300009174 | Bacteria | 13743 |
| 286 | Ga0105241_10005464 | 3300009174 | Bacteria | 9398 |
| 287 | Ga0105241_10012839 | 3300009174 | Bacteria | 6148 |
| 288 | Ga0105242_10004571 | 3300009176 | Bacteria | 10731 |
| 289 | Ga0105242_10119196 | 3300009176 | Bacteria | 2262 |
| 290 | Ga0105248_10356815 | 3300009177 | Bacteria | 1646 |
| 291 | Ga0105248_10419031 | 3300009177 | Bacteria | 1508 |
| 292 | Ga0105237_10003409 | 3300009545 | Bacteria | 18893 |
| 293 | Ga0105237_10058609 | 3300009545 | Bacteria | 3854 |
| 294 | Ga0105237_10230252 | 3300009545 | Bacteria | 1854 |
| 295 | Ga0105237_10289715 | 3300009545 | Bacteria | 1640 |
| 296 | Ga0105238_10003255 | 3300009551 | Bacteria | 16213 |
| 297 | Ga0105238_10004602 | 3300009551 | Bacteria | 13646 |
| 298 | Ga0105238_10011128 | 3300009551 | Bacteria | 9047 |
| 299 | Ga0105238_10019606 | 3300009551 | Bacteria | 6886 |
| 300 | Ga0105238_10107715 | 3300009551 | Bacteria | 2768 |
| 301 | Ga0105238_10205288 | 3300009551 | Bacteria | 1946 |
| 302 | Ga0105249_10012144 | 3300009553 | Bacteria | 7583 |
| 303 | Ga0105249_10034861 | 3300009553 | Bacteria | 4562 |
| 304 | Ga0105239_10181267 | 3300010375 | Bacteria | 2356 |
| 305 | Ga0105239_10200517 | 3300010375 | Bacteria | 2235 |
| 306 | Ga0105239_10306831 | 3300010375 | Bacteria | 1788 |
| 307 | Ga0105246_10246698 | 3300011119 | Bacteria | 1415 |
| 308 | Ga0105246_10607435 | 3300011119 | Bacteria | 946 |
| 309 | Ga0157373_10006161 | 3300013100 | Bacteria | 8965 |
| 310 | Ga0157373_10029137 | 3300013100 | Bacteria | 3979 |
| 311 | Ga0157371_10186823 | 3300013102 | Bacteria | 1483 |
| 312 | Ga0157371_10320643 | 3300013102 | Bacteria | 1124 |
| 313 | Ga0157370_10015691 | 3300013104 | Bacteria | 7694 |
| 314 | Ga0157370_10018515 | 3300013104 | Bacteria | 7001 |
| 315 | Ga0157370_10113806 | 3300013104 | Bacteria | 2528 |
| 316 | Ga0157369_10001622 | 3300013105 | Bacteria | 27496 |
| 317 | Ga0157369_10550806 | 3300013105 | Bacteria | 1192 |
| 318 | Ga0157374_10000781 | 3300013296 | Bacteria | 27884 |
| 319 | Ga0157374_10255298 | 3300013296 | Bacteria | 1726 |
| 320 | Ga0157378_10013116 | 3300013297 | Bacteria | 7251 |
| 321 | Ga0157378_10035751 | 3300013297 | Bacteria | 4396 |
| 322 | Ga0157378_10178174 | 3300013297 | Bacteria | 1998 |
| 323 | Ga0163162_10001760 | 3300013306 | Bacteria | 20292 |
| 324 | Ga0163162_10003592 | 3300013306 | Bacteria | 14849 |
| 325 | Ga0163162_10078134 | 3300013306 | Bacteria | 3374 |
| 326 | Ga0163162_10242165 | 3300013306 | Bacteria | 1935 |
| 327 | Ga0163162_10950599 | 3300013306 | Bacteria | 970 |
| 328 | Ga0157372_10062862 | 3300013307 | Bacteria | 4161 |
| 329 | Ga0157372_10076101 | 3300013307 | Bacteria | 3789 |
| 330 | Ga0157372_10262490 | 3300013307 | Bacteria | 2006 |
| 331 | Ga0157375_10056860 | 3300013308 | Bacteria | 3865 |
| 332 | Ga0157375_10089343 | 3300013308 | Bacteria | 3137 |
| 333 | Ga0157375_10145786 | 3300013308 | Bacteria | 2498 |
| 334 | Ga0157375_10361020 | 3300013308 | Bacteria | 1619 |
| 335 | Ga0157375_10433587 | 3300013308 | Bacteria | 1480 |
| 336 | Ga0157375_10547009 | 3300013308 | Bacteria | 1320 |
| 337 | Ga0157375_10683929 | 3300013308 | Bacteria | 1180 |
| 338 | Ga0163163_10005175 | 3300014325 | Bacteria | 11249 |
| 339 | Ga0163163_10033734 | 3300014325 | Bacteria | 4954 |
| 340 | Ga0163163_10515677 | 3300014325 | Bacteria | 1258 |
| 341 | Ga0163163_10670552 | 3300014325 | Bacteria | 1100 |
| 342 | Ga0163163_10737915 | 3300014325 | Bacteria | 1048 |
| 343 | Ga0157380_10179340 | 3300014326 | Bacteria | 1859 |
| 344 | Ga0182008_10141994 | 3300014497 | Bacteria | 1202 |
| 345 | Ga0157377_10020766 | 3300014745 | Bacteria | 3445 |
| 346 | Ga0157377_10272155 | 3300014745 | Bacteria | 1106 |
| 347 | Ga0157379_10029742 | 3300014968 | Bacteria | 4857 |
| 348 | Ga0157376_10020699 | 3300014969 | Bacteria | 5097 |
| 349 | Ga0157376_10134249 | 3300014969 | Bacteria | 2213 |
| 350 | Ga0157376_10144912 | 3300014969 | Bacteria | 2135 |
| 351 | Ga0157376_10292964 | 3300014969 | Bacteria | 1537 |
| 352 | Ga0182007_10003381 | 3300015262 | Bacteria | 7519 |
| 353 | Ga0182007_10008462 | 3300015262 | Bacteria | 4225 |
| 354 | Ga0182005_1000300 | 3300015265 | Bacteria | 30284 |
| 355 | Ga0163161_10032838 | 3300017792 | Bacteria | 3707 |
| 356 | Ga0163161_10354899 | 3300017792 | Bacteria | 1166 |
| 357 | Ga0206356_10237460 | 3300020070 | Bacteria | 1988 |
| 358 | Ga0206353_11660178 | 3300020082 | Bacteria | 8267 |
| 359 | Ga0213876_10133841 | 3300021384 | Unclassified | 1318 |
| 360 | Ga0213876_10233164 | 3300021384 | Bacteria | 978 |
| 361 | Ga0213875_10009902 | 3300021388 | Bacteria | 4805 |
| 362 | Ga0213875_10020568 | 3300021388 | Bacteria | 3167 |
| 363 | Ga0213875_10077647 | 3300021388 | Bacteria | 1550 |
| 364 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 365 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 366 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 367 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 368 | Ga0207427_100311 | 3300025231 | Bacteria | 33858 |
| 369 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 370 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 371 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 372 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 373 | Ga0209050_1004071 | 3300025298 | Bacteria | 10231 |
| 374 | Ga0209257_1000634 | 3300025304 | Bacteria | 56352 |
| 375 | Ga0207656_10018970 | 3300025321 | Bacteria | 2715 |
| 376 | Ga0207682_10084799 | 3300025893 | Bacteria | 1364 |
| 377 | Ga0207692_10003106 | 3300025898 | Bacteria | 6448 |
| 378 | Ga0207642_10033257 | 3300025899 | Bacteria | 2180 |
| 379 | Ga0207642_10193729 | 3300025899 | Bacteria | 1117 |
| 380 | Ga0207710_10140898 | 3300025900 | Bacteria | 1164 |
| 381 | Ga0207688_10010543 | 3300025901 | Bacteria | 5027 |
| 382 | Ga0207680_10005767 | 3300025903 | Bacteria | 5941 |
| 383 | Ga0207647_10070604 | 3300025904 | Bacteria | 2109 |
| 384 | Ga0207685_10038823 | 3300025905 | Bacteria | 1763 |
| 385 | Ga0207685_10054554 | 3300025905 | Bacteria | 1557 |
| 386 | Ga0207699_10036248 | 3300025906 | Bacteria | 2810 |
| 387 | Ga0207699_10156631 | 3300025906 | Bacteria | 1512 |
| 388 | Ga0207699_10281645 | 3300025906 | Bacteria | 1155 |
| 389 | Ga0207699_10301766 | 3300025906 | Bacteria | 1118 |
| 390 | Ga0207645_10011735 | 3300025907 | Bacteria | 5971 |
| 391 | Ga0207645_10015093 | 3300025907 | Bacteria | 5145 |
| 392 | Ga0207645_10081281 | 3300025907 | Bacteria | 2077 |
| 393 | Ga0207643_10023495 | 3300025908 | Bacteria | 3399 |
| 394 | Ga0207643_10060318 | 3300025908 | Bacteria | 2165 |
| 395 | Ga0207643_10074470 | 3300025908 | Bacteria | 1958 |
| 396 | Ga0207705_10017844 | 3300025909 | Bacteria | 5075 |
| 397 | Ga0207705_10059325 | 3300025909 | Bacteria | 2761 |
| 398 | Ga0207684_10068220 | 3300025910 | Bacteria | 3022 |
| 399 | Ga0207654_10007783 | 3300025911 | Bacteria | 5409 |
| 400 | Ga0207654_10047546 | 3300025911 | Bacteria | 2452 |
| 401 | Ga0207654_10061712 | 3300025911 | Bacteria | 2194 |
| 402 | Ga0207654_10180230 | 3300025911 | Bacteria | 1378 |
| 403 | Ga0207707_10187443 | 3300025912 | Bacteria | 1805 |
| 404 | Ga0207695_10011865 | 3300025913 | Bacteria | 10507 |
| 405 | Ga0207695_10122250 | 3300025913 | Bacteria | 2570 |
| 406 | Ga0207695_10177384 | 3300025913 | Bacteria | 2053 |
| 407 | Ga0207671_10010872 | 3300025914 | Bacteria | 7466 |
| 408 | Ga0207671_10069454 | 3300025914 | Bacteria | 2626 |
| 409 | Ga0207671_10238260 | 3300025914 | Bacteria | 1429 |
| 410 | Ga0207693_10000153 | 3300025915 | Bacteria | 63886 |
| 411 | Ga0207693_10009382 | 3300025915 | Bacteria | 7981 |
| 412 | Ga0207693_10010429 | 3300025915 | Bacteria | 7540 |
| 413 | Ga0207693_10068957 | 3300025915 | Bacteria | 2768 |
| 414 | Ga0207693_10094768 | 3300025915 | Bacteria | 2340 |
| 415 | Ga0207663_10109493 | 3300025916 | Bacteria | 1872 |
| 416 | Ga0207663_10125897 | 3300025916 | Bacteria | 1762 |
| 417 | Ga0207660_10011594 | 3300025917 | Bacteria | 5745 |
| 418 | Ga0207660_10030021 | 3300025917 | Bacteria | 3734 |
| 419 | Ga0207660_10132509 | 3300025917 | Bacteria | 1898 |
| 420 | Ga0207662_10152073 | 3300025918 | Bacteria | 1472 |
| 421 | Ga0207657_10000586 | 3300025919 | Bacteria | 38661 |
| 422 | Ga0207657_10020066 | 3300025919 | Bacteria | 6330 |
| 423 | Ga0207657_10036647 | 3300025919 | Bacteria | 4388 |
| 424 | Ga0207649_10035660 | 3300025920 | Bacteria | 2990 |
| 425 | Ga0207652_10012687 | 3300025921 | Bacteria | 6815 |
| 426 | Ga0207652_10611905 | 3300025921 | Bacteria | 976 |
| 427 | Ga0207646_10002124 | 3300025922 | Bacteria | 23705 |
| 428 | Ga0207646_10068935 | 3300025922 | Bacteria | 3159 |
| 429 | Ga0207681_10131610 | 3300025923 | Bacteria | 1850 |
