F485367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 391 | 791 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300046501|Ga0495607_0014731|Ga0495607_0014731_3605_4072 |
| Length | 155 |
| Sequence | MTLFCAPRIKQLALGLALIGMAWQVSAQTQVNDAWVRATVAGQPSSGAFMTLQADTDSKLLSVQSPVAKLVQIHQSSMKQVESVALPAGKAVSFDPHGYHIMLMDLTGQIKEGSKVPLTLTVENAKGEKETIKVDAEARALGTMDHGNXXXSKMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 12 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 13 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 14 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 15 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 16 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 17 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 18 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 19 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 20 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 21 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 22 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 23 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 24 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 25 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 26 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 27 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 28 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 29 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 30 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 31 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 32 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 33 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 34 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 35 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 36 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 37 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 38 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 39 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 40 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 41 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 42 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 43 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 44 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 45 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 46 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 47 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 48 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 49 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 50 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 51 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 52 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 53 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 54 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 55 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 56 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 57 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 58 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 59 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 60 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 61 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 62 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 63 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 64 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 65 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 66 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 67 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 68 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 69 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 70 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 71 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 72 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 73 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 74 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 75 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 76 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 77 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 78 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 79 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 80 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 81 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 82 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 83 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 84 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 85 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 86 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 87 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 88 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 89 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 90 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 91 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 92 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 93 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 94 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 95 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 96 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 97 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 98 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 99 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 100 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 101 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 103 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 104 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 105 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 106 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 107 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 108 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 109 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 110 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 111 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 115 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 118 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 119 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 132 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 138 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 139 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 143 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 144 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 145 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 146 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 150 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 236 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 237 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 242 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 243 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 244 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 245 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 246 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 247 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 248 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 249 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 250 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 251 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 252 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 253 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 254 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 255 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 256 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 257 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 258 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 259 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 260 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 261 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 264 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 265 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 266 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 267 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 355 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 356 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 357 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 358 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 374 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 375 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 376 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 377 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 378 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 379 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 380 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 381 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 382 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 383 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 384 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 385 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 386 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 387 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 388 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 389 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 390 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 391 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.21 |
| Metatranscriptomes | 0 |
| Isolates | 12.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.06 |
| Nodule | 1.87 |
| Rhizoplane | 2.98 |
| Rhizosphere | 79.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1296335 | 2162886007 | Bacteria | 2138 |
| 2 | Ga0055538_1000133 | 3300003751 | Bacteria | 53318 |
| 3 | Ga0055539_1000182 | 3300003752 | Bacteria | 53318 |
| 4 | Ga0055533_1000181 | 3300003756 | Bacteria | 53318 |
| 5 | Ga0055532_1000195 | 3300003758 | Bacteria | 50586 |
| 6 | Ga0055525_1000250 | 3300003759 | Bacteria | 53318 |
| 7 | Ga0055535_1008029 | 3300003761 | Bacteria | 1947 |
| 8 | Ga0055536_1000115 | 3300003781 | Bacteria | 69846 |
| 9 | Ga0055536_1040697 | 3300003781 | Bacteria | 1104 |
| 10 | Ga0055530_10000041 | 3300003791 | Bacteria | 112647 |
| 11 | Ga0055530_10003977 | 3300003791 | Bacteria | 7980 |
| 12 | Ga0055530_10016572 | 3300003791 | Bacteria | 2347 |
| 13 | Ga0055540_1000195 | 3300003792 | Bacteria | 58558 |
| 14 | Ga0055540_1000204 | 3300003792 | Bacteria | 57435 |
| 15 | Ga0055531_10000186 | 3300003794 | Bacteria | 69495 |
| 16 | Ga0055541_1000067 | 3300003841 | Bacteria | 99013 |
| 17 | Ga0065714_10006412 | 3300005288 | Bacteria | 6071 |
| 18 | Ga0065714_10028204 | 3300005288 | Bacteria | 1188 |
| 19 | Ga0065714_10064945 | 3300005288 | Bacteria | 15037 |
| 20 | Ga0065714_10087459 | 3300005288 | Bacteria | 2057 |
| 21 | Ga0065704_10119359 | 3300005289 | Bacteria | 1801 |
| 22 | Ga0065704_10472404 | 3300005289 | Bacteria | 688 |
| 23 | Ga0065704_10604140 | 3300005289 | Bacteria | 605 |
| 24 | Ga0065712_10080270 | 3300005290 | Bacteria | 3126 |
| 25 | Ga0070676_10223938 | 3300005328 | Bacteria | 1244 |
| 26 | Ga0070670_100000112 | 3300005331 | Bacteria | 76289 |
| 27 | Ga0070670_100000945 | 3300005331 | Bacteria | 22835 |
| 28 | Ga0068869_100056224 | 3300005334 | Bacteria | 2869 |
| 29 | Ga0070689_100119979 | 3300005340 | Bacteria | 2100 |
| 30 | Ga0070661_100000310 | 3300005344 | Bacteria | 39292 |
| 31 | Ga0070668_100005467 | 3300005347 | Bacteria | 9431 |
| 32 | Ga0070669_101060759 | 3300005353 | Bacteria | 697 |
| 33 | Ga0070669_101093576 | 3300005353 | Bacteria | 686 |
| 34 | Ga0070675_100117126 | 3300005354 | Bacteria | 2260 |
| 35 | Ga0070674_100215326 | 3300005356 | Bacteria | 1491 |
| 36 | Ga0070674_101058135 | 3300005356 | Bacteria | 715 |
| 37 | Ga0070667_100501921 | 3300005367 | Bacteria | 1112 |
| 38 | Ga0070701_10097456 | 3300005438 | Bacteria | 1622 |
| 39 | Ga0070705_100312453 | 3300005440 | Bacteria | 1131 |
| 40 | Ga0070700_100171993 | 3300005441 | Bacteria | 1501 |
| 41 | Ga0070694_100219194 | 3300005444 | Bacteria | 1426 |
| 42 | Ga0070678_100007327 | 3300005456 | Bacteria | 6536 |
| 43 | Ga0070662_100007847 | 3300005457 | Bacteria | 6933 |
