F485367

General Info

Members Datasets Scaffolds Average Seq Length
907 391 791 159

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0014731|Ga0495607_0014731_3605_4072
Length 155
Sequence MTLFCAPRIKQLALGLALIGMAWQVSAQTQVNDAWVRATVAGQPSSGAFMTLQADTDSKLLSVQSPVAKLVQIHQSSMKQVESVALPAGKAVSFDPHGYHIMLMDLTGQIKEGSKVPLTLTVENAKGEKETIKVDAEARALGTMDHGNXXXSKMH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
19 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
20 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
21 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
22 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
23 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
24 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
25 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
26 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
27 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
28 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
29 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
30 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
31 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
32 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
33 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
34 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
35 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
36 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
37 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
38 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
39 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
40 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
41 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
42 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
43 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
44 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
45 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
46 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
47 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
48 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
49 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
50 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
51 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
52 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
53 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
54 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
55 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
56 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
57 2773857673 Pseudomonas sp. 443 Isolate Unclassified
58 2784132063 Pseudomonas sp. 424 Isolate Unclassified
59 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
60 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
61 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
62 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
63 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
64 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
65 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
66 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
67 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
68 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
69 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
70 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
71 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
72 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
73 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
74 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
75 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
76 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
77 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
78 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
79 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
80 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
81 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
82 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
83 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
84 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
85 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
86 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
87 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
88 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
89 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
90 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
91 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
92 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
93 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
94 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
95 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
96 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
97 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
98 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
99 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
100 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
101 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
102 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
103 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
104 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
105 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
106 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
107 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
108 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
109 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
110 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
111 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
112 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
113 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
114 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
117 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
118 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
119 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
126 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
127 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
128 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
139 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
143 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
144 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
156 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
176 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
236 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
237 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
243 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
244 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
245 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
246 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
247 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
248 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
249 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
250 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
251 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
252 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
253 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
254 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
255 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
256 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
257 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
258 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
259 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
260 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
261 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
264 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
265 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
266 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
366 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
373 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
374 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
375 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
376 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
377 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
378 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
379 8052494512 Pseudomonas putida LD6 Isolate Unclassified
380 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
381 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
382 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
383 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
384 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
385 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
386 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
387 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
388 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
389 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
390 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
391 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.21
Metatranscriptomes 0
Isolates 12.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.06
Nodule 1.87
Rhizoplane 2.98
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1296335 2162886007 Bacteria 2138
2 Ga0055538_1000133 3300003751 Bacteria 53318
3 Ga0055539_1000182 3300003752 Bacteria 53318
4 Ga0055533_1000181 3300003756 Bacteria 53318
5 Ga0055532_1000195 3300003758 Bacteria 50586
6 Ga0055525_1000250 3300003759 Bacteria 53318
7 Ga0055535_1008029 3300003761 Bacteria 1947
8 Ga0055536_1000115 3300003781 Bacteria 69846
9 Ga0055536_1040697 3300003781 Bacteria 1104
10 Ga0055530_10000041 3300003791 Bacteria 112647
11 Ga0055530_10003977 3300003791 Bacteria 7980
12 Ga0055530_10016572 3300003791 Bacteria 2347
13 Ga0055540_1000195 3300003792 Bacteria 58558
14 Ga0055540_1000204 3300003792 Bacteria 57435
15 Ga0055531_10000186 3300003794 Bacteria 69495
16 Ga0055541_1000067 3300003841 Bacteria 99013
17 Ga0065714_10006412 3300005288 Bacteria 6071
18 Ga0065714_10028204 3300005288 Bacteria 1188
19 Ga0065714_10064945 3300005288 Bacteria 15037
20 Ga0065714_10087459 3300005288 Bacteria 2057
21 Ga0065704_10119359 3300005289 Bacteria 1801
22 Ga0065704_10472404 3300005289 Bacteria 688
23 Ga0065704_10604140 3300005289 Bacteria 605
24 Ga0065712_10080270 3300005290 Bacteria 3126
25 Ga0070676_10223938 3300005328 Bacteria 1244
26 Ga0070670_100000112 3300005331 Bacteria 76289
27 Ga0070670_100000945 3300005331 Bacteria 22835
28 Ga0068869_100056224 3300005334 Bacteria 2869
29 Ga0070689_100119979 3300005340 Bacteria 2100
30 Ga0070661_100000310 3300005344 Bacteria 39292
31 Ga0070668_100005467 3300005347 Bacteria 9431
32 Ga0070669_101060759 3300005353 Bacteria 697
33 Ga0070669_101093576 3300005353 Bacteria 686
34 Ga0070675_100117126 3300005354 Bacteria 2260
35 Ga0070674_100215326 3300005356 Bacteria 1491
36 Ga0070674_101058135 3300005356 Bacteria 715
37 Ga0070667_100501921 3300005367 Bacteria 1112
38 Ga0070701_10097456 3300005438 Bacteria 1622
39 Ga0070705_100312453 3300005440 Bacteria 1131
40 Ga0070700_100171993 3300005441 Bacteria 1501
41 Ga0070694_100219194 3300005444 Bacteria 1426
42 Ga0070678_100007327 3300005456 Bacteria 6536
43 Ga0070662_100007847 3300005457 Bacteria 6933
44 Ga0070662_100050082 3300005457 Bacteria 3013
45 Ga0068867_100100941 3300005459 Bacteria 2204
46 Ga0070672_100353736 3300005543 Bacteria 1252
47 Ga0070665_100171494 3300005548 Bacteria 2170
48 Ga0070665_100458325 3300005548 Bacteria 1285
49 Ga0070664_100000241 3300005564 Bacteria 39292
50 Ga0068854_100008490 3300005578 Bacteria 6608
51 Ga0068859_100316393 3300005617 Bacteria 1655
52 Ga0068861_100313773 3300005719 Bacteria 1363
53 Ga0068851_10005508 3300005834 Bacteria 5737
54 Ga0068863_101405756 3300005841 Unclassified 706
55 Ga0068860_100822777 3300005843 Bacteria 943
56 Ga0068862_100040294 3300005844 Bacteria 3971
57 Ga0075364_10058419 3300006051 Bacteria 2528
58 Ga0075364_10252061 3300006051 Bacteria 1200
59 Ga0075364_10401361 3300006051 Bacteria 935
60 Ga0075364_10588389 3300006051 Bacteria 760
61 Ga0075432_10002955 3300006058 Bacteria 5722
62 Ga0075432_10017391 3300006058 Bacteria 2452
63 Ga0075432_10027014 3300006058 Bacteria 1974
64 Ga0075432_10070899 3300006058 Bacteria 1252
65 Ga0075432_10181661 3300006058 Bacteria 823
66 Ga0075362_10032802 3300006177 Bacteria 2256
67 Ga0075362_10033895 3300006177 Bacteria 2223
68 Ga0075362_10072069 3300006177 Bacteria 1580
69 Ga0075362_10147453 3300006177 Bacteria 1127
70 Ga0075362_10294315 3300006177 Bacteria 805
71 Ga0075369_10083682 3300006186 Bacteria 1417
72 Ga0097621_100401234 3300006237 Bacteria 1227
73 Ga0068871_100011642 3300006358 Bacteria 6458
74 Ga0097620_100316392 3300006931 Bacteria 1655
75 Ga0079104_1000068 3300006946 Bacteria 154984
76 Ga0105251_10001646 3300009011 Bacteria 18925