| 430 | Ga0207694_10015265 | 3300025924 | Bacteria | 5795 |
| 431 | Ga0207694_10020755 | 3300025924 | Bacteria | 4973 |
| 432 | Ga0207694_10036415 | 3300025924 | Bacteria | 3777 |
| 433 | Ga0207650_10002086 | 3300025925 | Bacteria | 13981 |
| 434 | Ga0207650_10009326 | 3300025925 | Bacteria | 6707 |
| 435 | Ga0207650_10060478 | 3300025925 | Bacteria | 2827 |
| 436 | Ga0207650_10210122 | 3300025925 | Bacteria | 1563 |
| 437 | Ga0207650_10211391 | 3300025925 | Bacteria | 1558 |
| 438 | Ga0207659_10014420 | 3300025926 | Bacteria | 5097 |
| 439 | Ga0207659_10038655 | 3300025926 | Bacteria | 3321 |
| 440 | Ga0207687_10002184 | 3300025927 | Bacteria | 13362 |
| 441 | Ga0207687_10005074 | 3300025927 | Bacteria | 8716 |
| 442 | Ga0207687_10118391 | 3300025927 | Bacteria | 1977 |
| 443 | Ga0207700_10015934 | 3300025928 | Bacteria | 4978 |
| 444 | Ga0207700_10051344 | 3300025928 | Bacteria | 3077 |
| 445 | Ga0207700_10225944 | 3300025928 | Bacteria | 1589 |
| 446 | Ga0207700_10540464 | 3300025928 | Bacteria | 1034 |
| 447 | Ga0207664_10002430 | 3300025929 | Bacteria | 12320 |
| 448 | Ga0207664_10010782 | 3300025929 | Bacteria | 6466 |
| 449 | Ga0207664_10024658 | 3300025929 | Bacteria | 4521 |
| 450 | Ga0207664_10182245 | 3300025929 | Bacteria | 1803 |
| 451 | Ga0207664_10207148 | 3300025929 | Bacteria | 1695 |
| 452 | Ga0207664_10409963 | 3300025929 | Bacteria | 1206 |
| 453 | Ga0207664_10489130 | 3300025929 | Bacteria | 1101 |
| 454 | Ga0207644_10003209 | 3300025931 | Bacteria | 10534 |
| 455 | Ga0207644_10041311 | 3300025931 | Bacteria | 3262 |
| 456 | Ga0207644_10343702 | 3300025931 | Bacteria | 1210 |
| 457 | Ga0207644_10434118 | 3300025931 | Bacteria | 1077 |
| 458 | Ga0207690_10000960 | 3300025932 | Bacteria | 18458 |
| 459 | Ga0207690_10018527 | 3300025932 | Bacteria | 4270 |
| 460 | Ga0207706_10004245 | 3300025933 | Bacteria | 13495 |
| 461 | Ga0207706_10028422 | 3300025933 | Bacteria | 4994 |
| 462 | Ga0207706_10038159 | 3300025933 | Bacteria | 4261 |
| 463 | Ga0207686_10006273 | 3300025934 | Bacteria | 6397 |
| 464 | Ga0207670_10027629 | 3300025936 | Bacteria | 3590 |
| 465 | Ga0207670_10038996 | 3300025936 | Bacteria | 3107 |
| 466 | Ga0207670_10104032 | 3300025936 | Bacteria | 2033 |
| 467 | Ga0207669_10181230 | 3300025937 | Bacteria | 1510 |
| 468 | Ga0207704_10364296 | 3300025938 | Bacteria | 1129 |
| 469 | Ga0207704_10561271 | 3300025938 | Bacteria | 929 |
| 470 | Ga0207665_10002771 | 3300025939 | Bacteria | 11748 |
| 471 | Ga0207665_10048971 | 3300025939 | Bacteria | 2838 |
| 472 | Ga0207665_10186751 | 3300025939 | Bacteria | 1504 |
| 473 | Ga0207691_10001558 | 3300025940 | Bacteria | 22754 |
| 474 | Ga0207691_10035297 | 3300025940 | Bacteria | 4643 |
| 475 | Ga0207691_10193111 | 3300025940 | Bacteria | 1775 |
| 476 | Ga0207691_10276634 | 3300025940 | Bacteria | 1445 |
| 477 | Ga0207711_10001574 | 3300025941 | Bacteria | 21065 |
| 478 | Ga0207711_10056201 | 3300025941 | Bacteria | 3381 |
| 479 | Ga0207711_10084109 | 3300025941 | Bacteria | 2785 |
| 480 | Ga0207711_10303693 | 3300025941 | Bacteria | 1472 |
| 481 | Ga0207711_10575558 | 3300025941 | Bacteria | 1050 |
| 482 | Ga0207689_10005580 | 3300025942 | Bacteria | 11223 |
| 483 | Ga0207689_10007156 | 3300025942 | Bacteria | 9813 |
| 484 | Ga0207689_10021571 | 3300025942 | Bacteria | 5415 |
| 485 | Ga0207689_10028135 | 3300025942 | Bacteria | 4701 |
| 486 | Ga0207689_10036814 | 3300025942 | Bacteria | 4061 |
| 487 | Ga0207661_10036988 | 3300025944 | Bacteria | 3814 |
| 488 | Ga0207661_10653898 | 3300025944 | Bacteria | 966 |
| 489 | Ga0207679_10237940 | 3300025945 | Bacteria | 1541 |
| 490 | Ga0207667_10000425 | 3300025949 | Bacteria | 56804 |
| 491 | Ga0207667_10004554 | 3300025949 | Bacteria | 16991 |
| 492 | Ga0207667_10054342 | 3300025949 | Bacteria | 4213 |
| 493 | Ga0207667_10193676 | 3300025949 | Bacteria | 2086 |
| 494 | Ga0207651_10002703 | 3300025960 | Bacteria | 8501 |
| 495 | Ga0207651_10134763 | 3300025960 | Bacteria | 1897 |
| 496 | Ga0207651_10234733 | 3300025960 | Bacteria | 1491 |
| 497 | Ga0207651_10413442 | 3300025960 | Bacteria | 1150 |
| 498 | Ga0207712_10048719 | 3300025961 | Bacteria | 2949 |
| 499 | Ga0207712_10076359 | 3300025961 | Bacteria | 2425 |
| 500 | Ga0207668_10103494 | 3300025972 | Bacteria | 2120 |
| 501 | Ga0207640_10094940 | 3300025981 | Bacteria | 2075 |
| 502 | Ga0207640_10114699 | 3300025981 | Bacteria | 1917 |
| 503 | Ga0207640_10180973 | 3300025981 | Bacteria | 1580 |
| 504 | Ga0207640_10545023 | 3300025981 | Bacteria | 974 |
| 505 | Ga0207658_10011772 | 3300025986 | Bacteria | 5958 |
| 506 | Ga0207658_10066409 | 3300025986 | Bacteria | 2713 |
| 507 | Ga0207658_10085117 | 3300025986 | Bacteria | 2435 |
| 508 | Ga0207658_10085950 | 3300025986 | Bacteria | 2424 |
| 509 | Ga0207677_10001064 | 3300026023 | Bacteria | 15036 |
| 510 | Ga0207677_10131263 | 3300026023 | Bacteria | 1902 |
| 511 | Ga0207677_10234128 | 3300026023 | Bacteria | 1481 |
| 512 | Ga0207639_10006026 | 3300026041 | Bacteria | 8222 |
| 513 | Ga0207639_10160805 | 3300026041 | Bacteria | 1892 |
| 514 | Ga0207678_10000668 | 3300026067 | Bacteria | 31472 |
| 515 | Ga0207678_10009943 | 3300026067 | Bacteria | 8344 |
| 516 | Ga0207678_10020435 | 3300026067 | Bacteria | 5807 |
| 517 | Ga0207678_10033821 | 3300026067 | Bacteria | 4452 |
| 518 | Ga0207708_10003117 | 3300026075 | Bacteria | 12204 |
| 519 | Ga0207702_10004490 | 3300026078 | Bacteria | 12384 |
| 520 | Ga0207702_10082237 | 3300026078 | Bacteria | 2799 |
| 521 | Ga0207702_10109772 | 3300026078 | Bacteria | 2450 |
| 522 | Ga0207702_10317498 | 3300026078 | Bacteria | 1483 |
| 523 | Ga0207641_10004440 | 3300026088 | Bacteria | 12153 |
| 524 | Ga0207641_10016808 | 3300026088 | Bacteria | 5991 |
| 525 | Ga0207641_10039978 | 3300026088 | Bacteria | 3924 |
| 526 | Ga0207641_10179451 | 3300026088 | Bacteria | 1938 |
| 527 | Ga0207641_10364874 | 3300026088 | Bacteria | 1380 |
| 528 | Ga0207641_10531932 | 3300026088 | Bacteria | 1144 |
| 529 | Ga0207648_10009160 | 3300026089 | Bacteria | 9511 |
| 530 | Ga0207648_10030124 | 3300026089 | Bacteria | 4810 |
| 531 | Ga0207648_10242735 | 3300026089 | Bacteria | 1604 |
| 532 | Ga0207676_10000811 | 3300026095 | Bacteria | 24361 |
| 533 | Ga0207676_10046728 | 3300026095 | Bacteria | 3351 |
| 534 | Ga0207676_10048511 | 3300026095 | Bacteria | 3297 |
| 535 | Ga0207674_10004614 | 3300026116 | Bacteria | 16534 |
| 536 | Ga0207674_10329456 | 3300026116 | Bacteria | 1477 |
| 537 | Ga0207674_10537450 | 3300026116 | Bacteria | 1129 |
| 538 | Ga0207675_100018362 | 3300026118 | Bacteria | 6521 |
| 539 | Ga0207675_100023777 | 3300026118 | Bacteria | 5701 |
| 540 | Ga0207675_100026149 | 3300026118 | Bacteria | 5434 |
| 541 | Ga0207675_100124671 | 3300026118 | Bacteria | 2439 |
| 542 | Ga0207683_10005347 | 3300026121 | Bacteria | 11015 |
| 543 | Ga0207683_10008660 | 3300026121 | Bacteria | 8700 |
| 544 | Ga0207683_10089194 | 3300026121 | Bacteria | 2744 |
| 545 | Ga0207683_10147252 | 3300026121 | Bacteria | 2124 |
| 546 | Ga0207683_10245069 | 3300026121 | Bacteria | 1635 |
| 547 | Ga0207698_10001506 | 3300026142 | Bacteria | 13557 |
| 548 | Ga0207698_10022387 | 3300026142 | Bacteria | 4390 |
| 549 | Ga0207698_10091988 | 3300026142 | Bacteria | 2485 |
| 550 | Ga0210002_1032261 | 3300027617 | Bacteria | 873 |
| 551 | Ga0209588_1085730 | 3300027671 | Bacteria | 1016 |
| 552 | Ga0209971_1007080 | 3300027682 | Bacteria | 2660 |
| 553 | Ga0268266_10000612 | 3300028379 | Bacteria | 48661 |
| 554 | Ga0268266_10009375 | 3300028379 | Bacteria | 8627 |
| 555 | Ga0268265_10017286 | 3300028380 | Bacteria | 4973 |
| 556 | Ga0268265_10166659 | 3300028380 | Bacteria | 1878 |
| 557 | Ga0268265_10424378 | 3300028380 | Bacteria | 1235 |
| 558 | Ga0268264_10020465 | 3300028381 | Bacteria | 5406 |
| 559 | Ga0268264_10150955 | 3300028381 | Bacteria | 2083 |
| 560 | Ga0268264_10175403 | 3300028381 | Bacteria | 1942 |
| 561 | Ga0268264_10263250 | 3300028381 | Bacteria | 1607 |
| 562 | Ga0268264_10295234 | 3300028381 | Bacteria | 1523 |
| 563 | Ga0268264_10342670 | 3300028381 | Bacteria | 1420 |
| 564 | Ga0268264_10372636 | 3300028381 | Bacteria | 1365 |
| 565 | Ga0265770_1003724 | 3300030878 | Bacteria | 2074 |
| 566 | Ga0265332_10005033 | 3300031238 | Bacteria | 6143 |
| 567 | Ga0265331_10001457 | 3300031250 | Bacteria | 17393 |
| 568 | Ga0307513_10081219 | 3300031456 | Bacteria | 3341 |
| 569 | Ga0265313_10011287 | 3300031595 | Bacteria | 5565 |
| 570 | Ga0307508_10244575 | 3300031616 | Bacteria | 1391 |
| 571 | Ga0307516_10005198 | 3300031730 | Bacteria | 15667 |
| 572 | Ga0307518_10000367 | 3300031838 | Bacteria | 34371 |
| 573 | Ga0307416_100521956 | 3300032002 | Bacteria | 1256 |
| 574 | Ga0373934_0018541 | 3300035086 | Bacteria | 2664 |