| 44 | Ga0070662_100050082 | 3300005457 | Bacteria | 3013 |
| 45 | Ga0068867_100100941 | 3300005459 | Bacteria | 2204 |
| 46 | Ga0070672_100353736 | 3300005543 | Bacteria | 1252 |
| 47 | Ga0070665_100171494 | 3300005548 | Bacteria | 2170 |
| 48 | Ga0070665_100458325 | 3300005548 | Bacteria | 1285 |
| 49 | Ga0070664_100000241 | 3300005564 | Bacteria | 39292 |
| 50 | Ga0068854_100008490 | 3300005578 | Bacteria | 6608 |
| 51 | Ga0068859_100316393 | 3300005617 | Bacteria | 1655 |
| 52 | Ga0068861_100313773 | 3300005719 | Bacteria | 1363 |
| 53 | Ga0068851_10005508 | 3300005834 | Bacteria | 5737 |
| 54 | Ga0068863_101405756 | 3300005841 | Unclassified | 706 |
| 55 | Ga0068860_100822777 | 3300005843 | Bacteria | 943 |
| 56 | Ga0068862_100040294 | 3300005844 | Bacteria | 3971 |
| 57 | Ga0075364_10058419 | 3300006051 | Bacteria | 2528 |
| 58 | Ga0075364_10252061 | 3300006051 | Bacteria | 1200 |
| 59 | Ga0075364_10401361 | 3300006051 | Bacteria | 935 |
| 60 | Ga0075364_10588389 | 3300006051 | Bacteria | 760 |
| 61 | Ga0075432_10002955 | 3300006058 | Bacteria | 5722 |
| 62 | Ga0075432_10017391 | 3300006058 | Bacteria | 2452 |
| 63 | Ga0075432_10027014 | 3300006058 | Bacteria | 1974 |
| 64 | Ga0075432_10070899 | 3300006058 | Bacteria | 1252 |
| 65 | Ga0075432_10181661 | 3300006058 | Bacteria | 823 |
| 66 | Ga0075362_10032802 | 3300006177 | Bacteria | 2256 |
| 67 | Ga0075362_10033895 | 3300006177 | Bacteria | 2223 |
| 68 | Ga0075362_10072069 | 3300006177 | Bacteria | 1580 |
| 69 | Ga0075362_10147453 | 3300006177 | Bacteria | 1127 |
| 70 | Ga0075362_10294315 | 3300006177 | Bacteria | 805 |
| 71 | Ga0075369_10083682 | 3300006186 | Bacteria | 1417 |
| 72 | Ga0097621_100401234 | 3300006237 | Bacteria | 1227 |
| 73 | Ga0068871_100011642 | 3300006358 | Bacteria | 6458 |
| 74 | Ga0097620_100316392 | 3300006931 | Bacteria | 1655 |
| 75 | Ga0079104_1000068 | 3300006946 | Bacteria | 154984 |
| 76 | Ga0105251_10001646 | 3300009011 | Bacteria | 18925 |
| 77 | Ga0105251_10011003 | 3300009011 | Bacteria | 5198 |
| 78 | Ga0105251_10016946 | 3300009011 | Bacteria | 3917 |
| 79 | Ga0105251_10020138 | 3300009011 | Bacteria | 3509 |
| 80 | Ga0105251_10020803 | 3300009011 | Bacteria | 3440 |
| 81 | Ga0105251_10254189 | 3300009011 | Bacteria | 792 |
| 82 | Ga0105244_10001447 | 3300009036 | Bacteria | 19213 |
| 83 | Ga0105244_10003827 | 3300009036 | Bacteria | 10614 |
| 84 | Ga0105244_10018753 | 3300009036 | Bacteria | 3875 |
| 85 | Ga0105244_10020302 | 3300009036 | Bacteria | 3694 |
| 86 | Ga0105244_10025780 | 3300009036 | Bacteria | 3189 |
| 87 | Ga0105244_10046539 | 3300009036 | Bacteria | 2228 |
| 88 | Ga0105244_10141964 | 3300009036 | Bacteria | 1154 |
| 89 | Ga0105250_10000337 | 3300009092 | Bacteria | 36160 |
| 90 | Ga0105250_10000506 | 3300009092 | Bacteria | 27341 |
| 91 | Ga0105250_10001803 | 3300009092 | Bacteria | 11215 |
| 92 | Ga0105250_10190021 | 3300009092 | Bacteria | 864 |
| 93 | Ga0105245_10656334 | 3300009098 | Bacteria | 1079 |
| 94 | Ga0105243_10000491 | 3300009148 | Bacteria | 40396 |
| 95 | Ga0105243_10013616 | 3300009148 | Bacteria | 6152 |
| 96 | Ga0105243_10055674 | 3300009148 | Bacteria | 3143 |
| 97 | Ga0105243_10138235 | 3300009148 | Bacteria | 2075 |
| 98 | Ga0105243_12033645 | 3300009148 | Bacteria | 609 |
| 99 | Ga0105242_10000099 | 3300009176 | Bacteria | 61092 |
| 100 | Ga0105242_10094770 | 3300009176 | Bacteria | 2519 |
| 101 | Ga0105248_10849713 | 3300009177 | Bacteria | 1030 |
| 102 | Ga0105237_10002377 | 3300009545 | Bacteria | 23363 |
| 103 | Ga0105246_10000501 | 3300011119 | Bacteria | 21333 |
| 104 | Ga0105246_10001438 | 3300011119 | Bacteria | 14095 |
| 105 | Ga0105246_10002958 | 3300011119 | Bacteria | 10296 |
| 106 | Ga0105246_11521776 | 3300011119 | Bacteria | 629 |
| 107 | Ga0157345_1000004 | 3300012498 | Bacteria | 80365 |
| 108 | Ga0157373_10000596 | 3300013100 | Bacteria | 28045 |
| 109 | Ga0157373_10001351 | 3300013100 | Bacteria | 18813 |
| 110 | Ga0157373_10001464 | 3300013100 | Bacteria | 18044 |
| 111 | Ga0157373_10005498 | 3300013100 | Bacteria | 9507 |
| 112 | Ga0157373_10016104 | 3300013100 | Bacteria | 5457 |
| 113 | Ga0157373_10090111 | 3300013100 | Bacteria | 2160 |
| 114 | Ga0157373_10331129 | 3300013100 | Bacteria | 1084 |
| 115 | Ga0157373_10377092 | 3300013100 | Bacteria | 1014 |
| 116 | Ga0157371_10163629 | 3300013102 | Bacteria | 1589 |
| 117 | Ga0157370_10070762 | 3300013104 | Bacteria | 3293 |
| 118 | Ga0157370_10257075 | 3300013104 | Bacteria | 1614 |
| 119 | Ga0157370_11313840 | 3300013104 | Bacteria | 651 |
| 120 | Ga0157369_10052524 | 3300013105 | Bacteria | 4409 |
| 121 | Ga0157369_10706704 | 3300013105 | Bacteria | 1038 |
| 122 | Ga0157378_10334083 | 3300013297 | Bacteria | 1476 |
| 123 | Ga0163162_10029228 | 3300013306 | Bacteria | 5454 |
| 124 | Ga0163162_10047982 | 3300013306 | Bacteria | 4279 |
| 125 | Ga0163162_10143362 | 3300013306 | Bacteria | 2503 |
| 126 | Ga0163162_10589285 | 3300013306 | Bacteria | 1238 |
| 127 | Ga0157372_10003028 | 3300013307 | Bacteria | 18103 |
| 128 | Ga0157375_10000602 | 3300013308 | Bacteria | 31951 |
| 129 | Ga0157375_10001025 | 3300013308 | Bacteria | 24117 |
| 130 | Ga0157380_10103938 | 3300014326 | Bacteria | 2371 |
| 131 | Ga0182008_10000878 | 3300014497 | Bacteria | 20898 |
| 132 | Ga0182008_10001189 | 3300014497 | Bacteria | 17933 |
| 133 | Ga0182008_10005940 | 3300014497 | Bacteria | 6886 |
| 134 | Ga0182008_10051469 | 3300014497 | Bacteria | 2043 |
| 135 | Ga0157376_10186074 | 3300014969 | Bacteria | 1901 |
| 136 | Ga0182006_1000073 | 3300015261 | Bacteria | 131224 |
| 137 | Ga0182006_1000158 | 3300015261 | Bacteria | 72283 |
| 138 | Ga0182006_1009488 | 3300015261 | Bacteria | 4360 |
| 139 | Ga0182006_1018318 | 3300015261 | Bacteria | 2960 |
| 140 | Ga0182007_10000031 | 3300015262 | Bacteria | 152299 |
| 141 | Ga0182007_10000769 | 3300015262 | Bacteria | 17954 |
| 142 | Ga0182007_10037365 | 3300015262 | Bacteria | 1631 |
| 143 | Ga0182005_1000149 | 3300015265 | Bacteria | 49294 |
| 144 | Ga0182005_1002371 | 3300015265 | Bacteria | 6787 |
| 145 | Ga0182005_1005290 | 3300015265 | Bacteria | 4048 |
| 146 | Ga0163161_10129360 | 3300017792 | Bacteria | 1903 |
| 147 | Ga0163161_10136904 | 3300017792 | Bacteria | 1852 |
| 148 | Ga0163161_10180763 | 3300017792 | Bacteria | 1617 |
| 149 | Ga0163161_10333952 | 3300017792 | Bacteria | 1201 |
| 150 | Ga0163161_10368723 | 3300017792 | Bacteria | 1145 |
| 151 | Ga0163161_11030684 | 3300017792 | Bacteria | 704 |
| 152 | Ga0209435_103779 | 3300025206 | Bacteria | 1721 |
| 153 | Ga0209784_100112 | 3300025224 | Bacteria | 91142 |
| 154 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 155 | Ga0209674_100156 | 3300025226 | Bacteria | 91147 |
| 156 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 157 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 158 | Ga0209563_101430 | 3300025230 | Bacteria | 6335 |
| 159 | Ga0209437_106567 | 3300025233 | Bacteria | 1930 |
| 160 | Ga0209258_100411 | 3300025242 | Bacteria | 51845 |
| 161 | Ga0209646_1000147 | 3300025246 | Bacteria | 103287 |
| 162 | Ga0209677_100103 | 3300025253 | Bacteria | 91142 |
| 163 | Ga0209675_1010776 | 3300025291 | Bacteria | 3087 |
| 164 | Ga0209676_1000062 | 3300025292 | Bacteria | 332319 |
| 165 | Ga0209676_1000102 | 3300025292 | Bacteria | 227372 |
| 166 | Ga0209676_1008332 | 3300025292 | Bacteria | 4640 |
| 167 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 168 | Ga0209050_1000105 | 3300025298 | Bacteria | 227285 |
| 169 | Ga0209050_1001809 | 3300025298 | Bacteria | 20913 |
| 170 | Ga0209051_1000066 | 3300025303 | Bacteria | 227369 |
| 171 | Ga0209051_1000181 | 3300025303 | Bacteria | 113391 |
| 172 | Ga0209051_1005603 | 3300025303 | Bacteria | 7283 |
| 173 | Ga0209257_1000124 | 3300025304 | Bacteria | 218195 |
| 174 | Ga0207656_10002993 | 3300025321 | Bacteria | 5778 |
| 175 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 176 | Ga0207696_1000051 | 3300025711 | Bacteria | 276833 |
| 177 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 178 | Ga0207696_1000176 | 3300025711 | Bacteria | 100134 |
| 179 | Ga0207696_1000177 | 3300025711 | Bacteria | 100134 |
| 180 | Ga0207696_1001491 | 3300025711 | Bacteria | 12591 |
| 181 | Ga0207696_1001893 | 3300025711 | Bacteria | 10684 |
| 182 | Ga0207696_1026827 | 3300025711 | Bacteria | 1780 |
| 183 | Ga0207696_1097355 | 3300025711 | Bacteria | 803 |
| 184 | Ga0207655_1000022 | 3300025728 | Bacteria | 483933 |
| 185 | Ga0207655_1000080 | 3300025728 | Bacteria | 214570 |
| 186 | Ga0207655_1000203 | 3300025728 | Bacteria | 103900 |
| 187 | Ga0207655_1002205 | 3300025728 | Bacteria | 16174 |
| 188 | Ga0207655_1002480 | 3300025728 | Bacteria | 14944 |
| 189 | Ga0207655_1004514 | 3300025728 | Bacteria | 9845 |
| 190 | Ga0207655_1012613 | 3300025728 | Bacteria | 4923 |
| 191 | Ga0207655_1025620 | 3300025728 | Bacteria | 2857 |
| 192 | Ga0207655_1035418 | 3300025728 | Bacteria | 2228 |
| 193 | Ga0207655_1043160 | 3300025728 | Bacteria | 1911 |
| 194 | Ga0207655_1044338 | 3300025728 | Bacteria | 1870 |
| 195 | Ga0207655_1067195 | 3300025728 | Bacteria | 1351 |
| 196 | Ga0207713_1000199 | 3300025735 | Bacteria | 83023 |
| 197 | Ga0207713_1001317 | 3300025735 | Bacteria | 20372 |
| 198 | Ga0207713_1001509 | 3300025735 | Bacteria | 18384 |
| 199 | Ga0207713_1008208 | 3300025735 | Bacteria | 6043 |
| 200 | Ga0207713_1012828 | 3300025735 | Bacteria | 4453 |
| 201 | Ga0207713_1021403 | 3300025735 | Bacteria | 3100 |
| 202 | Ga0207713_1026862 | 3300025735 | Bacteria | 2627 |
| 203 | Ga0207713_1057320 | 3300025735 | Bacteria | 1507 |
| 204 | Ga0207713_1136376 | 3300025735 | Bacteria | 806 |
| 205 | Ga0207645_10161504 | 3300025907 | Bacteria | 1466 |
| 206 | Ga0207671_10000060 | 3300025914 | Bacteria | 178435 |
| 207 | Ga0207671_10002355 | 3300025914 | Bacteria | 20338 |
| 208 | Ga0207649_10000695 | 3300025920 | Bacteria | 22177 |
| 209 | Ga0207681_10003303 | 3300025923 | Bacteria | 10097 |
| 210 | Ga0207681_10989441 | 3300025923 | Bacteria | 705 |
| 211 | Ga0207650_10000145 | 3300025925 | Bacteria | 85892 |
| 212 | Ga0207650_10000721 | 3300025925 | Bacteria | 25687 |
| 213 | Ga0207706_10003884 | 3300025933 | Bacteria | 14189 |
| 214 | Ga0207706_10051270 | 3300025933 | Bacteria | 3644 |
| 215 | Ga0207686_10007813 | 3300025934 | Bacteria | 5766 |
| 216 | Ga0207686_10126878 | 3300025934 | Bacteria | 1745 |
| 217 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 218 | Ga0207709_10030722 | 3300025935 | Bacteria | 3128 |
| 219 | Ga0207709_10120368 | 3300025935 | Bacteria | 1771 |
| 220 | Ga0207669_10076592 | 3300025937 | Bacteria | 2124 |
| 221 | Ga0207669_10254692 | 3300025937 | Bacteria | 1309 |
| 222 | Ga0207704_10067008 | 3300025938 | Bacteria | 2256 |
| 223 | Ga0207691_10254933 | 3300025940 | Bacteria | 1513 |
| 224 | Ga0207711_10883964 | 3300025941 | Bacteria | 831 |
| 225 | Ga0207689_10049630 | 3300025942 | Bacteria | 3462 |
| 226 | Ga0207679_10000037 | 3300025945 | Bacteria | 133550 |
| 227 | Ga0207712_10180635 | 3300025961 | Bacteria | 1657 |
| 228 | Ga0207668_10004599 | 3300025972 | Bacteria | 8114 |
| 229 | Ga0207640_10124822 | 3300025981 | Bacteria | 1851 |
| 230 | Ga0207658_10084176 | 3300025986 | Bacteria | 2447 |
| 231 | Ga0207708_10019449 | 3300026075 | Bacteria | 5119 |
| 232 | Ga0207648_10118187 | 3300026089 | Bacteria | 2330 |
| 233 | Ga0207676_10290992 | 3300026095 | Bacteria | 1487 |
| 234 | Ga0207675_101171014 | 3300026118 | Bacteria | 789 |
| 235 | Ga0207683_10052026 | 3300026121 | Bacteria | 3588 |
| 236 | Ga0209281_1000168 | 3300027111 | Bacteria | 155116 |
| 237 | Ga0207428_10013492 | 3300027907 | Bacteria | 7136 |
| 238 | Ga0207428_10080727 | 3300027907 | Bacteria | 2540 |
| 239 | Ga0207428_10143551 | 3300027907 | Bacteria | 1821 |
| 240 | Ga0207428_10212817 | 3300027907 | Bacteria | 1452 |
| 241 | Ga0268266_10059082 | 3300028379 | Bacteria | 3303 |
| 242 | Ga0268265_10107257 | 3300028380 | Bacteria | 2271 |
| 243 | Ga0268265_10308815 | 3300028380 | Bacteria | 1427 |
| 244 | Ga0268264_11910173 | 3300028381 | Bacteria | 603 |
| 245 | Ga0307511_10110964 | 3300030521 | Bacteria | 1745 |
| 246 | Ga0316179_1024534 | 3300030734 | Bacteria | 936 |
| 247 | Ga0265316_10185481 | 3300031344 | Bacteria | 1548 |
| 248 | Ga0307408_100004965 | 3300031548 | Bacteria | 8945 |