77 Ga0105251_10011003 3300009011 Bacteria 5198
78 Ga0105251_10016946 3300009011 Bacteria 3917
79 Ga0105251_10020138 3300009011 Bacteria 3509
80 Ga0105251_10020803 3300009011 Bacteria 3440
81 Ga0105251_10254189 3300009011 Bacteria 792
82 Ga0105244_10001447 3300009036 Bacteria 19213
83 Ga0105244_10003827 3300009036 Bacteria 10614
84 Ga0105244_10018753 3300009036 Bacteria 3875
85 Ga0105244_10020302 3300009036 Bacteria 3694
86 Ga0105244_10025780 3300009036 Bacteria 3189
87 Ga0105244_10046539 3300009036 Bacteria 2228
88 Ga0105244_10141964 3300009036 Bacteria 1154
89 Ga0105250_10000337 3300009092 Bacteria 36160
90 Ga0105250_10000506 3300009092 Bacteria 27341
91 Ga0105250_10001803 3300009092 Bacteria 11215
92 Ga0105250_10190021 3300009092 Bacteria 864
93 Ga0105245_10656334 3300009098 Bacteria 1079
94 Ga0105243_10000491 3300009148 Bacteria 40396
95 Ga0105243_10013616 3300009148 Bacteria 6152
96 Ga0105243_10055674 3300009148 Bacteria 3143
97 Ga0105243_10138235 3300009148 Bacteria 2075
98 Ga0105243_12033645 3300009148 Bacteria 609
99 Ga0105242_10000099 3300009176 Bacteria 61092
100 Ga0105242_10094770 3300009176 Bacteria 2519
101 Ga0105248_10849713 3300009177 Bacteria 1030
102 Ga0105237_10002377 3300009545 Bacteria 23363
103 Ga0105246_10000501 3300011119 Bacteria 21333
104 Ga0105246_10001438 3300011119 Bacteria 14095
105 Ga0105246_10002958 3300011119 Bacteria 10296
106 Ga0105246_11521776 3300011119 Bacteria 629
107 Ga0157345_1000004 3300012498 Bacteria 80365
108 Ga0157373_10000596 3300013100 Bacteria 28045
109 Ga0157373_10001351 3300013100 Bacteria 18813
110 Ga0157373_10001464 3300013100 Bacteria 18044
111 Ga0157373_10005498 3300013100 Bacteria 9507
112 Ga0157373_10016104 3300013100 Bacteria 5457
113 Ga0157373_10090111 3300013100 Bacteria 2160
114 Ga0157373_10331129 3300013100 Bacteria 1084
115 Ga0157373_10377092 3300013100 Bacteria 1014
116 Ga0157371_10163629 3300013102 Bacteria 1589
117 Ga0157370_10070762 3300013104 Bacteria 3293
118 Ga0157370_10257075 3300013104 Bacteria 1614
119 Ga0157370_11313840 3300013104 Bacteria 651
120 Ga0157369_10052524 3300013105 Bacteria 4409
121 Ga0157369_10706704 3300013105 Bacteria 1038
122 Ga0157378_10334083 3300013297 Bacteria 1476
123 Ga0163162_10029228 3300013306 Bacteria 5454
124 Ga0163162_10047982 3300013306 Bacteria 4279
125 Ga0163162_10143362 3300013306 Bacteria 2503
126 Ga0163162_10589285 3300013306 Bacteria 1238
127 Ga0157372_10003028 3300013307 Bacteria 18103
128 Ga0157375_10000602 3300013308 Bacteria 31951
129 Ga0157375_10001025 3300013308 Bacteria 24117
130 Ga0157380_10103938 3300014326 Bacteria 2371
131 Ga0182008_10000878 3300014497 Bacteria 20898
132 Ga0182008_10001189 3300014497 Bacteria 17933
133 Ga0182008_10005940 3300014497 Bacteria 6886
134 Ga0182008_10051469 3300014497 Bacteria 2043
135 Ga0157376_10186074 3300014969 Bacteria 1901
136 Ga0182006_1000073 3300015261 Bacteria 131224
137 Ga0182006_1000158 3300015261 Bacteria 72283
138 Ga0182006_1009488 3300015261 Bacteria 4360
139 Ga0182006_1018318 3300015261 Bacteria 2960
140 Ga0182007_10000031 3300015262 Bacteria 152299
141 Ga0182007_10000769 3300015262 Bacteria 17954
142 Ga0182007_10037365 3300015262 Bacteria 1631
143 Ga0182005_1000149 3300015265 Bacteria 49294
144 Ga0182005_1002371 3300015265 Bacteria 6787
145 Ga0182005_1005290 3300015265 Bacteria 4048
146 Ga0163161_10129360 3300017792 Bacteria 1903
147 Ga0163161_10136904 3300017792 Bacteria 1852
148 Ga0163161_10180763 3300017792 Bacteria 1617
149 Ga0163161_10333952 3300017792 Bacteria 1201
150 Ga0163161_10368723 3300017792 Bacteria 1145
151 Ga0163161_11030684 3300017792 Bacteria 704
152 Ga0209435_103779 3300025206 Bacteria 1721
153 Ga0209784_100112 3300025224 Bacteria 91142
154 Ga0209566_100045 3300025225 Bacteria 258557
155 Ga0209674_100156 3300025226 Bacteria 91147
156 Ga0209147_100056 3300025229 Bacteria 258557
157 Ga0209563_100064 3300025230 Bacteria 258557
158 Ga0209563_101430 3300025230 Bacteria 6335
159 Ga0209437_106567 3300025233 Bacteria 1930
160 Ga0209258_100411 3300025242 Bacteria 51845
161 Ga0209646_1000147 3300025246 Bacteria 103287
162 Ga0209677_100103 3300025253 Bacteria 91142
163 Ga0209675_1010776 3300025291 Bacteria 3087
164 Ga0209676_1000062 3300025292 Bacteria 332319
165 Ga0209676_1000102 3300025292 Bacteria 227372
166 Ga0209676_1008332 3300025292 Bacteria 4640
167 Ga0209050_1000004 3300025298 Bacteria 1600040
168 Ga0209050_1000105 3300025298 Bacteria 227285
169 Ga0209050_1001809 3300025298 Bacteria 20913
170 Ga0209051_1000066 3300025303 Bacteria 227369
171 Ga0209051_1000181 3300025303 Bacteria 113391
172 Ga0209051_1005603 3300025303 Bacteria 7283
173 Ga0209257_1000124 3300025304 Bacteria 218195
174 Ga0207656_10002993 3300025321 Bacteria 5778
175 Ga0207696_1000023 3300025711 Bacteria 422195
176 Ga0207696_1000051 3300025711 Bacteria 276833
177 Ga0207696_1000090 3300025711 Bacteria 188474
178 Ga0207696_1000176 3300025711 Bacteria 100134
179 Ga0207696_1000177 3300025711 Bacteria 100134
180 Ga0207696_1001491 3300025711 Bacteria 12591
181 Ga0207696_1001893 3300025711 Bacteria 10684
182 Ga0207696_1026827 3300025711 Bacteria 1780
183 Ga0207696_1097355 3300025711 Bacteria 803
184 Ga0207655_1000022 3300025728 Bacteria 483933
185 Ga0207655_1000080 3300025728 Bacteria 214570
186 Ga0207655_1000203 3300025728 Bacteria 103900
187 Ga0207655_1002205 3300025728 Bacteria 16174
188 Ga0207655_1002480 3300025728 Bacteria 14944
189 Ga0207655_1004514 3300025728 Bacteria 9845
190 Ga0207655_1012613 3300025728 Bacteria 4923
191 Ga0207655_1025620 3300025728 Bacteria 2857
192 Ga0207655_1035418 3300025728 Bacteria 2228
193 Ga0207655_1043160 3300025728 Bacteria 1911
194 Ga0207655_1044338 3300025728 Bacteria 1870
195 Ga0207655_1067195 3300025728 Bacteria 1351
196 Ga0207713_1000199 3300025735 Bacteria 83023
197 Ga0207713_1001317 3300025735 Bacteria 20372
198 Ga0207713_1001509 3300025735 Bacteria 18384
199 Ga0207713_1008208 3300025735 Bacteria 6043
200 Ga0207713_1012828 3300025735 Bacteria 4453
201 Ga0207713_1021403 3300025735 Bacteria 3100
202 Ga0207713_1026862 3300025735 Bacteria 2627
203 Ga0207713_1057320 3300025735 Bacteria 1507
204 Ga0207713_1136376 3300025735 Bacteria 806
205 Ga0207645_10161504 3300025907 Bacteria 1466
206 Ga0207671_10000060 3300025914 Bacteria 178435
207 Ga0207671_10002355 3300025914 Bacteria 20338
208 Ga0207649_10000695 3300025920 Bacteria 22177
209 Ga0207681_10003303 3300025923 Bacteria 10097
210 Ga0207681_10989441 3300025923 Bacteria 705
211 Ga0207650_10000145 3300025925 Bacteria 85892
212 Ga0207650_10000721 3300025925 Bacteria 25687
213 Ga0207706_10003884 3300025933 Bacteria 14189
214 Ga0207706_10051270 3300025933 Bacteria 3644
215 Ga0207686_10007813 3300025934 Bacteria 5766
216 Ga0207686_10126878 3300025934 Bacteria 1745
217 Ga0207709_10000011 3300025935 Bacteria 552881
218 Ga0207709_10030722 3300025935 Bacteria 3128
219 Ga0207709_10120368 3300025935 Bacteria 1771
220 Ga0207669_10076592 3300025937 Bacteria 2124
221 Ga0207669_10254692 3300025937 Bacteria 1309
222 Ga0207704_10067008 3300025938 Bacteria 2256
223 Ga0207691_10254933 3300025940 Bacteria 1513
224 Ga0207711_10883964 3300025941 Bacteria 831
225 Ga0207689_10049630 3300025942 Bacteria 3462
226 Ga0207679_10000037 3300025945 Bacteria 133550
227 Ga0207712_10180635 3300025961 Bacteria 1657
228 Ga0207668_10004599 3300025972 Bacteria 8114
229 Ga0207640_10124822 3300025981 Bacteria 1851
230 Ga0207658_10084176 3300025986 Bacteria 2447
231 Ga0207708_10019449 3300026075 Bacteria 5119
232 Ga0207648_10118187 3300026089 Bacteria 2330
233 Ga0207676_10290992 3300026095 Bacteria 1487
234 Ga0207675_101171014 3300026118 Bacteria 789
235 Ga0207683_10052026 3300026121 Bacteria 3588
236 Ga0209281_1000168 3300027111 Bacteria 155116
237 Ga0207428_10013492 3300027907 Bacteria 7136
238 Ga0207428_10080727 3300027907 Bacteria 2540
239 Ga0207428_10143551 3300027907 Bacteria 1821
240 Ga0207428_10212817 3300027907 Bacteria 1452
241 Ga0268266_10059082 3300028379 Bacteria 3303
242 Ga0268265_10107257 3300028380 Bacteria 2271
243 Ga0268265_10308815 3300028380 Bacteria 1427
244 Ga0268264_11910173 3300028381 Bacteria 603
245 Ga0307511_10110964 3300030521 Bacteria 1745
246 Ga0316179_1024534 3300030734 Bacteria 936
247 Ga0265316_10185481 3300031344 Bacteria 1548
248 Ga0307408_100004965 3300031548 Bacteria 8945
249 Ga0307408_100032029 3300031548 Bacteria 3664
250 Ga0265342_10469672 3300031712 Bacteria 644
251 Ga0307405_10000073 3300031731 Bacteria 44879
252 Ga0307413_11151411 3300031824 Bacteria 672
253 Ga0307406_10748779 3300031901 Bacteria 820
254 Ga0307412_10032406 3300031911 Bacteria 3311
255 Ga0307412_10182834 3300031911 Bacteria 1578
256 Ga0307409_101686090 3300031995 Bacteria 662
257 Ga0307416_102313851 3300032002 Bacteria 638
258 Ga0307416_102411748 3300032002 Bacteria 625
259 Ga0307414_10022107 3300032004 Bacteria 4004
260 Ga0307411_10009261 3300032005 Bacteria 5163
261 Ga0237819_00233 3300038705 Bacteria 20367
262 Ga0439438_000661 3300041405 Bacteria 15479
263 Ga0439438_000981 3300041405 Bacteria 12759
264 Ga0439438_006127 3300041405 Bacteria 4296
265 Ga0439438_006478 3300041405 Bacteria 4120
266 Ga0439438_007556 3300041405 Bacteria 3703
267 Ga0439438_012757 3300041405 Bacteria 2562
268 Ga0439447_000516 3300041407 Bacteria 14332
269 Ga0439447_000847 3300041407 Bacteria 11221
270 Ga0439447_022493 3300041407 Bacteria 1649
271 Ga0439447_023816 3300041407 Bacteria 1591
272 Ga0439447_027028 3300041407 Bacteria 1466
273 Ga0439447_084311 3300041407 Bacteria 732
274 Ga0439466_0000243 3300041411 Bacteria 21378
275 Ga0439466_0003461 3300041411 Bacteria 6114
276 Ga0439466_0010274 3300041411 Bacteria 3479
277 Ga0439466_0018916 3300041411 Bacteria 2467
278 Ga0439466_0019324 3300041411 Bacteria 2438
279 Ga0439466_0034499 3300041411 Bacteria 1715
280 Ga0439466_0038148 3300041411 Bacteria 1614
281 Ga0439465_0110222 3300041413 Bacteria 957
282 Ga0451853_3249340 3300041512 Bacteria 510
283 Ga0439432_000022 3300042006 Bacteria 54425
284 Ga0439432_001360 3300042006 Bacteria 9254
285 Ga0439451_013378 3300042009 Bacteria 1658
286 Ga0439451_047248 3300042009 Bacteria 862
287 Ga0439451_052159 3300042009 Bacteria 819
288 Ga0439452_000077 3300042010 Bacteria 84014
289 Ga0439452_000081 3300042010 Bacteria 82231
290 Ga0439452_001764 3300042010 Bacteria 8448
291 Ga0439452_060884 3300042010 Bacteria 845
292 Ga0439452_065003 3300042010 Bacteria 811
293 Ga0439456_000194 3300042013 Bacteria 17520
294 Ga0439456_001343 3300042013 Bacteria 4908
295 Ga0439456_009275 3300042013 Bacteria 2033
296 Ga0439456_013477 3300042013 Bacteria 1701
297 Ga0439456_040197 3300042013 Bacteria 1012
298 Ga0439463_000020 3300042016 Bacteria 34395
299 Ga0439463_000257 3300042016 Bacteria 14564
300 Ga0439463_006880 3300042016 Bacteria 2808
301 Ga0439463_009968 3300042016 Bacteria 2334
302 Ga0439463_038882 3300042016 Bacteria 1207
303 Ga0450911_000488 3300042115 Bacteria 12619
304 Ga0450911_001475 3300042115 Bacteria 5388
305 Ga0450911_001694 3300042115 Bacteria 4850
306 Ga0450911_005682 3300042115 Bacteria 1913
307 Ga0450919_000545 3300042121 Bacteria 4736
308 Ga0450922_000117 3300042124 Bacteria 7838
309 Ga0450922_003138 3300042124 Bacteria 1527
310 Ga0450923_004356 3300042125 Bacteria 2221
311 Ga0450890_003233 3300042127 Bacteria 2175
312 Ga0450898_003631 3300042134 Bacteria 2228
313 Ga0450900_008085 3300042136 Bacteria 1307
314 Ga0450902_006363 3300042137 Bacteria 1809
315 Ga0450902_006918 3300042137 Bacteria 1745
316 Ga0450902_009470 3300042137 Bacteria 1534
317 Ga0450903_001356 3300042138 Bacteria 4581
318 Ga0450905_006961 3300042142 Bacteria 1534
319 Ga0450906_000314 3300042145 Bacteria 9792
320 Ga0450906_000446 3300042145 Bacteria 8593
321 Ga0450906_001777 3300042145 Bacteria 4725
322 Ga0450907_000780 3300042146 Bacteria 7976
323 Ga0450907_002098 3300042146 Bacteria 3941
324 Ga0450910_000701 3300042147 Bacteria 4021
325 Ga0450910_002897 3300042147 Bacteria 2259
326 Ga0439446_0002932 3300042156 Bacteria 4165
327 Ga0450908_002470 3300042184 Bacteria 3616
328 Ga0450908_023536 3300042184 Bacteria 1078
329 Ga0450909_000180 3300042185 Bacteria 7078
330 Ga0439434_0041898 3300042435 Bacteria 1407
331 Ga0439464_0032381 3300042439 Bacteria 1469
332 Ga0439464_0033424 3300042439 Bacteria 1448
333 Ga0439460_0002037 3300042461 Bacteria 4844
334 Ga0450918_010451 3300042531 Bacteria 1621
335 Ga0450918_019228 3300042531 Bacteria 1191
336 Ga0450918_092929 3300042531 Bacteria 585
337 Ga0439440_0000375 3300042993 Bacteria 7448
338 Ga0439440_0042699 3300042993 Bacteria 1110
339 Ga0495617_003562 3300046452 Bacteria 5824
340 Ga0495617_004248 3300046452 Bacteria 5232
341 Ga0495617_021389 3300046452 Bacteria 2184
342 Ga0495617_030719 3300046452 Bacteria 1805
343 Ga0495617_043989 3300046452 Bacteria 1491
344 Ga0495617_070033 3300046452 Bacteria 1153
345 Ga0495617_199149 3300046452 Bacteria 626
346 Ga0495627_003287 3300046453 Bacteria 7234