| 575 | Ga0373940_0019514 | 3300035088 | Bacteria | 1714 |
| 576 | Ga0373949_0006124 | 3300035090 | Bacteria | 2661 |
| 577 | Ga0373951_0007338 | 3300035091 | Bacteria | 2505 |
| 578 | Ga0373923_0014532 | 3300035111 | Bacteria | 2959 |
| 579 | Ga0373923_0018735 | 3300035111 | Bacteria | 2669 |
| 580 | Ga0373923_0031669 | 3300035111 | Bacteria | 2133 |
| 581 | Ga0373936_0008921 | 3300035113 | Bacteria | 3779 |
| 582 | Ga0373939_0009931 | 3300035114 | Bacteria | 2369 |
| 583 | Ga0373945_0022914 | 3300035116 | Bacteria | 2155 |
| 584 | Ga0373945_0080553 | 3300035116 | Bacteria | 1247 |
| 585 | Ga0373953_0014201 | 3300035117 | Bacteria | 2860 |
| 586 | Ga0373954_0071616 | 3300035118 | Bacteria | 1647 |
| 587 | Ga0373957_0044697 | 3300035120 | Bacteria | 1677 |
| 588 | Ga0373957_0070673 | 3300035120 | Bacteria | 1364 |
| 589 | Ga0373957_0102060 | 3300035120 | Bacteria | 1149 |
| 590 | Ga0373943_0058681 | 3300035170 | Bacteria | 1916 |
| 591 | Ga0373943_0086150 | 3300035170 | Bacteria | 1619 |
| 592 | Ga0373946_0011117 | 3300035171 | Bacteria | 3350 |
| 593 | Ga0373955_0051094 | 3300035172 | Bacteria | 2251 |
| 594 | Ga0373962_0027201 | 3300035242 | Bacteria | 1546 |
| 595 | Ga0373924_0008418 | 3300035410 | Bacteria | 3747 |
| 596 | Ga0373924_0072287 | 3300035410 | Bacteria | 1456 |
| 597 | Ga0373931_0033393 | 3300035691 | Bacteria | 2666 |
| 598 | Ga0373935_0023165 | 3300035692 | Bacteria | 3814 |
| 599 | Ga0373935_0167150 | 3300035692 | Bacteria | 1503 |
| 600 | Ga0373927_0012491 | 3300035695 | Bacteria | 5655 |
| 601 | Ga0373927_0045703 | 3300035695 | Bacteria | 2832 |
| 602 | Ga0373933_0003686 | 3300035724 | Bacteria | 8478 |
| 603 | Ga0373933_0010665 | 3300035724 | Bacteria | 5038 |
| 604 | Ga0373933_0034792 | 3300035724 | Bacteria | 2938 |
| 605 | Ga0373933_0041902 | 3300035724 | Bacteria | 2704 |
| 606 | Ga0373937_0007489 | 3300036401 | Bacteria | 9447 |
| 607 | Ga0373937_0024000 | 3300036401 | Bacteria | 5499 |
| 608 | Ga0373937_0114046 | 3300036401 | Bacteria | 2515 |
| 609 | Ga0373937_0139384 | 3300036401 | Bacteria | 2268 |
| 610 | Ga0316584_0017673 | 3300036712 | Bacteria | 5134 |
| 611 | Ga0373925_0042682 | 3300037068 | Bacteria | 3365 |
| 612 | Ga0373925_0063961 | 3300037068 | Bacteria | 2768 |
| 613 | Ga0373925_0360550 | 3300037068 | Bacteria | 1181 |
| 614 | Ga0373925_0557799 | 3300037068 | Bacteria | 942 |
| 615 | Ga0395900_0303266 | 3300037418 | Bacteria | 1583 |
| 616 | Ga0436364_0180261 | 3300037853 | Bacteria | 4004 |
| 617 | Ga0436364_0287884 | 3300037853 | Bacteria | 10794 |
| 618 | Ga0436364_0509323 | 3300037853 | Bacteria | 1896 |
| 619 | Ga0436364_1311957 | 3300037853 | Bacteria | 1583 |
| 620 | Ga0436365_0281494 | 3300039437 | Bacteria | 11403 |
| 621 | Ga0436365_0627039 | 3300039437 | Bacteria | 7837 |
| 622 | Ga0436365_0674621 | 3300039437 | Bacteria | 1890 |
| 623 | Ga0436365_1880555 | 3300039437 | Unclassified | 2247 |
| 624 | Ga0436363_0751098 | 3300039450 | Bacteria | 4380 |
| 625 | Ga0436363_0981235 | 3300039450 | Bacteria | 2513 |
| 626 | Ga0436362_0193295 | 3300039453 | Bacteria | 4360 |
| 627 | Ga0436362_0311511 | 3300039453 | Bacteria | 905 |
| 628 | Ga0451787_499637 | 3300041441 | Bacteria | 1347 |
| 629 | Ga0451789_0995645 | 3300041443 | Bacteria | 1375 |
| 630 | Ga0451800_1646914 | 3300041459 | Bacteria | 3113 |
| 631 | Ga0451807_1038203 | 3300041486 | Bacteria | 3193 |
| 632 | Ga0439446_0086715 | 3300042156 | Bacteria | 975 |
| 633 | Ga0466963_0074228 | 3300044694 | Bacteria | 2293 |
| 634 | Ga0466963_0160912 | 3300044694 | Bacteria | 1562 |
| 635 | Ga0466963_0222941 | 3300044694 | Bacteria | 1321 |
| 636 | Ga0466963_0246220 | 3300044694 | Bacteria | 1254 |
| 637 | Ga0466960_0023293 | 3300044901 | Bacteria | 2779 |
| 638 | Ga0466960_0060535 | 3300044901 | Bacteria | 1856 |
| 639 | Ga0451576_0172820 | 3300045051 | Bacteria | 2255 |
| 640 | Ga0466958_0145562 | 3300045836 | Bacteria | 1493 |
| 641 | Ga0466967_0015121 | 3300045976 | Bacteria | 6041 |
| 642 | Ga0466967_0094547 | 3300045976 | Bacteria | 2722 |
| 643 | Ga0466967_0232372 | 3300045976 | Bacteria | 1756 |
| 644 | Ga0466967_0232641 | 3300045976 | Bacteria | 1755 |
| 645 | Ga0466967_0307425 | 3300045976 | Bacteria | 1526 |
| 646 | Ga0466967_0580764 | 3300045976 | Bacteria | 1105 |
| 647 | Ga0466967_0666966 | 3300045976 | Bacteria | 1029 |
| 648 | Ga0466967_0696910 | 3300045976 | Bacteria | 1006 |
| 649 | Ga0466967_0714219 | 3300045976 | Bacteria | 993 |
| 650 | Ga0495592_0013413 | 3300046454 | Bacteria | 6235 |
| 651 | Ga0495592_0025944 | 3300046454 | Bacteria | 4446 |
| 652 | Ga0495592_0027021 | 3300046454 | Bacteria | 4350 |
| 653 | Ga0495592_0216487 | 3300046454 | Bacteria | 1283 |
| 654 | Ga0495592_0265365 | 3300046454 | Bacteria | 1129 |
| 655 | Ga0495629_0082238 | 3300046459 | Bacteria | 2247 |
| 656 | Ga0495638_0102347 | 3300046460 | Bacteria | 1712 |
| 657 | Ga0495641_0016701 | 3300046461 | Bacteria | 3857 |
| 658 | Ga0495651_0000734 | 3300046462 | Bacteria | 25321 |
| 659 | Ga0495651_0008430 | 3300046462 | Bacteria | 7900 |
| 660 | Ga0495651_0042930 | 3300046462 | Bacteria | 3508 |
| 661 | Ga0495651_0194872 | 3300046462 | Bacteria | 1423 |
| 662 | Ga0495651_0269623 | 3300046462 | Bacteria | 1154 |
| 663 | Ga0495653_0009930 | 3300046463 | Bacteria | 7787 |
| 664 | Ga0495580_0022242 | 3300046472 | Bacteria | 4668 |
| 665 | Ga0495582_0011027 | 3300046473 | Bacteria | 4975 |
| 666 | Ga0495582_0029350 | 3300046473 | Bacteria | 3019 |
| 667 | Ga0495639_0053305 | 3300046475 | Bacteria | 1842 |
| 668 | Ga0495662_0006250 | 3300046476 | Bacteria | 5953 |
| 669 | Ga0495662_0114154 | 3300046476 | Bacteria | 1324 |
| 670 | Ga0495664_0038498 | 3300046477 | Bacteria | 2822 |
| 671 | Ga0495664_0137601 | 3300046477 | Bacteria | 1480 |
| 672 | Ga0495608_0008621 | 3300046511 | Bacteria | 7138 |
| 673 | Ga0495608_0009042 | 3300046511 | Bacteria | 6970 |
| 674 | Ga0495608_0015217 | 3300046511 | Bacteria | 5338 |
| 675 | Ga0495608_0051950 | 3300046511 | Bacteria | 2714 |
| 676 | Ga0495618_0009027 | 3300046514 | Bacteria | 6016 |
| 677 | Ga0495618_0048439 | 3300046514 | Bacteria | 2682 |
| 678 | Ga0495618_0108212 | 3300046514 | Bacteria | 1780 |
| 679 | Ga0495618_0189461 | 3300046514 | Bacteria | 1305 |
| 680 | Ga0495618_0205030 | 3300046514 | Bacteria | 1247 |
| 681 | Ga0495628_0000090 | 3300046516 | Bacteria | 72021 |
| 682 | Ga0495628_0030180 | 3300046516 | Bacteria | 4391 |
| 683 | Ga0495628_0035342 | 3300046516 | Bacteria | 4016 |
| 684 | Ga0495628_0070797 | 3300046516 | Bacteria | 2719 |
| 685 | Ga0495628_0117420 | 3300046516 | Bacteria | 2043 |
| 686 | Ga0495628_0150233 | 3300046516 | Bacteria | 1775 |
| 687 | Ga0495652_0002601 | 3300046529 | Bacteria | 18455 |
| 688 | Ga0495652_0003220 | 3300046529 | Bacteria | 16287 |
| 689 | Ga0495652_0021522 | 3300046529 | Bacteria | 5730 |
| 690 | Ga0495665_0030134 | 3300046531 | Bacteria | 2903 |
| 691 | Ga0495665_0032144 | 3300046531 | Bacteria | 2806 |
| 692 | Ga0495665_0065270 | 3300046531 | Bacteria | 1921 |
| 693 | Ga0495640_0084968 | 3300046533 | Bacteria | 2097 |
| 694 | Ga0495586_0011220 | 3300046535 | Bacteria | 4763 |
| 695 | Ga0495586_0055188 | 3300046535 | Bacteria | 2153 |
| 696 | Ga0495587_0009014 | 3300046536 | Bacteria | 6405 |
| 697 | Ga0495621_0004858 | 3300046539 | Bacteria | 3814 |
| 698 | Ga0495645_0035777 | 3300046543 | Bacteria | 3620 |
| 699 | Ga0495645_0063469 | 3300046543 | Bacteria | 2674 |
| 700 | Ga0495645_0103356 | 3300046543 | Bacteria | 2024 |
| 701 | Ga0495645_0124457 | 3300046543 | Bacteria | 1812 |
| 702 | Ga0495645_0130724 | 3300046543 | Bacteria | 1759 |
| 703 | Ga0495645_0295954 | 3300046543 | Bacteria | 1059 |
| 704 | Ga0495622_0053168 | 3300046557 | Bacteria | 1879 |
| 705 | Ga0495667_0010099 | 3300046559 | Bacteria | 6390 |
| 706 | Ga0495634_0073989 | 3300046642 | Bacteria | 2239 |
| 707 | Ga0495634_0079085 | 3300046642 | Bacteria | 2154 |
| 708 | Ga0495635_0029788 | 3300046663 | Bacteria | 3796 |
| 709 | Ga0495635_0064719 | 3300046663 | Bacteria | 2510 |
| 710 | Ga0495635_0075749 | 3300046663 | Bacteria | 2305 |
| 711 | Ga0495659_0016146 | 3300046664 | Bacteria | 2461 |
| 712 | Ga0495657_0019468 | 3300046675 | Bacteria | 4895 |
| 713 | Ga0495657_0023265 | 3300046675 | Bacteria | 4429 |
| 714 | Ga0495657_0242903 | 3300046675 | Bacteria | 1086 |
| 715 | Ga0495599_0000496 | 3300046678 | Bacteria | 22471 |
| 716 | Ga0495599_0351276 | 3300046678 | Bacteria | 884 |
| 717 | Ga0495623_0004072 | 3300046679 | Bacteria | 9626 |
| 718 | Ga0495623_0030996 | 3300046679 | Bacteria | 3440 |
| 719 | Ga0495623_0053941 | 3300046679 | Bacteria | 2537 |
| 720 | Ga0495623_0150444 | 3300046679 | Bacteria | 1376 |
| 721 | Ga0495646_0001309 | 3300046680 | Bacteria | 14702 |