| 249 | Ga0307408_100032029 | 3300031548 | Bacteria | 3664 |
| 250 | Ga0265342_10469672 | 3300031712 | Bacteria | 644 |
| 251 | Ga0307405_10000073 | 3300031731 | Bacteria | 44879 |
| 252 | Ga0307413_11151411 | 3300031824 | Bacteria | 672 |
| 253 | Ga0307406_10748779 | 3300031901 | Bacteria | 820 |
| 254 | Ga0307412_10032406 | 3300031911 | Bacteria | 3311 |
| 255 | Ga0307412_10182834 | 3300031911 | Bacteria | 1578 |
| 256 | Ga0307409_101686090 | 3300031995 | Bacteria | 662 |
| 257 | Ga0307416_102313851 | 3300032002 | Bacteria | 638 |
| 258 | Ga0307416_102411748 | 3300032002 | Bacteria | 625 |
| 259 | Ga0307414_10022107 | 3300032004 | Bacteria | 4004 |
| 260 | Ga0307411_10009261 | 3300032005 | Bacteria | 5163 |
| 261 | Ga0237819_00233 | 3300038705 | Bacteria | 20367 |
| 262 | Ga0439438_000661 | 3300041405 | Bacteria | 15479 |
| 263 | Ga0439438_000981 | 3300041405 | Bacteria | 12759 |
| 264 | Ga0439438_006127 | 3300041405 | Bacteria | 4296 |
| 265 | Ga0439438_006478 | 3300041405 | Bacteria | 4120 |
| 266 | Ga0439438_007556 | 3300041405 | Bacteria | 3703 |
| 267 | Ga0439438_012757 | 3300041405 | Bacteria | 2562 |
| 268 | Ga0439447_000516 | 3300041407 | Bacteria | 14332 |
| 269 | Ga0439447_000847 | 3300041407 | Bacteria | 11221 |
| 270 | Ga0439447_022493 | 3300041407 | Bacteria | 1649 |
| 271 | Ga0439447_023816 | 3300041407 | Bacteria | 1591 |
| 272 | Ga0439447_027028 | 3300041407 | Bacteria | 1466 |
| 273 | Ga0439447_084311 | 3300041407 | Bacteria | 732 |
| 274 | Ga0439466_0000243 | 3300041411 | Bacteria | 21378 |
| 275 | Ga0439466_0003461 | 3300041411 | Bacteria | 6114 |
| 276 | Ga0439466_0010274 | 3300041411 | Bacteria | 3479 |
| 277 | Ga0439466_0018916 | 3300041411 | Bacteria | 2467 |
| 278 | Ga0439466_0019324 | 3300041411 | Bacteria | 2438 |
| 279 | Ga0439466_0034499 | 3300041411 | Bacteria | 1715 |
| 280 | Ga0439466_0038148 | 3300041411 | Bacteria | 1614 |
| 281 | Ga0439465_0110222 | 3300041413 | Bacteria | 957 |
| 282 | Ga0451853_3249340 | 3300041512 | Bacteria | 510 |
| 283 | Ga0439432_000022 | 3300042006 | Bacteria | 54425 |
| 284 | Ga0439432_001360 | 3300042006 | Bacteria | 9254 |
| 285 | Ga0439451_013378 | 3300042009 | Bacteria | 1658 |
| 286 | Ga0439451_047248 | 3300042009 | Bacteria | 862 |
| 287 | Ga0439451_052159 | 3300042009 | Bacteria | 819 |
| 288 | Ga0439452_000077 | 3300042010 | Bacteria | 84014 |
| 289 | Ga0439452_000081 | 3300042010 | Bacteria | 82231 |
| 290 | Ga0439452_001764 | 3300042010 | Bacteria | 8448 |
| 291 | Ga0439452_060884 | 3300042010 | Bacteria | 845 |
| 292 | Ga0439452_065003 | 3300042010 | Bacteria | 811 |
| 293 | Ga0439456_000194 | 3300042013 | Bacteria | 17520 |
| 294 | Ga0439456_001343 | 3300042013 | Bacteria | 4908 |
| 295 | Ga0439456_009275 | 3300042013 | Bacteria | 2033 |
| 296 | Ga0439456_013477 | 3300042013 | Bacteria | 1701 |
| 297 | Ga0439456_040197 | 3300042013 | Bacteria | 1012 |
| 298 | Ga0439463_000020 | 3300042016 | Bacteria | 34395 |
| 299 | Ga0439463_000257 | 3300042016 | Bacteria | 14564 |
| 300 | Ga0439463_006880 | 3300042016 | Bacteria | 2808 |
| 301 | Ga0439463_009968 | 3300042016 | Bacteria | 2334 |
| 302 | Ga0439463_038882 | 3300042016 | Bacteria | 1207 |
| 303 | Ga0450911_000488 | 3300042115 | Bacteria | 12619 |
| 304 | Ga0450911_001475 | 3300042115 | Bacteria | 5388 |
| 305 | Ga0450911_001694 | 3300042115 | Bacteria | 4850 |
| 306 | Ga0450911_005682 | 3300042115 | Bacteria | 1913 |
| 307 | Ga0450919_000545 | 3300042121 | Bacteria | 4736 |
| 308 | Ga0450922_000117 | 3300042124 | Bacteria | 7838 |
| 309 | Ga0450922_003138 | 3300042124 | Bacteria | 1527 |
| 310 | Ga0450923_004356 | 3300042125 | Bacteria | 2221 |
| 311 | Ga0450890_003233 | 3300042127 | Bacteria | 2175 |
| 312 | Ga0450898_003631 | 3300042134 | Bacteria | 2228 |
| 313 | Ga0450900_008085 | 3300042136 | Bacteria | 1307 |
| 314 | Ga0450902_006363 | 3300042137 | Bacteria | 1809 |
| 315 | Ga0450902_006918 | 3300042137 | Bacteria | 1745 |
| 316 | Ga0450902_009470 | 3300042137 | Bacteria | 1534 |
| 317 | Ga0450903_001356 | 3300042138 | Bacteria | 4581 |
| 318 | Ga0450905_006961 | 3300042142 | Bacteria | 1534 |
| 319 | Ga0450906_000314 | 3300042145 | Bacteria | 9792 |
| 320 | Ga0450906_000446 | 3300042145 | Bacteria | 8593 |
| 321 | Ga0450906_001777 | 3300042145 | Bacteria | 4725 |
| 322 | Ga0450907_000780 | 3300042146 | Bacteria | 7976 |
| 323 | Ga0450907_002098 | 3300042146 | Bacteria | 3941 |
| 324 | Ga0450910_000701 | 3300042147 | Bacteria | 4021 |
| 325 | Ga0450910_002897 | 3300042147 | Bacteria | 2259 |
| 326 | Ga0439446_0002932 | 3300042156 | Bacteria | 4165 |
| 327 | Ga0450908_002470 | 3300042184 | Bacteria | 3616 |
| 328 | Ga0450908_023536 | 3300042184 | Bacteria | 1078 |
| 329 | Ga0450909_000180 | 3300042185 | Bacteria | 7078 |
| 330 | Ga0439434_0041898 | 3300042435 | Bacteria | 1407 |
| 331 | Ga0439464_0032381 | 3300042439 | Bacteria | 1469 |
| 332 | Ga0439464_0033424 | 3300042439 | Bacteria | 1448 |
| 333 | Ga0439460_0002037 | 3300042461 | Bacteria | 4844 |
| 334 | Ga0450918_010451 | 3300042531 | Bacteria | 1621 |
| 335 | Ga0450918_019228 | 3300042531 | Bacteria | 1191 |
| 336 | Ga0450918_092929 | 3300042531 | Bacteria | 585 |
| 337 | Ga0439440_0000375 | 3300042993 | Bacteria | 7448 |
| 338 | Ga0439440_0042699 | 3300042993 | Bacteria | 1110 |
| 339 | Ga0495617_003562 | 3300046452 | Bacteria | 5824 |
| 340 | Ga0495617_004248 | 3300046452 | Bacteria | 5232 |
| 341 | Ga0495617_021389 | 3300046452 | Bacteria | 2184 |
| 342 | Ga0495617_030719 | 3300046452 | Bacteria | 1805 |
| 343 | Ga0495617_043989 | 3300046452 | Bacteria | 1491 |
| 344 | Ga0495617_070033 | 3300046452 | Bacteria | 1153 |
| 345 | Ga0495617_199149 | 3300046452 | Bacteria | 626 |
| 346 | Ga0495627_003287 | 3300046453 | Bacteria | 7234 |
| 347 | Ga0495627_005742 | 3300046453 | Bacteria | 4953 |
| 348 | Ga0495627_118885 | 3300046453 | Bacteria | 747 |
| 349 | Ga0495627_144181 | 3300046453 | Bacteria | 666 |
| 350 | Ga0495603_0069782 | 3300046455 | Bacteria | 2067 |
| 351 | Ga0495590_0001444 | 3300046457 | Bacteria | 10253 |
| 352 | Ga0495590_0003719 | 3300046457 | Bacteria | 6213 |
| 353 | Ga0495590_0007200 | 3300046457 | Bacteria | 4301 |
| 354 | Ga0495590_0008013 | 3300046457 | Bacteria | 4052 |
| 355 | Ga0495590_0027246 | 3300046457 | Bacteria | 2005 |
| 356 | Ga0495590_0063193 | 3300046457 | Bacteria | 1295 |
| 357 | Ga0495591_000021 | 3300046458 | Bacteria | 203554 |
| 358 | Ga0495591_000032 | 3300046458 | Bacteria | 176337 |
| 359 | Ga0495591_000082 | 3300046458 | Bacteria | 107579 |
| 360 | Ga0495591_000120 | 3300046458 | Bacteria | 86214 |
| 361 | Ga0495591_006430 | 3300046458 | Bacteria | 5193 |
| 362 | Ga0495591_008205 | 3300046458 | Bacteria | 4303 |
| 363 | Ga0495591_010282 | 3300046458 | Bacteria | 3639 |
| 364 | Ga0495591_019213 | 3300046458 | Bacteria | 2293 |
| 365 | Ga0495591_022614 | 3300046458 | Bacteria | 2028 |
| 366 | Ga0495591_035580 | 3300046458 | Bacteria | 1456 |
| 367 | Ga0495591_037727 | 3300046458 | Bacteria | 1396 |
| 368 | Ga0495638_0000240 | 3300046460 | Bacteria | 75170 |
| 369 | Ga0495638_0000449 | 3300046460 | Bacteria | 49303 |
| 370 | Ga0495638_0002830 | 3300046460 | Bacteria | 13904 |
| 371 | Ga0495638_0014216 | 3300046460 | Bacteria | 5388 |
| 372 | Ga0495638_0019151 | 3300046460 | Bacteria | 4531 |
| 373 | Ga0495638_0019276 | 3300046460 | Bacteria | 4514 |
| 374 | Ga0495638_0025349 | 3300046460 | Bacteria | 3856 |
| 375 | Ga0495638_0028318 | 3300046460 | Bacteria | 3618 |
| 376 | Ga0495638_0042776 | 3300046460 | Bacteria | 2860 |
| 377 | Ga0495638_0085430 | 3300046460 | Bacteria | 1908 |
| 378 | Ga0495638_0104569 | 3300046460 | Bacteria | 1688 |
| 379 | Ga0495638_0196222 | 3300046460 | Bacteria | 1142 |
| 380 | Ga0495653_0000151 | 3300046463 | Bacteria | 57928 |
| 381 | Ga0495653_0217190 | 3300046463 | Bacteria | 1287 |
| 382 | Ga0495650_0003857 | 3300046471 | Bacteria | 10631 |
| 383 | Ga0495650_0005553 | 3300046471 | Bacteria | 8141 |
| 384 | Ga0495650_0005962 | 3300046471 | Bacteria | 7727 |
| 385 | Ga0495650_0047571 | 3300046471 | Bacteria | 1793 |
| 386 | Ga0495650_0209234 | 3300046471 | Bacteria | 675 |
| 387 | Ga0495580_0050165 | 3300046472 | Bacteria | 2951 |
| 388 | Ga0495605_0000147 | 3300046474 | Bacteria | 90988 |
| 389 | Ga0495605_0002577 | 3300046474 | Bacteria | 11151 |
| 390 | Ga0495605_0011759 | 3300046474 | Bacteria | 4870 |
| 391 | Ga0495605_0015327 | 3300046474 | Bacteria | 4172 |
| 392 | Ga0495605_0019150 | 3300046474 | Bacteria | 3661 |
| 393 | Ga0495605_0050253 | 3300046474 | Bacteria | 2034 |
| 394 | Ga0495639_0000002 | 3300046475 | Bacteria | 192403 |
| 395 | Ga0495584_0000084 | 3300046491 | Bacteria | 65138 |
| 396 | Ga0495584_0002475 | 3300046491 | Bacteria | 10460 |
| 397 | Ga0495584_0005134 | 3300046491 | Bacteria | 6949 |
| 398 | Ga0495584_0010457 | 3300046491 | Bacteria | 4767 |
| 399 | Ga0495584_0015017 | 3300046491 | Bacteria | 3946 |
| 400 | Ga0495584_0026065 | 3300046491 | Bacteria | 2962 |
| 401 | Ga0495584_0031264 | 3300046491 | Bacteria | 2695 |
| 402 | Ga0495584_0075978 | 3300046491 | Bacteria | 1689 |
| 403 | Ga0495584_0091813 | 3300046491 | Bacteria | 1531 |
| 404 | Ga0495585_0000234 | 3300046492 | Bacteria | 57324 |
| 405 | Ga0495585_0000523 | 3300046492 | Bacteria | 36267 |
| 406 | Ga0495585_0003811 | 3300046492 | Bacteria | 10041 |
| 407 | Ga0495585_0020869 | 3300046492 | Bacteria | 3764 |
| 408 | Ga0495585_0065349 | 3300046492 | Bacteria | 1993 |
| 409 | Ga0495594_0071216 | 3300046499 | Bacteria | 1933 |
| 410 | Ga0495596_0000012 | 3300046500 | Bacteria | 125996 |
| 411 | Ga0495607_0000084 | 3300046501 | Bacteria | 96419 |
| 412 | Ga0495607_0004317 | 3300046501 | Bacteria | 10489 |
| 413 | Ga0495607_0006134 | 3300046501 | Bacteria | 8504 |
| 414 | Ga0495607_0009835 | 3300046501 | Bacteria | 6454 |
| 415 | Ga0495607_0014731 | 3300046501 | Bacteria | 5083 |
| 416 | Ga0495607_0052906 | 3300046501 | Bacteria | 2349 |
| 417 | Ga0495607_0256686 | 3300046501 | Bacteria | 839 |
| 418 | Ga0495583_0001807 | 3300046506 | Bacteria | 20185 |
| 419 | Ga0495583_0013299 | 3300046506 | Bacteria | 4598 |
| 420 | Ga0495606_0000634 | 3300046507 | Bacteria | 55249 |
| 421 | Ga0495606_0003122 | 3300046507 | Bacteria | 17989 |
| 422 | Ga0495606_0004827 | 3300046507 | Bacteria | 13237 |
| 423 | Ga0495606_0008632 | 3300046507 | Bacteria | 8802 |
| 424 | Ga0495606_0016876 | 3300046507 | Bacteria | 5544 |
| 425 | Ga0495606_0029928 | 3300046507 | Bacteria | 3814 |
| 426 | Ga0495606_0067519 | 3300046507 | Bacteria | 2264 |
| 427 | Ga0495606_0164399 | 3300046507 | Bacteria | 1292 |
| 428 | Ga0495610_0000133 | 3300046512 | Bacteria | 82356 |
| 429 | Ga0495610_0003053 | 3300046512 | Bacteria | 13388 |
| 430 | Ga0495610_0003737 | 3300046512 | Bacteria | 11649 |
| 431 | Ga0495610_0007249 | 3300046512 | Bacteria | 7429 |
| 432 | Ga0495610_0011999 | 3300046512 | Bacteria | 5249 |
| 433 | Ga0495610_0016851 | 3300046512 | Bacteria | 4187 |
| 434 | Ga0495610_0017455 | 3300046512 | Bacteria | 4090 |
| 435 | Ga0495610_0094510 | 3300046512 | Bacteria | 1349 |
| 436 | Ga0495610_0105270 | 3300046512 | Bacteria | 1257 |
| 437 | Ga0495616_0001757 | 3300046513 | Bacteria | 14739 |
| 438 | Ga0495616_0004524 | 3300046513 | Bacteria | 8754 |
| 439 | Ga0495616_0004535 | 3300046513 | Bacteria | 8744 |
| 440 | Ga0495616_0030187 | 3300046513 | Bacteria | 2851 |
| 441 | Ga0495616_0033092 | 3300046513 | Bacteria | 2696 |
| 442 | Ga0495616_0065594 | 3300046513 | Bacteria | 1768 |
| 443 | Ga0495620_0000127 | 3300046515 | Bacteria | 62010 |
| 444 | Ga0495620_0002118 | 3300046515 | Bacteria | 11537 |
| 445 | Ga0495620_0002539 | 3300046515 | Bacteria | 10564 |
| 446 | Ga0495620_0006750 | 3300046515 | Bacteria | 6276 |
| 447 | Ga0495620_0007988 | 3300046515 | Bacteria | 5704 |
| 448 | Ga0495620_0027913 | 3300046515 | Bacteria | 2633 |
| 449 | Ga0495628_0048643 | 3300046516 | Bacteria | 3361 |
| 450 | Ga0495630_0014950 | 3300046517 | Bacteria | 5660 |
| 451 | Ga0495630_0022414 | 3300046517 | Bacteria | 4663 |
| 452 | Ga0495631_0004246 | 3300046518 | Bacteria | 7667 |
| 453 | Ga0495631_0010191 | 3300046518 | Bacteria | 4661 |
| 454 | Ga0495631_0167942 | 3300046518 | Bacteria | 941 |
| 455 | Ga0495631_0194296 | 3300046518 | Bacteria | 868 |
| 456 | Ga0495632_0004655 | 3300046519 | Bacteria | 9266 |