347 Ga0495627_005742 3300046453 Bacteria 4953
348 Ga0495627_118885 3300046453 Bacteria 747
349 Ga0495627_144181 3300046453 Bacteria 666
350 Ga0495603_0069782 3300046455 Bacteria 2067
351 Ga0495590_0001444 3300046457 Bacteria 10253
352 Ga0495590_0003719 3300046457 Bacteria 6213
353 Ga0495590_0007200 3300046457 Bacteria 4301
354 Ga0495590_0008013 3300046457 Bacteria 4052
355 Ga0495590_0027246 3300046457 Bacteria 2005
356 Ga0495590_0063193 3300046457 Bacteria 1295
357 Ga0495591_000021 3300046458 Bacteria 203554
358 Ga0495591_000032 3300046458 Bacteria 176337
359 Ga0495591_000082 3300046458 Bacteria 107579
360 Ga0495591_000120 3300046458 Bacteria 86214
361 Ga0495591_006430 3300046458 Bacteria 5193
362 Ga0495591_008205 3300046458 Bacteria 4303
363 Ga0495591_010282 3300046458 Bacteria 3639
364 Ga0495591_019213 3300046458 Bacteria 2293
365 Ga0495591_022614 3300046458 Bacteria 2028
366 Ga0495591_035580 3300046458 Bacteria 1456
367 Ga0495591_037727 3300046458 Bacteria 1396
368 Ga0495638_0000240 3300046460 Bacteria 75170
369 Ga0495638_0000449 3300046460 Bacteria 49303
370 Ga0495638_0002830 3300046460 Bacteria 13904
371 Ga0495638_0014216 3300046460 Bacteria 5388
372 Ga0495638_0019151 3300046460 Bacteria 4531
373 Ga0495638_0019276 3300046460 Bacteria 4514
374 Ga0495638_0025349 3300046460 Bacteria 3856
375 Ga0495638_0028318 3300046460 Bacteria 3618
376 Ga0495638_0042776 3300046460 Bacteria 2860
377 Ga0495638_0085430 3300046460 Bacteria 1908
378 Ga0495638_0104569 3300046460 Bacteria 1688
379 Ga0495638_0196222 3300046460 Bacteria 1142
380 Ga0495653_0000151 3300046463 Bacteria 57928
381 Ga0495653_0217190 3300046463 Bacteria 1287
382 Ga0495650_0003857 3300046471 Bacteria 10631
383 Ga0495650_0005553 3300046471 Bacteria 8141
384 Ga0495650_0005962 3300046471 Bacteria 7727
385 Ga0495650_0047571 3300046471 Bacteria 1793
386 Ga0495650_0209234 3300046471 Bacteria 675
387 Ga0495580_0050165 3300046472 Bacteria 2951
388 Ga0495605_0000147 3300046474 Bacteria 90988
389 Ga0495605_0002577 3300046474 Bacteria 11151
390 Ga0495605_0011759 3300046474 Bacteria 4870
391 Ga0495605_0015327 3300046474 Bacteria 4172
392 Ga0495605_0019150 3300046474 Bacteria 3661
393 Ga0495605_0050253 3300046474 Bacteria 2034
394 Ga0495639_0000002 3300046475 Bacteria 192403
395 Ga0495584_0000084 3300046491 Bacteria 65138
396 Ga0495584_0002475 3300046491 Bacteria 10460
397 Ga0495584_0005134 3300046491 Bacteria 6949
398 Ga0495584_0010457 3300046491 Bacteria 4767
399 Ga0495584_0015017 3300046491 Bacteria 3946
400 Ga0495584_0026065 3300046491 Bacteria 2962
401 Ga0495584_0031264 3300046491 Bacteria 2695
402 Ga0495584_0075978 3300046491 Bacteria 1689
403 Ga0495584_0091813 3300046491 Bacteria 1531
404 Ga0495585_0000234 3300046492 Bacteria 57324
405 Ga0495585_0000523 3300046492 Bacteria 36267
406 Ga0495585_0003811 3300046492 Bacteria 10041
407 Ga0495585_0020869 3300046492 Bacteria 3764
408 Ga0495585_0065349 3300046492 Bacteria 1993
409 Ga0495594_0071216 3300046499 Bacteria 1933
410 Ga0495596_0000012 3300046500 Bacteria 125996
411 Ga0495607_0000084 3300046501 Bacteria 96419
412 Ga0495607_0004317 3300046501 Bacteria 10489
413 Ga0495607_0006134 3300046501 Bacteria 8504
414 Ga0495607_0009835 3300046501 Bacteria 6454
415 Ga0495607_0014731 3300046501 Bacteria 5083
416 Ga0495607_0052906 3300046501 Bacteria 2349
417 Ga0495607_0256686 3300046501 Bacteria 839
418 Ga0495583_0001807 3300046506 Bacteria 20185
419 Ga0495583_0013299 3300046506 Bacteria 4598
420 Ga0495606_0000634 3300046507 Bacteria 55249
421 Ga0495606_0003122 3300046507 Bacteria 17989
422 Ga0495606_0004827 3300046507 Bacteria 13237
423 Ga0495606_0008632 3300046507 Bacteria 8802
424 Ga0495606_0016876 3300046507 Bacteria 5544
425 Ga0495606_0029928 3300046507 Bacteria 3814
426 Ga0495606_0067519 3300046507 Bacteria 2264
427 Ga0495606_0164399 3300046507 Bacteria 1292
428 Ga0495610_0000133 3300046512 Bacteria 82356
429 Ga0495610_0003053 3300046512 Bacteria 13388
430 Ga0495610_0003737 3300046512 Bacteria 11649
431 Ga0495610_0007249 3300046512 Bacteria 7429
432 Ga0495610_0011999 3300046512 Bacteria 5249
433 Ga0495610_0016851 3300046512 Bacteria 4187
434 Ga0495610_0017455 3300046512 Bacteria 4090
435 Ga0495610_0094510 3300046512 Bacteria 1349
436 Ga0495610_0105270 3300046512 Bacteria 1257
437 Ga0495616_0001757 3300046513 Bacteria 14739
438 Ga0495616_0004524 3300046513 Bacteria 8754
439 Ga0495616_0004535 3300046513 Bacteria 8744
440 Ga0495616_0030187 3300046513 Bacteria 2851
441 Ga0495616_0033092 3300046513 Bacteria 2696
442 Ga0495616_0065594 3300046513 Bacteria 1768
443 Ga0495620_0000127 3300046515 Bacteria 62010
444 Ga0495620_0002118 3300046515 Bacteria 11537
445 Ga0495620_0002539 3300046515 Bacteria 10564
446 Ga0495620_0006750 3300046515 Bacteria 6276
447 Ga0495620_0007988 3300046515 Bacteria 5704
448 Ga0495620_0027913 3300046515 Bacteria 2633
449 Ga0495628_0048643 3300046516 Bacteria 3361
450 Ga0495630_0014950 3300046517 Bacteria 5660
451 Ga0495630_0022414 3300046517 Bacteria 4663
452 Ga0495631_0004246 3300046518 Bacteria 7667
453 Ga0495631_0010191 3300046518 Bacteria 4661
454 Ga0495631_0167942 3300046518 Bacteria 941
455 Ga0495631_0194296 3300046518 Bacteria 868
456 Ga0495632_0004655 3300046519 Bacteria 9266
457 Ga0495632_0005740 3300046519 Bacteria 8148
458 Ga0495632_0007976 3300046519 Bacteria 6574
459 Ga0495632_0010142 3300046519 Bacteria 5606
460 Ga0495632_0011904 3300046519 Bacteria 5052
461 Ga0495632_0017077 3300046519 Bacteria 4016
462 Ga0495632_0053888 3300046519 Bacteria 1973
463 Ga0495632_0073255 3300046519 Bacteria 1642
464 Ga0495632_0080809 3300046519 Bacteria 1550
465 Ga0495632_0096096 3300046519 Bacteria 1399
466 Ga0495637_0000038 3300046520 Bacteria 118140
467 Ga0495637_0000246 3300046520 Bacteria 42500
468 Ga0495637_0000562 3300046520 Bacteria 26595
469 Ga0495637_0000710 3300046520 Bacteria 22801
470 Ga0495637_0003314 3300046520 Bacteria 8564
471 Ga0495637_0004299 3300046520 Bacteria 7398
472 Ga0495637_0004752 3300046520 Bacteria 7005
473 Ga0495637_0018084 3300046520 Bacteria 3272
474 Ga0495637_0033289 3300046520 Bacteria 2265
475 Ga0495637_0181969 3300046520 Bacteria 779
476 Ga0495637_0284728 3300046520 Bacteria 589
477 Ga0495643_0004314 3300046522 Bacteria 10017
478 Ga0495643_0012863 3300046522 Bacteria 5033
479 Ga0495643_0013747 3300046522 Bacteria 4834
480 Ga0495643_0018270 3300046522 Bacteria 4079
481 Ga0495643_0085119 3300046522 Bacteria 1640
482 Ga0495644_0000125 3300046523 Bacteria 36680
483 Ga0495644_0006344 3300046523 Bacteria 4587
484 Ga0495644_0007103 3300046523 Bacteria 4331
485 Ga0495644_0154328 3300046523 Bacteria 879
486 Ga0495644_0251388 3300046523 Bacteria 686
487 Ga0495648_0000259 3300046524 Bacteria 59999
488 Ga0495648_0000695 3300046524 Bacteria 35872
489 Ga0495648_0000884 3300046524 Bacteria 31492
490 Ga0495648_0006035 3300046524 Bacteria 9942
491 Ga0495648_0007344 3300046524 Bacteria 8826
492 Ga0495648_0008673 3300046524 Bacteria 7971
493 Ga0495648_0017356 3300046524 Bacteria 5148
494 Ga0495648_0056683 3300046524 Bacteria 2355
495 Ga0495648_0112508 3300046524 Bacteria 1478
496 Ga0495648_0116622 3300046524 Bacteria 1442
497 Ga0495648_0135890 3300046524 Bacteria 1300
498 Ga0495648_0209011 3300046524 Bacteria 971
499 Ga0495648_0257165 3300046524 Bacteria 840
500 Ga0495666_0002039 3300046526 Bacteria 9986
501 Ga0495666_0022607 3300046526 Bacteria 3114
502 Ga0495666_0320682 3300046526 Bacteria 699
503 Ga0495642_0000030 3300046528 Bacteria 89032
504 Ga0495654_0000104 3300046530 Bacteria 95266
505 Ga0495654_0001431 3300046530 Bacteria 16424
506 Ga0495654_0003839 3300046530 Bacteria 9083
507 Ga0495654_0006521 3300046530 Bacteria 6618
508 Ga0495654_0014105 3300046530 Bacteria 4260
509 Ga0495654_0014299 3300046530 Bacteria 4226
510 Ga0495654_0016297 3300046530 Bacteria 3932
511 Ga0495654_0026000 3300046530 Bacteria 3013
512 Ga0495654_0073450 3300046530 Bacteria 1617
513 Ga0495654_0135216 3300046530 Bacteria 1103
514 Ga0495654_0171299 3300046530 Bacteria 946
515 Ga0495654_0238629 3300046530 Bacteria 762
516 Ga0495586_0859337 3300046535 Bacteria 523
517 Ga0495587_0001686 3300046536 Bacteria 14745
518 Ga0495609_0007370 3300046538 Bacteria 5500
519 Ga0495609_0129890 3300046538 Bacteria 1079
520 Ga0495597_0000965 3300046542 Bacteria 22210
521 Ga0495597_0012636 3300046542 Bacteria 4066
522 Ga0495597_0034476 3300046542 Bacteria 2287
523 Ga0495597_0040156 3300046542 Bacteria 2092
524 Ga0495597_0049023 3300046542 Bacteria 1867
525 Ga0495597_0062125 3300046542 Bacteria 1625
526 Ga0495597_0171546 3300046542 Bacteria 880
527 Ga0495597_0298352 3300046542 Bacteria 625
528 Ga0495622_0000047 3300046557 Bacteria 109638
529 Ga0495622_0000650 3300046557 Bacteria 19801
530 Ga0495622_0011294 3300046557 Bacteria 4124
531 Ga0495622_0109725 3300046557 Bacteria 1263
532 Ga0495633_0003115 3300046558 Bacteria 11239
533 Ga0495633_0004004 3300046558 Bacteria 9535
534 Ga0495633_0152420 3300046558 Bacteria 1067
535 Ga0495633_0442408 3300046558 Bacteria 587
536 Ga0495656_0478370 3300046615 Bacteria 658
537 Ga0495668_0000728 3300046616 Bacteria 39499
538 Ga0495668_0002358 3300046616 Bacteria 15711
539 Ga0495668_0004114 3300046616 Bacteria 10535
540 Ga0495634_0000615 3300046642 Bacteria 34539
541 Ga0495611_0009704 3300046648 Bacteria 4069
542 Ga0495611_0064734 3300046648 Bacteria 1665
543 Ga0495611_0407553 3300046648 Bacteria 621
544 Ga0495625_0000103 3300046660 Bacteria 136109
545 Ga0495625_0001514 3300046660 Bacteria 27865
546 Ga0495625_0054529 3300046660 Bacteria 2854
547 Ga0495625_0063830 3300046660 Bacteria 2600
548 Ga0495625_0077378 3300046660 Bacteria 2324
549 Ga0495625_0109830 3300046660 Bacteria 1886
550 Ga0495625_0114308 3300046660 Bacteria 1843
551 Ga0495625_0325030 3300046660 Bacteria 978
552 Ga0495635_0002026 3300046663 Bacteria 13735
553 Ga0495659_0250521 3300046664 Bacteria 738
554 Ga0495661_0001273 3300046665 Bacteria 21643
555 Ga0495661_0025295 3300046665 Bacteria 3835
556 Ga0495661_0056622 3300046665 Bacteria 2344
557 Ga0495661_0063092 3300046665 Bacteria 2191
558 Ga0495661_0099925 3300046665 Bacteria 1635
559 Ga0495661_0234801 3300046665 Bacteria 944
560 Ga0495661_0396150 3300046665 Bacteria 672
561 Ga0495588_0044220 3300046674 Bacteria 2280
562 Ga0495588_0119873 3300046674 Bacteria 1387
563 Ga0495657_0076943 3300046675 Bacteria 2166
564 Ga0495623_0008695 3300046679 Bacteria 6591
565 Ga0495623_0015436 3300046679 Bacteria 4937
566 Ga0495646_0008791 3300046680 Bacteria 6414
567 Ga0495646_0028904 3300046680 Bacteria 3468
568 Ga0495669_0052388 3300046684 Bacteria 1833
569 Ga0495669_0499372 3300046684 Bacteria 592
570 Ga0495613_0001739 3300046689 Bacteria 16574
571 Ga0495613_0014121 3300046689 Bacteria 5925
572 Ga0495624_0000172 3300046690 Bacteria 47939
573 Ga0495624_0203911 3300046690 Bacteria 1201
574 Ga0495670_0002041 3300046691 Bacteria 9957
575 Ga0495670_0002383 3300046691 Bacteria 9257
576 Ga0495670_0019670 3300046691 Bacteria 3327
577 Ga0495670_0046437 3300046691 Bacteria 2169
578 Ga0495670_0545929 3300046691 Bacteria 630
579 Ga0495671_0000136 3300046692 Bacteria 65148
580 Ga0495671_0000541 3300046692 Bacteria 28528
581 Ga0495671_0000799 3300046692 Bacteria 22506
582 Ga0495671_0002282 3300046692 Bacteria 12187
583 Ga0495671_0004879 3300046692 Bacteria 7933
584 Ga0495671_0008285 3300046692 Bacteria 5853
585 Ga0495671_0008616 3300046692 Bacteria 5728
586 Ga0495671_0048873 3300046692 Bacteria 2109
587 Ga0495671_0109272 3300046692 Bacteria 1350
588 Ga0495671_0221633 3300046692 Bacteria 915
589 Ga0495671_0233979 3300046692 Bacteria 888
590 Ga0495649_0002309 3300046694 Bacteria 13533
591 Ga0495649_0004240 3300046694 Bacteria 9400
592 Ga0495649_0004547 3300046694 Bacteria 9050
593 Ga0495649_0005159 3300046694 Bacteria 8375
594 Ga0495649_0005390 3300046694 Bacteria 8143
595 Ga0495649_0007150 3300046694 Bacteria 6854
596 Ga0495649_0007753 3300046694 Bacteria 6516
597 Ga0495649_0016721 3300046694 Bacteria 4154
598 Ga0495649_0019016 3300046694 Bacteria 3859
599 Ga0495649_0056345 3300046694 Bacteria 2122
600 Ga0495649_0062920 3300046694 Bacteria 1994
601 Ga0495589_0000297 3300046794 Bacteria 39517
602 Ga0495589_0002333 3300046794 Bacteria 10666
603 Ga0495589_0002859 3300046794 Bacteria 9559
604 Ga0495589_0003519 3300046794 Bacteria 8474
605 Ga0495589_0009785 3300046794 Bacteria 4977
606 Ga0495589_0043722 3300046794 Bacteria 2229
607 Ga0495589_0045040 3300046794 Bacteria 2192
608 Ga0495600_0021302 3300046809 Bacteria 4149
609 Ga0495600_0050369 3300046809 Bacteria 2717
610 Ga0495660_0000785 3300046810 Bacteria 23782
611 Ga0495660_0002759 3300046810 Bacteria 11073
612 Ga0495660_0010521 3300046810 Bacteria 5383
613 Ga0495660_0014918 3300046810 Bacteria 4494
614 Ga0495660_0034236 3300046810 Bacteria 2843
615 Ga0495660_0077956 3300046810 Bacteria 1742
616 Ga0495660_0108915 3300046810 Bacteria 1415
617 Ga0495660_0228809 3300046810 Bacteria 872
618 Ga0495581_0000452 3300047315 Bacteria 21032