| 722 | Ga0495646_0009343 | 3300046680 | Bacteria | 6220 |
| 723 | Ga0495646_0119167 | 3300046680 | Bacteria | 1495 |
| 724 | Ga0495658_0057033 | 3300046683 | Bacteria | 2229 |
| 725 | Ga0495669_0060994 | 3300046684 | Bacteria | 1706 |
| 726 | Ga0495613_0167729 | 3300046689 | Bacteria | 1559 |
| 727 | Ga0495624_0011309 | 3300046690 | Bacteria | 6135 |
| 728 | Ga0495624_0035737 | 3300046690 | Bacteria | 3207 |
| 729 | Ga0495624_0139689 | 3300046690 | Bacteria | 1484 |
| 730 | Ga0495600_0011970 | 3300046809 | Bacteria | 5416 |
| 731 | Ga0495581_0011767 | 3300047315 | Bacteria | 5066 |
| 732 | Ga0495581_0011844 | 3300047315 | Bacteria | 5048 |
| 733 | Ga0495604_0002827 | 3300047317 | Bacteria | 13931 |
| 734 | Ga0495604_0224497 | 3300047317 | Bacteria | 1291 |
| 735 | Ga0495674_0014375 | 3300047319 | Bacteria | 7411 |
| 736 | Ga0495674_0051235 | 3300047319 | Bacteria | 3639 |
| 737 | Ga0495672_0079370 | 3300047320 | Bacteria | 1833 |
| 738 | Ga0495672_0083228 | 3300047320 | Bacteria | 1778 |
| 739 | Ga0495680_0014109 | 3300047322 | Bacteria | 6940 |
| 740 | Ga0495680_0015607 | 3300047322 | Bacteria | 6549 |
| 741 | Ga0495675_0019663 | 3300047444 | Bacteria | 4290 |
| 742 | Ga0495684_0151341 | 3300047471 | Bacteria | 1734 |
| 743 | Ga0495686_0085768 | 3300047472 | Bacteria | 1917 |
| 744 | Ga0495593_0033842 | 3300047673 | Bacteria | 2781 |
| 745 | Ga0495602_0019973 | 3300048088 | Bacteria | 6632 |
| 746 | Ga0495602_0048859 | 3300048088 | Bacteria | 3796 |
| 747 | Ga0495602_0049900 | 3300048088 | Bacteria | 3743 |
| 748 | Ga0495602_0068927 | 3300048088 | Bacteria | 3035 |
| 749 | Ga0496100_0133891 | 3300048903 | Bacteria | 1749 |
| 750 | Ga0496102_0115515 | 3300048905 | Bacteria | 2504 |
| 751 | Ga0496104_0013601 | 3300048907 | Bacteria | 7336 |
| 752 | Ga0496104_0042946 | 3300048907 | Bacteria | 4245 |
| 753 | Ga0496105_0004617 | 3300048908 | Bacteria | 10382 |
| 754 | Ga0496105_0074969 | 3300048908 | Bacteria | 2795 |
| 755 | Ga0496106_0050563 | 3300048909 | Bacteria | 3132 |
| 756 | Ga0496107_0075321 | 3300048910 | Bacteria | 2456 |
| 757 | Ga0496108_0078034 | 3300048911 | Bacteria | 2802 |
| 758 | Ga0496108_0681768 | 3300048911 | Bacteria | 892 |
| 759 | Ga0496109_0095159 | 3300048912 | Bacteria | 2757 |
| 760 | Ga0496109_0848297 | 3300048912 | Bacteria | 851 |
| 761 | Ga0496110_0010759 | 3300048913 | Bacteria | 7455 |
| 762 | Ga0496110_0657132 | 3300048913 | Bacteria | 948 |
| 763 | Ga0496112_0001245 | 3300048915 | Bacteria | 19249 |
| 764 | Ga0496112_0489792 | 3300048915 | Bacteria | 1165 |
| 765 | Ga0496113_0111577 | 3300048916 | Bacteria | 2129 |
| 766 | Ga0496114_0068684 | 3300048917 | Bacteria | 2975 |
| 767 | Ga0496114_0379189 | 3300048917 | Bacteria | 1252 |
| 768 | Ga0496115_0000630 | 3300048918 | Bacteria | 26611 |
| 769 | Ga0496115_0015178 | 3300048918 | Bacteria | 5838 |
| 770 | Ga0496117_0114618 | 3300048920 | Bacteria | 1670 |
| 771 | Ga0496122_0039999 | 3300048925 | Bacteria | 3733 |
| 772 | Ga0496123_0042289 | 3300048926 | Bacteria | 3147 |
| 773 | Ga0501031_0049733 | 3300049568 | Bacteria | 2732 |
| 774 | Ga0501031_0352428 | 3300049568 | Bacteria | 953 |
| 775 | Ga0501032_0020705 | 3300049569 | Bacteria | 4579 |
| 776 | Ga0501033_0405735 | 3300049570 | Bacteria | 950 |
| 777 | Ga0501034_0019507 | 3300049571 | Bacteria | 6935 |
| 778 | Ga0501034_0224094 | 3300049571 | Bacteria | 1832 |
| 779 | Ga0501034_0231310 | 3300049571 | Bacteria | 1797 |
| 780 | Ga0501034_0718361 | 3300049571 | Bacteria | 896 |
| 781 | Ga0501036_0103928 | 3300049572 | Bacteria | 2402 |
| 782 | Ga0501037_0030539 | 3300049573 | Bacteria | 3982 |
| 783 | Ga0501037_0120645 | 3300049573 | Bacteria | 1885 |
| 784 | Ga0501038_0168868 | 3300049574 | Bacteria | 1772 |
| 785 | Ga0501039_0270743 | 3300049575 | Bacteria | 1335 |
| 786 | Ga0501041_0208249 | 3300049577 | Bacteria | 1226 |
| 787 | Ga0501042_0210893 | 3300049578 | Bacteria | 1401 |
| 788 | Ga0501043_0001676 | 3300049579 | Bacteria | 19238 |
| 789 | Ga0501043_0058736 | 3300049579 | Bacteria | 3019 |
| 790 | Ga0501043_0062247 | 3300049579 | Bacteria | 2930 |
| 791 | Ga0501046_0034630 | 3300049580 | Bacteria | 4073 |
| 792 | Ga0501046_0240098 | 3300049580 | Bacteria | 1336 |
| 793 | Ga0501046_0427691 | 3300049580 | Bacteria | 954 |
| 794 | Ga0501047_0001868 | 3300049581 | Bacteria | 20268 |
| 795 | Ga0501047_0146969 | 3300049581 | Bacteria | 2233 |
| 796 | Ga0501047_0368511 | 3300049581 | Bacteria | 1271 |
| 797 | Ga0501048_0035790 | 3300049582 | Bacteria | 3571 |
| 798 | Ga0501067_0097813 | 3300049583 | Bacteria | 1630 |
| 799 | Ga0501067_0226281 | 3300049583 | Bacteria | 1041 |
| 800 | Ga0501068_0075864 | 3300049584 | Bacteria | 2057 |
| 801 | Ga0501070_0379239 | 3300049586 | Bacteria | 1145 |
| 802 | Ga0501070_0497801 | 3300049586 | Bacteria | 979 |
| 803 | Ga0501070_0514094 | 3300049586 | Bacteria | 961 |
| 804 | Ga0501071_0222130 | 3300049587 | Bacteria | 1422 |
| 805 | Ga0501072_0027941 | 3300049588 | Bacteria | 4403 |
| 806 | Ga0501072_0148510 | 3300049588 | Bacteria | 1869 |
| 807 | Ga0501072_0242548 | 3300049588 | Bacteria | 1435 |
| 808 | Ga0501073_0065565 | 3300049589 | Bacteria | 2532 |
| 809 | Ga0501073_0104289 | 3300049589 | Bacteria | 1968 |
| 810 | Ga0501073_0192774 | 3300049589 | Bacteria | 1410 |
| 811 | Ga0501073_0234123 | 3300049589 | Bacteria | 1268 |
| 812 | Ga0501073_0337961 | 3300049589 | Bacteria | 1039 |
| 813 | Ga0501073_0436980 | 3300049589 | Bacteria | 904 |
| 814 | Ga0501074_0120310 | 3300049590 | Bacteria | 1878 |
| 815 | Ga0501074_0180223 | 3300049590 | Bacteria | 1507 |
| 816 | Ga0501075_0031959 | 3300049591 | Bacteria | 3910 |
| 817 | Ga0501075_0485288 | 3300049591 | Bacteria | 943 |
| 818 | Ga0501076_0028913 | 3300049592 | Bacteria | 4308 |
| 819 | Ga0501076_0070713 | 3300049592 | Bacteria | 2791 |
| 820 | Ga0501077_0006863 | 3300049593 | Bacteria | 7007 |
| 821 | Ga0501077_0076023 | 3300049593 | Bacteria | 2127 |
| 822 | Ga0501077_0108492 | 3300049593 | Bacteria | 1759 |
| 823 | Ga0501077_0149142 | 3300049593 | Bacteria | 1484 |
| 824 | Ga0501079_0020531 | 3300049741 | Bacteria | 5051 |
| 825 | Ga0501079_0027340 | 3300049741 | Bacteria | 4373 |
| 826 | Ga0501079_0066842 | 3300049741 | Bacteria | 2774 |
| 827 | Ga0501080_0125999 | 3300049742 | Bacteria | 2372 |
| 828 | Ga0501080_0170748 | 3300049742 | Bacteria | 2006 |
| 829 | Ga0501080_0253514 | 3300049742 | Bacteria | 1604 |
| 830 | Ga0501080_0390132 | 3300049742 | Bacteria | 1253 |
| 831 | Ga0501081_0057815 | 3300049743 | Bacteria | 2682 |
| 832 | Ga0501083_0040893 | 3300049744 | Bacteria | 3146 |
| 833 | Ga0501083_0045180 | 3300049744 | Bacteria | 2980 |
| 834 | Ga0501083_0086763 | 3300049744 | Bacteria | 2069 |
| 835 | Ga0501083_0104083 | 3300049744 | Bacteria | 1870 |
| 836 | Ga0501035_0112884 | 3300049822 | Bacteria | 2380 |
| 837 | Ga0501035_0390578 | 3300049822 | Bacteria | 1159 |
| 838 | Ga0501035_0424792 | 3300049822 | Bacteria | 1103 |
| 839 | Ga0501044_0077920 | 3300049823 | Bacteria | 3360 |
| 840 | Ga0501044_0079013 | 3300049823 | Bacteria | 3334 |
| 841 | Ga0501044_0278327 | 3300049823 | Bacteria | 1607 |
| 842 | Ga0501044_0314637 | 3300049823 | Bacteria | 1491 |
| 843 | Ga0501044_0364071 | 3300049823 | Bacteria | 1363 |
| 844 | Ga0501045_0039020 | 3300049824 | Bacteria | 3456 |
| 845 | Ga0501045_0041276 | 3300049824 | Bacteria | 3358 |
| 846 | nmdc:mga05p37_134619_c1 | 3300050507 | Bacteria | 3032 |
| 847 | nmdc:mga05p37_154862_c1 | 3300050507 | Bacteria | 2801 |
| 848 | nmdc:mga05p37_303662_c1 | 3300050507 | Bacteria | 1895 |
| 849 | nmdc:mga05p37_48143_c1 | 3300050507 | Bacteria | 4637 |
| 850 | nmdc:mga05p37_52382_c1 | 3300050507 | Bacteria | 5019 |
| 851 | nmdc:mga05p37_8269_c1 | 3300050507 | Bacteria | 12302 |
| 852 | nmdc:mga09592_298997_c1 | 3300050508 | Bacteria | 1395 |
| 853 | nmdc:mga0qj67_13011_c1 | 3300050509 | Bacteria | 6280 |
| 854 | nmdc:mga0qj67_144511_c1 | 3300050509 | Bacteria | 1929 |
| 855 | nmdc:mga06r32_425390_c1 | 3300050510 | Bacteria | 1309 |
| 856 | nmdc:mga06r32_42915_c1 | 3300050510 | Bacteria | 4302 |
| 857 | nmdc:mga06r32_57340_c1 | 3300050510 | Bacteria | 3741 |
| 858 | nmdc:mga06r32_633764_c1 | 3300050510 | Bacteria | 1038 |
| 859 | nmdc:mga06r32_91312_c1 | 3300050510 | Bacteria | 2976 |
| 860 | nmdc:mga08y16_140745_c1 | 3300050511 | Bacteria | 2508 |
| 861 | nmdc:mga08y16_336825_c1 | 3300050511 | Bacteria | 1551 |
| 862 | nmdc:mga08y16_355696_c1 | 3300050511 | Bacteria | 1504 |
| 863 | nmdc:mga0rr50_58322_c1 | 3300050513 | Bacteria | 2893 |
| 864 | nmdc:mga08x19_133448_c1 | 3300050514 | Bacteria | 1672 |
| 865 | nmdc:mga08x19_7131_c1 | 3300050514 | Bacteria | 6637 |
| 866 | nmdc:mga0a205_358850_c1 | 3300050515 | Bacteria | 1324 |