| 457 | Ga0495632_0005740 | 3300046519 | Bacteria | 8148 |
| 458 | Ga0495632_0007976 | 3300046519 | Bacteria | 6574 |
| 459 | Ga0495632_0010142 | 3300046519 | Bacteria | 5606 |
| 460 | Ga0495632_0011904 | 3300046519 | Bacteria | 5052 |
| 461 | Ga0495632_0017077 | 3300046519 | Bacteria | 4016 |
| 462 | Ga0495632_0053888 | 3300046519 | Bacteria | 1973 |
| 463 | Ga0495632_0073255 | 3300046519 | Bacteria | 1642 |
| 464 | Ga0495632_0080809 | 3300046519 | Bacteria | 1550 |
| 465 | Ga0495632_0096096 | 3300046519 | Bacteria | 1399 |
| 466 | Ga0495637_0000038 | 3300046520 | Bacteria | 118140 |
| 467 | Ga0495637_0000246 | 3300046520 | Bacteria | 42500 |
| 468 | Ga0495637_0000562 | 3300046520 | Bacteria | 26595 |
| 469 | Ga0495637_0000710 | 3300046520 | Bacteria | 22801 |
| 470 | Ga0495637_0003314 | 3300046520 | Bacteria | 8564 |
| 471 | Ga0495637_0004299 | 3300046520 | Bacteria | 7398 |
| 472 | Ga0495637_0004752 | 3300046520 | Bacteria | 7005 |
| 473 | Ga0495637_0018084 | 3300046520 | Bacteria | 3272 |
| 474 | Ga0495637_0033289 | 3300046520 | Bacteria | 2265 |
| 475 | Ga0495637_0181969 | 3300046520 | Bacteria | 779 |
| 476 | Ga0495637_0284728 | 3300046520 | Bacteria | 589 |
| 477 | Ga0495643_0004314 | 3300046522 | Bacteria | 10017 |
| 478 | Ga0495643_0012863 | 3300046522 | Bacteria | 5033 |
| 479 | Ga0495643_0013747 | 3300046522 | Bacteria | 4834 |
| 480 | Ga0495643_0018270 | 3300046522 | Bacteria | 4079 |
| 481 | Ga0495643_0085119 | 3300046522 | Bacteria | 1640 |
| 482 | Ga0495644_0000125 | 3300046523 | Bacteria | 36680 |
| 483 | Ga0495644_0006344 | 3300046523 | Bacteria | 4587 |
| 484 | Ga0495644_0007103 | 3300046523 | Bacteria | 4331 |
| 485 | Ga0495644_0154328 | 3300046523 | Bacteria | 879 |
| 486 | Ga0495644_0251388 | 3300046523 | Bacteria | 686 |
| 487 | Ga0495648_0000259 | 3300046524 | Bacteria | 59999 |
| 488 | Ga0495648_0000695 | 3300046524 | Bacteria | 35872 |
| 489 | Ga0495648_0000884 | 3300046524 | Bacteria | 31492 |
| 490 | Ga0495648_0006035 | 3300046524 | Bacteria | 9942 |
| 491 | Ga0495648_0007344 | 3300046524 | Bacteria | 8826 |
| 492 | Ga0495648_0008673 | 3300046524 | Bacteria | 7971 |
| 493 | Ga0495648_0017356 | 3300046524 | Bacteria | 5148 |
| 494 | Ga0495648_0056683 | 3300046524 | Bacteria | 2355 |
| 495 | Ga0495648_0112508 | 3300046524 | Bacteria | 1478 |
| 496 | Ga0495648_0116622 | 3300046524 | Bacteria | 1442 |
| 497 | Ga0495648_0135890 | 3300046524 | Bacteria | 1300 |
| 498 | Ga0495648_0209011 | 3300046524 | Bacteria | 971 |
| 499 | Ga0495648_0257165 | 3300046524 | Bacteria | 840 |
| 500 | Ga0495666_0002039 | 3300046526 | Bacteria | 9986 |
| 501 | Ga0495666_0022607 | 3300046526 | Bacteria | 3114 |
| 502 | Ga0495666_0320682 | 3300046526 | Bacteria | 699 |
| 503 | Ga0495642_0000030 | 3300046528 | Bacteria | 89032 |
| 504 | Ga0495654_0000104 | 3300046530 | Bacteria | 95266 |
| 505 | Ga0495654_0001431 | 3300046530 | Bacteria | 16424 |
| 506 | Ga0495654_0003839 | 3300046530 | Bacteria | 9083 |
| 507 | Ga0495654_0006521 | 3300046530 | Bacteria | 6618 |
| 508 | Ga0495654_0014105 | 3300046530 | Bacteria | 4260 |
| 509 | Ga0495654_0014299 | 3300046530 | Bacteria | 4226 |
| 510 | Ga0495654_0016297 | 3300046530 | Bacteria | 3932 |
| 511 | Ga0495654_0026000 | 3300046530 | Bacteria | 3013 |
| 512 | Ga0495654_0073450 | 3300046530 | Bacteria | 1617 |
| 513 | Ga0495654_0135216 | 3300046530 | Bacteria | 1103 |
| 514 | Ga0495654_0171299 | 3300046530 | Bacteria | 946 |
| 515 | Ga0495654_0238629 | 3300046530 | Bacteria | 762 |
| 516 | Ga0495586_0859337 | 3300046535 | Bacteria | 523 |
| 517 | Ga0495587_0001686 | 3300046536 | Bacteria | 14745 |
| 518 | Ga0495609_0007370 | 3300046538 | Bacteria | 5500 |
| 519 | Ga0495609_0129890 | 3300046538 | Bacteria | 1079 |
| 520 | Ga0495597_0000965 | 3300046542 | Bacteria | 22210 |
| 521 | Ga0495597_0012636 | 3300046542 | Bacteria | 4066 |
| 522 | Ga0495597_0034476 | 3300046542 | Bacteria | 2287 |
| 523 | Ga0495597_0040156 | 3300046542 | Bacteria | 2092 |
| 524 | Ga0495597_0049023 | 3300046542 | Bacteria | 1867 |
| 525 | Ga0495597_0062125 | 3300046542 | Bacteria | 1625 |
| 526 | Ga0495597_0171546 | 3300046542 | Bacteria | 880 |
| 527 | Ga0495597_0298352 | 3300046542 | Bacteria | 625 |
| 528 | Ga0495622_0000047 | 3300046557 | Bacteria | 109638 |
| 529 | Ga0495622_0000650 | 3300046557 | Bacteria | 19801 |
| 530 | Ga0495622_0011294 | 3300046557 | Bacteria | 4124 |
| 531 | Ga0495622_0109725 | 3300046557 | Bacteria | 1263 |
| 532 | Ga0495633_0003115 | 3300046558 | Bacteria | 11239 |
| 533 | Ga0495633_0004004 | 3300046558 | Bacteria | 9535 |
| 534 | Ga0495633_0152420 | 3300046558 | Bacteria | 1067 |
| 535 | Ga0495633_0442408 | 3300046558 | Bacteria | 587 |
| 536 | Ga0495656_0478370 | 3300046615 | Bacteria | 658 |
| 537 | Ga0495668_0000728 | 3300046616 | Bacteria | 39499 |
| 538 | Ga0495668_0002358 | 3300046616 | Bacteria | 15711 |
| 539 | Ga0495668_0004114 | 3300046616 | Bacteria | 10535 |
| 540 | Ga0495634_0000615 | 3300046642 | Bacteria | 34539 |
| 541 | Ga0495611_0009704 | 3300046648 | Bacteria | 4069 |
| 542 | Ga0495611_0064734 | 3300046648 | Bacteria | 1665 |
| 543 | Ga0495611_0407553 | 3300046648 | Bacteria | 621 |
| 544 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 545 | Ga0495625_0001514 | 3300046660 | Bacteria | 27865 |
| 546 | Ga0495625_0054529 | 3300046660 | Bacteria | 2854 |
| 547 | Ga0495625_0063830 | 3300046660 | Bacteria | 2600 |
| 548 | Ga0495625_0077378 | 3300046660 | Bacteria | 2324 |
| 549 | Ga0495625_0109830 | 3300046660 | Bacteria | 1886 |
| 550 | Ga0495625_0114308 | 3300046660 | Bacteria | 1843 |
| 551 | Ga0495625_0325030 | 3300046660 | Bacteria | 978 |
| 552 | Ga0495635_0002026 | 3300046663 | Bacteria | 13735 |
| 553 | Ga0495659_0250521 | 3300046664 | Bacteria | 738 |
| 554 | Ga0495661_0001273 | 3300046665 | Bacteria | 21643 |
| 555 | Ga0495661_0025295 | 3300046665 | Bacteria | 3835 |
| 556 | Ga0495661_0056622 | 3300046665 | Bacteria | 2344 |
| 557 | Ga0495661_0063092 | 3300046665 | Bacteria | 2191 |
| 558 | Ga0495661_0099925 | 3300046665 | Bacteria | 1635 |
| 559 | Ga0495661_0234801 | 3300046665 | Bacteria | 944 |
| 560 | Ga0495661_0396150 | 3300046665 | Bacteria | 672 |
| 561 | Ga0495588_0044220 | 3300046674 | Bacteria | 2280 |
| 562 | Ga0495588_0119873 | 3300046674 | Bacteria | 1387 |
| 563 | Ga0495657_0076943 | 3300046675 | Bacteria | 2166 |
| 564 | Ga0495623_0008695 | 3300046679 | Bacteria | 6591 |
| 565 | Ga0495623_0015436 | 3300046679 | Bacteria | 4937 |
| 566 | Ga0495646_0008791 | 3300046680 | Bacteria | 6414 |
| 567 | Ga0495646_0028904 | 3300046680 | Bacteria | 3468 |
| 568 | Ga0495669_0052388 | 3300046684 | Bacteria | 1833 |
| 569 | Ga0495669_0499372 | 3300046684 | Bacteria | 592 |
| 570 | Ga0495613_0001739 | 3300046689 | Bacteria | 16574 |
| 571 | Ga0495613_0014121 | 3300046689 | Bacteria | 5925 |
| 572 | Ga0495624_0000172 | 3300046690 | Bacteria | 47939 |
| 573 | Ga0495624_0203911 | 3300046690 | Bacteria | 1201 |
| 574 | Ga0495670_0002041 | 3300046691 | Bacteria | 9957 |
| 575 | Ga0495670_0002383 | 3300046691 | Bacteria | 9257 |
| 576 | Ga0495670_0019670 | 3300046691 | Bacteria | 3327 |
| 577 | Ga0495670_0046437 | 3300046691 | Bacteria | 2169 |
| 578 | Ga0495670_0545929 | 3300046691 | Bacteria | 630 |
| 579 | Ga0495671_0000136 | 3300046692 | Bacteria | 65148 |
| 580 | Ga0495671_0000541 | 3300046692 | Bacteria | 28528 |
| 581 | Ga0495671_0000799 | 3300046692 | Bacteria | 22506 |
| 582 | Ga0495671_0002282 | 3300046692 | Bacteria | 12187 |
| 583 | Ga0495671_0004879 | 3300046692 | Bacteria | 7933 |
| 584 | Ga0495671_0008285 | 3300046692 | Bacteria | 5853 |
| 585 | Ga0495671_0008616 | 3300046692 | Bacteria | 5728 |
| 586 | Ga0495671_0048873 | 3300046692 | Bacteria | 2109 |
| 587 | Ga0495671_0109272 | 3300046692 | Bacteria | 1350 |
| 588 | Ga0495671_0221633 | 3300046692 | Bacteria | 915 |
| 589 | Ga0495671_0233979 | 3300046692 | Bacteria | 888 |
| 590 | Ga0495649_0002309 | 3300046694 | Bacteria | 13533 |
| 591 | Ga0495649_0004240 | 3300046694 | Bacteria | 9400 |
| 592 | Ga0495649_0004547 | 3300046694 | Bacteria | 9050 |
| 593 | Ga0495649_0005159 | 3300046694 | Bacteria | 8375 |
| 594 | Ga0495649_0005390 | 3300046694 | Bacteria | 8143 |
| 595 | Ga0495649_0007150 | 3300046694 | Bacteria | 6854 |
| 596 | Ga0495649_0007753 | 3300046694 | Bacteria | 6516 |
| 597 | Ga0495649_0016721 | 3300046694 | Bacteria | 4154 |
| 598 | Ga0495649_0019016 | 3300046694 | Bacteria | 3859 |
| 599 | Ga0495649_0056345 | 3300046694 | Bacteria | 2122 |
| 600 | Ga0495649_0062920 | 3300046694 | Bacteria | 1994 |
| 601 | Ga0495589_0000297 | 3300046794 | Bacteria | 39517 |
| 602 | Ga0495589_0002333 | 3300046794 | Bacteria | 10666 |
| 603 | Ga0495589_0002859 | 3300046794 | Bacteria | 9559 |
| 604 | Ga0495589_0003519 | 3300046794 | Bacteria | 8474 |
| 605 | Ga0495589_0009785 | 3300046794 | Bacteria | 4977 |
| 606 | Ga0495589_0043722 | 3300046794 | Bacteria | 2229 |
| 607 | Ga0495589_0045040 | 3300046794 | Bacteria | 2192 |
| 608 | Ga0495600_0021302 | 3300046809 | Bacteria | 4149 |
| 609 | Ga0495600_0050369 | 3300046809 | Bacteria | 2717 |
| 610 | Ga0495660_0000785 | 3300046810 | Bacteria | 23782 |
| 611 | Ga0495660_0002759 | 3300046810 | Bacteria | 11073 |
| 612 | Ga0495660_0010521 | 3300046810 | Bacteria | 5383 |
| 613 | Ga0495660_0014918 | 3300046810 | Bacteria | 4494 |
| 614 | Ga0495660_0034236 | 3300046810 | Bacteria | 2843 |
| 615 | Ga0495660_0077956 | 3300046810 | Bacteria | 1742 |
| 616 | Ga0495660_0108915 | 3300046810 | Bacteria | 1415 |
| 617 | Ga0495660_0228809 | 3300046810 | Bacteria | 872 |
| 618 | Ga0495581_0000452 | 3300047315 | Bacteria | 21032 |
| 619 | Ga0495604_0182626 | 3300047317 | Bacteria | 1466 |
| 620 | Ga0495636_0126540 | 3300047318 | Bacteria | 1134 |
| 621 | Ga0495674_0002341 | 3300047319 | Bacteria | 18612 |
| 622 | Ga0495672_0000174 | 3300047320 | Bacteria | 93615 |
| 623 | Ga0495672_0000185 | 3300047320 | Bacteria | 90160 |
| 624 | Ga0495672_0000218 | 3300047320 | Bacteria | 81743 |
| 625 | Ga0495672_0000841 | 3300047320 | Bacteria | 32658 |
| 626 | Ga0495672_0002969 | 3300047320 | Bacteria | 14923 |
| 627 | Ga0495672_0003653 | 3300047320 | Bacteria | 13028 |
| 628 | Ga0495672_0004386 | 3300047320 | Bacteria | 11576 |
| 629 | Ga0495672_0005978 | 3300047320 | Bacteria | 9532 |
| 630 | Ga0495672_0046569 | 3300047320 | Bacteria | 2585 |
| 631 | Ga0495672_0057311 | 3300047320 | Bacteria | 2263 |
| 632 | Ga0495672_0069814 | 3300047320 | Bacteria | 1993 |
| 633 | Ga0495672_0238649 | 3300047320 | Bacteria | 888 |
| 634 | Ga0495676_0002653 | 3300047321 | Bacteria | 16007 |
| 635 | Ga0495680_0005627 | 3300047322 | Bacteria | 11740 |
| 636 | Ga0495680_0064664 | 3300047322 | Bacteria | 2804 |
| 637 | Ga0495680_0117857 | 3300047322 | Bacteria | 1962 |
| 638 | Ga0495683_0000131 | 3300047323 | Bacteria | 75476 |
| 639 | Ga0495683_0004045 | 3300047323 | Bacteria | 8411 |
| 640 | Ga0495683_0009364 | 3300047323 | Bacteria | 5218 |
| 641 | Ga0495683_0011172 | 3300047323 | Bacteria | 4732 |
| 642 | Ga0495683_0018944 | 3300047323 | Bacteria | 3553 |
| 643 | Ga0495683_0035401 | 3300047323 | Bacteria | 2538 |
| 644 | Ga0495683_0036767 | 3300047323 | Bacteria | 2484 |
| 645 | Ga0495683_0074728 | 3300047323 | Bacteria | 1660 |
| 646 | Ga0495683_0196466 | 3300047323 | Bacteria | 912 |
| 647 | Ga0495687_001097 | 3300047443 | Bacteria | 26435 |
| 648 | Ga0495675_0007804 | 3300047444 | Bacteria | 6605 |
| 649 | Ga0495675_0640830 | 3300047444 | Bacteria | 599 |
| 650 | Ga0495679_000180 | 3300047446 | Bacteria | 56996 |
| 651 | Ga0495679_000247 | 3300047446 | Bacteria | 44736 |
| 652 | Ga0495679_000434 | 3300047446 | Bacteria | 30922 |
| 653 | Ga0495679_000612 | 3300047446 | Bacteria | 24130 |
| 654 | Ga0495679_004870 | 3300047446 | Bacteria | 6061 |
| 655 | Ga0495679_013110 | 3300047446 | Bacteria | 3125 |
| 656 | Ga0495679_022231 | 3300047446 | Bacteria | 2174 |
| 657 | Ga0495679_046751 | 3300047446 | Bacteria | 1315 |
| 658 | Ga0495673_0000328 | 3300047469 | Bacteria | 61350 |
| 659 | Ga0495673_0000503 | 3300047469 | Bacteria | 41432 |
| 660 | Ga0495673_0002039 | 3300047469 | Bacteria | 14802 |
| 661 | Ga0495673_0002083 | 3300047469 | Bacteria | 14608 |
| 662 | Ga0495673_0003594 | 3300047469 | Bacteria | 10172 |
| 663 | Ga0495673_0003724 | 3300047469 | Bacteria | 9908 |