619 Ga0495604_0182626 3300047317 Bacteria 1466
620 Ga0495636_0126540 3300047318 Bacteria 1134
621 Ga0495674_0002341 3300047319 Bacteria 18612
622 Ga0495672_0000174 3300047320 Bacteria 93615
623 Ga0495672_0000185 3300047320 Bacteria 90160
624 Ga0495672_0000218 3300047320 Bacteria 81743
625 Ga0495672_0000841 3300047320 Bacteria 32658
626 Ga0495672_0002969 3300047320 Bacteria 14923
627 Ga0495672_0003653 3300047320 Bacteria 13028
628 Ga0495672_0004386 3300047320 Bacteria 11576
629 Ga0495672_0005978 3300047320 Bacteria 9532
630 Ga0495672_0046569 3300047320 Bacteria 2585
631 Ga0495672_0057311 3300047320 Bacteria 2263
632 Ga0495672_0069814 3300047320 Bacteria 1993
633 Ga0495672_0238649 3300047320 Bacteria 888
634 Ga0495676_0002653 3300047321 Bacteria 16007
635 Ga0495680_0005627 3300047322 Bacteria 11740
636 Ga0495680_0064664 3300047322 Bacteria 2804
637 Ga0495680_0117857 3300047322 Bacteria 1962
638 Ga0495683_0000131 3300047323 Bacteria 75476
639 Ga0495683_0004045 3300047323 Bacteria 8411
640 Ga0495683_0009364 3300047323 Bacteria 5218
641 Ga0495683_0011172 3300047323 Bacteria 4732
642 Ga0495683_0018944 3300047323 Bacteria 3553
643 Ga0495683_0035401 3300047323 Bacteria 2538
644 Ga0495683_0036767 3300047323 Bacteria 2484
645 Ga0495683_0074728 3300047323 Bacteria 1660
646 Ga0495683_0196466 3300047323 Bacteria 912
647 Ga0495687_001097 3300047443 Bacteria 26435
648 Ga0495675_0007804 3300047444 Bacteria 6605
649 Ga0495675_0640830 3300047444 Bacteria 599
650 Ga0495679_000180 3300047446 Bacteria 56996
651 Ga0495679_000247 3300047446 Bacteria 44736
652 Ga0495679_000434 3300047446 Bacteria 30922
653 Ga0495679_000612 3300047446 Bacteria 24130
654 Ga0495679_004870 3300047446 Bacteria 6061
655 Ga0495679_013110 3300047446 Bacteria 3125
656 Ga0495679_022231 3300047446 Bacteria 2174
657 Ga0495679_046751 3300047446 Bacteria 1315
658 Ga0495673_0000328 3300047469 Bacteria 61350
659 Ga0495673_0000503 3300047469 Bacteria 41432
660 Ga0495673_0002039 3300047469 Bacteria 14802
661 Ga0495673_0002083 3300047469 Bacteria 14608
662 Ga0495673_0003594 3300047469 Bacteria 10172
663 Ga0495673_0003724 3300047469 Bacteria 9908
664 Ga0495673_0014478 3300047469 Bacteria 4098
665 Ga0495673_0016368 3300047469 Bacteria 3791
666 Ga0495673_0030492 3300047469 Bacteria 2532
667 Ga0495673_0036415 3300047469 Bacteria 2258
668 Ga0495673_0045651 3300047469 Bacteria 1946
669 Ga0495673_0050434 3300047469 Bacteria 1826
670 Ga0495673_0061973 3300047469 Bacteria 1599
671 Ga0495681_0000581 3300047470 Bacteria 27903
672 Ga0495681_0003808 3300047470 Bacteria 10452
673 Ga0495681_0005002 3300047470 Bacteria 8938
674 Ga0495681_0005691 3300047470 Bacteria 8298
675 Ga0495681_0005884 3300047470 Bacteria 8142
676 Ga0495681_0007175 3300047470 Bacteria 7167
677 Ga0495681_0011298 3300047470 Bacteria 5327
678 Ga0495681_0029827 3300047470 Bacteria 2785
679 Ga0495681_0210442 3300047470 Bacteria 784
680 Ga0495684_0010927 3300047471 Bacteria 7018
681 Ga0495684_0300311 3300047471 Bacteria 1153
682 Ga0495686_0000266 3300047472 Bacteria 93781
683 Ga0495686_0015706 3300047472 Bacteria 5159
684 Ga0495686_0017794 3300047472 Bacteria 4782
685 Ga0495686_0034296 3300047472 Bacteria 3269
686 Ga0495686_0164061 3300047472 Bacteria 1296
687 Ga0495686_0562723 3300047472 Bacteria 594
688 Ga0495593_0003948 3300047673 Bacteria 8856
689 Ga0495593_0012965 3300047673 Bacteria 4761
690 Ga0495602_0000750 3300048088 Bacteria 30821
691 Ga0495602_0152803 3300048088 Bacteria 1812
692 Ga0495626_0000074 3300048091 Bacteria 132552
693 Ga0495626_0000087 3300048091 Bacteria 122878
694 Ga0495626_0000112 3300048091 Bacteria 105221
695 Ga0495626_0000525 3300048091 Bacteria 38289
696 Ga0495626_0000544 3300048091 Bacteria 37459
697 Ga0495626_0002514 3300048091 Bacteria 12639
698 Ga0495626_0007211 3300048091 Bacteria 6212
699 Ga0495626_0012349 3300048091 Bacteria 4481
700 Ga0495626_0036229 3300048091 Bacteria 2351
701 Ga0495626_0060625 3300048091 Bacteria 1723
702 Ga0495626_0106021 3300048091 Bacteria 1221
703 Ga0496102_0000799 3300048905 Bacteria 30569
704 Ga0496102_0399382 3300048905 Bacteria 1292
705 Ga0496103_0001281 3300048906 Bacteria 17149
706 Ga0496105_0517198 3300048908 Bacteria 935
707 Ga0496106_0752034 3300048909 Bacteria 775
708 Ga0496110_0062435 3300048913 Bacteria 3290
709 Ga0496111_0189334 3300048914 Bacteria 1530
710 Ga0496112_0199164 3300048915 Bacteria 1963
711 Ga0496113_0443527 3300048916 Bacteria 1043
712 Ga0496114_0194954 3300048917 Bacteria 1773
713 Ga0496115_0033114 3300048918 Bacteria 4079
714 Ga0496116_0000255 3300048919 Bacteria 94048
715 Ga0496116_0001015 3300048919 Bacteria 34238
716 Ga0496116_0007951 3300048919 Bacteria 9292
717 Ga0496116_0010620 3300048919 Bacteria 7700
718 Ga0496116_0316594 3300048919 Bacteria 733
719 Ga0496117_0000475 3300048920 Bacteria 66690
720 Ga0496117_0005333 3300048920 Bacteria 13555
721 Ga0496117_0005546 3300048920 Bacteria 13210
722 Ga0496117_0028925 3300048920 Bacteria 4281
723 Ga0496117_0033605 3300048920 Bacteria 3876
724 Ga0496118_0000482 3300048921 Bacteria 66218
725 Ga0496118_0004092 3300048921 Bacteria 17677
726 Ga0496118_0011019 3300048921 Bacteria 8880
727 Ga0496118_0018808 3300048921 Bacteria 6204
728 Ga0496119_0045464 3300048922 Bacteria 2752
729 Ga0496119_0261263 3300048922 Bacteria 869
730 Ga0496120_0014928 3300048923 Bacteria 5146
731 Ga0496120_0081872 3300048923 Bacteria 1745
732 Ga0496121_0002213 3300048924 Bacteria 30366
733 Ga0496121_0007471 3300048924 Bacteria 13196
734 Ga0496121_0012122 3300048924 Bacteria 9463
735 Ga0496121_0138498 3300048924 Bacteria 1809
736 Ga0496122_0009192 3300048925 Bacteria 10466
737 Ga0496122_0031382 3300048925 Bacteria 4423
738 Ga0496122_0144978 3300048925 Bacteria 1477
739 Ga0496122_0478571 3300048925 Bacteria 610
740 Ga0496123_0003395 3300048926 Bacteria 17945
741 Ga0496123_0004023 3300048926 Bacteria 15877
742 Ga0496123_0019067 3300048926 Bacteria 5416
743 Ga0496123_0026890 3300048926 Bacteria 4298
744 Ga0496123_0145418 3300048926 Bacteria 1288
745 Ga0496123_0427584 3300048926 Bacteria 595
746 Ga0496124_0000309 3300048927 Bacteria 90452
747 Ga0496124_0015966 3300048927 Bacteria 7167
748 Ga0496124_0021538 3300048927 Bacteria 5937
749 Ga0496124_0035164 3300048927 Bacteria 4386
750 Ga0496124_0066878 3300048927 Bacteria 2991
751 Ga0496124_0093148 3300048927 Bacteria 2452
752 Ga0496124_0135104 3300048927 Bacteria 1953
753 Ga0496125_0003844 3300048928 Bacteria 17815
754 Ga0496125_0048582 3300048928 Bacteria 3536
755 Ga0496125_0516735 3300048928 Bacteria 668
756 Ga0496126_0006999 3300048929 Bacteria 12459
757 Ga0496126_0213283 3300048929 Bacteria 1624
758 Ga0496126_0365625 3300048929 Bacteria 1177
759 Ga0495678_000222 3300049459 Bacteria 65798
760 Ga0495678_000987 3300049459 Bacteria 24370
761 Ga0495678_001994 3300049459 Bacteria 14674
762 Ga0495678_005791 3300049459 Bacteria 6710
763 Ga0495678_007524 3300049459 Bacteria 5629
764 Ga0495678_008180 3300049459 Bacteria 5312
765 Ga0495678_014258 3300049459 Bacteria 3701
766 Ga0495678_026398 3300049459 Bacteria 2480
767 Ga0495678_035033 3300049459 Bacteria 2061
768 Ga0495678_048215 3300049459 Bacteria 1662
769 Ga0495678_051035 3300049459 Bacteria 1600
770 Ga0495678_069458 3300049459 Bacteria 1295
771 Ga0495678_107823 3300049459 Bacteria 954
772 Ga0495682_0000131 3300049460 Bacteria 65377
773 Ga0495682_0000425 3300049460 Bacteria 29587
774 Ga0495682_0003606 3300049460 Bacteria 6826
775 Ga0495682_0026255 3300049460 Bacteria 2163
776 Ga0495682_0026589 3300049460 Bacteria 2147
777 Ga0495682_0040999 3300049460 Bacteria 1697
778 Ga0495682_0061415 3300049460 Bacteria 1356
779 Ga0495682_0208762 3300049460 Bacteria 692
780 Ga0501034_0000045 3300049571 Bacteria 226186
781 Ga0501241_000247 3300049758 Bacteria 12110
782 nmdc:mga03683_3264_c1 3300050489 Bacteria 5200
783 nmdc:mga00v17_3574_c1 3300050491 Bacteria 8033
784 nmdc:mga00v17_395857_c1 3300050491 Bacteria 898
785 nmdc:mga00v17_419715_c1 3300050491 Bacteria 869
786 nmdc:mga00v17_68535_c1 3300050491 Bacteria 2193
787 nmdc:mga0sz30_1001_c1 3300050516 Bacteria 2747
788 Ga0500572_000029 3300053111 Bacteria 44779
789 Ga0500659_0000105 3300053135 Bacteria 44063
790 Ga0500586_072460 3300053145 Bacteria 1206
791 Ga0500634_0001224 3300053161 Bacteria 9685

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0119873 Ga0495588_0119873_25_438 137
2 3300041512 Ga0451853_3249340 Ga0451853_3249340_69_497 139
3 3300046452 Ga0495617_199149 Ga0495617_199149_119_577 139
4 3300046453 Ga0495627_144181 Ga0495627_144181_190_648 139
5 3300046457 Ga0495590_0063193 Ga0495590_0063193_397_855 139
6 3300046458 Ga0495591_000021 Ga0495591_000021_98760_99218 139
7 3300046460 Ga0495638_0104569 Ga0495638_0104569_159_617 139
8 3300046471 Ga0495650_0005962 Ga0495650_0005962_1080_1538 139
9 3300046474 Ga0495605_0050253 Ga0495605_0050253_997_1455 139
10 3300046491 Ga0495584_0026065 Ga0495584_0026065_876_1334 139
11 3300046500 Ga0495596_0000012 Ga0495596_0000012_102580_103038 139
12 3300046507 Ga0495606_0016876 Ga0495606_0016876_997_1455 139
13 3300046512 Ga0495610_0017455 Ga0495610_0017455_2636_3094 139
14 3300046513 Ga0495616_0033092 Ga0495616_0033092_569_1027 139
15 3300046515 Ga0495620_0007988 Ga0495620_0007988_514_972 139
16 3300046518 Ga0495631_0010191 Ga0495631_0010191_568_1026 139
17 3300046519 Ga0495632_0005740 Ga0495632_0005740_1072_1530 139
18 3300046520 Ga0495637_0000246 Ga0495637_0000246_36319_36777 139
19 3300046523 Ga0495644_0006344 Ga0495644_0006344_2585_3043 139
20 3300046524 Ga0495648_0112508 Ga0495648_0112508_452_910 139
21 3300046530 Ga0495654_0016297 Ga0495654_0016297_2895_3353 139
22 3300046558 Ga0495633_0442408 Ga0495633_0442408_18_476 139
23 3300046616 Ga0495668_0000728 Ga0495668_0000728_3631_4089 139
24 3300046660 Ga0495625_0054529 Ga0495625_0054529_134_592 139
25 3300046665 Ga0495661_0056622 Ga0495661_0056622_1738_2196 139
26 3300046694 Ga0495649_0007753 Ga0495649_0007753_3307_3765 139
27 3300046794 Ga0495589_0043722 Ga0495589_0043722_83_541 139
28 3300047469 Ga0495673_0050434 Ga0495673_0050434_749_1207 139
29 3300047470 Ga0495681_0005002 Ga0495681_0005002_2764_3222 139
30 3300047472 Ga0495686_0017794 Ga0495686_0017794_3677_4135 139
31 3300048091 Ga0495626_0000525 Ga0495626_0000525_11388_11846 139
32 3300049459 Ga0495678_069458 Ga0495678_069458_397_855 139
33 3300005328 Ga0070676_10223938 Ga0070676_102239382 141
34 3300005334 Ga0068869_100056224 Ga0068869_1000562243 141
35 3300005340 Ga0070689_100119979 Ga0070689_1001199792 141
36 3300005354 Ga0070675_100117126 Ga0070675_1001171262 141
37 3300005367 Ga0070667_100501921 Ga0070667_1005019212 141
38 3300005438 Ga0070701_10097456 Ga0070701_100974562 141
39 3300005440 Ga0070705_100312453 Ga0070705_1003124531 141
40 3300005456 Ga0070678_100007327 Ga0070678_1000073273 141
41 3300005459 Ga0068867_100100941 Ga0068867_1001009411 141
42 3300005617 Ga0068859_100316393 Ga0068859_1003163931 141
43 3300005841 Ga0068863_101405756 Ga0068863_1014057561 141
44 3300006177 Ga0075362_10072069 Ga0075362_100720693 141
45 3300006237 Ga0097621_100401234 Ga0097621_1004012341 141
46 3300006358 Ga0068871_100011642 Ga0068871_1000116423 141
47 3300006931 Ga0097620_100316392 Ga0097620_1003163921 141
48 3300017792 Ga0163161_10333952 Ga0163161_103339521 141
49 3300025907 Ga0207645_10161504 Ga0207645_101615042 141
50 3300025937 Ga0207669_10254692 Ga0207669_102546922 141
51 3300025942 Ga0207689_10049630 Ga0207689_100496302 141
52 3300025961 Ga0207712_10180635 Ga0207712_101806352 141
53 3300025986 Ga0207658_10084176 Ga0207658_100841762 141
54 3300026075 Ga0207708_10019449 Ga0207708_100194493 141
55 3300026089 Ga0207648_10118187 Ga0207648_101181872 141
56 3300026095 Ga0207676_10290992 Ga0207676_102909922 141
57 3300026121 Ga0207683_10052026 Ga0207683_100520262 141
58 3300028381 Ga0268264_11910173 Ga0268264_119101731 141
59 3300046684 Ga0495669_0499372 Ga0495669_0499372_75_503 141
60 3300041405 Ga0439438_007556 Ga0439438_007556_1328_1771 142
61 3300041407 Ga0439447_027028 Ga0439447_027028_824_1267 142
62 3300041411 Ga0439466_0003461 Ga0439466_0003461_4579_5022 142
63 3300046457 Ga0495590_0007200 Ga0495590_0007200_1468_1911 142
64 3300046458 Ga0495591_010282 Ga0495591_010282_301_744 142
65 3300046460 Ga0495638_0000240 Ga0495638_0000240_73246_73689 142
66 3300046491 Ga0495584_0015017 Ga0495584_0015017_1692_2135 142
67 3300046501 Ga0495607_0052906 Ga0495607_0052906_510_953 142
68 3300046513 Ga0495616_0030187 Ga0495616_0030187_1430_1873 142
69 3300046519 Ga0495632_0010142 Ga0495632_0010142_3677_4120 142
70 3300046522 Ga0495643_0013747 Ga0495643_0013747_899_1342 142
71 3300046523 Ga0495644_0000125 Ga0495644_0000125_32286_32729 142
72 3300046530 Ga0495654_0026000 Ga0495654_0026000_1614_2057 142
73 3300046542 Ga0495597_0012636 Ga0495597_0012636_1533_1976 142
74 3300046648 Ga0495611_0009704 Ga0495611_0009704_2170_2613 142
75 3300046692 Ga0495671_0048873 Ga0495671_0048873_661_1104 142
76 3300046694 Ga0495649_0005159 Ga0495649_0005159_2706_3149 142