| 867 | nmdc:mga0a205_364851_c1 | 3300050515 | Bacteria | 1311 |
| 868 | Ga0495601_0017241 | 3300053077 | Bacteria | 4383 |
| 869 | Ga0495601_0032228 | 3300053077 | Bacteria | 3261 |
| 870 | Ga0495601_0042524 | 3300053077 | Bacteria | 2851 |
| 871 | Ga0495612_0001520 | 3300053078 | Bacteria | 9545 |
| 872 | Ga0495612_0002459 | 3300053078 | Bacteria | 7633 |
| 873 | Ga0495595_0033396 | 3300053084 | Bacteria | 2322 |
| 874 | Ga0495595_0104703 | 3300053084 | Bacteria | 1368 |
| 875 | Ga0495619_0019064 | 3300053085 | Bacteria | 4358 |
| 876 | Ga0495619_0281858 | 3300053085 | Bacteria | 1152 |
| 877 | Ga0500578_0014436 | 3300053086 | Bacteria | 5079 |
| 878 | Ga0500646_0004041 | 3300053090 | Bacteria | 3727 |
| 879 | Ga0500651_0056328 | 3300053093 | Bacteria | 2461 |
| 880 | Ga0500555_010442 | 3300053103 | Bacteria | 2662 |
| 881 | Ga0500595_002824 | 3300053119 | Bacteria | 8356 |
| 882 | Ga0500595_003384 | 3300053119 | Bacteria | 7470 |
| 883 | Ga0500595_059687 | 3300053119 | Bacteria | 1156 |
| 884 | Ga0500642_0000239 | 3300053130 | Bacteria | 21277 |
| 885 | Ga0500568_0005103 | 3300053139 | Bacteria | 6864 |
| 886 | Ga0500574_000707 | 3300053141 | Bacteria | 4412 |
| 887 | Ga0500577_0074170 | 3300053142 | Bacteria | 1341 |
| 888 | Ga0500588_0012469 | 3300053146 | Bacteria | 2109 |
| 889 | Ga0500604_0038187 | 3300053151 | Bacteria | 1439 |
| 890 | Ga0500616_0001024 | 3300053153 | Bacteria | 29671 |
| 891 | Ga0500609_000560 | 3300053731 | Bacteria | 5617 |
| 892 | Ga0501084_0009016 | 3300054114 | Bacteria | 8253 |
| 893 | Ga0501084_0028282 | 3300054114 | Bacteria | 4685 |
| 894 | Ga0501084_0446467 | 3300054114 | Bacteria | 1093 |
| 895 | Ga0501084_0483454 | 3300054114 | Bacteria | 1047 |
| 896 | Ga0501082_0087133 | 3300060353 | Bacteria | 2694 |
| 897 | Ga0501082_0238915 | 3300060353 | Bacteria | 1581 |
| 898 | Ga0501082_0389256 | 3300060353 | Bacteria | 1216 |
| 899 | Ga0530510_0083020 | 3300061734 | Bacteria | 2333 |
| 900 | 2558906073 | 2558860112 | Bacteria | 9931328 |
| 901 | 2586063388 | 2585427649 | Bacteria | 9053857 |
| 902 | 2819541363 | 2818991436 | Bacteria | 5376622 |
| 903 | 2866553942 | 2866552031 | Bacteria | 5824618 |
| 904 | 8047899445 | 8047893842 | Bacteria | 11723082 |
| 905 | 8048359485 | 8048356638 | Bacteria | 11044339 |
| 906 | 8048376393 | 8048369669 | Bacteria | 11666822 |
| 907 | 8048385448 | 8048379754 | Bacteria | 11877923 |
| 908 | 8054566327 | 8054563764 | Bacteria | 5592885 |
| 909 | Ga0105248_10254688 | |||
| 910 | JGI25162J39368_1000677 | |||
| 911 | JGI25165J46597_1000279 | |||
| 912 | JGI25153J46596_10000049 | |||
| 913 | Ga0055538_1000107 | |||
| 914 | Ga0055539_1000156 | |||
| 915 | Ga0055533_1000157 | |||
| 916 | Ga0055525_1000210 | |||
| 917 | Ga0055541_1000103 | |||
| 918 | Ga0070658_10177940 | |||
| 919 | Ga0070658_10255410 | |||
| 920 | Ga0070676_10075811 | |||
| 921 | Ga0070683_100459504 | |||
| 922 | Ga0070683_100472380 | |||
| 923 | Ga0070690_100008036 | |||
| 924 | Ga0070690_100105317 | |||
| 925 | Ga0070670_100002419 | |||
| 926 | Ga0070670_100011166 | |||
| 927 | Ga0070670_100067519 | |||
| 928 | Ga0070670_100191672 | |||
| 929 | Ga0070670_100211844 | |||
| 930 | Ga0070677_10063535 | |||
| 931 | Ga0068869_100005562 | |||
| 932 | Ga0068869_100049340 | |||
| 933 | Ga0068869_100058468 | |||
| 934 | Ga0068869_100067101 | |||
| 935 | Ga0068869_100175887 | |||
| 936 | Ga0070666_10008875 | |||
| 937 | Ga0070666_10031098 | |||
| 938 | Ga0070680_100007729 | |||
| 939 | Ga0070680_100102787 | |||
| 940 | Ga0070680_100106543 | |||
| 941 | Ga0070682_100056675 | |||
| 942 | Ga0070682_100120994 | |||
| 943 | Ga0068868_100001910 | |||
| 944 | Ga0070660_100015113 | |||
| 945 | Ga0070660_100022206 | |||
| 946 | Ga0070660_100044579 | |||
| 947 | Ga0070660_100071029 | |||
| 948 | Ga0070660_100188933 | |||
| 949 | Ga0070660_100252183 | |||
| 950 | Ga0070689_100018449 | |||
| 951 | Ga0070689_100027860 | |||
| 952 | Ga0070689_100225616 | |||
| 953 | Ga0070691_10093133 | |||
| 954 | Ga0070661_100005984 | |||
| 955 | Ga0070692_10029816 | |||
| 956 | Ga0070668_100007508 | |||
| 957 | Ga0070668_100013975 | |||
| 958 | Ga0070668_100064104 | |||
| 959 | Ga0070669_100037586 | |||
| 960 | Ga0070669_100090969 | |||
| 961 | Ga0070675_100003484 | |||
| 962 | Ga0070675_100004908 | |||
| 963 | Ga0070675_100062020 | |||
| 964 | Ga0070671_100010727 | |||
| 965 | Ga0070671_100079399 | |||
| 966 | Ga0070671_100082786 | |||
| 967 | Ga0070671_100084866 | |||
| 968 | Ga0070674_100058884 | |||
| 969 | Ga0070673_100002794 | |||
| 970 | Ga0070673_100004318 | |||
| 971 | Ga0070673_100058588 | |||
| 972 | Ga0070673_100090418 | |||
| 973 | Ga0070688_100010654 | |||
| 974 | Ga0070688_100052211 | |||
| 975 | Ga0070659_100000521 | |||
| 976 | Ga0070659_100000918 | |||
| 977 | Ga0070659_100142242 | |||
| 978 | Ga0070667_100030504 | |||
| 979 | Ga0070667_100034074 | |||
| 980 | Ga0070667_100067831 | |||
| 981 | Ga0070667_100073829 | |||
| 982 | Ga0070667_100101027 | |||
| 983 | Ga0070709_10006162 | |||
| 984 | Ga0070709_10036148 | |||
| 985 | Ga0070714_100008197 | |||
| 986 | Ga0070714_100011039 | |||
| 987 | Ga0070714_100026716 | |||
| 988 | Ga0070714_100030876 | |||
| 989 | Ga0070714_100056991 | |||
| 990 | Ga0070714_100137774 | |||
| 991 | Ga0070713_100014794 | |||
| 992 | Ga0070713_100019908 | |||
| 993 | Ga0070713_100082505 | |||
| 994 | Ga0070713_100197847 | |||
| 995 | Ga0070713_100201314 | |||
| 996 | Ga0070713_100269329 | |||
| 997 | Ga0070710_10010155 | |||
| 998 | Ga0070710_10021330 | |||
| 999 | Ga0070710_10161679 | |||
| 1000 | Ga0070711_100007691 | |||
| 1001 | Ga0070711_100026517 | |||
| 1002 | Ga0070705_100087474 | |||
| 1003 | Ga0070705_100130056 | |||
| 1004 | Ga0070705_100177226 | |||
| 1005 | Ga0070700_100270656 | |||
| 1006 | Ga0070694_100019288 | |||
| 1007 | Ga0070708_100048502 | |||
| 1008 | Ga0070663_100006780 | |||
| 1009 | Ga0070663_100072886 | |||
| 1010 | Ga0070663_100309799 | |||
| 1011 | Ga0070678_100072385 | |||
| 1012 | Ga0070678_100135265 | |||
| 1013 | Ga0070678_100157257 | |||
| 1014 | Ga0070662_100046188 | |||
| 1015 | Ga0070662_100120038 | |||
| 1016 | Ga0070681_10022240 | |||
| 1017 | Ga0070681_10037937 | |||
| 1018 | Ga0070681_10155525 | |||
| 1019 | Ga0068867_100042904 | |||
| 1020 | Ga0070685_10016642 | |||
| 1021 | Ga0070685_10088569 | |||
| 1022 | Ga0070685_10099244 | |||
| 1023 | Ga0070685_10444864 | |||
| 1024 | Ga0070706_100018927 | |||
| 1025 | Ga0070706_100080508 | |||
| 1026 | Ga0070706_100623569 | |||
| 1027 | Ga0070707_100011054 | |||
| 1028 | Ga0070698_100001751 | |||
| 1029 | Ga0070698_100200359 | |||
| 1030 | Ga0070698_100359090 | |||
| 1031 | Ga0070698_100518701 | |||
| 1032 | Ga0070699_100056330 | |||
| 1033 | Ga0070699_100156264 | |||
| 1034 | Ga0070699_100748796 | |||
| 1035 | Ga0070679_100043058 | |||
| 1036 | Ga0070679_100105346 | |||
| 1037 | Ga0070679_100478765 | |||
| 1038 | Ga0070684_100005198 | |||
| 1039 | Ga0070684_100092893 | |||
| 1040 | Ga0070684_100359470 | |||
| 1041 | Ga0070684_100427788 | |||
| 1042 | Ga0070697_100001259 | |||
| 1043 | Ga0070697_100195077 | |||
| 1044 | Ga0068853_100001224 | |||
| 1045 | Ga0068853_100202723 | |||
| 1046 | Ga0068853_100290221 | |||
| 1047 | Ga0070672_100002370 | |||
| 1048 | Ga0070672_100035278 | |||
| 1049 | Ga0070672_100094974 | |||
| 1050 | Ga0070695_100041604 | |||
| 1051 | Ga0070695_100512325 | |||
| 1052 | Ga0070696_100022591 | |||
| 1053 | Ga0070696_100186877 | |||
| 1054 | Ga0070693_100003501 | |||
| 1055 | Ga0070693_100007123 | |||
| 1056 | Ga0070693_100060288 | |||
| 1057 | Ga0070665_100000290 | |||
| 1058 | Ga0070665_100164829 | |||
| 1059 | Ga0070665_100240450 | |||
| 1060 | Ga0070665_100244752 | |||
| 1061 | Ga0070704_100202390 | |||
| 1062 | Ga0070704_100224600 | |||
| 1063 | Ga0068855_100006531 | |||
| 1064 | Ga0068855_100018773 | |||
| 1065 | Ga0068855_100170940 | |||
| 1066 | Ga0068855_100202443 | |||
| 1067 | Ga0070664_100004429 | |||
| 1068 | Ga0070664_100308171 | |||
| 1069 | Ga0068857_100091109 | |||
| 1070 | Ga0068857_100171808 | |||
| 1071 | Ga0068857_100372454 | |||
| 1072 | Ga0068854_100011366 | |||
| 1073 | Ga0068854_100037729 | |||
| 1074 | Ga0068854_100253963 | |||
| 1075 | Ga0068856_100000936 | |||
| 1076 | Ga0068856_100106498 | |||
| 1077 | Ga0068856_100106960 | |||
| 1078 | Ga0068856_100129343 | |||
| 1079 | Ga0068856_100214013 | |||
| 1080 | Ga0070702_100002951 | |||
| 1081 | Ga0070702_100011425 | |||
| 1082 | Ga0070702_100041427 | |||
| 1083 | Ga0070702_100122473 | |||
| 1084 | Ga0068852_100028228 | |||
| 1085 | Ga0068852_100045456 | |||
| 1086 | Ga0068852_100112310 | |||
| 1087 | Ga0068852_100128229 | |||
| 1088 | Ga0068852_100186122 | |||
| 1089 | Ga0068852_100418407 | |||