| 664 | Ga0495673_0014478 | 3300047469 | Bacteria | 4098 |
| 665 | Ga0495673_0016368 | 3300047469 | Bacteria | 3791 |
| 666 | Ga0495673_0030492 | 3300047469 | Bacteria | 2532 |
| 667 | Ga0495673_0036415 | 3300047469 | Bacteria | 2258 |
| 668 | Ga0495673_0045651 | 3300047469 | Bacteria | 1946 |
| 669 | Ga0495673_0050434 | 3300047469 | Bacteria | 1826 |
| 670 | Ga0495673_0061973 | 3300047469 | Bacteria | 1599 |
| 671 | Ga0495681_0000581 | 3300047470 | Bacteria | 27903 |
| 672 | Ga0495681_0003808 | 3300047470 | Bacteria | 10452 |
| 673 | Ga0495681_0005002 | 3300047470 | Bacteria | 8938 |
| 674 | Ga0495681_0005691 | 3300047470 | Bacteria | 8298 |
| 675 | Ga0495681_0005884 | 3300047470 | Bacteria | 8142 |
| 676 | Ga0495681_0007175 | 3300047470 | Bacteria | 7167 |
| 677 | Ga0495681_0011298 | 3300047470 | Bacteria | 5327 |
| 678 | Ga0495681_0029827 | 3300047470 | Bacteria | 2785 |
| 679 | Ga0495681_0210442 | 3300047470 | Bacteria | 784 |
| 680 | Ga0495684_0010927 | 3300047471 | Bacteria | 7018 |
| 681 | Ga0495684_0300311 | 3300047471 | Bacteria | 1153 |
| 682 | Ga0495686_0000266 | 3300047472 | Bacteria | 93781 |
| 683 | Ga0495686_0015706 | 3300047472 | Bacteria | 5159 |
| 684 | Ga0495686_0017794 | 3300047472 | Bacteria | 4782 |
| 685 | Ga0495686_0034296 | 3300047472 | Bacteria | 3269 |
| 686 | Ga0495686_0164061 | 3300047472 | Bacteria | 1296 |
| 687 | Ga0495686_0562723 | 3300047472 | Bacteria | 594 |
| 688 | Ga0495593_0003948 | 3300047673 | Bacteria | 8856 |
| 689 | Ga0495593_0012965 | 3300047673 | Bacteria | 4761 |
| 690 | Ga0495602_0000750 | 3300048088 | Bacteria | 30821 |
| 691 | Ga0495602_0152803 | 3300048088 | Bacteria | 1812 |
| 692 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 693 | Ga0495626_0000087 | 3300048091 | Bacteria | 122878 |
| 694 | Ga0495626_0000112 | 3300048091 | Bacteria | 105221 |
| 695 | Ga0495626_0000525 | 3300048091 | Bacteria | 38289 |
| 696 | Ga0495626_0000544 | 3300048091 | Bacteria | 37459 |
| 697 | Ga0495626_0002514 | 3300048091 | Bacteria | 12639 |
| 698 | Ga0495626_0007211 | 3300048091 | Bacteria | 6212 |
| 699 | Ga0495626_0012349 | 3300048091 | Bacteria | 4481 |
| 700 | Ga0495626_0036229 | 3300048091 | Bacteria | 2351 |
| 701 | Ga0495626_0060625 | 3300048091 | Bacteria | 1723 |
| 702 | Ga0495626_0106021 | 3300048091 | Bacteria | 1221 |
| 703 | Ga0496102_0000799 | 3300048905 | Bacteria | 30569 |
| 704 | Ga0496102_0399382 | 3300048905 | Bacteria | 1292 |
| 705 | Ga0496103_0001281 | 3300048906 | Bacteria | 17149 |
| 706 | Ga0496105_0517198 | 3300048908 | Bacteria | 935 |
| 707 | Ga0496106_0752034 | 3300048909 | Bacteria | 775 |
| 708 | Ga0496110_0062435 | 3300048913 | Bacteria | 3290 |
| 709 | Ga0496111_0189334 | 3300048914 | Bacteria | 1530 |
| 710 | Ga0496112_0199164 | 3300048915 | Bacteria | 1963 |
| 711 | Ga0496113_0443527 | 3300048916 | Bacteria | 1043 |
| 712 | Ga0496114_0194954 | 3300048917 | Bacteria | 1773 |
| 713 | Ga0496115_0033114 | 3300048918 | Bacteria | 4079 |
| 714 | Ga0496116_0000255 | 3300048919 | Bacteria | 94048 |
| 715 | Ga0496116_0001015 | 3300048919 | Bacteria | 34238 |
| 716 | Ga0496116_0007951 | 3300048919 | Bacteria | 9292 |
| 717 | Ga0496116_0010620 | 3300048919 | Bacteria | 7700 |
| 718 | Ga0496116_0316594 | 3300048919 | Bacteria | 733 |
| 719 | Ga0496117_0000475 | 3300048920 | Bacteria | 66690 |
| 720 | Ga0496117_0005333 | 3300048920 | Bacteria | 13555 |
| 721 | Ga0496117_0005546 | 3300048920 | Bacteria | 13210 |
| 722 | Ga0496117_0028925 | 3300048920 | Bacteria | 4281 |
| 723 | Ga0496117_0033605 | 3300048920 | Bacteria | 3876 |
| 724 | Ga0496118_0000482 | 3300048921 | Bacteria | 66218 |
| 725 | Ga0496118_0004092 | 3300048921 | Bacteria | 17677 |
| 726 | Ga0496118_0011019 | 3300048921 | Bacteria | 8880 |
| 727 | Ga0496118_0018808 | 3300048921 | Bacteria | 6204 |
| 728 | Ga0496119_0045464 | 3300048922 | Bacteria | 2752 |
| 729 | Ga0496119_0261263 | 3300048922 | Bacteria | 869 |
| 730 | Ga0496120_0014928 | 3300048923 | Bacteria | 5146 |
| 731 | Ga0496120_0081872 | 3300048923 | Bacteria | 1745 |
| 732 | Ga0496121_0002213 | 3300048924 | Bacteria | 30366 |
| 733 | Ga0496121_0007471 | 3300048924 | Bacteria | 13196 |
| 734 | Ga0496121_0012122 | 3300048924 | Bacteria | 9463 |
| 735 | Ga0496121_0138498 | 3300048924 | Bacteria | 1809 |
| 736 | Ga0496122_0009192 | 3300048925 | Bacteria | 10466 |
| 737 | Ga0496122_0031382 | 3300048925 | Bacteria | 4423 |
| 738 | Ga0496122_0144978 | 3300048925 | Bacteria | 1477 |
| 739 | Ga0496122_0478571 | 3300048925 | Bacteria | 610 |
| 740 | Ga0496123_0003395 | 3300048926 | Bacteria | 17945 |
| 741 | Ga0496123_0004023 | 3300048926 | Bacteria | 15877 |
| 742 | Ga0496123_0019067 | 3300048926 | Bacteria | 5416 |
| 743 | Ga0496123_0026890 | 3300048926 | Bacteria | 4298 |
| 744 | Ga0496123_0145418 | 3300048926 | Bacteria | 1288 |
| 745 | Ga0496123_0427584 | 3300048926 | Bacteria | 595 |
| 746 | Ga0496124_0000309 | 3300048927 | Bacteria | 90452 |
| 747 | Ga0496124_0015966 | 3300048927 | Bacteria | 7167 |
| 748 | Ga0496124_0021538 | 3300048927 | Bacteria | 5937 |
| 749 | Ga0496124_0035164 | 3300048927 | Bacteria | 4386 |
| 750 | Ga0496124_0066878 | 3300048927 | Bacteria | 2991 |
| 751 | Ga0496124_0093148 | 3300048927 | Bacteria | 2452 |
| 752 | Ga0496124_0135104 | 3300048927 | Bacteria | 1953 |
| 753 | Ga0496125_0003844 | 3300048928 | Bacteria | 17815 |
| 754 | Ga0496125_0048582 | 3300048928 | Bacteria | 3536 |
| 755 | Ga0496125_0516735 | 3300048928 | Bacteria | 668 |
| 756 | Ga0496126_0006999 | 3300048929 | Bacteria | 12459 |
| 757 | Ga0496126_0213283 | 3300048929 | Bacteria | 1624 |
| 758 | Ga0496126_0365625 | 3300048929 | Bacteria | 1177 |
| 759 | Ga0495678_000222 | 3300049459 | Bacteria | 65798 |
| 760 | Ga0495678_000987 | 3300049459 | Bacteria | 24370 |
| 761 | Ga0495678_001994 | 3300049459 | Bacteria | 14674 |
| 762 | Ga0495678_005791 | 3300049459 | Bacteria | 6710 |
| 763 | Ga0495678_007524 | 3300049459 | Bacteria | 5629 |
| 764 | Ga0495678_008180 | 3300049459 | Bacteria | 5312 |
| 765 | Ga0495678_014258 | 3300049459 | Bacteria | 3701 |
| 766 | Ga0495678_026398 | 3300049459 | Bacteria | 2480 |
| 767 | Ga0495678_035033 | 3300049459 | Bacteria | 2061 |
| 768 | Ga0495678_048215 | 3300049459 | Bacteria | 1662 |
| 769 | Ga0495678_051035 | 3300049459 | Bacteria | 1600 |
| 770 | Ga0495678_069458 | 3300049459 | Bacteria | 1295 |
| 771 | Ga0495678_107823 | 3300049459 | Bacteria | 954 |
| 772 | Ga0495682_0000131 | 3300049460 | Bacteria | 65377 |
| 773 | Ga0495682_0000425 | 3300049460 | Bacteria | 29587 |
| 774 | Ga0495682_0003606 | 3300049460 | Bacteria | 6826 |
| 775 | Ga0495682_0026255 | 3300049460 | Bacteria | 2163 |
| 776 | Ga0495682_0026589 | 3300049460 | Bacteria | 2147 |
| 777 | Ga0495682_0040999 | 3300049460 | Bacteria | 1697 |
| 778 | Ga0495682_0061415 | 3300049460 | Bacteria | 1356 |
| 779 | Ga0495682_0208762 | 3300049460 | Bacteria | 692 |
| 780 | Ga0501034_0000045 | 3300049571 | Bacteria | 226186 |
| 781 | Ga0501241_000247 | 3300049758 | Bacteria | 12110 |
| 782 | nmdc:mga03683_3264_c1 | 3300050489 | Bacteria | 5200 |
| 783 | nmdc:mga00v17_3574_c1 | 3300050491 | Bacteria | 8033 |
| 784 | nmdc:mga00v17_395857_c1 | 3300050491 | Bacteria | 898 |
| 785 | nmdc:mga00v17_419715_c1 | 3300050491 | Bacteria | 869 |
| 786 | nmdc:mga00v17_68535_c1 | 3300050491 | Bacteria | 2193 |
| 787 | nmdc:mga0sz30_1001_c1 | 3300050516 | Bacteria | 2747 |
| 788 | Ga0500572_000029 | 3300053111 | Bacteria | 44779 |
| 789 | Ga0500659_0000105 | 3300053135 | Bacteria | 44063 |
| 790 | Ga0500586_072460 | 3300053145 | Bacteria | 1206 |
| 791 | Ga0500634_0001224 | 3300053161 | Bacteria | 9685 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046674 | Ga0495588_0119873 | Ga0495588_0119873_25_438 | 137 |
| 2 | 3300041512 | Ga0451853_3249340 | Ga0451853_3249340_69_497 | 139 |
| 3 | 3300046452 | Ga0495617_199149 | Ga0495617_199149_119_577 | 139 |
| 4 | 3300046453 | Ga0495627_144181 | Ga0495627_144181_190_648 | 139 |
| 5 | 3300046457 | Ga0495590_0063193 | Ga0495590_0063193_397_855 | 139 |
| 6 | 3300046458 | Ga0495591_000021 | Ga0495591_000021_98760_99218 | 139 |
| 7 | 3300046460 | Ga0495638_0104569 | Ga0495638_0104569_159_617 | 139 |
| 8 | 3300046471 | Ga0495650_0005962 | Ga0495650_0005962_1080_1538 | 139 |
| 9 | 3300046474 | Ga0495605_0050253 | Ga0495605_0050253_997_1455 | 139 |
| 10 | 3300046491 | Ga0495584_0026065 | Ga0495584_0026065_876_1334 | 139 |
| 11 | 3300046500 | Ga0495596_0000012 | Ga0495596_0000012_102580_103038 | 139 |
| 12 | 3300046507 | Ga0495606_0016876 | Ga0495606_0016876_997_1455 | 139 |
| 13 | 3300046512 | Ga0495610_0017455 | Ga0495610_0017455_2636_3094 | 139 |
| 14 | 3300046513 | Ga0495616_0033092 | Ga0495616_0033092_569_1027 | 139 |
| 15 | 3300046515 | Ga0495620_0007988 | Ga0495620_0007988_514_972 | 139 |
| 16 | 3300046518 | Ga0495631_0010191 | Ga0495631_0010191_568_1026 | 139 |
| 17 | 3300046519 | Ga0495632_0005740 | Ga0495632_0005740_1072_1530 | 139 |
| 18 | 3300046520 | Ga0495637_0000246 | Ga0495637_0000246_36319_36777 | 139 |
| 19 | 3300046523 | Ga0495644_0006344 | Ga0495644_0006344_2585_3043 | 139 |
| 20 | 3300046524 | Ga0495648_0112508 | Ga0495648_0112508_452_910 | 139 |
| 21 | 3300046530 | Ga0495654_0016297 | Ga0495654_0016297_2895_3353 | 139 |
| 22 | 3300046558 | Ga0495633_0442408 | Ga0495633_0442408_18_476 | 139 |
| 23 | 3300046616 | Ga0495668_0000728 | Ga0495668_0000728_3631_4089 | 139 |
| 24 | 3300046660 | Ga0495625_0054529 | Ga0495625_0054529_134_592 | 139 |
| 25 | 3300046665 | Ga0495661_0056622 | Ga0495661_0056622_1738_2196 | 139 |
| 26 | 3300046694 | Ga0495649_0007753 | Ga0495649_0007753_3307_3765 | 139 |
| 27 | 3300046794 | Ga0495589_0043722 | Ga0495589_0043722_83_541 | 139 |
| 28 | 3300047469 | Ga0495673_0050434 | Ga0495673_0050434_749_1207 | 139 |
| 29 | 3300047470 | Ga0495681_0005002 | Ga0495681_0005002_2764_3222 | 139 |
| 30 | 3300047472 | Ga0495686_0017794 | Ga0495686_0017794_3677_4135 | 139 |
| 31 | 3300048091 | Ga0495626_0000525 | Ga0495626_0000525_11388_11846 | 139 |
| 32 | 3300049459 | Ga0495678_069458 | Ga0495678_069458_397_855 | 139 |
| 33 | 3300005328 | Ga0070676_10223938 | Ga0070676_102239382 | 141 |
| 34 | 3300005334 | Ga0068869_100056224 | Ga0068869_1000562243 | 141 |
| 35 | 3300005340 | Ga0070689_100119979 | Ga0070689_1001199792 | 141 |
| 36 | 3300005354 | Ga0070675_100117126 | Ga0070675_1001171262 | 141 |
| 37 | 3300005367 | Ga0070667_100501921 | Ga0070667_1005019212 | 141 |
| 38 | 3300005438 | Ga0070701_10097456 | Ga0070701_100974562 | 141 |
| 39 | 3300005440 | Ga0070705_100312453 | Ga0070705_1003124531 | 141 |
| 40 | 3300005456 | Ga0070678_100007327 | Ga0070678_1000073273 | 141 |
| 41 | 3300005459 | Ga0068867_100100941 | Ga0068867_1001009411 | 141 |
| 42 | 3300005617 | Ga0068859_100316393 | Ga0068859_1003163931 | 141 |
| 43 | 3300005841 | Ga0068863_101405756 | Ga0068863_1014057561 | 141 |
| 44 | 3300006177 | Ga0075362_10072069 | Ga0075362_100720693 | 141 |
| 45 | 3300006237 | Ga0097621_100401234 | Ga0097621_1004012341 | 141 |
| 46 | 3300006358 | Ga0068871_100011642 | Ga0068871_1000116423 | 141 |
| 47 | 3300006931 | Ga0097620_100316392 | Ga0097620_1003163921 | 141 |
| 48 | 3300017792 | Ga0163161_10333952 | Ga0163161_103339521 | 141 |
| 49 | 3300025907 | Ga0207645_10161504 | Ga0207645_101615042 | 141 |
| 50 | 3300025937 | Ga0207669_10254692 | Ga0207669_102546922 | 141 |
| 51 | 3300025942 | Ga0207689_10049630 | Ga0207689_100496302 | 141 |
| 52 | 3300025961 | Ga0207712_10180635 | Ga0207712_101806352 | 141 |
| 53 | 3300025986 | Ga0207658_10084176 | Ga0207658_100841762 | 141 |
| 54 | 3300026075 | Ga0207708_10019449 | Ga0207708_100194493 | 141 |
| 55 | 3300026089 | Ga0207648_10118187 | Ga0207648_101181872 | 141 |
| 56 | 3300026095 | Ga0207676_10290992 | Ga0207676_102909922 | 141 |
| 57 | 3300026121 | Ga0207683_10052026 | Ga0207683_100520262 | 141 |
| 58 | 3300028381 | Ga0268264_11910173 | Ga0268264_119101731 | 141 |
| 59 | 3300046684 | Ga0495669_0499372 | Ga0495669_0499372_75_503 | 141 |
| 60 | 3300041405 | Ga0439438_007556 | Ga0439438_007556_1328_1771 | 142 |
| 61 | 3300041407 | Ga0439447_027028 | Ga0439447_027028_824_1267 | 142 |
| 62 | 3300041411 | Ga0439466_0003461 | Ga0439466_0003461_4579_5022 | 142 |
| 63 | 3300046457 | Ga0495590_0007200 | Ga0495590_0007200_1468_1911 | 142 |