77 3300046810 Ga0495660_0014918 Ga0495660_0014918_3886_4329 142
78 3300047320 Ga0495672_0000185 Ga0495672_0000185_10867_11310 142
79 3300047320 Ga0495672_0000218 Ga0495672_0000218_1482_1925 142
80 3300047323 Ga0495683_0004045 Ga0495683_0004045_1514_1957 142
81 3300047469 Ga0495673_0002083 Ga0495673_0002083_1492_1935 142
82 3300047469 Ga0495673_0030492 Ga0495673_0030492_1964_2431 142
83 3300048913 Ga0496110_0062435 Ga0496110_0062435_1091_1534 142
84 3300048927 Ga0496124_0015966 Ga0496124_0015966_5200_5643 142
85 3300049459 Ga0495678_007524 Ga0495678_007524_1497_1940 142
86 3300013102 Ga0157371_10163629 Ga0157371_101636293 143
87 3300047323 Ga0495683_0009364 Ga0495683_0009364_153_665 143
88 3300048908 Ga0496105_0517198 Ga0496105_0517198_291_779 143
89 3300042439 Ga0439464_0033424 Ga0439464_0033424_55_537 144
90 3300046501 Ga0495607_0014731 Ga0495607_0014731_3605_4072 144
91 3300049571 Ga0501034_0000045 Ga0501034_0000045_131559_132041 144
92 3300053135 Ga0500659_0000105 Ga0500659_0000105_902_1384 144
93 3300032002 Ga0307416_102313851 Ga0307416_1023138511 145
94 3300005347 Ga0070668_100005467 Ga0070668_1000054673 146
95 3300005353 Ga0070669_101060759 Ga0070669_1010607591 146
96 3300005356 Ga0070674_100215326 Ga0070674_1002153261 146
97 3300005719 Ga0068861_100313773 Ga0068861_1003137731 146
98 3300005844 Ga0068862_100040294 Ga0068862_1000402942 146
99 3300014326 Ga0157380_10103938 Ga0157380_101039382 146
100 3300014497 Ga0182008_10005940 Ga0182008_100059407 146
101 3300025937 Ga0207669_10076592 Ga0207669_100765922 146
102 3300025972 Ga0207668_10004599 Ga0207668_100045997 146
103 3300026118 Ga0207675_101171014 Ga0207675_1011710141 146
104 3300028380 Ga0268265_10107257 Ga0268265_101072572 146
105 3300046526 Ga0495666_0320682 Ga0495666_0320682_124_597 147
106 3300041405 Ga0439438_012757 Ga0439438_012757_1611_2114 148
107 3300042010 Ga0439452_000077 Ga0439452_000077_63342_63845 148
108 3300042115 Ga0450911_001694 Ga0450911_001694_3580_4080 148
109 3300046460 Ga0495638_0014216 Ga0495638_0014216_1348_1851 148
110 3300046491 Ga0495584_0075978 Ga0495584_0075978_927_1430 148
111 3300046492 Ga0495585_0000523 Ga0495585_0000523_11216_11734 148
112 3300046512 Ga0495610_0016851 Ga0495610_0016851_2105_2608 148
113 3300046524 Ga0495648_0209011 Ga0495648_0209011_234_737 148
114 3300046542 Ga0495597_0049023 Ga0495597_0049023_1295_1798 148
115 3300046615 Ga0495656_0478370 Ga0495656_0478370_103_606 148
116 3300046665 Ga0495661_0099925 Ga0495661_0099925_302_805 148
117 3300047470 Ga0495681_0029827 Ga0495681_0029827_1219_1722 148
118 3300047472 Ga0495686_0015706 Ga0495686_0015706_789_1292 148
119 3300042531 Ga0450918_092929 Ga0450918_092929_19_501 149
120 3300046520 Ga0495637_0003314 Ga0495637_0003314_1379_1864 150
121 3300046694 Ga0495649_0062920 Ga0495649_0062920_115_600 150
122 3300005288 Ga0065714_10006412 Ga0065714_100064124 151
123 3300005289 Ga0065704_10472404 Ga0065704_104724041 151
124 3300005289 Ga0065704_10604140 Ga0065704_106041401 151
125 3300006058 Ga0075432_10002955 Ga0075432_100029553 151
126 3300009011 Ga0105251_10016946 Ga0105251_100169464 151
127 3300015265 Ga0182005_1002371 Ga0182005_10023713 151
128 3300025735 Ga0207713_1012828 Ga0207713_10128283 151
129 3300027907 Ga0207428_10013492 Ga0207428_100134922 151
130 3300041405 Ga0439438_000981 Ga0439438_000981_10032_10505 151
131 3300041407 Ga0439447_022493 Ga0439447_022493_307_780 151
132 3300041411 Ga0439466_0018916 Ga0439466_0018916_566_1054 151
133 3300041413 Ga0439465_0110222 Ga0439465_0110222_116_589 151
134 3300042006 Ga0439432_001360 Ga0439432_001360_3671_4144 151
135 3300042010 Ga0439452_060884 Ga0439452_060884_66_539 151
136 3300042013 Ga0439456_040197 Ga0439456_040197_468_941 151
137 3300042016 Ga0439463_009968 Ga0439463_009968_1563_2036 151
138 3300042115 Ga0450911_001475 Ga0450911_001475_2322_2795 151
139 3300042121 Ga0450919_000545 Ga0450919_000545_458_931 151
140 3300042124 Ga0450922_003138 Ga0450922_003138_444_917 151
141 3300042127 Ga0450890_003233 Ga0450890_003233_1263_1736 151
142 3300042137 Ga0450902_006918 Ga0450902_006918_1243_1731 151
143 3300042145 Ga0450906_001777 Ga0450906_001777_3646_4119 151
144 3300042146 Ga0450907_002098 Ga0450907_002098_1890_2363 151
145 3300042147 Ga0450910_002897 Ga0450910_002897_1234_1707 151
146 3300042156 Ga0439446_0002932 Ga0439446_0002932_1928_2401 151
147 3300042184 Ga0450908_002470 Ga0450908_002470_840_1313 151
148 3300042184 Ga0450908_023536 Ga0450908_023536_538_1026 151
149 3300042185 Ga0450909_000180 Ga0450909_000180_2992_3465 151
150 3300042435 Ga0439434_0041898 Ga0439434_0041898_497_970 151
151 3300042439 Ga0439464_0032381 Ga0439464_0032381_690_1163 151
152 3300042531 Ga0450918_019228 Ga0450918_019228_102_575 151
153 3300042993 Ga0439440_0042699 Ga0439440_0042699_467_940 151
154 3300046452 Ga0495617_004248 Ga0495617_004248_3972_4460 151
155 3300046452 Ga0495617_070033 Ga0495617_070033_27_515 151
156 3300046453 Ga0495627_003287 Ga0495627_003287_984_1472 151
157 3300046455 Ga0495603_0069782 Ga0495603_0069782_914_1405 151
158 3300046457 Ga0495590_0027246 Ga0495590_0027246_1299_1787 151
159 3300046458 Ga0495591_008205 Ga0495591_008205_497_985 151
160 3300046460 Ga0495638_0028318 Ga0495638_0028318_615_1103 151
161 3300046460 Ga0495638_0196222 Ga0495638_0196222_82_555 151
162 3300046471 Ga0495650_0003857 Ga0495650_0003857_8659_9147 151
163 3300046474 Ga0495605_0015327 Ga0495605_0015327_3151_3639 151
164 3300046491 Ga0495584_0000084 Ga0495584_0000084_39361_39834 151
165 3300046491 Ga0495584_0010457 Ga0495584_0010457_1265_1753 151
166 3300046492 Ga0495585_0065349 Ga0495585_0065349_649_1137 151
167 3300046501 Ga0495607_0009835 Ga0495607_0009835_2897_3385 151
168 3300046507 Ga0495606_0004827 Ga0495606_0004827_8929_9417 151
169 3300046512 Ga0495610_0011999 Ga0495610_0011999_3713_4201 151
170 3300046512 Ga0495610_0094510 Ga0495610_0094510_217_705 151
171 3300046513 Ga0495616_0065594 Ga0495616_0065594_597_1085 151
172 3300046515 Ga0495620_0002118 Ga0495620_0002118_5876_6364 151
173 3300046517 Ga0495630_0022414 Ga0495630_0022414_2742_3233 151
174 3300046518 Ga0495631_0167942 Ga0495631_0167942_438_911 151
175 3300046518 Ga0495631_0194296 Ga0495631_0194296_102_590 151
176 3300046519 Ga0495632_0004655 Ga0495632_0004655_8659_9147 151
177 3300046519 Ga0495632_0017077 Ga0495632_0017077_1350_1838 151
178 3300046520 Ga0495637_0000562 Ga0495637_0000562_1731_2204 151
179 3300046520 Ga0495637_0033289 Ga0495637_0033289_678_1166 151
180 3300046522 Ga0495643_0018270 Ga0495643_0018270_256_744 151
181 3300046523 Ga0495644_0007103 Ga0495644_0007103_1637_2125 151
182 3300046523 Ga0495644_0154328 Ga0495644_0154328_59_547 151
183 3300046524 Ga0495648_0135890 Ga0495648_0135890_82_570 151
184 3300046526 Ga0495666_0002039 Ga0495666_0002039_2648_3139 151
185 3300046530 Ga0495654_0238629 Ga0495654_0238629_46_534 151
186 3300046535 Ga0495586_0859337 Ga0495586_0859337_18_509 151
187 3300046542 Ga0495597_0034476 Ga0495597_0034476_578_1066 151
188 3300046542 Ga0495597_0040156 Ga0495597_0040156_1358_1846 151
189 3300046542 Ga0495597_0062125 Ga0495597_0062125_578_1066 151
190 3300046542 Ga0495597_0171546 Ga0495597_0171546_72_560 151
191 3300046542 Ga0495597_0298352 Ga0495597_0298352_117_590 151
192 3300046558 Ga0495633_0152420 Ga0495633_0152420_340_828 151
193 3300046660 Ga0495625_0063830 Ga0495625_0063830_1317_1805 151
194 3300046660 Ga0495625_0109830 Ga0495625_0109830_254_727 151
195 3300046660 Ga0495625_0325030 Ga0495625_0325030_311_799 151
196 3300046665 Ga0495661_0025295 Ga0495661_0025295_2707_3195 151
197 3300046665 Ga0495661_0063092 Ga0495661_0063092_499_987 151
198 3300046675 Ga0495657_0076943 Ga0495657_0076943_286_777 151
199 3300046679 Ga0495623_0015436 Ga0495623_0015436_4180_4671 151
200 3300046691 Ga0495670_0002383 Ga0495670_0002383_4983_5456 151
201 3300046691 Ga0495670_0019670 Ga0495670_0019670_2074_2562 151
202 3300046691 Ga0495670_0046437 Ga0495670_0046437_1049_1537 151
203 3300046692 Ga0495671_0000136 Ga0495671_0000136_25305_25778 151
204 3300046692 Ga0495671_0109272 Ga0495671_0109272_214_702 151
205 3300046694 Ga0495649_0019016 Ga0495649_0019016_809_1297 151
206 3300046694 Ga0495649_0056345 Ga0495649_0056345_505_993 151
207 3300046794 Ga0495589_0045040 Ga0495589_0045040_299_787 151
208 3300046809 Ga0495600_0050369 Ga0495600_0050369_101_592 151
209 3300046810 Ga0495660_0034236 Ga0495660_0034236_798_1286 151
210 3300046810 Ga0495660_0228809 Ga0495660_0228809_93_581 151
211 3300047318 Ga0495636_0126540 Ga0495636_0126540_43_516 151
212 3300047320 Ga0495672_0057311 Ga0495672_0057311_654_1142 151
213 3300047320 Ga0495672_0069814 Ga0495672_0069814_1063_1554 151
214 3300047322 Ga0495680_0064664 Ga0495680_0064664_1302_1793 151
215 3300047322 Ga0495680_0117857 Ga0495680_0117857_352_843 151
216 3300047323 Ga0495683_0035401 Ga0495683_0035401_1967_2440 151
217 3300047323 Ga0495683_0036767 Ga0495683_0036767_742_1230 151
218 3300047444 Ga0495675_0640830 Ga0495675_0640830_69_560 151
219 3300047446 Ga0495679_013110 Ga0495679_013110_798_1286 151
220 3300047446 Ga0495679_046751 Ga0495679_046751_639_1127 151
221 3300047469 Ga0495673_0014478 Ga0495673_0014478_2628_3116 151
222 3300047469 Ga0495673_0016368 Ga0495673_0016368_678_1166 151
223 3300047469 Ga0495673_0061973 Ga0495673_0061973_70_543 151
224 3300047470 Ga0495681_0007175 Ga0495681_0007175_870_1358 151
225 3300047470 Ga0495681_0011298 Ga0495681_0011298_1108_1596 151
226 3300047471 Ga0495684_0300311 Ga0495684_0300311_380_871 151
227 3300047472 Ga0495686_0164061 Ga0495686_0164061_548_1036 151
228 3300047673 Ga0495593_0003948 Ga0495593_0003948_5414_5905 151
229 3300048091 Ga0495626_0000112 Ga0495626_0000112_76912_77400 151
230 3300048091 Ga0495626_0012349 Ga0495626_0012349_2891_3364 151
231 3300048914 Ga0496111_0189334 Ga0496111_0189334_942_1430 151
232 3300048915 Ga0496112_0199164 Ga0496112_0199164_1026_1511 151
233 3300048916 Ga0496113_0443527 Ga0496113_0443527_221_706 151
234 3300048924 Ga0496121_0002213 Ga0496121_0002213_5771_6256 151
235 3300048925 Ga0496122_0144978 Ga0496122_0144978_927_1412 151
236 3300048926 Ga0496123_0026890 Ga0496123_0026890_3594_4079 151
237 3300049459 Ga0495678_000987 Ga0495678_000987_4067_4540 151
238 3300049459 Ga0495678_005791 Ga0495678_005791_4909_5397 151
239 3300049459 Ga0495678_026398 Ga0495678_026398_1586_2074 151
240 3300049460 Ga0495682_0061415 Ga0495682_0061415_539_1012 151
241 iso_pu_bacteria 2511231004 2511255526 151
242 iso_pu_bacteria 2511231016 2511328541 151
243 iso_pu_bacteria 2511231021 2511358730 151
244 iso_pu_bacteria 2511231022 2511363147 151
245 iso_pu_bacteria 2599185288 2599880635 151
246 iso_pu_bacteria 2599185303 2599952066 151
247 iso_pu_bacteria 2619619299 2621300297 151
248 iso_pu_bacteria 2738541265 2738674664 151
249 iso_pu_bacteria 2738541282 2738753057 151
250 iso_pu_bacteria 2738541294 2738806244 151
251 iso_pu_bacteria 2738541303 2738862212 151
252 iso_pu_bacteria 2738541309 2738893604 151
253 iso_pu_bacteria 2808606385 2808980384 151
254 iso_pu_bacteria 2808606388 2808996105 151
255 iso_pu_bacteria 2816332298 2817490629 151
256 iso_pu_bacteria 2834028612 2834034409 151
257 iso_pu_bacteria 2852612431 2852613987 151
258 iso_pu_bacteria 2852667396 2852668276 151
259 iso_pu_bacteria 2908446538 2908449077 151
260 iso_pu_bacteria 2945928738 2945933046 151
261 iso_pu_bacteria 8054285046 8054290047 151
262 iso_pu_bacteria 8055817908 8055821511 151
263 iso_pu_bacteria 8056131705 8056135198 151
264 iso_pu_bacteria 8056161164 8056165685 151
265 3300046460 Ga0495638_0042776 Ga0495638_0042776_1462_1959 152
266 3300046507 Ga0495606_0067519 Ga0495606_0067519_1180_1677 152
267 3300046519 Ga0495632_0080809 Ga0495632_0080809_14_511 152
268 3300046530 Ga0495654_0006521 Ga0495654_0006521_1461_1958 152
269 3300046692 Ga0495671_0233979 Ga0495671_0233979_278_775 152
270 3300046694 Ga0495649_0016721 Ga0495649_0016721_3543_4040 152
271 3300046794 Ga0495589_0002859 Ga0495589_0002859_8983_9480 152
272 iso_pu_bacteria 2597489888 2597864299 152
273 iso_pu_bacteria 2599185167 2599397518 152
274 iso_pu_bacteria 2599185179 2599451963 152
275 iso_pu_bacteria 2599185189 2599509068 152
276 iso_pu_bacteria 2599185190 2599513655 152
277 iso_pu_bacteria 2599185191 2599521960 152
278 iso_pu_bacteria 2599185290 2599892332 152
279 iso_pu_bacteria 2600255296 2601690362 152
280 iso_pu_bacteria 2643221565 2643842177 152
281 iso_pu_bacteria 2643221571 2643870582 152
282 iso_pu_bacteria 2643221713 2644622476 152
283 iso_pu_bacteria 2721755607 2723249114 152
284 iso_pu_bacteria 2842826826 2842830828 152
285 iso_pu_bacteria 2842837860 2842840246 152
286 iso_pu_bacteria 2860867994 2860870919 152
287 iso_pu_bacteria 2931390751 2931393528 152
288 iso_pu_bacteria 2946027586 2946031247 152
289 iso_pu_bacteria 2947233263 2947238208 152
290 iso_pu_bacteria 8054347763 8054351434 152
291 iso_pu_bacteria 8054503363 8054506746 152