| 1090 | Ga0068852_100437244 | |||
| 1091 | Ga0068859_100002129 | |||
| 1092 | Ga0068859_100267159 | |||
| 1093 | Ga0068859_100726996 | |||
| 1094 | Ga0068864_100000793 | |||
| 1095 | Ga0068864_100010430 | |||
| 1096 | Ga0068864_100040189 | |||
| 1097 | Ga0068864_100041441 | |||
| 1098 | Ga0068864_100049918 | |||
| 1099 | Ga0068864_100147587 | |||
| 1100 | Ga0068864_100229991 | |||
| 1101 | Ga0068866_10000648 | |||
| 1102 | Ga0068866_10007669 | |||
| 1103 | Ga0068866_10077193 | |||
| 1104 | Ga0068866_10088871 | |||
| 1105 | Ga0068861_100060896 | |||
| 1106 | Ga0068861_100087193 | |||
| 1107 | Ga0068861_100158832 | |||
| 1108 | Ga0068851_10092005 | |||
| 1109 | Ga0068851_10095896 | |||
| 1110 | Ga0068870_10004071 | |||
| 1111 | Ga0068870_10038362 | |||
| 1112 | Ga0068870_10109485 | |||
| 1113 | Ga0068863_100009664 | |||
| 1114 | Ga0068863_100023553 | |||
| 1115 | Ga0068863_100024304 | |||
| 1116 | Ga0068863_100061508 | |||
| 1117 | Ga0068863_100069934 | |||
| 1118 | Ga0068863_100082283 | |||
| 1119 | Ga0068863_100088533 | |||
| 1120 | Ga0068863_100358807 | |||
| 1121 | Ga0068863_100590539 | |||
| 1122 | Ga0068858_100035770 | |||
| 1123 | Ga0068858_100292577 | |||
| 1124 | Ga0068860_100011333 | |||
| 1125 | Ga0068860_100022797 | |||
| 1126 | Ga0068860_100080512 | |||
| 1127 | Ga0068862_100023073 | |||
| 1128 | Ga0068862_100186624 | |||
| 1129 | Ga0068862_100826221 | |||
| 1130 | Ga0081538_10011028 | |||
| 1131 | Ga0081538_10109875 | |||
| 1132 | Ga0081539_10090817 | |||
| 1133 | Ga0070717_10015403 | |||
| 1134 | Ga0070717_10022019 | |||
| 1135 | Ga0070717_10065019 | |||
| 1136 | Ga0070717_10065808 | |||
| 1137 | Ga0070717_10129563 | |||
| 1138 | Ga0070717_10329888 | |||
| 1139 | Ga0070716_100015979 | |||
| 1140 | Ga0070716_100356247 | |||
| 1141 | Ga0070712_100023796 | |||
| 1142 | Ga0070712_100025129 | |||
| 1143 | Ga0070712_100037153 | |||
| 1144 | Ga0070712_100054851 | |||
| 1145 | Ga0070712_100152112 | |||
| 1146 | Ga0097621_100027514 | |||
| 1147 | Ga0097621_100046036 | |||
| 1148 | Ga0097621_100222436 | |||
| 1149 | Ga0097621_100379874 | |||
| 1150 | Ga0097621_100410948 | |||
| 1151 | Ga0068871_100023795 | |||
| 1152 | Ga0068871_100044208 | |||
| 1153 | Ga0068871_100059015 | |||
| 1154 | Ga0068871_100060034 | |||
| 1155 | Ga0068871_100079734 | |||
| 1156 | Ga0068871_100245852 | |||
| 1157 | Ga0075428_100246242 | |||
| 1158 | Ga0075428_100368365 | |||
| 1159 | Ga0075430_100027317 | |||
| 1160 | Ga0075431_100062269 | |||
| 1161 | Ga0075431_100089470 | |||
| 1162 | Ga0075433_10043588 | |||
| 1163 | Ga0075434_100042650 | |||
| 1164 | Ga0075429_100667506 | |||
| 1165 | Ga0068865_100134894 | |||
| 1166 | Ga0068865_100204543 | |||
| 1167 | Ga0075436_100121509 | |||
| 1168 | Ga0097620_100002129 | |||
| 1169 | Ga0097620_100267136 | |||
| 1170 | Ga0097620_100727009 | |||
| 1171 | Ga0075435_100109361 | |||
| 1172 | Ga0099794_10081185 | |||
| 1173 | Ga0099794_10145397 | |||
| 1174 | Ga0105240_10007389 | |||
| 1175 | Ga0105240_10039790 | |||
| 1176 | Ga0105240_10082256 | |||
| 1177 | Ga0105240_10153453 | |||
| 1178 | Ga0111539_10059711 | |||
| 1179 | Ga0111539_10214581 | |||
| 1180 | Ga0105245_10001578 | |||
| 1181 | Ga0105245_10016018 | |||
| 1182 | Ga0105245_10048069 | |||
| 1183 | Ga0105247_10028121 | |||
| 1184 | Ga0105247_10116692 | |||
| 1185 | Ga0114129_10001780 | |||
| 1186 | Ga0114129_10004894 | |||
| 1187 | Ga0114129_10060825 | |||
| 1188 | Ga0105243_10032143 | |||
| 1189 | Ga0105243_10163522 | |||
| 1190 | Ga0105243_10185727 | |||
| 1191 | Ga0105243_10194537 | |||
| 1192 | Ga0105243_10213838 | |||
| 1193 | Ga0105241_10002518 | |||
| 1194 | Ga0105241_10005464 | |||
| 1195 | Ga0105241_10012839 | |||
| 1196 | Ga0105242_10004571 | |||
| 1197 | Ga0105242_10119196 | |||
| 1198 | Ga0105248_10356815 | |||
| 1199 | Ga0105248_10419031 | |||
| 1200 | Ga0105237_10003409 | |||
| 1201 | Ga0105237_10058609 | |||
| 1202 | Ga0105237_10230252 | |||
| 1203 | Ga0105237_10289715 | |||
| 1204 | Ga0105238_10003255 | |||
| 1205 | Ga0105238_10004602 | |||
| 1206 | Ga0105238_10011128 | |||
| 1207 | Ga0105238_10019606 | |||
| 1208 | Ga0105238_10107715 | |||
| 1209 | Ga0105238_10205288 | |||
| 1210 | Ga0105249_10012144 | |||
| 1211 | Ga0105249_10034861 | |||
| 1212 | Ga0105239_10181267 | |||
| 1213 | Ga0105239_10200517 | |||
| 1214 | Ga0105239_10306831 | |||
| 1215 | Ga0105246_10246698 | |||
| 1216 | Ga0105246_10607435 | |||
| 1217 | Ga0157373_10006161 | |||
| 1218 | Ga0157373_10029137 | |||
| 1219 | Ga0157371_10186823 | |||
| 1220 | Ga0157371_10320643 | |||
| 1221 | Ga0157370_10015691 | |||
| 1222 | Ga0157370_10018515 | |||
| 1223 | Ga0157370_10113806 | |||
| 1224 | Ga0157369_10001622 | |||
| 1225 | Ga0157369_10550806 | |||
| 1226 | Ga0157374_10000781 | |||
| 1227 | Ga0157374_10255298 | |||
| 1228 | Ga0157378_10013116 | |||
| 1229 | Ga0157378_10035751 | |||
| 1230 | Ga0157378_10178174 | |||
| 1231 | Ga0163162_10001760 | |||
| 1232 | Ga0163162_10003592 | |||
| 1233 | Ga0163162_10078134 | |||
| 1234 | Ga0163162_10242165 | |||
| 1235 | Ga0163162_10950599 | |||
| 1236 | Ga0157372_10062862 | |||
| 1237 | Ga0157372_10076101 | |||
| 1238 | Ga0157372_10262490 | |||
| 1239 | Ga0157375_10056860 | |||
| 1240 | Ga0157375_10089343 | |||
| 1241 | Ga0157375_10145786 | |||
| 1242 | Ga0157375_10361020 | |||
| 1243 | Ga0157375_10433587 | |||
| 1244 | Ga0157375_10547009 | |||
| 1245 | Ga0157375_10683929 | |||
| 1246 | Ga0163163_10005175 | |||
| 1247 | Ga0163163_10033734 | |||
| 1248 | Ga0163163_10515677 | |||
| 1249 | Ga0163163_10670552 | |||
| 1250 | Ga0163163_10737915 | |||
| 1251 | Ga0157380_10179340 | |||
| 1252 | Ga0182008_10141994 | |||
| 1253 | Ga0157377_10020766 | |||
| 1254 | Ga0157377_10272155 | |||
| 1255 | Ga0157379_10029742 | |||
| 1256 | Ga0157376_10020699 | |||
| 1257 | Ga0157376_10134249 | |||
| 1258 | Ga0157376_10144912 | |||
| 1259 | Ga0157376_10292964 | |||
| 1260 | Ga0182007_10003381 | |||
| 1261 | Ga0182007_10008462 | |||
| 1262 | Ga0182005_1000300 | |||
| 1263 | Ga0163161_10032838 | |||
| 1264 | Ga0163161_10354899 | |||
| 1265 | Ga0206356_10237460 | |||
| 1266 | Ga0206353_11660178 | |||
| 1267 | Ga0213876_10133841 | |||
| 1268 | Ga0213876_10233164 | |||
| 1269 | Ga0213875_10009902 | |||
| 1270 | Ga0213875_10020568 | |||
| 1271 | Ga0213875_10077647 | |||
| 1272 | Ga0209784_100019 | |||
| 1273 | Ga0209566_100017 | |||
| 1274 | Ga0209674_100031 | |||
| 1275 | Ga0209563_100035 | |||
| 1276 | Ga0207427_100311 | |||
| 1277 | Ga0209437_100038 | |||
| 1278 | Ga0209677_100020 | |||
| 1279 | Ga0209233_1000049 | |||
| 1280 | Ga0209758_1000029 | |||
| 1281 | Ga0209050_1004071 | |||
| 1282 | Ga0209257_1000634 | |||
| 1283 | Ga0207656_10018970 | |||
| 1284 | Ga0207682_10084799 | |||
| 1285 | Ga0207692_10003106 | |||
| 1286 | Ga0207642_10033257 | |||
| 1287 | Ga0207642_10193729 | |||
| 1288 | Ga0207710_10140898 | |||
| 1289 | Ga0207688_10010543 | |||
| 1290 | Ga0207680_10005767 | |||
| 1291 | Ga0207647_10070604 | |||
| 1292 | Ga0207685_10038823 | |||
| 1293 | Ga0207685_10054554 | |||
| 1294 | Ga0207699_10036248 | |||
| 1295 | Ga0207699_10156631 | |||
| 1296 | Ga0207699_10281645 | |||
| 1297 | Ga0207699_10301766 | |||
| 1298 | Ga0207645_10011735 | |||
| 1299 | Ga0207645_10015093 | |||
| 1300 | Ga0207645_10081281 | |||
| 1301 | Ga0207643_10023495 | |||
| 1302 | Ga0207643_10060318 | |||
| 1303 | Ga0207643_10074470 | |||
| 1304 | Ga0207705_10017844 | |||
| 1305 | Ga0207705_10059325 | |||
| 1306 | Ga0207684_10068220 | |||
| 1307 | Ga0207654_10007783 | |||
| 1308 | Ga0207654_10047546 | |||
| 1309 | Ga0207654_10061712 | |||
| 1310 | Ga0207654_10180230 | |||
| 1311 | Ga0207707_10187443 | |||
| 1312 | Ga0207695_10011865 | |||
| 1313 | Ga0207695_10122250 | |||
| 1314 | Ga0207695_10177384 | |||
| 1315 | Ga0207671_10010872 | |||
| 1316 | Ga0207671_10069454 | |||
| 1317 | Ga0207671_10238260 | |||
| 1318 | Ga0207693_10000153 | |||
| 1319 | Ga0207693_10009382 | |||
| 1320 | Ga0207693_10010429 | |||
| 1321 | Ga0207693_10068957 | |||
| 1322 | Ga0207693_10094768 | |||
| 1323 | Ga0207663_10109493 | |||
| 1324 | Ga0207663_10125897 | |||
| 1325 | Ga0207660_10011594 | |||
| 1326 | Ga0207660_10030021 | |||
| 1327 | Ga0207660_10132509 | |||
| 1328 | Ga0207662_10152073 | |||
| 1329 | Ga0207657_10000586 | |||
| 1330 | Ga0207657_10020066 | |||
| 1331 | Ga0207657_10036647 | |||
| 1332 | Ga0207649_10035660 | |||
| 1333 | Ga0207652_10012687 | |||
| 1334 | Ga0207652_10611905 | |||
| 1335 | Ga0207646_10002124 | |||
| 1336 | Ga0207646_10068935 | |||
| 1337 | Ga0207681_10131610 | |||
| 1338 | Ga0207694_10015265 | |||
| 1339 | Ga0207694_10020755 | |||
| 1340 | Ga0207694_10036415 | |||
| 1341 | Ga0207650_10002086 | |||
| 1342 | Ga0207650_10009326 | |||
| 1343 | Ga0207650_10060478 | |||
| 1344 | Ga0207650_10210122 | |||