| 64 | 3300046458 | Ga0495591_010282 | Ga0495591_010282_301_744 | 142 |
| 65 | 3300046460 | Ga0495638_0000240 | Ga0495638_0000240_73246_73689 | 142 |
| 66 | 3300046491 | Ga0495584_0015017 | Ga0495584_0015017_1692_2135 | 142 |
| 67 | 3300046501 | Ga0495607_0052906 | Ga0495607_0052906_510_953 | 142 |
| 68 | 3300046513 | Ga0495616_0030187 | Ga0495616_0030187_1430_1873 | 142 |
| 69 | 3300046519 | Ga0495632_0010142 | Ga0495632_0010142_3677_4120 | 142 |
| 70 | 3300046522 | Ga0495643_0013747 | Ga0495643_0013747_899_1342 | 142 |
| 71 | 3300046523 | Ga0495644_0000125 | Ga0495644_0000125_32286_32729 | 142 |
| 72 | 3300046530 | Ga0495654_0026000 | Ga0495654_0026000_1614_2057 | 142 |
| 73 | 3300046542 | Ga0495597_0012636 | Ga0495597_0012636_1533_1976 | 142 |
| 74 | 3300046648 | Ga0495611_0009704 | Ga0495611_0009704_2170_2613 | 142 |
| 75 | 3300046692 | Ga0495671_0048873 | Ga0495671_0048873_661_1104 | 142 |
| 76 | 3300046694 | Ga0495649_0005159 | Ga0495649_0005159_2706_3149 | 142 |
| 77 | 3300046810 | Ga0495660_0014918 | Ga0495660_0014918_3886_4329 | 142 |
| 78 | 3300047320 | Ga0495672_0000185 | Ga0495672_0000185_10867_11310 | 142 |
| 79 | 3300047320 | Ga0495672_0000218 | Ga0495672_0000218_1482_1925 | 142 |
| 80 | 3300047323 | Ga0495683_0004045 | Ga0495683_0004045_1514_1957 | 142 |
| 81 | 3300047469 | Ga0495673_0002083 | Ga0495673_0002083_1492_1935 | 142 |
| 82 | 3300047469 | Ga0495673_0030492 | Ga0495673_0030492_1964_2431 | 142 |
| 83 | 3300048913 | Ga0496110_0062435 | Ga0496110_0062435_1091_1534 | 142 |
| 84 | 3300048927 | Ga0496124_0015966 | Ga0496124_0015966_5200_5643 | 142 |
| 85 | 3300049459 | Ga0495678_007524 | Ga0495678_007524_1497_1940 | 142 |
| 86 | 3300013102 | Ga0157371_10163629 | Ga0157371_101636293 | 143 |
| 87 | 3300047323 | Ga0495683_0009364 | Ga0495683_0009364_153_665 | 143 |
| 88 | 3300048908 | Ga0496105_0517198 | Ga0496105_0517198_291_779 | 143 |
| 89 | 3300042439 | Ga0439464_0033424 | Ga0439464_0033424_55_537 | 144 |
| 90 | 3300046501 | Ga0495607_0014731 | Ga0495607_0014731_3605_4072 | 144 |
| 91 | 3300049571 | Ga0501034_0000045 | Ga0501034_0000045_131559_132041 | 144 |
| 92 | 3300053135 | Ga0500659_0000105 | Ga0500659_0000105_902_1384 | 144 |
| 93 | 3300032002 | Ga0307416_102313851 | Ga0307416_1023138511 | 145 |
| 94 | 3300005347 | Ga0070668_100005467 | Ga0070668_1000054673 | 146 |
| 95 | 3300005353 | Ga0070669_101060759 | Ga0070669_1010607591 | 146 |
| 96 | 3300005356 | Ga0070674_100215326 | Ga0070674_1002153261 | 146 |
| 97 | 3300005719 | Ga0068861_100313773 | Ga0068861_1003137731 | 146 |
| 98 | 3300005844 | Ga0068862_100040294 | Ga0068862_1000402942 | 146 |
| 99 | 3300014326 | Ga0157380_10103938 | Ga0157380_101039382 | 146 |
| 100 | 3300014497 | Ga0182008_10005940 | Ga0182008_100059407 | 146 |
| 101 | 3300025937 | Ga0207669_10076592 | Ga0207669_100765922 | 146 |
| 102 | 3300025972 | Ga0207668_10004599 | Ga0207668_100045997 | 146 |
| 103 | 3300026118 | Ga0207675_101171014 | Ga0207675_1011710141 | 146 |
| 104 | 3300028380 | Ga0268265_10107257 | Ga0268265_101072572 | 146 |
| 105 | 3300046526 | Ga0495666_0320682 | Ga0495666_0320682_124_597 | 147 |
| 106 | 3300041405 | Ga0439438_012757 | Ga0439438_012757_1611_2114 | 148 |
| 107 | 3300042010 | Ga0439452_000077 | Ga0439452_000077_63342_63845 | 148 |
| 108 | 3300042115 | Ga0450911_001694 | Ga0450911_001694_3580_4080 | 148 |
| 109 | 3300046460 | Ga0495638_0014216 | Ga0495638_0014216_1348_1851 | 148 |
| 110 | 3300046491 | Ga0495584_0075978 | Ga0495584_0075978_927_1430 | 148 |
| 111 | 3300046492 | Ga0495585_0000523 | Ga0495585_0000523_11216_11734 | 148 |
| 112 | 3300046512 | Ga0495610_0016851 | Ga0495610_0016851_2105_2608 | 148 |
| 113 | 3300046524 | Ga0495648_0209011 | Ga0495648_0209011_234_737 | 148 |
| 114 | 3300046542 | Ga0495597_0049023 | Ga0495597_0049023_1295_1798 | 148 |
| 115 | 3300046615 | Ga0495656_0478370 | Ga0495656_0478370_103_606 | 148 |
| 116 | 3300046665 | Ga0495661_0099925 | Ga0495661_0099925_302_805 | 148 |
| 117 | 3300047470 | Ga0495681_0029827 | Ga0495681_0029827_1219_1722 | 148 |
| 118 | 3300047472 | Ga0495686_0015706 | Ga0495686_0015706_789_1292 | 148 |
| 119 | 3300042531 | Ga0450918_092929 | Ga0450918_092929_19_501 | 149 |
| 120 | 3300046520 | Ga0495637_0003314 | Ga0495637_0003314_1379_1864 | 150 |
| 121 | 3300046694 | Ga0495649_0062920 | Ga0495649_0062920_115_600 | 150 |
| 122 | 3300005288 | Ga0065714_10006412 | Ga0065714_100064124 | 151 |
| 123 | 3300005289 | Ga0065704_10472404 | Ga0065704_104724041 | 151 |
| 124 | 3300005289 | Ga0065704_10604140 | Ga0065704_106041401 | 151 |
| 125 | 3300006058 | Ga0075432_10002955 | Ga0075432_100029553 | 151 |
| 126 | 3300009011 | Ga0105251_10016946 | Ga0105251_100169464 | 151 |
| 127 | 3300015265 | Ga0182005_1002371 | Ga0182005_10023713 | 151 |
| 128 | 3300025735 | Ga0207713_1012828 | Ga0207713_10128283 | 151 |
| 129 | 3300027907 | Ga0207428_10013492 | Ga0207428_100134922 | 151 |
| 130 | 3300041405 | Ga0439438_000981 | Ga0439438_000981_10032_10505 | 151 |
| 131 | 3300041407 | Ga0439447_022493 | Ga0439447_022493_307_780 | 151 |
| 132 | 3300041411 | Ga0439466_0018916 | Ga0439466_0018916_566_1054 | 151 |
| 133 | 3300041413 | Ga0439465_0110222 | Ga0439465_0110222_116_589 | 151 |
| 134 | 3300042006 | Ga0439432_001360 | Ga0439432_001360_3671_4144 | 151 |
| 135 | 3300042010 | Ga0439452_060884 | Ga0439452_060884_66_539 | 151 |
| 136 | 3300042013 | Ga0439456_040197 | Ga0439456_040197_468_941 | 151 |
| 137 | 3300042016 | Ga0439463_009968 | Ga0439463_009968_1563_2036 | 151 |
| 138 | 3300042115 | Ga0450911_001475 | Ga0450911_001475_2322_2795 | 151 |
| 139 | 3300042121 | Ga0450919_000545 | Ga0450919_000545_458_931 | 151 |
| 140 | 3300042124 | Ga0450922_003138 | Ga0450922_003138_444_917 | 151 |
| 141 | 3300042127 | Ga0450890_003233 | Ga0450890_003233_1263_1736 | 151 |
| 142 | 3300042137 | Ga0450902_006918 | Ga0450902_006918_1243_1731 | 151 |
| 143 | 3300042145 | Ga0450906_001777 | Ga0450906_001777_3646_4119 | 151 |
| 144 | 3300042146 | Ga0450907_002098 | Ga0450907_002098_1890_2363 | 151 |
| 145 | 3300042147 | Ga0450910_002897 | Ga0450910_002897_1234_1707 | 151 |
| 146 | 3300042156 | Ga0439446_0002932 | Ga0439446_0002932_1928_2401 | 151 |
| 147 | 3300042184 | Ga0450908_002470 | Ga0450908_002470_840_1313 | 151 |
| 148 | 3300042184 | Ga0450908_023536 | Ga0450908_023536_538_1026 | 151 |
| 149 | 3300042185 | Ga0450909_000180 | Ga0450909_000180_2992_3465 | 151 |
| 150 | 3300042435 | Ga0439434_0041898 | Ga0439434_0041898_497_970 | 151 |
| 151 | 3300042439 | Ga0439464_0032381 | Ga0439464_0032381_690_1163 | 151 |
| 152 | 3300042531 | Ga0450918_019228 | Ga0450918_019228_102_575 | 151 |
| 153 | 3300042993 | Ga0439440_0042699 | Ga0439440_0042699_467_940 | 151 |
| 154 | 3300046452 | Ga0495617_004248 | Ga0495617_004248_3972_4460 | 151 |
| 155 | 3300046452 | Ga0495617_070033 | Ga0495617_070033_27_515 | 151 |
| 156 | 3300046453 | Ga0495627_003287 | Ga0495627_003287_984_1472 | 151 |
| 157 | 3300046455 | Ga0495603_0069782 | Ga0495603_0069782_914_1405 | 151 |
| 158 | 3300046457 | Ga0495590_0027246 | Ga0495590_0027246_1299_1787 | 151 |
| 159 | 3300046458 | Ga0495591_008205 | Ga0495591_008205_497_985 | 151 |
| 160 | 3300046460 | Ga0495638_0028318 | Ga0495638_0028318_615_1103 | 151 |
| 161 | 3300046460 | Ga0495638_0196222 | Ga0495638_0196222_82_555 | 151 |
| 162 | 3300046471 | Ga0495650_0003857 | Ga0495650_0003857_8659_9147 | 151 |
| 163 | 3300046474 | Ga0495605_0015327 | Ga0495605_0015327_3151_3639 | 151 |
| 164 | 3300046491 | Ga0495584_0000084 | Ga0495584_0000084_39361_39834 | 151 |
| 165 | 3300046491 | Ga0495584_0010457 | Ga0495584_0010457_1265_1753 | 151 |
| 166 | 3300046492 | Ga0495585_0065349 | Ga0495585_0065349_649_1137 | 151 |
| 167 | 3300046501 | Ga0495607_0009835 | Ga0495607_0009835_2897_3385 | 151 |
| 168 | 3300046507 | Ga0495606_0004827 | Ga0495606_0004827_8929_9417 | 151 |
| 169 | 3300046512 | Ga0495610_0011999 | Ga0495610_0011999_3713_4201 | 151 |
| 170 | 3300046512 | Ga0495610_0094510 | Ga0495610_0094510_217_705 | 151 |
| 171 | 3300046513 | Ga0495616_0065594 | Ga0495616_0065594_597_1085 | 151 |
| 172 | 3300046515 | Ga0495620_0002118 | Ga0495620_0002118_5876_6364 | 151 |
| 173 | 3300046517 | Ga0495630_0022414 | Ga0495630_0022414_2742_3233 | 151 |
| 174 | 3300046518 | Ga0495631_0167942 | Ga0495631_0167942_438_911 | 151 |
| 175 | 3300046518 | Ga0495631_0194296 | Ga0495631_0194296_102_590 | 151 |
| 176 | 3300046519 | Ga0495632_0004655 | Ga0495632_0004655_8659_9147 | 151 |
| 177 | 3300046519 | Ga0495632_0017077 | Ga0495632_0017077_1350_1838 | 151 |
| 178 | 3300046520 | Ga0495637_0000562 | Ga0495637_0000562_1731_2204 | 151 |
| 179 | 3300046520 | Ga0495637_0033289 | Ga0495637_0033289_678_1166 | 151 |
| 180 | 3300046522 | Ga0495643_0018270 | Ga0495643_0018270_256_744 | 151 |
| 181 | 3300046523 | Ga0495644_0007103 | Ga0495644_0007103_1637_2125 | 151 |
| 182 | 3300046523 | Ga0495644_0154328 | Ga0495644_0154328_59_547 | 151 |
| 183 | 3300046524 | Ga0495648_0135890 | Ga0495648_0135890_82_570 | 151 |
| 184 | 3300046526 | Ga0495666_0002039 | Ga0495666_0002039_2648_3139 | 151 |
| 185 | 3300046530 | Ga0495654_0238629 | Ga0495654_0238629_46_534 | 151 |
| 186 | 3300046535 | Ga0495586_0859337 | Ga0495586_0859337_18_509 | 151 |
| 187 | 3300046542 | Ga0495597_0034476 | Ga0495597_0034476_578_1066 | 151 |
| 188 | 3300046542 | Ga0495597_0040156 | Ga0495597_0040156_1358_1846 | 151 |
| 189 | 3300046542 | Ga0495597_0062125 | Ga0495597_0062125_578_1066 | 151 |
| 190 | 3300046542 | Ga0495597_0171546 | Ga0495597_0171546_72_560 | 151 |
| 191 | 3300046542 | Ga0495597_0298352 | Ga0495597_0298352_117_590 | 151 |
| 192 | 3300046558 | Ga0495633_0152420 | Ga0495633_0152420_340_828 | 151 |
| 193 | 3300046660 | Ga0495625_0063830 | Ga0495625_0063830_1317_1805 | 151 |
| 194 | 3300046660 | Ga0495625_0109830 | Ga0495625_0109830_254_727 | 151 |
| 195 | 3300046660 | Ga0495625_0325030 | Ga0495625_0325030_311_799 | 151 |
| 196 | 3300046665 | Ga0495661_0025295 | Ga0495661_0025295_2707_3195 | 151 |
| 197 | 3300046665 | Ga0495661_0063092 | Ga0495661_0063092_499_987 | 151 |
| 198 | 3300046675 | Ga0495657_0076943 | Ga0495657_0076943_286_777 | 151 |
| 199 | 3300046679 | Ga0495623_0015436 | Ga0495623_0015436_4180_4671 | 151 |
| 200 | 3300046691 | Ga0495670_0002383 | Ga0495670_0002383_4983_5456 | 151 |
| 201 | 3300046691 | Ga0495670_0019670 | Ga0495670_0019670_2074_2562 | 151 |
| 202 | 3300046691 | Ga0495670_0046437 | Ga0495670_0046437_1049_1537 | 151 |
| 203 | 3300046692 | Ga0495671_0000136 | Ga0495671_0000136_25305_25778 | 151 |
| 204 | 3300046692 | Ga0495671_0109272 | Ga0495671_0109272_214_702 | 151 |
| 205 | 3300046694 | Ga0495649_0019016 | Ga0495649_0019016_809_1297 | 151 |
| 206 | 3300046694 | Ga0495649_0056345 | Ga0495649_0056345_505_993 | 151 |
| 207 | 3300046794 | Ga0495589_0045040 | Ga0495589_0045040_299_787 | 151 |
| 208 | 3300046809 | Ga0495600_0050369 | Ga0495600_0050369_101_592 | 151 |
| 209 | 3300046810 | Ga0495660_0034236 | Ga0495660_0034236_798_1286 | 151 |
| 210 | 3300046810 | Ga0495660_0228809 | Ga0495660_0228809_93_581 | 151 |
| 211 | 3300047318 | Ga0495636_0126540 | Ga0495636_0126540_43_516 | 151 |
| 212 | 3300047320 | Ga0495672_0057311 | Ga0495672_0057311_654_1142 | 151 |
| 213 | 3300047320 | Ga0495672_0069814 | Ga0495672_0069814_1063_1554 | 151 |
| 214 | 3300047322 | Ga0495680_0064664 | Ga0495680_0064664_1302_1793 | 151 |
| 215 | 3300047322 | Ga0495680_0117857 | Ga0495680_0117857_352_843 | 151 |
| 216 | 3300047323 | Ga0495683_0035401 | Ga0495683_0035401_1967_2440 | 151 |
| 217 | 3300047323 | Ga0495683_0036767 | Ga0495683_0036767_742_1230 | 151 |
| 218 | 3300047444 | Ga0495675_0640830 | Ga0495675_0640830_69_560 | 151 |
| 219 | 3300047446 | Ga0495679_013110 | Ga0495679_013110_798_1286 | 151 |
| 220 | 3300047446 | Ga0495679_046751 | Ga0495679_046751_639_1127 | 151 |
| 221 | 3300047469 | Ga0495673_0014478 | Ga0495673_0014478_2628_3116 | 151 |
| 222 | 3300047469 | Ga0495673_0016368 | Ga0495673_0016368_678_1166 | 151 |
| 223 | 3300047469 | Ga0495673_0061973 | Ga0495673_0061973_70_543 | 151 |
| 224 | 3300047470 | Ga0495681_0007175 | Ga0495681_0007175_870_1358 | 151 |
| 225 | 3300047470 | Ga0495681_0011298 | Ga0495681_0011298_1108_1596 | 151 |
| 226 | 3300047471 | Ga0495684_0300311 | Ga0495684_0300311_380_871 | 151 |