292 iso_pu_bacteria 8056148874 8056154997 152
293 iso_pu_bacteria 8056177738 8056178706 152
294 3300046452 Ga0495617_003562 Ga0495617_003562_5173_5703 153
295 3300003751 Ga0055538_1000133 Ga0055538_100013319 154
296 3300003752 Ga0055539_1000182 Ga0055539_100018219 154
297 3300003756 Ga0055533_1000181 Ga0055533_100018119 154
298 3300003758 Ga0055532_1000195 Ga0055532_100019519 154
299 3300003759 Ga0055525_1000250 Ga0055525_100025019 154
300 3300003761 Ga0055535_1008029 Ga0055535_10080293 154
301 3300003841 Ga0055541_1000067 Ga0055541_100006760 154
302 3300009011 Ga0105251_10020138 Ga0105251_100201381 154
303 3300009036 Ga0105244_10003827 Ga0105244_100038271 154
304 3300009036 Ga0105244_10025780 Ga0105244_100257804 154
305 3300009148 Ga0105243_10138235 Ga0105243_101382352 154
306 3300011119 Ga0105246_10002958 Ga0105246_100029587 154
307 3300013100 Ga0157373_10001351 Ga0157373_100013512 154
308 3300015262 Ga0182007_10037365 Ga0182007_100373652 154
309 3300015265 Ga0182005_1000149 Ga0182005_10001497 154
310 3300025206 Ga0209435_103779 Ga0209435_1037791 154
311 3300025224 Ga0209784_100112 Ga0209784_10011219 154
312 3300025225 Ga0209566_100045 Ga0209566_100045162 154
313 3300025226 Ga0209674_100156 Ga0209674_10015619 154
314 3300025229 Ga0209147_100056 Ga0209147_100056162 154
315 3300025230 Ga0209563_100064 Ga0209563_100064162 154
316 3300025233 Ga0209437_106567 Ga0209437_1065671 154
317 3300025242 Ga0209258_100411 Ga0209258_10041116 154
318 3300025246 Ga0209646_1000147 Ga0209646_100014720 154
319 3300025253 Ga0209677_100103 Ga0209677_10010319 154
320 3300025728 Ga0207655_1000022 Ga0207655_1000022202 154
321 3300025728 Ga0207655_1004514 Ga0207655_10045147 154
322 3300025935 Ga0207709_10120368 Ga0207709_101203682 154
323 3300042009 Ga0439451_047248 Ga0439451_047248_354_836 154
324 3300042013 Ga0439456_000194 Ga0439456_000194_3361_3843 154
325 3300042016 Ga0439463_000020 Ga0439463_000020_8942_9424 154
326 3300046458 Ga0495591_006430 Ga0495591_006430_1337_1819 154
327 3300046501 Ga0495607_0000084 Ga0495607_0000084_34513_34995 154
328 3300046519 Ga0495632_0011904 Ga0495632_0011904_4074_4556 154
329 3300046520 Ga0495637_0000038 Ga0495637_0000038_62311_62793 154
330 3300046524 Ga0495648_0000884 Ga0495648_0000884_14507_14977 154
331 3300046530 Ga0495654_0003839 Ga0495654_0003839_2728_3210 154
332 3300046530 Ga0495654_0135216 Ga0495654_0135216_400_870 154
333 3300046665 Ga0495661_0396150 Ga0495661_0396150_65_535 154
334 3300046692 Ga0495671_0002282 Ga0495671_0002282_7352_7834 154
335 3300047446 Ga0495679_000180 Ga0495679_000180_43958_44440 154
336 3300047469 Ga0495673_0000503 Ga0495673_0000503_35152_35634 154
337 3300049460 Ga0495682_0000131 Ga0495682_0000131_21930_22412 154
338 iso_pu_bacteria 2511231010 2511291258 154
339 iso_pu_bacteria 2600255318 2601796141 154
340 iso_pu_bacteria 2603880185 2606075006 154
341 iso_pu_bacteria 2603880199 2606127869 154
342 iso_pu_bacteria 2623620443 2624480186 154
343 iso_pu_bacteria 2713897149 2715757245 154
344 iso_pu_bacteria 2713897149 2715758417 154
345 iso_pu_bacteria 2878029506 2878032099 154
346 iso_pu_bacteria 2919063839 2919068575 154
347 iso_pu_bacteria 2935353572 2935353664 154
348 iso_pu_bacteria 2945961074 2945963100 154
349 3300005288 Ga0065714_10064945 Ga0065714_1006494516 155
350 3300005290 Ga0065712_10080270 Ga0065712_100802706 155
351 3300005331 Ga0070670_100000112 Ga0070670_10000011221 155
352 3300005331 Ga0070670_100000945 Ga0070670_10000094513 155
353 3300005344 Ga0070661_100000310 Ga0070661_10000031022 155
354 3300005356 Ga0070674_101058135 Ga0070674_1010581351 155
355 3300005548 Ga0070665_100458325 Ga0070665_1004583252 155
356 3300005564 Ga0070664_100000241 Ga0070664_10000024121 155
357 3300006051 Ga0075364_10252061 Ga0075364_102520611 155
358 3300006058 Ga0075432_10017391 Ga0075432_100173912 155
359 3300009011 Ga0105251_10001646 Ga0105251_1000164623 155
360 3300009036 Ga0105244_10046539 Ga0105244_100465393 155
361 3300009092 Ga0105250_10000337 Ga0105250_1000033733 155
362 3300009176 Ga0105242_10000099 Ga0105242_1000009922 155
363 3300009545 Ga0105237_10002377 Ga0105237_100023777 155
364 3300011119 Ga0105246_10001438 Ga0105246_1000143815 155
365 3300011119 Ga0105246_11521776 Ga0105246_115217761 155
366 3300013100 Ga0157373_10000596 Ga0157373_1000059616 155
367 3300013100 Ga0157373_10001464 Ga0157373_1000146421 155
368 3300013100 Ga0157373_10090111 Ga0157373_100901113 155
369 3300013104 Ga0157370_10070762 Ga0157370_100707623 155
370 3300013105 Ga0157369_10052524 Ga0157369_100525246 155
371 3300013306 Ga0163162_10029228 Ga0163162_100292285 155
372 3300013306 Ga0163162_10047982 Ga0163162_100479822 155
373 3300013308 Ga0157375_10000602 Ga0157375_1000060218 155
374 3300013308 Ga0157375_10001025 Ga0157375_1000102525 155
375 3300014497 Ga0182008_10001189 Ga0182008_1000118920 155
376 3300015261 Ga0182006_1000158 Ga0182006_100015855 155
377 3300015262 Ga0182007_10000769 Ga0182007_100007691 155
378 3300025711 Ga0207696_1000090 Ga0207696_1000090199 155
379 3300025711 Ga0207696_1000176 Ga0207696_100017687 155
380 3300025711 Ga0207696_1000177 Ga0207696_100017722 155
381 3300025728 Ga0207655_1000203 Ga0207655_100020387 155
382 3300025728 Ga0207655_1035418 Ga0207655_10354181 155
383 3300025735 Ga0207713_1001317 Ga0207713_10013173 155
384 3300025914 Ga0207671_10002355 Ga0207671_100023553 155
385 3300025920 Ga0207649_10000695 Ga0207649_1000069522 155
386 3300025925 Ga0207650_10000145 Ga0207650_1000014532 155
387 3300025925 Ga0207650_10000721 Ga0207650_1000072120 155
388 3300025934 Ga0207686_10007813 Ga0207686_100078132 155
389 3300025945 Ga0207679_10000037 Ga0207679_1000003722 155
390 3300030521 Ga0307511_10110964 Ga0307511_101109642 155
391 3300031344 Ga0265316_10185481 Ga0265316_101854814 155
392 3300031712 Ga0265342_10469672 Ga0265342_104696721 155
393 3300031731 Ga0307405_10000073 Ga0307405_1000007329 155
394 3300031911 Ga0307412_10032406 Ga0307412_100324065 155
395 3300042006 Ga0439432_000022 Ga0439432_000022_19121_19588 155
396 3300042134 Ga0450898_003631 Ga0450898_003631_23_490 155
397 3300046460 Ga0495638_0019151 Ga0495638_0019151_3083_3592 155
398 3300046515 Ga0495620_0027913 Ga0495620_0027913_2050_2517 155
399 3300046520 Ga0495637_0181969 Ga0495637_0181969_240_749 155
400 3300046524 Ga0495648_0008673 Ga0495648_0008673_30_497 155
401 3300046648 Ga0495611_0407553 Ga0495611_0407553_105_572 155
402 3300046665 Ga0495661_0001273 Ga0495661_0001273_11939_12406 155
403 3300046810 Ga0495660_0077956 Ga0495660_0077956_58_525 155
404 3300047446 Ga0495679_000247 Ga0495679_000247_3408_3875 155
405 3300048920 Ga0496117_0005333 Ga0496117_0005333_8072_8539 155
406 3300048923 Ga0496120_0014928 Ga0496120_0014928_178_645 155
407 3300048924 Ga0496121_0012122 Ga0496121_0012122_760_1227 155
408 3300048925 Ga0496122_0031382 Ga0496122_0031382_124_591 155
409 3300048926 Ga0496123_0004023 Ga0496123_0004023_15302_15769 155
410 3300048926 Ga0496123_0019067 Ga0496123_0019067_2095_2562 155
411 3300048927 Ga0496124_0066878 Ga0496124_0066878_557_1024 155
412 3300048927 Ga0496124_0093148 Ga0496124_0093148_1228_1695 155
413 3300048928 Ga0496125_0003844 Ga0496125_0003844_500_967 155
414 3300048928 Ga0496125_0048582 Ga0496125_0048582_2427_2894 155
415 3300048928 Ga0496125_0516735 Ga0496125_0516735_85_552 155
416 3300048929 Ga0496126_0006999 Ga0496126_0006999_1081_1548 155
417 3300053161 Ga0500634_0001224 Ga0500634_0001224_1002_1469 155
418 iso_pu_bacteria 2511231011 2511296524 155
419 iso_pu_bacteria 2511231023 2511367963 155
420 iso_pu_bacteria 2713897148 2715753507 155
421 iso_pu_bacteria 2718217725 2718634533 155
422 iso_pu_bacteria 2738543025 2739313176 155
423 iso_pu_bacteria 2773857673 2774138000 155
424 iso_pu_bacteria 2784132063 2784264928 155
425 iso_pu_bacteria 2818991456 2819656854 155
426 iso_pu_bacteria 2842832357 2842835310 155
427 iso_pu_bacteria 2842843487 2842844129 155
428 iso_pu_bacteria 2852657418 2852662149 155
429 iso_pu_bacteria 2880230671 2880233031 155
430 iso_pu_bacteria 2904518522 2904523419 155
431 iso_pu_bacteria 2919487758 2919492924 155
432 iso_pu_bacteria 2969304461 2969307027 155
433 iso_pu_bacteria 2998139840 2998142221 155
434 iso_pu_bacteria 3007614139 3007619274 155
435 iso_pu_bacteria 3007718800 3007723366 155
436 iso_pu_bacteria 3007855910 3007856428 155
437 iso_pu_bacteria 3007861166 3007862521 155
438 iso_pu_bacteria 8029995093 8029998487 155
439 iso_pu_bacteria 8056166840 8056168849 155
440 iso_pu_bacteria 8056569372 8056574256 155
441 3300003781 Ga0055536_1040697 Ga0055536_10406971 156
442 3300003791 Ga0055530_10016572 Ga0055530_100165722 156
443 3300005288 Ga0065714_10028204 Ga0065714_100282042 156
444 3300005457 Ga0070662_100007847 Ga0070662_1000078473 156
445 3300005578 Ga0068854_100008490 Ga0068854_1000084908 156
446 3300005834 Ga0068851_10005508 Ga0068851_100055086 156
447 3300006051 Ga0075364_10058419 Ga0075364_100584193 156
448 3300006051 Ga0075364_10401361 Ga0075364_104013612 156
449 3300006051 Ga0075364_10588389 Ga0075364_105883891 156
450 3300006058 Ga0075432_10027014 Ga0075432_100270143 156
451 3300006058 Ga0075432_10070899 Ga0075432_100708992 156
452 3300006058 Ga0075432_10181661 Ga0075432_101816611 156
453 3300006177 Ga0075362_10032802 Ga0075362_100328023 156
454 3300006177 Ga0075362_10033895 Ga0075362_100338953 156
455 3300006177 Ga0075362_10147453 Ga0075362_101474531 156
456 3300006186 Ga0075369_10083682 Ga0075369_100836822 156
457 3300006946 Ga0079104_1000068 Ga0079104_1000068158 156
458 3300009011 Ga0105251_10020803 Ga0105251_100208036 156
459 3300009036 Ga0105244_10020302 Ga0105244_100203022 156
460 3300009036 Ga0105244_10141964 Ga0105244_101419642 156
461 3300009148 Ga0105243_10055674 Ga0105243_100556744 156
462 3300009177 Ga0105248_10849713 Ga0105248_108497132 156
463 3300013100 Ga0157373_10005498 Ga0157373_100054981 156
464 3300013100 Ga0157373_10331129 Ga0157373_103311292 156
465 3300013104 Ga0157370_10257075 Ga0157370_102570753 156
466 3300013104 Ga0157370_11313840 Ga0157370_113138401 156
467 3300013306 Ga0163162_10589285 Ga0163162_105892851 156
468 3300014497 Ga0182008_10051469 Ga0182008_100514692 156
469 3300015261 Ga0182006_1000073 Ga0182006_100007399 156
470 3300015262 Ga0182007_10000031 Ga0182007_1000003110 156
471 3300015265 Ga0182005_1005290 Ga0182005_10052903 156
472 3300017792 Ga0163161_10180763 Ga0163161_101807631 156
473 3300017792 Ga0163161_11030684 Ga0163161_110306841 156
474 3300025292 Ga0209676_1008332 Ga0209676_10083324 156
475 3300025298 Ga0209050_1001809 Ga0209050_10018097 156
476 3300025303 Ga0209051_1005603 Ga0209051_10056035 156
477 3300025321 Ga0207656_10002993 Ga0207656_100029936 156
478 3300025728 Ga0207655_1025620 Ga0207655_10256202 156
479 3300025728 Ga0207655_1043160 Ga0207655_10431603 156
480 3300025728 Ga0207655_1044338 Ga0207655_10443382 156
481 3300025728 Ga0207655_1067195 Ga0207655_10671952 156
482 3300025735 Ga0207713_1001509 Ga0207713_10015096 156
483 3300025735 Ga0207713_1008208 Ga0207713_10082085 156
484 3300025923 Ga0207681_10003303 Ga0207681_100033039 156
485 3300025933 Ga0207706_10003884 Ga0207706_100038846 156
486 3300025935 Ga0207709_10030722 Ga0207709_100307222 156
487 3300025941 Ga0207711_10883964 Ga0207711_108839642 156
488 3300025981 Ga0207640_10124822 Ga0207640_101248222 156
489 3300027111 Ga0209281_1000168 Ga0209281_10001688 156
490 3300027907 Ga0207428_10080727 Ga0207428_100807271 156
491 3300027907 Ga0207428_10143551 Ga0207428_101435512 156
492 3300027907 Ga0207428_10212817 Ga0207428_102128172 156
493 3300041405 Ga0439438_000661 Ga0439438_000661_4018_4527 156
494 3300041405 Ga0439438_006127 Ga0439438_006127_116_625 156
495 3300041407 Ga0439447_000516 Ga0439447_000516_5827_6336 156
496 3300041407 Ga0439447_000847 Ga0439447_000847_4865_5353 156
497 3300041407 Ga0439447_084311 Ga0439447_084311_75_584 156
498 3300041411 Ga0439466_0010274 Ga0439466_0010274_1878_2387 156
499 3300041411 Ga0439466_0034499 Ga0439466_0034499_1101_1610 156
500 3300041411 Ga0439466_0038148 Ga0439466_0038148_495_983 156
501 3300042009 Ga0439451_013378 Ga0439451_013378_798_1286 156
502 3300042009 Ga0439451_052159 Ga0439451_052159_22_531 156
503 3300042010 Ga0439452_001764 Ga0439452_001764_3969_4478 156
504 3300042010 Ga0439452_065003 Ga0439452_065003_156_665 156
505 3300042013 Ga0439456_009275 Ga0439456_009275_226_735 156
506 3300042016 Ga0439463_006880 Ga0439463_006880_744_1232 156
507 3300042115 Ga0450911_005682 Ga0450911_005682_115_624 156
508 3300042124 Ga0450922_000117 Ga0450922_000117_2424_2933 156
509 3300042125 Ga0450923_004356 Ga0450923_004356_1266_1775 156
510 3300042137 Ga0450902_009470 Ga0450902_009470_222_710 156
511 3300042138 Ga0450903_001356 Ga0450903_001356_2382_2891 156
512 3300042142 Ga0450905_006961 Ga0450905_006961_184_672 156
513 3300042145 Ga0450906_000314 Ga0450906_000314_1959_2468 156
514 3300042146 Ga0450907_000780 Ga0450907_000780_5404_5913 156
515 3300042147 Ga0450910_000701 Ga0450910_000701_785_1294 156