| 1345 | Ga0207650_10211391 | |||
| 1346 | Ga0207659_10014420 | |||
| 1347 | Ga0207659_10038655 | |||
| 1348 | Ga0207687_10002184 | |||
| 1349 | Ga0207687_10005074 | |||
| 1350 | Ga0207687_10118391 | |||
| 1351 | Ga0207700_10015934 | |||
| 1352 | Ga0207700_10051344 | |||
| 1353 | Ga0207700_10225944 | |||
| 1354 | Ga0207700_10540464 | |||
| 1355 | Ga0207664_10002430 | |||
| 1356 | Ga0207664_10010782 | |||
| 1357 | Ga0207664_10024658 | |||
| 1358 | Ga0207664_10182245 | |||
| 1359 | Ga0207664_10207148 | |||
| 1360 | Ga0207664_10409963 | |||
| 1361 | Ga0207664_10489130 | |||
| 1362 | Ga0207644_10003209 | |||
| 1363 | Ga0207644_10041311 | |||
| 1364 | Ga0207644_10343702 | |||
| 1365 | Ga0207644_10434118 | |||
| 1366 | Ga0207690_10000960 | |||
| 1367 | Ga0207690_10018527 | |||
| 1368 | Ga0207706_10004245 | |||
| 1369 | Ga0207706_10028422 | |||
| 1370 | Ga0207706_10038159 | |||
| 1371 | Ga0207686_10006273 | |||
| 1372 | Ga0207670_10027629 | |||
| 1373 | Ga0207670_10038996 | |||
| 1374 | Ga0207670_10104032 | |||
| 1375 | Ga0207669_10181230 | |||
| 1376 | Ga0207704_10364296 | |||
| 1377 | Ga0207704_10561271 | |||
| 1378 | Ga0207665_10002771 | |||
| 1379 | Ga0207665_10048971 | |||
| 1380 | Ga0207665_10186751 | |||
| 1381 | Ga0207691_10001558 | |||
| 1382 | Ga0207691_10035297 | |||
| 1383 | Ga0207691_10193111 | |||
| 1384 | Ga0207691_10276634 | |||
| 1385 | Ga0207711_10001574 | |||
| 1386 | Ga0207711_10056201 | |||
| 1387 | Ga0207711_10084109 | |||
| 1388 | Ga0207711_10303693 | |||
| 1389 | Ga0207711_10575558 | |||
| 1390 | Ga0207689_10005580 | |||
| 1391 | Ga0207689_10007156 | |||
| 1392 | Ga0207689_10021571 | |||
| 1393 | Ga0207689_10028135 | |||
| 1394 | Ga0207689_10036814 | |||
| 1395 | Ga0207661_10036988 | |||
| 1396 | Ga0207661_10653898 | |||
| 1397 | Ga0207679_10237940 | |||
| 1398 | Ga0207667_10000425 | |||
| 1399 | Ga0207667_10004554 | |||
| 1400 | Ga0207667_10054342 | |||
| 1401 | Ga0207667_10193676 | |||
| 1402 | Ga0207651_10002703 | |||
| 1403 | Ga0207651_10134763 | |||
| 1404 | Ga0207651_10234733 | |||
| 1405 | Ga0207651_10413442 | |||
| 1406 | Ga0207712_10048719 | |||
| 1407 | Ga0207712_10076359 | |||
| 1408 | Ga0207668_10103494 | |||
| 1409 | Ga0207640_10094940 | |||
| 1410 | Ga0207640_10114699 | |||
| 1411 | Ga0207640_10180973 | |||
| 1412 | Ga0207640_10545023 | |||
| 1413 | Ga0207658_10011772 | |||
| 1414 | Ga0207658_10066409 | |||
| 1415 | Ga0207658_10085117 | |||
| 1416 | Ga0207658_10085950 | |||
| 1417 | Ga0207677_10001064 | |||
| 1418 | Ga0207677_10131263 | |||
| 1419 | Ga0207677_10234128 | |||
| 1420 | Ga0207639_10006026 | |||
| 1421 | Ga0207639_10160805 | |||
| 1422 | Ga0207678_10000668 | |||
| 1423 | Ga0207678_10009943 | |||
| 1424 | Ga0207678_10020435 | |||
| 1425 | Ga0207678_10033821 | |||
| 1426 | Ga0207708_10003117 | |||
| 1427 | Ga0207702_10004490 | |||
| 1428 | Ga0207702_10082237 | |||
| 1429 | Ga0207702_10109772 | |||
| 1430 | Ga0207702_10317498 | |||
| 1431 | Ga0207641_10004440 | |||
| 1432 | Ga0207641_10016808 | |||
| 1433 | Ga0207641_10039978 | |||
| 1434 | Ga0207641_10179451 | |||
| 1435 | Ga0207641_10364874 | |||
| 1436 | Ga0207641_10531932 | |||
| 1437 | Ga0207648_10009160 | |||
| 1438 | Ga0207648_10030124 | |||
| 1439 | Ga0207648_10242735 | |||
| 1440 | Ga0207676_10000811 | |||
| 1441 | Ga0207676_10046728 | |||
| 1442 | Ga0207676_10048511 | |||
| 1443 | Ga0207674_10004614 | |||
| 1444 | Ga0207674_10329456 | |||
| 1445 | Ga0207674_10537450 | |||
| 1446 | Ga0207675_100018362 | |||
| 1447 | Ga0207675_100023777 | |||
| 1448 | Ga0207675_100026149 | |||
| 1449 | Ga0207675_100124671 | |||
| 1450 | Ga0207683_10005347 | |||
| 1451 | Ga0207683_10008660 | |||
| 1452 | Ga0207683_10089194 | |||
| 1453 | Ga0207683_10147252 | |||
| 1454 | Ga0207683_10245069 | |||
| 1455 | Ga0207698_10001506 | |||
| 1456 | Ga0207698_10022387 | |||
| 1457 | Ga0207698_10091988 | |||
| 1458 | Ga0210002_1032261 | |||
| 1459 | Ga0209588_1085730 | |||
| 1460 | Ga0209971_1007080 | |||
| 1461 | Ga0268266_10000612 | |||
| 1462 | Ga0268266_10009375 | |||
| 1463 | Ga0268265_10017286 | |||
| 1464 | Ga0268265_10166659 | |||
| 1465 | Ga0268265_10424378 | |||
| 1466 | Ga0268264_10020465 | |||
| 1467 | Ga0268264_10150955 | |||
| 1468 | Ga0268264_10175403 | |||
| 1469 | Ga0268264_10263250 | |||
| 1470 | Ga0268264_10295234 | |||
| 1471 | Ga0268264_10342670 | |||
| 1472 | Ga0268264_10372636 | |||
| 1473 | Ga0265770_1003724 | |||
| 1474 | Ga0265332_10005033 | |||
| 1475 | Ga0265331_10001457 | |||
| 1476 | Ga0307513_10081219 | |||
| 1477 | Ga0265313_10011287 | |||
| 1478 | Ga0307508_10244575 | |||
| 1479 | Ga0307516_10005198 | |||
| 1480 | Ga0307518_10000367 | |||
| 1481 | Ga0307416_100521956 | |||
| 1482 | Ga0373934_0018541 | |||
| 1483 | Ga0373940_0019514 | |||
| 1484 | Ga0373949_0006124 | |||
| 1485 | Ga0373951_0007338 | |||
| 1486 | Ga0373923_0014532 | |||
| 1487 | Ga0373923_0018735 | |||
| 1488 | Ga0373923_0031669 | |||
| 1489 | Ga0373936_0008921 | |||
| 1490 | Ga0373939_0009931 | |||
| 1491 | Ga0373945_0022914 | |||
| 1492 | Ga0373945_0080553 | |||
| 1493 | Ga0373953_0014201 | |||
| 1494 | Ga0373954_0071616 | |||
| 1495 | Ga0373957_0044697 | |||
| 1496 | Ga0373957_0070673 | |||
| 1497 | Ga0373957_0102060 | |||
| 1498 | Ga0373943_0058681 | |||
| 1499 | Ga0373943_0086150 | |||
| 1500 | Ga0373946_0011117 | |||
| 1501 | Ga0373955_0051094 | |||
| 1502 | Ga0373962_0027201 | |||
| 1503 | Ga0373924_0008418 | |||
| 1504 | Ga0373924_0072287 | |||
| 1505 | Ga0373931_0033393 | |||
| 1506 | Ga0373935_0023165 | |||
| 1507 | Ga0373935_0167150 | |||
| 1508 | Ga0373927_0012491 | |||
| 1509 | Ga0373927_0045703 | |||
| 1510 | Ga0373933_0003686 | |||
| 1511 | Ga0373933_0010665 | |||
| 1512 | Ga0373933_0034792 | |||
| 1513 | Ga0373933_0041902 | |||
| 1514 | Ga0373937_0007489 | |||
| 1515 | Ga0373937_0024000 | |||
| 1516 | Ga0373937_0114046 | |||
| 1517 | Ga0373937_0139384 | |||
| 1518 | Ga0316584_0017673 | |||
| 1519 | Ga0373925_0042682 | |||
| 1520 | Ga0373925_0063961 | |||
| 1521 | Ga0373925_0360550 | |||
| 1522 | Ga0373925_0557799 | |||
| 1523 | Ga0395900_0303266 | |||
| 1524 | Ga0436364_0180261 | |||
| 1525 | Ga0436364_0287884 | |||
| 1526 | Ga0436364_0509323 | |||
| 1527 | Ga0436364_1311957 | |||
| 1528 | Ga0436365_0281494 | |||
| 1529 | Ga0436365_0627039 | |||
| 1530 | Ga0436365_0674621 | |||
| 1531 | Ga0436365_1880555 | |||
| 1532 | Ga0436363_0751098 | |||
| 1533 | Ga0436363_0981235 | |||
| 1534 | Ga0436362_0193295 | |||
| 1535 | Ga0436362_0311511 | |||
| 1536 | Ga0451787_499637 | |||
| 1537 | Ga0451789_0995645 | |||
| 1538 | Ga0451800_1646914 | |||
| 1539 | Ga0451807_1038203 | |||
| 1540 | Ga0439446_0086715 | |||
| 1541 | Ga0466963_0074228 | |||
| 1542 | Ga0466963_0160912 | |||
| 1543 | Ga0466963_0222941 | |||
| 1544 | Ga0466963_0246220 | |||
| 1545 | Ga0466960_0023293 | |||
| 1546 | Ga0466960_0060535 | |||
| 1547 | Ga0451576_0172820 | |||
| 1548 | Ga0466958_0145562 | |||
| 1549 | Ga0466967_0015121 | |||
| 1550 | Ga0466967_0094547 | |||
| 1551 | Ga0466967_0232372 | |||
| 1552 | Ga0466967_0232641 | |||
| 1553 | Ga0466967_0307425 | |||
| 1554 | Ga0466967_0580764 | |||
| 1555 | Ga0466967_0666966 | |||
| 1556 | Ga0466967_0696910 | |||
| 1557 | Ga0466967_0714219 | |||
| 1558 | Ga0495592_0013413 | |||
| 1559 | Ga0495592_0025944 | |||
| 1560 | Ga0495592_0027021 | |||
| 1561 | Ga0495592_0216487 | |||
| 1562 | Ga0495592_0265365 | |||
| 1563 | Ga0495629_0082238 | |||
| 1564 | Ga0495638_0102347 | |||
| 1565 | Ga0495641_0016701 | |||
| 1566 | Ga0495651_0000734 | |||
| 1567 | Ga0495651_0008430 | |||
| 1568 | Ga0495651_0042930 | |||
| 1569 | Ga0495651_0194872 | |||
| 1570 | Ga0495651_0269623 | |||
| 1571 | Ga0495653_0009930 | |||
| 1572 | Ga0495580_0022242 | |||
| 1573 | Ga0495582_0011027 | |||
| 1574 | Ga0495582_0029350 | |||
| 1575 | Ga0495639_0053305 | |||
| 1576 | Ga0495662_0006250 | |||
| 1577 | Ga0495662_0114154 | |||
| 1578 | Ga0495664_0038498 | |||
| 1579 | Ga0495664_0137601 | |||
| 1580 | Ga0495608_0008621 | |||
| 1581 | Ga0495608_0009042 | |||
| 1582 | Ga0495608_0015217 | |||
| 1583 | Ga0495608_0051950 | |||
| 1584 | Ga0495618_0009027 | |||
| 1585 | Ga0495618_0048439 | |||
| 1586 | Ga0495618_0108212 | |||
| 1587 | Ga0495618_0189461 | |||
| 1588 | Ga0495618_0205030 | |||
| 1589 | Ga0495628_0000090 | |||
| 1590 | Ga0495628_0030180 | |||
| 1591 | Ga0495628_0035342 | |||
| 1592 | Ga0495628_0070797 | |||
| 1593 | Ga0495628_0117420 | |||
| 1594 | Ga0495628_0150233 | |||
| 1595 | Ga0495652_0002601 | |||
| 1596 | Ga0495652_0003220 | |||
| 1597 | Ga0495652_0021522 | |||
| 1598 | Ga0495665_0030134 | |||
| 1599 | Ga0495665_0032144 | |||
| 1600 | Ga0495665_0065270 | |||
| 1601 | Ga0495640_0084968 | |||
| 1602 | Ga0495586_0011220 | |||
| 1603 | Ga0495586_0055188 | |||