| 227 | 3300047472 | Ga0495686_0164061 | Ga0495686_0164061_548_1036 | 151 |
| 228 | 3300047673 | Ga0495593_0003948 | Ga0495593_0003948_5414_5905 | 151 |
| 229 | 3300048091 | Ga0495626_0000112 | Ga0495626_0000112_76912_77400 | 151 |
| 230 | 3300048091 | Ga0495626_0012349 | Ga0495626_0012349_2891_3364 | 151 |
| 231 | 3300048914 | Ga0496111_0189334 | Ga0496111_0189334_942_1430 | 151 |
| 232 | 3300048915 | Ga0496112_0199164 | Ga0496112_0199164_1026_1511 | 151 |
| 233 | 3300048916 | Ga0496113_0443527 | Ga0496113_0443527_221_706 | 151 |
| 234 | 3300048924 | Ga0496121_0002213 | Ga0496121_0002213_5771_6256 | 151 |
| 235 | 3300048925 | Ga0496122_0144978 | Ga0496122_0144978_927_1412 | 151 |
| 236 | 3300048926 | Ga0496123_0026890 | Ga0496123_0026890_3594_4079 | 151 |
| 237 | 3300049459 | Ga0495678_000987 | Ga0495678_000987_4067_4540 | 151 |
| 238 | 3300049459 | Ga0495678_005791 | Ga0495678_005791_4909_5397 | 151 |
| 239 | 3300049459 | Ga0495678_026398 | Ga0495678_026398_1586_2074 | 151 |
| 240 | 3300049460 | Ga0495682_0061415 | Ga0495682_0061415_539_1012 | 151 |
| 241 | iso_pu_bacteria | 2511231004 | 2511255526 | 151 |
| 242 | iso_pu_bacteria | 2511231016 | 2511328541 | 151 |
| 243 | iso_pu_bacteria | 2511231021 | 2511358730 | 151 |
| 244 | iso_pu_bacteria | 2511231022 | 2511363147 | 151 |
| 245 | iso_pu_bacteria | 2599185288 | 2599880635 | 151 |
| 246 | iso_pu_bacteria | 2599185303 | 2599952066 | 151 |
| 247 | iso_pu_bacteria | 2619619299 | 2621300297 | 151 |
| 248 | iso_pu_bacteria | 2738541265 | 2738674664 | 151 |
| 249 | iso_pu_bacteria | 2738541282 | 2738753057 | 151 |
| 250 | iso_pu_bacteria | 2738541294 | 2738806244 | 151 |
| 251 | iso_pu_bacteria | 2738541303 | 2738862212 | 151 |
| 252 | iso_pu_bacteria | 2738541309 | 2738893604 | 151 |
| 253 | iso_pu_bacteria | 2808606385 | 2808980384 | 151 |
| 254 | iso_pu_bacteria | 2808606388 | 2808996105 | 151 |
| 255 | iso_pu_bacteria | 2816332298 | 2817490629 | 151 |
| 256 | iso_pu_bacteria | 2834028612 | 2834034409 | 151 |
| 257 | iso_pu_bacteria | 2852612431 | 2852613987 | 151 |
| 258 | iso_pu_bacteria | 2852667396 | 2852668276 | 151 |
| 259 | iso_pu_bacteria | 2908446538 | 2908449077 | 151 |
| 260 | iso_pu_bacteria | 2945928738 | 2945933046 | 151 |
| 261 | iso_pu_bacteria | 8054285046 | 8054290047 | 151 |
| 262 | iso_pu_bacteria | 8055817908 | 8055821511 | 151 |
| 263 | iso_pu_bacteria | 8056131705 | 8056135198 | 151 |
| 264 | iso_pu_bacteria | 8056161164 | 8056165685 | 151 |
| 265 | 3300046460 | Ga0495638_0042776 | Ga0495638_0042776_1462_1959 | 152 |
| 266 | 3300046507 | Ga0495606_0067519 | Ga0495606_0067519_1180_1677 | 152 |
| 267 | 3300046519 | Ga0495632_0080809 | Ga0495632_0080809_14_511 | 152 |
| 268 | 3300046530 | Ga0495654_0006521 | Ga0495654_0006521_1461_1958 | 152 |
| 269 | 3300046692 | Ga0495671_0233979 | Ga0495671_0233979_278_775 | 152 |
| 270 | 3300046694 | Ga0495649_0016721 | Ga0495649_0016721_3543_4040 | 152 |
| 271 | 3300046794 | Ga0495589_0002859 | Ga0495589_0002859_8983_9480 | 152 |
| 272 | iso_pu_bacteria | 2597489888 | 2597864299 | 152 |
| 273 | iso_pu_bacteria | 2599185167 | 2599397518 | 152 |
| 274 | iso_pu_bacteria | 2599185179 | 2599451963 | 152 |
| 275 | iso_pu_bacteria | 2599185189 | 2599509068 | 152 |
| 276 | iso_pu_bacteria | 2599185190 | 2599513655 | 152 |
| 277 | iso_pu_bacteria | 2599185191 | 2599521960 | 152 |
| 278 | iso_pu_bacteria | 2599185290 | 2599892332 | 152 |
| 279 | iso_pu_bacteria | 2600255296 | 2601690362 | 152 |
| 280 | iso_pu_bacteria | 2643221565 | 2643842177 | 152 |
| 281 | iso_pu_bacteria | 2643221571 | 2643870582 | 152 |
| 282 | iso_pu_bacteria | 2643221713 | 2644622476 | 152 |
| 283 | iso_pu_bacteria | 2721755607 | 2723249114 | 152 |
| 284 | iso_pu_bacteria | 2842826826 | 2842830828 | 152 |
| 285 | iso_pu_bacteria | 2842837860 | 2842840246 | 152 |
| 286 | iso_pu_bacteria | 2860867994 | 2860870919 | 152 |
| 287 | iso_pu_bacteria | 2931390751 | 2931393528 | 152 |
| 288 | iso_pu_bacteria | 2946027586 | 2946031247 | 152 |
| 289 | iso_pu_bacteria | 2947233263 | 2947238208 | 152 |
| 290 | iso_pu_bacteria | 8054347763 | 8054351434 | 152 |
| 291 | iso_pu_bacteria | 8054503363 | 8054506746 | 152 |
| 292 | iso_pu_bacteria | 8056148874 | 8056154997 | 152 |
| 293 | iso_pu_bacteria | 8056177738 | 8056178706 | 152 |
| 294 | 3300046452 | Ga0495617_003562 | Ga0495617_003562_5173_5703 | 153 |
| 295 | 3300003751 | Ga0055538_1000133 | Ga0055538_100013319 | 154 |
| 296 | 3300003752 | Ga0055539_1000182 | Ga0055539_100018219 | 154 |
| 297 | 3300003756 | Ga0055533_1000181 | Ga0055533_100018119 | 154 |
| 298 | 3300003758 | Ga0055532_1000195 | Ga0055532_100019519 | 154 |
| 299 | 3300003759 | Ga0055525_1000250 | Ga0055525_100025019 | 154 |
| 300 | 3300003761 | Ga0055535_1008029 | Ga0055535_10080293 | 154 |
| 301 | 3300003841 | Ga0055541_1000067 | Ga0055541_100006760 | 154 |
| 302 | 3300009011 | Ga0105251_10020138 | Ga0105251_100201381 | 154 |
| 303 | 3300009036 | Ga0105244_10003827 | Ga0105244_100038271 | 154 |
| 304 | 3300009036 | Ga0105244_10025780 | Ga0105244_100257804 | 154 |
| 305 | 3300009148 | Ga0105243_10138235 | Ga0105243_101382352 | 154 |
| 306 | 3300011119 | Ga0105246_10002958 | Ga0105246_100029587 | 154 |
| 307 | 3300013100 | Ga0157373_10001351 | Ga0157373_100013512 | 154 |
| 308 | 3300015262 | Ga0182007_10037365 | Ga0182007_100373652 | 154 |
| 309 | 3300015265 | Ga0182005_1000149 | Ga0182005_10001497 | 154 |
| 310 | 3300025206 | Ga0209435_103779 | Ga0209435_1037791 | 154 |
| 311 | 3300025224 | Ga0209784_100112 | Ga0209784_10011219 | 154 |
| 312 | 3300025225 | Ga0209566_100045 | Ga0209566_100045162 | 154 |
| 313 | 3300025226 | Ga0209674_100156 | Ga0209674_10015619 | 154 |
| 314 | 3300025229 | Ga0209147_100056 | Ga0209147_100056162 | 154 |
| 315 | 3300025230 | Ga0209563_100064 | Ga0209563_100064162 | 154 |
| 316 | 3300025233 | Ga0209437_106567 | Ga0209437_1065671 | 154 |
| 317 | 3300025242 | Ga0209258_100411 | Ga0209258_10041116 | 154 |
| 318 | 3300025246 | Ga0209646_1000147 | Ga0209646_100014720 | 154 |
| 319 | 3300025253 | Ga0209677_100103 | Ga0209677_10010319 | 154 |
| 320 | 3300025728 | Ga0207655_1000022 | Ga0207655_1000022202 | 154 |
| 321 | 3300025728 | Ga0207655_1004514 | Ga0207655_10045147 | 154 |
| 322 | 3300025935 | Ga0207709_10120368 | Ga0207709_101203682 | 154 |
| 323 | 3300042009 | Ga0439451_047248 | Ga0439451_047248_354_836 | 154 |
| 324 | 3300042013 | Ga0439456_000194 | Ga0439456_000194_3361_3843 | 154 |
| 325 | 3300042016 | Ga0439463_000020 | Ga0439463_000020_8942_9424 | 154 |
| 326 | 3300046458 | Ga0495591_006430 | Ga0495591_006430_1337_1819 | 154 |
| 327 | 3300046501 | Ga0495607_0000084 | Ga0495607_0000084_34513_34995 | 154 |
| 328 | 3300046519 | Ga0495632_0011904 | Ga0495632_0011904_4074_4556 | 154 |
| 329 | 3300046520 | Ga0495637_0000038 | Ga0495637_0000038_62311_62793 | 154 |
| 330 | 3300046524 | Ga0495648_0000884 | Ga0495648_0000884_14507_14977 | 154 |
| 331 | 3300046530 | Ga0495654_0003839 | Ga0495654_0003839_2728_3210 | 154 |
| 332 | 3300046530 | Ga0495654_0135216 | Ga0495654_0135216_400_870 | 154 |
| 333 | 3300046665 | Ga0495661_0396150 | Ga0495661_0396150_65_535 | 154 |
| 334 | 3300046692 | Ga0495671_0002282 | Ga0495671_0002282_7352_7834 | 154 |
| 335 | 3300047446 | Ga0495679_000180 | Ga0495679_000180_43958_44440 | 154 |
| 336 | 3300047469 | Ga0495673_0000503 | Ga0495673_0000503_35152_35634 | 154 |
| 337 | 3300049460 | Ga0495682_0000131 | Ga0495682_0000131_21930_22412 | 154 |
| 338 | iso_pu_bacteria | 2511231010 | 2511291258 | 154 |
| 339 | iso_pu_bacteria | 2600255318 | 2601796141 | 154 |
| 340 | iso_pu_bacteria | 2603880185 | 2606075006 | 154 |
| 341 | iso_pu_bacteria | 2603880199 | 2606127869 | 154 |
| 342 | iso_pu_bacteria | 2623620443 | 2624480186 | 154 |
| 343 | iso_pu_bacteria | 2713897149 | 2715757245 | 154 |
| 344 | iso_pu_bacteria | 2713897149 | 2715758417 | 154 |
| 345 | iso_pu_bacteria | 2878029506 | 2878032099 | 154 |
| 346 | iso_pu_bacteria | 2919063839 | 2919068575 | 154 |
| 347 | iso_pu_bacteria | 2935353572 | 2935353664 | 154 |
| 348 | iso_pu_bacteria | 2945961074 | 2945963100 | 154 |
| 349 | 3300005288 | Ga0065714_10064945 | Ga0065714_1006494516 | 155 |
| 350 | 3300005290 | Ga0065712_10080270 | Ga0065712_100802706 | 155 |
| 351 | 3300005331 | Ga0070670_100000112 | Ga0070670_10000011221 | 155 |
| 352 | 3300005331 | Ga0070670_100000945 | Ga0070670_10000094513 | 155 |
| 353 | 3300005344 | Ga0070661_100000310 | Ga0070661_10000031022 | 155 |
| 354 | 3300005356 | Ga0070674_101058135 | Ga0070674_1010581351 | 155 |
| 355 | 3300005548 | Ga0070665_100458325 | Ga0070665_1004583252 | 155 |
| 356 | 3300005564 | Ga0070664_100000241 | Ga0070664_10000024121 | 155 |
| 357 | 3300006051 | Ga0075364_10252061 | Ga0075364_102520611 | 155 |
| 358 | 3300006058 | Ga0075432_10017391 | Ga0075432_100173912 | 155 |
| 359 | 3300009011 | Ga0105251_10001646 | Ga0105251_1000164623 | 155 |
| 360 | 3300009036 | Ga0105244_10046539 | Ga0105244_100465393 | 155 |
| 361 | 3300009092 | Ga0105250_10000337 | Ga0105250_1000033733 | 155 |
| 362 | 3300009176 | Ga0105242_10000099 | Ga0105242_1000009922 | 155 |
| 363 | 3300009545 | Ga0105237_10002377 | Ga0105237_100023777 | 155 |
| 364 | 3300011119 | Ga0105246_10001438 | Ga0105246_1000143815 | 155 |
| 365 | 3300011119 | Ga0105246_11521776 | Ga0105246_115217761 | 155 |
| 366 | 3300013100 | Ga0157373_10000596 | Ga0157373_1000059616 | 155 |
| 367 | 3300013100 | Ga0157373_10001464 | Ga0157373_1000146421 | 155 |
| 368 | 3300013100 | Ga0157373_10090111 | Ga0157373_100901113 | 155 |
| 369 | 3300013104 | Ga0157370_10070762 | Ga0157370_100707623 | 155 |
| 370 | 3300013105 | Ga0157369_10052524 | Ga0157369_100525246 | 155 |
| 371 | 3300013306 | Ga0163162_10029228 | Ga0163162_100292285 | 155 |
| 372 | 3300013306 | Ga0163162_10047982 | Ga0163162_100479822 | 155 |
| 373 | 3300013308 | Ga0157375_10000602 | Ga0157375_1000060218 | 155 |
| 374 | 3300013308 | Ga0157375_10001025 | Ga0157375_1000102525 | 155 |
| 375 | 3300014497 | Ga0182008_10001189 | Ga0182008_1000118920 | 155 |
| 376 | 3300015261 | Ga0182006_1000158 | Ga0182006_100015855 | 155 |
| 377 | 3300015262 | Ga0182007_10000769 | Ga0182007_100007691 | 155 |
| 378 | 3300025711 | Ga0207696_1000090 | Ga0207696_1000090199 | 155 |
| 379 | 3300025711 | Ga0207696_1000176 | Ga0207696_100017687 | 155 |
| 380 | 3300025711 | Ga0207696_1000177 | Ga0207696_100017722 | 155 |
| 381 | 3300025728 | Ga0207655_1000203 | Ga0207655_100020387 | 155 |
| 382 | 3300025728 | Ga0207655_1035418 | Ga0207655_10354181 | 155 |
| 383 | 3300025735 | Ga0207713_1001317 | Ga0207713_10013173 | 155 |
| 384 | 3300025914 | Ga0207671_10002355 | Ga0207671_100023553 | 155 |
| 385 | 3300025920 | Ga0207649_10000695 | Ga0207649_1000069522 | 155 |
| 386 | 3300025925 | Ga0207650_10000145 | Ga0207650_1000014532 | 155 |
| 387 | 3300025925 | Ga0207650_10000721 | Ga0207650_1000072120 | 155 |
| 388 | 3300025934 | Ga0207686_10007813 | Ga0207686_100078132 | 155 |
| 389 | 3300025945 | Ga0207679_10000037 | Ga0207679_1000003722 | 155 |
| 390 | 3300030521 | Ga0307511_10110964 | Ga0307511_101109642 | 155 |
| 391 | 3300031344 | Ga0265316_10185481 | Ga0265316_101854814 | 155 |
| 392 | 3300031712 | Ga0265342_10469672 | Ga0265342_104696721 | 155 |
| 393 | 3300031731 | Ga0307405_10000073 | Ga0307405_1000007329 | 155 |
| 394 | 3300031911 | Ga0307412_10032406 | Ga0307412_100324065 | 155 |
| 395 | 3300042006 | Ga0439432_000022 | Ga0439432_000022_19121_19588 | 155 |
| 396 | 3300042134 | Ga0450898_003631 | Ga0450898_003631_23_490 | 155 |
| 397 | 3300046460 | Ga0495638_0019151 | Ga0495638_0019151_3083_3592 | 155 |
| 398 | 3300046515 | Ga0495620_0027913 | Ga0495620_0027913_2050_2517 | 155 |
| 399 | 3300046520 | Ga0495637_0181969 | Ga0495637_0181969_240_749 | 155 |
| 400 | 3300046524 | Ga0495648_0008673 | Ga0495648_0008673_30_497 | 155 |
| 401 | 3300046648 | Ga0495611_0407553 | Ga0495611_0407553_105_572 | 155 |
| 402 | 3300046665 | Ga0495661_0001273 | Ga0495661_0001273_11939_12406 | 155 |
| 403 | 3300046810 | Ga0495660_0077956 | Ga0495660_0077956_58_525 | 155 |
| 404 | 3300047446 | Ga0495679_000247 | Ga0495679_000247_3408_3875 | 155 |
| 405 | 3300048920 | Ga0496117_0005333 | Ga0496117_0005333_8072_8539 | 155 |
| 406 | 3300048923 | Ga0496120_0014928 | Ga0496120_0014928_178_645 | 155 |
| 407 | 3300048924 | Ga0496121_0012122 | Ga0496121_0012122_760_1227 | 155 |