516 3300042461 Ga0439460_0002037 Ga0439460_0002037_997_1506 156
517 3300042531 Ga0450918_010451 Ga0450918_010451_735_1244 156
518 3300046452 Ga0495617_030719 Ga0495617_030719_122_631 156
519 3300046452 Ga0495617_043989 Ga0495617_043989_709_1218 156
520 3300046453 Ga0495627_118885 Ga0495627_118885_39_548 156
521 3300046457 Ga0495590_0001444 Ga0495590_0001444_6449_6958 156
522 3300046457 Ga0495590_0003719 Ga0495590_0003719_251_760 156
523 3300046458 Ga0495591_022614 Ga0495591_022614_1264_1773 156
524 3300046458 Ga0495591_035580 Ga0495591_035580_754_1263 156
525 3300046460 Ga0495638_0002830 Ga0495638_0002830_543_1052 156
526 3300046460 Ga0495638_0019276 Ga0495638_0019276_3803_4312 156
527 3300046460 Ga0495638_0025349 Ga0495638_0025349_937_1425 156
528 3300046463 Ga0495653_0217190 Ga0495653_0217190_271_759 156
529 3300046471 Ga0495650_0047571 Ga0495650_0047571_492_1001 156
530 3300046471 Ga0495650_0209234 Ga0495650_0209234_11_520 156
531 3300046472 Ga0495580_0050165 Ga0495580_0050165_1294_1782 156
532 3300046474 Ga0495605_0002577 Ga0495605_0002577_5086_5574 156
533 3300046474 Ga0495605_0011759 Ga0495605_0011759_3173_3682 156
534 3300046474 Ga0495605_0019150 Ga0495605_0019150_501_989 156
535 3300046475 Ga0495639_0000002 Ga0495639_0000002_93507_93995 156
536 3300046491 Ga0495584_0002475 Ga0495584_0002475_443_931 156
537 3300046491 Ga0495584_0005134 Ga0495584_0005134_2295_2804 156
538 3300046491 Ga0495584_0031264 Ga0495584_0031264_1348_1857 156
539 3300046491 Ga0495584_0091813 Ga0495584_0091813_45_554 156
540 3300046499 Ga0495594_0071216 Ga0495594_0071216_942_1430 156
541 3300046501 Ga0495607_0004317 Ga0495607_0004317_8278_8787 156
542 3300046501 Ga0495607_0256686 Ga0495607_0256686_143_652 156
543 3300046506 Ga0495583_0001807 Ga0495583_0001807_13933_14442 156
544 3300046506 Ga0495583_0013299 Ga0495583_0013299_3825_4313 156
545 3300046507 Ga0495606_0008632 Ga0495606_0008632_5968_6477 156
546 3300046512 Ga0495610_0003053 Ga0495610_0003053_5968_6477 156
547 3300046512 Ga0495610_0003737 Ga0495610_0003737_10900_11409 156
548 3300046512 Ga0495610_0007249 Ga0495610_0007249_5114_5623 156
549 3300046512 Ga0495610_0105270 Ga0495610_0105270_70_579 156
550 3300046515 Ga0495620_0002539 Ga0495620_0002539_5118_5627 156
551 3300046515 Ga0495620_0006750 Ga0495620_0006750_5096_5605 156
552 3300046516 Ga0495628_0048643 Ga0495628_0048643_2193_2681 156
553 3300046517 Ga0495630_0014950 Ga0495630_0014950_3772_4260 156
554 3300046518 Ga0495631_0004246 Ga0495631_0004246_2808_3317 156
555 3300046520 Ga0495637_0004299 Ga0495637_0004299_6500_7000 156
556 3300046520 Ga0495637_0018084 Ga0495637_0018084_1547_2056 156
557 3300046520 Ga0495637_0284728 Ga0495637_0284728_60_569 156
558 3300046522 Ga0495643_0012863 Ga0495643_0012863_247_756 156
559 3300046523 Ga0495644_0251388 Ga0495644_0251388_52_561 156
560 3300046524 Ga0495648_0000695 Ga0495648_0000695_28171_28680 156
561 3300046524 Ga0495648_0007344 Ga0495648_0007344_2583_3092 156
562 3300046524 Ga0495648_0017356 Ga0495648_0017356_74_583 156
563 3300046524 Ga0495648_0056683 Ga0495648_0056683_445_954 156
564 3300046524 Ga0495648_0257165 Ga0495648_0257165_111_620 156
565 3300046528 Ga0495642_0000030 Ga0495642_0000030_6845_7354 156
566 3300046530 Ga0495654_0001431 Ga0495654_0001431_5277_5786 156
567 3300046530 Ga0495654_0014105 Ga0495654_0014105_967_1476 156
568 3300046530 Ga0495654_0014299 Ga0495654_0014299_256_765 156
569 3300046536 Ga0495587_0001686 Ga0495587_0001686_11194_11682 156
570 3300046557 Ga0495622_0000650 Ga0495622_0000650_18519_19007 156
571 3300046557 Ga0495622_0011294 Ga0495622_0011294_140_649 156
572 3300046558 Ga0495633_0003115 Ga0495633_0003115_4106_4615 156
573 3300046616 Ga0495668_0004114 Ga0495668_0004114_2474_2983 156
574 3300046642 Ga0495634_0000615 Ga0495634_0000615_28769_29257 156
575 3300046660 Ga0495625_0001514 Ga0495625_0001514_12022_12531 156
576 3300046660 Ga0495625_0114308 Ga0495625_0114308_118_627 156
577 3300046663 Ga0495635_0002026 Ga0495635_0002026_5251_5739 156
578 3300046664 Ga0495659_0250521 Ga0495659_0250521_76_564 156
579 3300046674 Ga0495588_0044220 Ga0495588_0044220_141_650 156
580 3300046679 Ga0495623_0008695 Ga0495623_0008695_2508_2996 156
581 3300046680 Ga0495646_0028904 Ga0495646_0028904_1324_1812 156
582 3300046684 Ga0495669_0052388 Ga0495669_0052388_84_593 156
583 3300046689 Ga0495613_0014121 Ga0495613_0014121_2034_2522 156
584 3300046691 Ga0495670_0002041 Ga0495670_0002041_7057_7566 156
585 3300046691 Ga0495670_0545929 Ga0495670_0545929_95_604 156
586 3300046692 Ga0495671_0004879 Ga0495671_0004879_3104_3613 156
587 3300046692 Ga0495671_0008616 Ga0495671_0008616_2528_3037 156
588 3300046692 Ga0495671_0221633 Ga0495671_0221633_166_675 156
589 3300046694 Ga0495649_0004240 Ga0495649_0004240_5968_6477 156
590 3300046694 Ga0495649_0004547 Ga0495649_0004547_5456_5965 156
591 3300046794 Ga0495589_0003519 Ga0495589_0003519_3145_3654 156
592 3300046794 Ga0495589_0009785 Ga0495589_0009785_3903_4412 156
593 3300046810 Ga0495660_0002759 Ga0495660_0002759_5218_5727 156
594 3300046810 Ga0495660_0010521 Ga0495660_0010521_4007_4495 156
595 3300047315 Ga0495581_0000452 Ga0495581_0000452_2843_3331 156
596 3300047319 Ga0495674_0002341 Ga0495674_0002341_11160_11648 156
597 3300047320 Ga0495672_0000841 Ga0495672_0000841_25412_25921 156
598 3300047320 Ga0495672_0004386 Ga0495672_0004386_5495_6004 156
599 3300047320 Ga0495672_0005978 Ga0495672_0005978_5563_6072 156
600 3300047320 Ga0495672_0046569 Ga0495672_0046569_1883_2392 156
601 3300047320 Ga0495672_0238649 Ga0495672_0238649_67_576 156
602 3300047323 Ga0495683_0000131 Ga0495683_0000131_38709_39218 156
603 3300047323 Ga0495683_0018944 Ga0495683_0018944_795_1283 156
604 3300047323 Ga0495683_0074728 Ga0495683_0074728_1002_1511 156
605 3300047323 Ga0495683_0196466 Ga0495683_0196466_43_552 156
606 3300047443 Ga0495687_001097 Ga0495687_001097_1873_2382 156
607 3300047444 Ga0495675_0007804 Ga0495675_0007804_3053_3541 156
608 3300047446 Ga0495679_000434 Ga0495679_000434_16569_17039 156
609 3300047446 Ga0495679_022231 Ga0495679_022231_212_721 156
610 3300047469 Ga0495673_0000328 Ga0495673_0000328_12231_12731 156
611 3300047469 Ga0495673_0003594 Ga0495673_0003594_4047_4535 156
612 3300047469 Ga0495673_0003724 Ga0495673_0003724_9066_9575 156
613 3300047470 Ga0495681_0000581 Ga0495681_0000581_6278_6787 156
614 3300047470 Ga0495681_0003808 Ga0495681_0003808_2861_3370 156
615 3300047470 Ga0495681_0005884 Ga0495681_0005884_5512_6021 156
616 3300047470 Ga0495681_0210442 Ga0495681_0210442_76_585 156
617 3300047472 Ga0495686_0034296 Ga0495686_0034296_1570_2079 156
618 3300047673 Ga0495593_0012965 Ga0495593_0012965_806_1294 156
619 3300048088 Ga0495602_0152803 Ga0495602_0152803_891_1379 156
620 3300048091 Ga0495626_0000087 Ga0495626_0000087_28550_29059 156
621 3300048091 Ga0495626_0000544 Ga0495626_0000544_18657_19145 156
622 3300048091 Ga0495626_0002514 Ga0495626_0002514_11938_12447 156
623 3300048091 Ga0495626_0036229 Ga0495626_0036229_736_1245 156
624 3300048905 Ga0496102_0000799 Ga0496102_0000799_24019_24507 156
625 3300048905 Ga0496102_0399382 Ga0496102_0399382_586_1095 156
626 3300048906 Ga0496103_0001281 Ga0496103_0001281_5174_5662 156
627 3300048909 Ga0496106_0752034 Ga0496106_0752034_182_670 156
628 3300048917 Ga0496114_0194954 Ga0496114_0194954_876_1364 156
629 3300048918 Ga0496115_0033114 Ga0496115_0033114_3197_3685 156
630 3300048919 Ga0496116_0010620 Ga0496116_0010620_4801_5289 156
631 3300048919 Ga0496116_0316594 Ga0496116_0316594_203_712 156
632 3300048920 Ga0496117_0005546 Ga0496117_0005546_7849_8337 156
633 3300048920 Ga0496117_0033605 Ga0496117_0033605_398_907 156
634 3300048921 Ga0496118_0011019 Ga0496118_0011019_3314_3802 156
635 3300048921 Ga0496118_0018808 Ga0496118_0018808_815_1324 156
636 3300048922 Ga0496119_0261263 Ga0496119_0261263_162_650 156
637 3300048924 Ga0496121_0138498 Ga0496121_0138498_224_712 156
638 3300048927 Ga0496124_0035164 Ga0496124_0035164_3187_3696 156
639 3300048929 Ga0496126_0213283 Ga0496126_0213283_471_959 156
640 3300049459 Ga0495678_051035 Ga0495678_051035_707_1195 156
641 3300049459 Ga0495678_107823 Ga0495678_107823_289_798 156
642 3300049460 Ga0495682_0003606 Ga0495682_0003606_6121_6630 156
643 3300049460 Ga0495682_0026589 Ga0495682_0026589_1562_2071 156
644 3300049460 Ga0495682_0208762 Ga0495682_0208762_111_620 156
645 3300050489 nmdc:mga03683_3264_c1 nmdc:mga03683_3264_c1_125_634 156
646 3300050491 nmdc:mga00v17_3574_c1 nmdc:mga00v17_3574_c1_3290_3799 156
647 3300050491 nmdc:mga00v17_395857_c1 nmdc:mga00v17_395857_c1_216_725 156
648 3300050491 nmdc:mga00v17_68535_c1 nmdc:mga00v17_68535_c1_831_1340 156
649 3300050516 nmdc:mga0sz30_1001_c1 nmdc:mga0sz30_1001_c1_2079_2588 156
650 iso_pu_bacteria 2511231007 2511274394 156
651 iso_pu_bacteria 2511231012 2511303642 156
652 iso_pu_bacteria 2511231014 2511316490 156
653 iso_pu_bacteria 2511231015 2511322413 156
654 iso_pu_bacteria 2511231017 2511335445 156
655 iso_pu_bacteria 2511231020 2511350745 156
656 iso_pu_bacteria 2623620446 2624492075 156
657 iso_pu_bacteria 2643221589 2643953463 156
658 iso_pu_bacteria 2643221602 2644021205 156
659 iso_pu_bacteria 2738543004 2739200135 156
660 iso_pu_bacteria 2738543015 2739261842 156
661 iso_pu_bacteria 2808606377 2808931491 156
662 iso_pu_bacteria 2808606381 2808953733 156
663 iso_pu_bacteria 2808606382 2808958355 156
664 iso_pu_bacteria 2860339153 2860342184 156
665 iso_pu_bacteria 2904550169 2904551915 156
666 iso_pu_bacteria 2919697872 2919698247 156
667 iso_pu_bacteria 2931396565 2931401120 156
668 iso_pu_bacteria 2939636861 2939641583 156
669 iso_pu_bacteria 8019775933 8019779866 156
670 iso_pu_bacteria 8052494512 8052496542 156
671 iso_pu_bacteria 8056125926 8056128216 156
672 3300003791 Ga0055530_10000041 Ga0055530_1000004152 157
673 3300003792 Ga0055540_1000195 Ga0055540_100019544 157
674 3300005289 Ga0065704_10119359 Ga0065704_101193591 157
675 3300005441 Ga0070700_100171993 Ga0070700_1001719931 157
676 3300005444 Ga0070694_100219194 Ga0070694_1002191941 157
677 3300005543 Ga0070672_100353736 Ga0070672_1003537362 157
678 3300005843 Ga0068860_100822777 Ga0068860_1008227771 157
679 3300006177 Ga0075362_10294315 Ga0075362_102943152 157
680 3300009098 Ga0105245_10656334 Ga0105245_106563341 157
681 3300009148 Ga0105243_12033645 Ga0105243_120336451 157
682 3300009176 Ga0105242_10094770 Ga0105242_100947702 157
683 3300013297 Ga0157378_10334083 Ga0157378_103340831 157
684 3300013306 Ga0163162_10143362 Ga0163162_101433623 157
685 3300014969 Ga0157376_10186074 Ga0157376_101860742 157
686 3300015261 Ga0182006_1009488 Ga0182006_10094885 157
687 3300025292 Ga0209676_1000062 Ga0209676_1000062101 157
688 3300025298 Ga0209050_1000004 Ga0209050_10000041402 157
689 3300025303 Ga0209051_1000181 Ga0209051_100018160 157
690 3300025914 Ga0207671_10000060 Ga0207671_1000006096 157
691 3300025934 Ga0207686_10126878 Ga0207686_101268782 157
692 3300025938 Ga0207704_10067008 Ga0207704_100670083 157
693 3300025940 Ga0207691_10254933 Ga0207691_102549332 157
694 3300028380 Ga0268265_10308815 Ga0268265_103088152 157
695 3300041411 Ga0439466_0000243 Ga0439466_0000243_1892_2383 157
696 3300042013 Ga0439456_013477 Ga0439456_013477_159_650 157
697 3300042016 Ga0439463_000257 Ga0439463_000257_12015_12506 157
698 3300042993 Ga0439440_0000375 Ga0439440_0000375_1309_1800 157
699 iso_pu_bacteria 2511231006 2511265072 157
700 iso_pu_bacteria 2512047018 2512327132 157
701 iso_pu_bacteria 2582580891 2583791654 157
702 iso_pu_bacteria 2597489887 2597857439 157
703 iso_pu_bacteria 2599185185 2599484623 157
704 iso_pu_bacteria 2599185257 2599802108 157
705 iso_pu_bacteria 2600254931 2600367404 157
706 iso_pu_bacteria 2671180172 2671769056 157
707 iso_pu_bacteria 2740892503 2743736865 157
708 iso_pu_bacteria 2923153595 2923155891 157
709 iso_pu_bacteria 2984286254 2984290132 157
710 iso_pu_bacteria 3007395558 3007401432 157
711 iso_pu_bacteria 8015687852 8015690133 157
712 iso_pu_bacteria 8055770955 8055773253 157
713 3300003781 Ga0055536_1000115 Ga0055536_100011519 158
714 3300003791 Ga0055530_10003977 Ga0055530_100039775 158
715 3300003792 Ga0055540_1000204 Ga0055540_10002049 158
716 3300003794 Ga0055531_10000186 Ga0055531_100001869 158
717 3300005288 Ga0065714_10087459 Ga0065714_100874592 158
718 3300005353 Ga0070669_101093576 Ga0070669_1010935761 158
719 3300009011 Ga0105251_10254189 Ga0105251_102541892 158
720 3300017792 Ga0163161_10368723 Ga0163161_103687232 158
721 3300025291 Ga0209675_1010776 Ga0209675_10107763 158
722 3300025292 Ga0209676_1000102 Ga0209676_100010219 158
723 3300025298 Ga0209050_1000105 Ga0209050_100010519 158
724 3300025303 Ga0209051_1000066 Ga0209051_100006619 158
725 3300025304 Ga0209257_1000124 Ga0209257_1000124171 158
726 3300025711 Ga0207696_1001491 Ga0207696_100149111 158
727 3300025711 Ga0207696_1097355 Ga0207696_10973552 158