| 1604 | Ga0495587_0009014 | |||
| 1605 | Ga0495621_0004858 | |||
| 1606 | Ga0495645_0035777 | |||
| 1607 | Ga0495645_0063469 | |||
| 1608 | Ga0495645_0103356 | |||
| 1609 | Ga0495645_0124457 | |||
| 1610 | Ga0495645_0130724 | |||
| 1611 | Ga0495645_0295954 | |||
| 1612 | Ga0495622_0053168 | |||
| 1613 | Ga0495667_0010099 | |||
| 1614 | Ga0495634_0073989 | |||
| 1615 | Ga0495634_0079085 | |||
| 1616 | Ga0495635_0029788 | |||
| 1617 | Ga0495635_0064719 | |||
| 1618 | Ga0495635_0075749 | |||
| 1619 | Ga0495659_0016146 | |||
| 1620 | Ga0495657_0019468 | |||
| 1621 | Ga0495657_0023265 | |||
| 1622 | Ga0495657_0242903 | |||
| 1623 | Ga0495599_0000496 | |||
| 1624 | Ga0495599_0351276 | |||
| 1625 | Ga0495623_0004072 | |||
| 1626 | Ga0495623_0030996 | |||
| 1627 | Ga0495623_0053941 | |||
| 1628 | Ga0495623_0150444 | |||
| 1629 | Ga0495646_0001309 | |||
| 1630 | Ga0495646_0009343 | |||
| 1631 | Ga0495646_0119167 | |||
| 1632 | Ga0495658_0057033 | |||
| 1633 | Ga0495669_0060994 | |||
| 1634 | Ga0495613_0167729 | |||
| 1635 | Ga0495624_0011309 | |||
| 1636 | Ga0495624_0035737 | |||
| 1637 | Ga0495624_0139689 | |||
| 1638 | Ga0495600_0011970 | |||
| 1639 | Ga0495581_0011767 | |||
| 1640 | Ga0495581_0011844 | |||
| 1641 | Ga0495604_0002827 | |||
| 1642 | Ga0495604_0224497 | |||
| 1643 | Ga0495674_0014375 | |||
| 1644 | Ga0495674_0051235 | |||
| 1645 | Ga0495672_0079370 | |||
| 1646 | Ga0495672_0083228 | |||
| 1647 | Ga0495680_0014109 | |||
| 1648 | Ga0495680_0015607 | |||
| 1649 | Ga0495675_0019663 | |||
| 1650 | Ga0495684_0151341 | |||
| 1651 | Ga0495686_0085768 | |||
| 1652 | Ga0495593_0033842 | |||
| 1653 | Ga0495602_0019973 | |||
| 1654 | Ga0495602_0048859 | |||
| 1655 | Ga0495602_0049900 | |||
| 1656 | Ga0495602_0068927 | |||
| 1657 | Ga0496100_0133891 | |||
| 1658 | Ga0496102_0115515 | |||
| 1659 | Ga0496104_0013601 | |||
| 1660 | Ga0496104_0042946 | |||
| 1661 | Ga0496105_0004617 | |||
| 1662 | Ga0496105_0074969 | |||
| 1663 | Ga0496106_0050563 | |||
| 1664 | Ga0496107_0075321 | |||
| 1665 | Ga0496108_0078034 | |||
| 1666 | Ga0496108_0681768 | |||
| 1667 | Ga0496109_0095159 | |||
| 1668 | Ga0496109_0848297 | |||
| 1669 | Ga0496110_0010759 | |||
| 1670 | Ga0496110_0657132 | |||
| 1671 | Ga0496112_0001245 | |||
| 1672 | Ga0496112_0489792 | |||
| 1673 | Ga0496113_0111577 | |||
| 1674 | Ga0496114_0068684 | |||
| 1675 | Ga0496114_0379189 | |||
| 1676 | Ga0496115_0000630 | |||
| 1677 | Ga0496115_0015178 | |||
| 1678 | Ga0496117_0114618 | |||
| 1679 | Ga0496122_0039999 | |||
| 1680 | Ga0496123_0042289 | |||
| 1681 | Ga0501031_0049733 | |||
| 1682 | Ga0501031_0352428 | |||
| 1683 | Ga0501032_0020705 | |||
| 1684 | Ga0501033_0405735 | |||
| 1685 | Ga0501034_0019507 | |||
| 1686 | Ga0501034_0224094 | |||
| 1687 | Ga0501034_0231310 | |||
| 1688 | Ga0501034_0718361 | |||
| 1689 | Ga0501036_0103928 | |||
| 1690 | Ga0501037_0030539 | |||
| 1691 | Ga0501037_0120645 | |||
| 1692 | Ga0501038_0168868 | |||
| 1693 | Ga0501039_0270743 | |||
| 1694 | Ga0501041_0208249 | |||
| 1695 | Ga0501042_0210893 | |||
| 1696 | Ga0501043_0001676 | |||
| 1697 | Ga0501043_0058736 | |||
| 1698 | Ga0501043_0062247 | |||
| 1699 | Ga0501046_0034630 | |||
| 1700 | Ga0501046_0240098 | |||
| 1701 | Ga0501046_0427691 | |||
| 1702 | Ga0501047_0001868 | |||
| 1703 | Ga0501047_0146969 | |||
| 1704 | Ga0501047_0368511 | |||
| 1705 | Ga0501048_0035790 | |||
| 1706 | Ga0501067_0097813 | |||
| 1707 | Ga0501067_0226281 | |||
| 1708 | Ga0501068_0075864 | |||
| 1709 | Ga0501070_0379239 | |||
| 1710 | Ga0501070_0497801 | |||
| 1711 | Ga0501070_0514094 | |||
| 1712 | Ga0501071_0222130 | |||
| 1713 | Ga0501072_0027941 | |||
| 1714 | Ga0501072_0148510 | |||
| 1715 | Ga0501072_0242548 | |||
| 1716 | Ga0501073_0065565 | |||
| 1717 | Ga0501073_0104289 | |||
| 1718 | Ga0501073_0192774 | |||
| 1719 | Ga0501073_0234123 | |||
| 1720 | Ga0501073_0337961 | |||
| 1721 | Ga0501073_0436980 | |||
| 1722 | Ga0501074_0120310 | |||
| 1723 | Ga0501074_0180223 | |||
| 1724 | Ga0501075_0031959 | |||
| 1725 | Ga0501075_0485288 | |||
| 1726 | Ga0501076_0028913 | |||
| 1727 | Ga0501076_0070713 | |||
| 1728 | Ga0501077_0006863 | |||
| 1729 | Ga0501077_0076023 | |||
| 1730 | Ga0501077_0108492 | |||
| 1731 | Ga0501077_0149142 | |||
| 1732 | Ga0501079_0020531 | |||
| 1733 | Ga0501079_0027340 | |||
| 1734 | Ga0501079_0066842 | |||
| 1735 | Ga0501080_0125999 | |||
| 1736 | Ga0501080_0170748 | |||
| 1737 | Ga0501080_0253514 | |||
| 1738 | Ga0501080_0390132 | |||
| 1739 | Ga0501081_0057815 | |||
| 1740 | Ga0501083_0040893 | |||
| 1741 | Ga0501083_0045180 | |||
| 1742 | Ga0501083_0086763 | |||
| 1743 | Ga0501083_0104083 | |||
| 1744 | Ga0501035_0112884 | |||
| 1745 | Ga0501035_0390578 | |||
| 1746 | Ga0501035_0424792 | |||
| 1747 | Ga0501044_0077920 | |||
| 1748 | Ga0501044_0079013 | |||
| 1749 | Ga0501044_0278327 | |||
| 1750 | Ga0501044_0314637 | |||
| 1751 | Ga0501044_0364071 | |||
| 1752 | Ga0501045_0039020 | |||
| 1753 | Ga0501045_0041276 | |||
| 1754 | nmdc:mga05p37_134619_c1 | |||
| 1755 | nmdc:mga05p37_154862_c1 | |||
| 1756 | nmdc:mga05p37_303662_c1 | |||
| 1757 | nmdc:mga05p37_48143_c1 | |||
| 1758 | nmdc:mga05p37_52382_c1 | |||
| 1759 | nmdc:mga05p37_8269_c1 | |||
| 1760 | nmdc:mga09592_298997_c1 | |||
| 1761 | nmdc:mga0qj67_13011_c1 | |||
| 1762 | nmdc:mga0qj67_144511_c1 | |||
| 1763 | nmdc:mga06r32_425390_c1 | |||
| 1764 | nmdc:mga06r32_42915_c1 | |||
| 1765 | nmdc:mga06r32_57340_c1 | |||
| 1766 | nmdc:mga06r32_633764_c1 | |||
| 1767 | nmdc:mga06r32_91312_c1 | |||
| 1768 | nmdc:mga08y16_140745_c1 | |||
| 1769 | nmdc:mga08y16_336825_c1 | |||
| 1770 | nmdc:mga08y16_355696_c1 | |||
| 1771 | nmdc:mga0rr50_58322_c1 | |||
| 1772 | nmdc:mga08x19_133448_c1 | |||
| 1773 | nmdc:mga08x19_7131_c1 | |||
| 1774 | nmdc:mga0a205_358850_c1 | |||
| 1775 | nmdc:mga0a205_364851_c1 | |||
| 1776 | Ga0495601_0017241 | |||
| 1777 | Ga0495601_0032228 | |||
| 1778 | Ga0495601_0042524 | |||
| 1779 | Ga0495612_0001520 | |||
| 1780 | Ga0495612_0002459 | |||
| 1781 | Ga0495595_0033396 | |||
| 1782 | Ga0495595_0104703 | |||
| 1783 | Ga0495619_0019064 | |||
| 1784 | Ga0495619_0281858 | |||
| 1785 | Ga0500578_0014436 | |||
| 1786 | Ga0500646_0004041 | |||
| 1787 | Ga0500651_0056328 | |||
| 1788 | Ga0500555_010442 | |||
| 1789 | Ga0500595_002824 | |||
| 1790 | Ga0500595_003384 | |||
| 1791 | Ga0500595_059687 | |||
| 1792 | Ga0500642_0000239 | |||
| 1793 | Ga0500568_0005103 | |||
| 1794 | Ga0500574_000707 | |||
| 1795 | Ga0500577_0074170 | |||
| 1796 | Ga0500588_0012469 | |||
| 1797 | Ga0500604_0038187 | |||
| 1798 | Ga0500616_0001024 | |||
| 1799 | Ga0500609_000560 | |||
| 1800 | Ga0501084_0009016 | |||
| 1801 | Ga0501084_0028282 | |||
| 1802 | Ga0501084_0446467 | |||
| 1803 | Ga0501084_0483454 | |||
| 1804 | Ga0501082_0087133 | |||
| 1805 | Ga0501082_0238915 | |||
| 1806 | Ga0501082_0389256 | |||
| 1807 | Ga0530510_0083020 | |||
| 1808 | 2558906073 | |||
| 1809 | 2586063388 | |||
| 1810 | 2819541363 | |||
| 1811 | 2866553942 | |||
| 1812 | 8047899445 | |||
| 1813 | 8048359485 | |||
| 1814 | 8048376393 | |||
| 1815 | 8048385448 | |||
| 1816 | 8054566327 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dyv-assembly1.cif.gz_A | crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 | 0.9722 | 5 | 244 |
| 4dyv-assembly1.cif.gz_A | crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 | 0.9677 | 5 | 244 |
| 4dry-assembly1.cif.gz_D | the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti | 0.9611 | 6 | 252 |
| 4dry-assembly1.cif.gz_A | the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti | 0.961 | 6 | 252 |
| 4dry-assembly1.cif.gz_A | the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti | 0.9571 | 6 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dyvA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9701 | 5 | 240 | 3.40.50.720 |
| 4dyvA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9563 | 5 | 240 | 3.40.50.720 |
| 4dryA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9549 | 6 | 252 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9517 | 2 | 184 | 3.40.50.720 |
| 4dryA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9509 | 6 | 252 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y3WUD5-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9888 | 5 | 184 |
GO:0016491
|
| AF-A0A382N0H9-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9879 | 1 | 223 |
GO:0016491
|
| AF-A0A1C5FGT3-F1-model_v4 | NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family | 0.987 | 57 | 252 |
GO:0016491
|
| AF-A0A3C0Y7A3-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9868 | 80 | 232 |
GO:0016491
|
| AF-A0A7K2AYR3-F1-model_v4 | SDR family oxidoreductase | 0.9857 | 1 | 252 |
GO:0016491
|