728 3300025728 Ga0207655_1002205 Ga0207655_10022055 158
729 3300025735 Ga0207713_1000199 Ga0207713_100019919 158
730 3300025735 Ga0207713_1026862 Ga0207713_10268625 158
731 3300025735 Ga0207713_1136376 Ga0207713_11363762 158
732 3300025923 Ga0207681_10989441 Ga0207681_109894412 158
733 3300046794 Ga0495589_0000297 Ga0495589_0000297_18768_19244 158
734 3300047472 Ga0495686_0562723 Ga0495686_0562723_74_550 158
735 3300048925 Ga0496122_0478571 Ga0496122_0478571_102_578 158
736 3300048926 Ga0496123_0427584 Ga0496123_0427584_90_566 158
737 3300048927 Ga0496124_0000309 Ga0496124_0000309_57264_57740 158
738 3300005457 Ga0070662_100050082 Ga0070662_1000500825 159
739 3300005548 Ga0070665_100171494 Ga0070665_1001714941 159
740 3300009011 Ga0105251_10011003 Ga0105251_100110032 159
741 3300009036 Ga0105244_10001447 Ga0105244_100014477 159
742 3300009036 Ga0105244_10018753 Ga0105244_100187532 159
743 3300009092 Ga0105250_10000506 Ga0105250_100005066 159
744 3300009092 Ga0105250_10001803 Ga0105250_100018035 159
745 3300009148 Ga0105243_10000491 Ga0105243_100004917 159
746 3300011119 Ga0105246_10000501 Ga0105246_100005013 159
747 3300012498 Ga0157345_1000004 Ga0157345_100000411 159
748 3300013100 Ga0157373_10016104 Ga0157373_100161042 159
749 3300013100 Ga0157373_10377092 Ga0157373_103770922 159
750 3300013105 Ga0157369_10706704 Ga0157369_107067042 159
751 3300013307 Ga0157372_10003028 Ga0157372_100030285 159
752 3300014497 Ga0182008_10000878 Ga0182008_100008785 159
753 3300015261 Ga0182006_1018318 Ga0182006_10183181 159
754 3300017792 Ga0163161_10129360 Ga0163161_101293603 159
755 3300017792 Ga0163161_10136904 Ga0163161_101369042 159
756 3300025230 Ga0209563_101430 Ga0209563_1014304 159
757 3300025711 Ga0207696_1000051 Ga0207696_100005112 159
758 3300025711 Ga0207696_1001893 Ga0207696_10018937 159
759 3300025728 Ga0207655_1000080 Ga0207655_100008087 159
760 3300025728 Ga0207655_1002480 Ga0207655_10024806 159
761 3300025735 Ga0207713_1021403 Ga0207713_10214035 159
762 3300025735 Ga0207713_1057320 Ga0207713_10573202 159
763 3300025933 Ga0207706_10051270 Ga0207706_100512709 159
764 3300025935 Ga0207709_10000011 Ga0207709_1000001178 159
765 3300028379 Ga0268266_10059082 Ga0268266_100590823 159
766 3300030734 Ga0316179_1024534 Ga0316179_10245341 159
767 3300031548 Ga0307408_100004965 Ga0307408_1000049657 159
768 3300031548 Ga0307408_100032029 Ga0307408_1000320296 159
769 3300031824 Ga0307413_11151411 Ga0307413_111514112 159
770 3300031901 Ga0307406_10748779 Ga0307406_107487792 159
771 3300031911 Ga0307412_10182834 Ga0307412_101828342 159
772 3300031995 Ga0307409_101686090 Ga0307409_1016860902 159
773 3300032002 Ga0307416_102411748 Ga0307416_1024117481 159
774 3300032004 Ga0307414_10022107 Ga0307414_100221072 159
775 3300032005 Ga0307411_10009261 Ga0307411_100092612 159
776 3300038705 Ga0237819_00233 Ga0237819_00233_302_781 159
777 3300041405 Ga0439438_006478 Ga0439438_006478_628_1107 159
778 3300041407 Ga0439447_023816 Ga0439447_023816_277_756 159
779 3300041411 Ga0439466_0019324 Ga0439466_0019324_1909_2388 159
780 3300042010 Ga0439452_000081 Ga0439452_000081_73677_74156 159
781 3300042013 Ga0439456_001343 Ga0439456_001343_2418_2897 159
782 3300042016 Ga0439463_038882 Ga0439463_038882_138_617 159
783 3300042115 Ga0450911_000488 Ga0450911_000488_7506_7985 159
784 3300042136 Ga0450900_008085 Ga0450900_008085_62_541 159
785 3300042137 Ga0450902_006363 Ga0450902_006363_196_675 159
786 3300042145 Ga0450906_000446 Ga0450906_000446_7816_8295 159
787 3300046452 Ga0495617_021389 Ga0495617_021389_383_862 159
788 3300046453 Ga0495627_005742 Ga0495627_005742_3988_4467 159
789 3300046457 Ga0495590_0008013 Ga0495590_0008013_2168_2647 159
790 3300046458 Ga0495591_000032 Ga0495591_000032_12462_12941 159
791 3300046458 Ga0495591_000082 Ga0495591_000082_94839_95318 159
792 3300046458 Ga0495591_000120 Ga0495591_000120_14861_15340 159
793 3300046458 Ga0495591_019213 Ga0495591_019213_1561_2040 159
794 3300046458 Ga0495591_037727 Ga0495591_037727_771_1250 159
795 3300046460 Ga0495638_0000449 Ga0495638_0000449_17506_17985 159
796 3300046460 Ga0495638_0085430 Ga0495638_0085430_1288_1767 159
797 3300046463 Ga0495653_0000151 Ga0495653_0000151_3397_3876 159
798 3300046471 Ga0495650_0005553 Ga0495650_0005553_5558_6037 159
799 3300046474 Ga0495605_0000147 Ga0495605_0000147_78186_78665 159
800 3300046492 Ga0495585_0000234 Ga0495585_0000234_31351_31830 159
801 3300046492 Ga0495585_0003811 Ga0495585_0003811_9039_9518 159
802 3300046492 Ga0495585_0020869 Ga0495585_0020869_514_993 159
803 3300046501 Ga0495607_0006134 Ga0495607_0006134_5687_6166 159
804 3300046507 Ga0495606_0000634 Ga0495606_0000634_2183_2662 159
805 3300046507 Ga0495606_0003122 Ga0495606_0003122_16496_16975 159
806 3300046507 Ga0495606_0029928 Ga0495606_0029928_3229_3708 159
807 3300046507 Ga0495606_0164399 Ga0495606_0164399_57_536 159
808 3300046512 Ga0495610_0000133 Ga0495610_0000133_16330_16809 159
809 3300046513 Ga0495616_0001757 Ga0495616_0001757_13573_14052 159
810 3300046513 Ga0495616_0004524 Ga0495616_0004524_5692_6171 159
811 3300046513 Ga0495616_0004535 Ga0495616_0004535_458_937 159
812 3300046515 Ga0495620_0000127 Ga0495620_0000127_11577_12056 159
813 3300046519 Ga0495632_0007976 Ga0495632_0007976_1138_1617 159
814 3300046519 Ga0495632_0053888 Ga0495632_0053888_983_1462 159
815 3300046519 Ga0495632_0073255 Ga0495632_0073255_923_1402 159
816 3300046519 Ga0495632_0096096 Ga0495632_0096096_483_962 159
817 3300046520 Ga0495637_0000710 Ga0495637_0000710_278_757 159
818 3300046520 Ga0495637_0004752 Ga0495637_0004752_779_1258 159
819 3300046522 Ga0495643_0004314 Ga0495643_0004314_831_1310 159
820 3300046522 Ga0495643_0085119 Ga0495643_0085119_591_1070 159
821 3300046524 Ga0495648_0000259 Ga0495648_0000259_20504_20983 159
822 3300046524 Ga0495648_0006035 Ga0495648_0006035_8423_8902 159
823 3300046524 Ga0495648_0116622 Ga0495648_0116622_129_608 159
824 3300046526 Ga0495666_0022607 Ga0495666_0022607_2604_3083 159
825 3300046530 Ga0495654_0000104 Ga0495654_0000104_14421_14900 159
826 3300046530 Ga0495654_0073450 Ga0495654_0073450_673_1152 159
827 3300046530 Ga0495654_0171299 Ga0495654_0171299_332_811 159
828 3300046538 Ga0495609_0007370 Ga0495609_0007370_4685_5164 159
829 3300046538 Ga0495609_0129890 Ga0495609_0129890_129_608 159
830 3300046542 Ga0495597_0000965 Ga0495597_0000965_20887_21366 159
831 3300046557 Ga0495622_0000047 Ga0495622_0000047_10208_10687 159
832 3300046557 Ga0495622_0109725 Ga0495622_0109725_270_749 159
833 3300046616 Ga0495668_0002358 Ga0495668_0002358_4848_5327 159
834 3300046648 Ga0495611_0064734 Ga0495611_0064734_771_1250 159
835 3300046660 Ga0495625_0000103 Ga0495625_0000103_122290_122769 159
836 3300046660 Ga0495625_0077378 Ga0495625_0077378_546_1025 159
837 3300046665 Ga0495661_0234801 Ga0495661_0234801_29_508 159
838 3300046680 Ga0495646_0008791 Ga0495646_0008791_2232_2711 159
839 3300046689 Ga0495613_0001739 Ga0495613_0001739_9632_10111 159
840 3300046690 Ga0495624_0000172 Ga0495624_0000172_9129_9608 159
841 3300046690 Ga0495624_0203911 Ga0495624_0203911_422_901 159
842 3300046692 Ga0495671_0000541 Ga0495671_0000541_24206_24685 159
843 3300046692 Ga0495671_0000799 Ga0495671_0000799_2835_3314 159
844 3300046692 Ga0495671_0008285 Ga0495671_0008285_4710_5189 159
845 3300046694 Ga0495649_0002309 Ga0495649_0002309_12540_13019 159
846 3300046694 Ga0495649_0005390 Ga0495649_0005390_5689_6168 159
847 3300046694 Ga0495649_0007150 Ga0495649_0007150_4012_4491 159
848 3300046794 Ga0495589_0002333 Ga0495589_0002333_9494_9973 159
849 3300046809 Ga0495600_0021302 Ga0495600_0021302_1280_1759 159
850 3300046810 Ga0495660_0000785 Ga0495660_0000785_2179_2658 159
851 3300046810 Ga0495660_0108915 Ga0495660_0108915_156_635 159
852 3300047317 Ga0495604_0182626 Ga0495604_0182626_139_618 159
853 3300047320 Ga0495672_0000174 Ga0495672_0000174_8958_9437 159
854 3300047320 Ga0495672_0003653 Ga0495672_0003653_12439_12918 159
855 3300047321 Ga0495676_0002653 Ga0495676_0002653_6583_7062 159
856 3300047322 Ga0495680_0005627 Ga0495680_0005627_8724_9203 159
857 3300047323 Ga0495683_0011172 Ga0495683_0011172_3989_4468 159
858 3300047446 Ga0495679_000612 Ga0495679_000612_10302_10781 159
859 3300047446 Ga0495679_004870 Ga0495679_004870_5505_5984 159
860 3300047469 Ga0495673_0002039 Ga0495673_0002039_13520_13999 159
861 3300047469 Ga0495673_0036415 Ga0495673_0036415_158_637 159
862 3300047469 Ga0495673_0045651 Ga0495673_0045651_1162_1641 159
863 3300047470 Ga0495681_0005691 Ga0495681_0005691_2196_2675 159
864 3300047471 Ga0495684_0010927 Ga0495684_0010927_22_501 159
865 3300047472 Ga0495686_0000266 Ga0495686_0000266_82884_83363 159
866 3300048088 Ga0495602_0000750 Ga0495602_0000750_21563_22042 159
867 3300048091 Ga0495626_0000074 Ga0495626_0000074_9786_10265 159
868 3300048091 Ga0495626_0007211 Ga0495626_0007211_3957_4436 159
869 3300048091 Ga0495626_0060625 Ga0495626_0060625_400_879 159
870 3300048091 Ga0495626_0106021 Ga0495626_0106021_645_1124 159
871 3300048919 Ga0496116_0000255 Ga0496116_0000255_61828_62307 159
872 3300048919 Ga0496116_0001015 Ga0496116_0001015_5940_6419 159
873 3300048919 Ga0496116_0007951 Ga0496116_0007951_122_601 159
874 3300048920 Ga0496117_0000475 Ga0496117_0000475_49227_49706 159
875 3300048920 Ga0496117_0028925 Ga0496117_0028925_3138_3617 159
876 3300048921 Ga0496118_0000482 Ga0496118_0000482_49291_49770 159
877 3300048921 Ga0496118_0004092 Ga0496118_0004092_14753_15232 159
878 3300048923 Ga0496120_0081872 Ga0496120_0081872_1251_1730 159
879 3300048924 Ga0496121_0007471 Ga0496121_0007471_9616_10095 159
880 3300048925 Ga0496122_0009192 Ga0496122_0009192_1764_2243 159
881 3300048926 Ga0496123_0003395 Ga0496123_0003395_16292_16771 159
882 3300048926 Ga0496123_0145418 Ga0496123_0145418_759_1238 159
883 3300048927 Ga0496124_0021538 Ga0496124_0021538_4796_5275 159
884 3300049459 Ga0495678_000222 Ga0495678_000222_51456_51935 159
885 3300049459 Ga0495678_001994 Ga0495678_001994_676_1155 159
886 3300049459 Ga0495678_008180 Ga0495678_008180_4698_5177 159
887 3300049459 Ga0495678_014258 Ga0495678_014258_107_586 159
888 3300049459 Ga0495678_035033 Ga0495678_035033_1223_1702 159
889 3300049459 Ga0495678_048215 Ga0495678_048215_765_1244 159
890 3300049460 Ga0495682_0000425 Ga0495682_0000425_9433_9912 159
891 3300049460 Ga0495682_0026255 Ga0495682_0026255_384_863 159
892 3300049460 Ga0495682_0040999 Ga0495682_0040999_231_710 159
893 3300049758 Ga0501241_000247 Ga0501241_000247_5214_5693 159
894 3300050491 nmdc:mga00v17_419715_c1 nmdc:mga00v17_419715_c1_276_755 159
895 3300053111 Ga0500572_000029 Ga0500572_000029_672_1151 159
896 3300053145 Ga0500586_072460 Ga0500586_072460_293_772 159
897 3300046558 Ga0495633_0004004 Ga0495633_0004004_6607_7092 160
898 3300047320 Ga0495672_0002969 Ga0495672_0002969_6217_6702 160
899 3300009148 Ga0105243_10013616 Ga0105243_100136167 161
900 3300025711 Ga0207696_1000023 Ga0207696_1000023227 161
901 2162886007 SwRhRL2b_contig_1296335 SwRhRL2b_0544.00003170 162
902 3300009092 Ga0105250_10190021 Ga0105250_101900211 162
903 3300025711 Ga0207696_1026827 Ga0207696_10268273 162
904 3300025728 Ga0207655_1012613 Ga0207655_10126136 162
905 3300048922 Ga0496119_0045464 Ga0496119_0045464_328_816 162
906 3300048927 Ga0496124_0135104 Ga0496124_0135104_622_1110 162
907 3300048929 Ga0496126_0365625 Ga0496126_0365625_314_802 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04314

PCuAC

Copper chaperone PCu(A)C

31

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s5z-assembly2.cif.gz_B structure of rib r28n from streptococcus pyogenes 0.9071 120 144
3zja-assembly1.cif.gz_A the crystal structure of a cu(i) metallochaperone from streptomyces lividans 0.9066 26 146
3zja-assembly1.cif.gz_A the crystal structure of a cu(i) metallochaperone from streptomyces lividans 0.8916 26 146
6sx1-assembly1.cif.gz_A structure of rib standard, a rib domain from lactobacillus acidophilus 0.8649 120 144
6p1g-assembly2.cif.gz_B copper-bound pcuac domain from pmof2 0.8635 28 146
ID Description Score Start End Superfamily
3zk0A01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.8945 34 145 2.60.40.1890
3zk0A01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.8708 34 145 2.60.40.1890
2k6zA01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.8231 34 145 2.60.40.1890
2k6zA01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.8032 34 145 2.60.40.1890
af_Q9TZQ1_71_373_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7318 121 148 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A0K8NV28-F1-model_v4 Copper metallochaperone 0.9674 29 145
AF-A0A1F3YZ32-F1-model_v4 Transporter 0.9657 28 150
AF-A0A0B7IZJ8-F1-model_v4 Copper chaperone PCu(A)C 0.9579 15 145
AF-A0A0T2QF31-F1-model_v4 Copper chaperone PCu(A)C 0.9437 31 149
AF-A0A3M4C9F5-F1-model_v4 deleted 0.9417 17 147

Feature Viewer

pLDDT pTM Quality
84.52 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map