| 408 | 3300048925 | Ga0496122_0031382 | Ga0496122_0031382_124_591 | 155 |
| 409 | 3300048926 | Ga0496123_0004023 | Ga0496123_0004023_15302_15769 | 155 |
| 410 | 3300048926 | Ga0496123_0019067 | Ga0496123_0019067_2095_2562 | 155 |
| 411 | 3300048927 | Ga0496124_0066878 | Ga0496124_0066878_557_1024 | 155 |
| 412 | 3300048927 | Ga0496124_0093148 | Ga0496124_0093148_1228_1695 | 155 |
| 413 | 3300048928 | Ga0496125_0003844 | Ga0496125_0003844_500_967 | 155 |
| 414 | 3300048928 | Ga0496125_0048582 | Ga0496125_0048582_2427_2894 | 155 |
| 415 | 3300048928 | Ga0496125_0516735 | Ga0496125_0516735_85_552 | 155 |
| 416 | 3300048929 | Ga0496126_0006999 | Ga0496126_0006999_1081_1548 | 155 |
| 417 | 3300053161 | Ga0500634_0001224 | Ga0500634_0001224_1002_1469 | 155 |
| 418 | iso_pu_bacteria | 2511231011 | 2511296524 | 155 |
| 419 | iso_pu_bacteria | 2511231023 | 2511367963 | 155 |
| 420 | iso_pu_bacteria | 2713897148 | 2715753507 | 155 |
| 421 | iso_pu_bacteria | 2718217725 | 2718634533 | 155 |
| 422 | iso_pu_bacteria | 2738543025 | 2739313176 | 155 |
| 423 | iso_pu_bacteria | 2773857673 | 2774138000 | 155 |
| 424 | iso_pu_bacteria | 2784132063 | 2784264928 | 155 |
| 425 | iso_pu_bacteria | 2818991456 | 2819656854 | 155 |
| 426 | iso_pu_bacteria | 2842832357 | 2842835310 | 155 |
| 427 | iso_pu_bacteria | 2842843487 | 2842844129 | 155 |
| 428 | iso_pu_bacteria | 2852657418 | 2852662149 | 155 |
| 429 | iso_pu_bacteria | 2880230671 | 2880233031 | 155 |
| 430 | iso_pu_bacteria | 2904518522 | 2904523419 | 155 |
| 431 | iso_pu_bacteria | 2919487758 | 2919492924 | 155 |
| 432 | iso_pu_bacteria | 2969304461 | 2969307027 | 155 |
| 433 | iso_pu_bacteria | 2998139840 | 2998142221 | 155 |
| 434 | iso_pu_bacteria | 3007614139 | 3007619274 | 155 |
| 435 | iso_pu_bacteria | 3007718800 | 3007723366 | 155 |
| 436 | iso_pu_bacteria | 3007855910 | 3007856428 | 155 |
| 437 | iso_pu_bacteria | 3007861166 | 3007862521 | 155 |
| 438 | iso_pu_bacteria | 8029995093 | 8029998487 | 155 |
| 439 | iso_pu_bacteria | 8056166840 | 8056168849 | 155 |
| 440 | iso_pu_bacteria | 8056569372 | 8056574256 | 155 |
| 441 | 3300003781 | Ga0055536_1040697 | Ga0055536_10406971 | 156 |
| 442 | 3300003791 | Ga0055530_10016572 | Ga0055530_100165722 | 156 |
| 443 | 3300005288 | Ga0065714_10028204 | Ga0065714_100282042 | 156 |
| 444 | 3300005457 | Ga0070662_100007847 | Ga0070662_1000078473 | 156 |
| 445 | 3300005578 | Ga0068854_100008490 | Ga0068854_1000084908 | 156 |
| 446 | 3300005834 | Ga0068851_10005508 | Ga0068851_100055086 | 156 |
| 447 | 3300006051 | Ga0075364_10058419 | Ga0075364_100584193 | 156 |
| 448 | 3300006051 | Ga0075364_10401361 | Ga0075364_104013612 | 156 |
| 449 | 3300006051 | Ga0075364_10588389 | Ga0075364_105883891 | 156 |
| 450 | 3300006058 | Ga0075432_10027014 | Ga0075432_100270143 | 156 |
| 451 | 3300006058 | Ga0075432_10070899 | Ga0075432_100708992 | 156 |
| 452 | 3300006058 | Ga0075432_10181661 | Ga0075432_101816611 | 156 |
| 453 | 3300006177 | Ga0075362_10032802 | Ga0075362_100328023 | 156 |
| 454 | 3300006177 | Ga0075362_10033895 | Ga0075362_100338953 | 156 |
| 455 | 3300006177 | Ga0075362_10147453 | Ga0075362_101474531 | 156 |
| 456 | 3300006186 | Ga0075369_10083682 | Ga0075369_100836822 | 156 |
| 457 | 3300006946 | Ga0079104_1000068 | Ga0079104_1000068158 | 156 |
| 458 | 3300009011 | Ga0105251_10020803 | Ga0105251_100208036 | 156 |
| 459 | 3300009036 | Ga0105244_10020302 | Ga0105244_100203022 | 156 |
| 460 | 3300009036 | Ga0105244_10141964 | Ga0105244_101419642 | 156 |
| 461 | 3300009148 | Ga0105243_10055674 | Ga0105243_100556744 | 156 |
| 462 | 3300009177 | Ga0105248_10849713 | Ga0105248_108497132 | 156 |
| 463 | 3300013100 | Ga0157373_10005498 | Ga0157373_100054981 | 156 |
| 464 | 3300013100 | Ga0157373_10331129 | Ga0157373_103311292 | 156 |
| 465 | 3300013104 | Ga0157370_10257075 | Ga0157370_102570753 | 156 |
| 466 | 3300013104 | Ga0157370_11313840 | Ga0157370_113138401 | 156 |
| 467 | 3300013306 | Ga0163162_10589285 | Ga0163162_105892851 | 156 |
| 468 | 3300014497 | Ga0182008_10051469 | Ga0182008_100514692 | 156 |
| 469 | 3300015261 | Ga0182006_1000073 | Ga0182006_100007399 | 156 |
| 470 | 3300015262 | Ga0182007_10000031 | Ga0182007_1000003110 | 156 |
| 471 | 3300015265 | Ga0182005_1005290 | Ga0182005_10052903 | 156 |
| 472 | 3300017792 | Ga0163161_10180763 | Ga0163161_101807631 | 156 |
| 473 | 3300017792 | Ga0163161_11030684 | Ga0163161_110306841 | 156 |
| 474 | 3300025292 | Ga0209676_1008332 | Ga0209676_10083324 | 156 |
| 475 | 3300025298 | Ga0209050_1001809 | Ga0209050_10018097 | 156 |
| 476 | 3300025303 | Ga0209051_1005603 | Ga0209051_10056035 | 156 |
| 477 | 3300025321 | Ga0207656_10002993 | Ga0207656_100029936 | 156 |
| 478 | 3300025728 | Ga0207655_1025620 | Ga0207655_10256202 | 156 |
| 479 | 3300025728 | Ga0207655_1043160 | Ga0207655_10431603 | 156 |
| 480 | 3300025728 | Ga0207655_1044338 | Ga0207655_10443382 | 156 |
| 481 | 3300025728 | Ga0207655_1067195 | Ga0207655_10671952 | 156 |
| 482 | 3300025735 | Ga0207713_1001509 | Ga0207713_10015096 | 156 |
| 483 | 3300025735 | Ga0207713_1008208 | Ga0207713_10082085 | 156 |
| 484 | 3300025923 | Ga0207681_10003303 | Ga0207681_100033039 | 156 |
| 485 | 3300025933 | Ga0207706_10003884 | Ga0207706_100038846 | 156 |
| 486 | 3300025935 | Ga0207709_10030722 | Ga0207709_100307222 | 156 |
| 487 | 3300025941 | Ga0207711_10883964 | Ga0207711_108839642 | 156 |
| 488 | 3300025981 | Ga0207640_10124822 | Ga0207640_101248222 | 156 |
| 489 | 3300027111 | Ga0209281_1000168 | Ga0209281_10001688 | 156 |
| 490 | 3300027907 | Ga0207428_10080727 | Ga0207428_100807271 | 156 |
| 491 | 3300027907 | Ga0207428_10143551 | Ga0207428_101435512 | 156 |
| 492 | 3300027907 | Ga0207428_10212817 | Ga0207428_102128172 | 156 |
| 493 | 3300041405 | Ga0439438_000661 | Ga0439438_000661_4018_4527 | 156 |
| 494 | 3300041405 | Ga0439438_006127 | Ga0439438_006127_116_625 | 156 |
| 495 | 3300041407 | Ga0439447_000516 | Ga0439447_000516_5827_6336 | 156 |
| 496 | 3300041407 | Ga0439447_000847 | Ga0439447_000847_4865_5353 | 156 |
| 497 | 3300041407 | Ga0439447_084311 | Ga0439447_084311_75_584 | 156 |
| 498 | 3300041411 | Ga0439466_0010274 | Ga0439466_0010274_1878_2387 | 156 |
| 499 | 3300041411 | Ga0439466_0034499 | Ga0439466_0034499_1101_1610 | 156 |
| 500 | 3300041411 | Ga0439466_0038148 | Ga0439466_0038148_495_983 | 156 |
| 501 | 3300042009 | Ga0439451_013378 | Ga0439451_013378_798_1286 | 156 |
| 502 | 3300042009 | Ga0439451_052159 | Ga0439451_052159_22_531 | 156 |
| 503 | 3300042010 | Ga0439452_001764 | Ga0439452_001764_3969_4478 | 156 |
| 504 | 3300042010 | Ga0439452_065003 | Ga0439452_065003_156_665 | 156 |
| 505 | 3300042013 | Ga0439456_009275 | Ga0439456_009275_226_735 | 156 |
| 506 | 3300042016 | Ga0439463_006880 | Ga0439463_006880_744_1232 | 156 |
| 507 | 3300042115 | Ga0450911_005682 | Ga0450911_005682_115_624 | 156 |
| 508 | 3300042124 | Ga0450922_000117 | Ga0450922_000117_2424_2933 | 156 |
| 509 | 3300042125 | Ga0450923_004356 | Ga0450923_004356_1266_1775 | 156 |
| 510 | 3300042137 | Ga0450902_009470 | Ga0450902_009470_222_710 | 156 |
| 511 | 3300042138 | Ga0450903_001356 | Ga0450903_001356_2382_2891 | 156 |
| 512 | 3300042142 | Ga0450905_006961 | Ga0450905_006961_184_672 | 156 |
| 513 | 3300042145 | Ga0450906_000314 | Ga0450906_000314_1959_2468 | 156 |
| 514 | 3300042146 | Ga0450907_000780 | Ga0450907_000780_5404_5913 | 156 |
| 515 | 3300042147 | Ga0450910_000701 | Ga0450910_000701_785_1294 | 156 |
| 516 | 3300042461 | Ga0439460_0002037 | Ga0439460_0002037_997_1506 | 156 |
| 517 | 3300042531 | Ga0450918_010451 | Ga0450918_010451_735_1244 | 156 |
| 518 | 3300046452 | Ga0495617_030719 | Ga0495617_030719_122_631 | 156 |
| 519 | 3300046452 | Ga0495617_043989 | Ga0495617_043989_709_1218 | 156 |
| 520 | 3300046453 | Ga0495627_118885 | Ga0495627_118885_39_548 | 156 |
| 521 | 3300046457 | Ga0495590_0001444 | Ga0495590_0001444_6449_6958 | 156 |
| 522 | 3300046457 | Ga0495590_0003719 | Ga0495590_0003719_251_760 | 156 |
| 523 | 3300046458 | Ga0495591_022614 | Ga0495591_022614_1264_1773 | 156 |
| 524 | 3300046458 | Ga0495591_035580 | Ga0495591_035580_754_1263 | 156 |
| 525 | 3300046460 | Ga0495638_0002830 | Ga0495638_0002830_543_1052 | 156 |
| 526 | 3300046460 | Ga0495638_0019276 | Ga0495638_0019276_3803_4312 | 156 |
| 527 | 3300046460 | Ga0495638_0025349 | Ga0495638_0025349_937_1425 | 156 |
| 528 | 3300046463 | Ga0495653_0217190 | Ga0495653_0217190_271_759 | 156 |
| 529 | 3300046471 | Ga0495650_0047571 | Ga0495650_0047571_492_1001 | 156 |
| 530 | 3300046471 | Ga0495650_0209234 | Ga0495650_0209234_11_520 | 156 |
| 531 | 3300046472 | Ga0495580_0050165 | Ga0495580_0050165_1294_1782 | 156 |
| 532 | 3300046474 | Ga0495605_0002577 | Ga0495605_0002577_5086_5574 | 156 |
| 533 | 3300046474 | Ga0495605_0011759 | Ga0495605_0011759_3173_3682 | 156 |
| 534 | 3300046474 | Ga0495605_0019150 | Ga0495605_0019150_501_989 | 156 |
| 535 | 3300046475 | Ga0495639_0000002 | Ga0495639_0000002_93507_93995 | 156 |
| 536 | 3300046491 | Ga0495584_0002475 | Ga0495584_0002475_443_931 | 156 |
| 537 | 3300046491 | Ga0495584_0005134 | Ga0495584_0005134_2295_2804 | 156 |
| 538 | 3300046491 | Ga0495584_0031264 | Ga0495584_0031264_1348_1857 | 156 |
| 539 | 3300046491 | Ga0495584_0091813 | Ga0495584_0091813_45_554 | 156 |
| 540 | 3300046499 | Ga0495594_0071216 | Ga0495594_0071216_942_1430 | 156 |
| 541 | 3300046501 | Ga0495607_0004317 | Ga0495607_0004317_8278_8787 | 156 |
| 542 | 3300046501 | Ga0495607_0256686 | Ga0495607_0256686_143_652 | 156 |
| 543 | 3300046506 | Ga0495583_0001807 | Ga0495583_0001807_13933_14442 | 156 |
| 544 | 3300046506 | Ga0495583_0013299 | Ga0495583_0013299_3825_4313 | 156 |
| 545 | 3300046507 | Ga0495606_0008632 | Ga0495606_0008632_5968_6477 | 156 |
| 546 | 3300046512 | Ga0495610_0003053 | Ga0495610_0003053_5968_6477 | 156 |
| 547 | 3300046512 | Ga0495610_0003737 | Ga0495610_0003737_10900_11409 | 156 |
| 548 | 3300046512 | Ga0495610_0007249 | Ga0495610_0007249_5114_5623 | 156 |
| 549 | 3300046512 | Ga0495610_0105270 | Ga0495610_0105270_70_579 | 156 |
| 550 | 3300046515 | Ga0495620_0002539 | Ga0495620_0002539_5118_5627 | 156 |
| 551 | 3300046515 | Ga0495620_0006750 | Ga0495620_0006750_5096_5605 | 156 |
| 552 | 3300046516 | Ga0495628_0048643 | Ga0495628_0048643_2193_2681 | 156 |
| 553 | 3300046517 | Ga0495630_0014950 | Ga0495630_0014950_3772_4260 | 156 |
| 554 | 3300046518 | Ga0495631_0004246 | Ga0495631_0004246_2808_3317 | 156 |
| 555 | 3300046520 | Ga0495637_0004299 | Ga0495637_0004299_6500_7000 | 156 |
| 556 | 3300046520 | Ga0495637_0018084 | Ga0495637_0018084_1547_2056 | 156 |
| 557 | 3300046520 | Ga0495637_0284728 | Ga0495637_0284728_60_569 | 156 |
| 558 | 3300046522 | Ga0495643_0012863 | Ga0495643_0012863_247_756 | 156 |
| 559 | 3300046523 | Ga0495644_0251388 | Ga0495644_0251388_52_561 | 156 |
| 560 | 3300046524 | Ga0495648_0000695 | Ga0495648_0000695_28171_28680 | 156 |
| 561 | 3300046524 | Ga0495648_0007344 | Ga0495648_0007344_2583_3092 | 156 |
| 562 | 3300046524 | Ga0495648_0017356 | Ga0495648_0017356_74_583 | 156 |
| 563 | 3300046524 | Ga0495648_0056683 | Ga0495648_0056683_445_954 | 156 |
| 564 | 3300046524 | Ga0495648_0257165 | Ga0495648_0257165_111_620 | 156 |
| 565 | 3300046528 | Ga0495642_0000030 | Ga0495642_0000030_6845_7354 | 156 |
| 566 | 3300046530 | Ga0495654_0001431 | Ga0495654_0001431_5277_5786 | 156 |
| 567 | 3300046530 | Ga0495654_0014105 | Ga0495654_0014105_967_1476 | 156 |
| 568 | 3300046530 | Ga0495654_0014299 | Ga0495654_0014299_256_765 | 156 |
| 569 | 3300046536 | Ga0495587_0001686 | Ga0495587_0001686_11194_11682 | 156 |
| 570 | 3300046557 | Ga0495622_0000650 | Ga0495622_0000650_18519_19007 | 156 |
| 571 | 3300046557 | Ga0495622_0011294 | Ga0495622_0011294_140_649 | 156 |
| 572 | 3300046558 | Ga0495633_0003115 | Ga0495633_0003115_4106_4615 | 156 |
| 573 | 3300046616 | Ga0495668_0004114 | Ga0495668_0004114_2474_2983 | 156 |
| 574 | 3300046642 | Ga0495634_0000615 | Ga0495634_0000615_28769_29257 | 156 |
| 575 | 3300046660 | Ga0495625_0001514 | Ga0495625_0001514_12022_12531 | 156 |
| 576 | 3300046660 | Ga0495625_0114308 | Ga0495625_0114308_118_627 | 156 |
| 577 | 3300046663 | Ga0495635_0002026 | Ga0495635_0002026_5251_5739 | 156 |
| 578 | 3300046664 | Ga0495659_0250521 | Ga0495659_0250521_76_564 | 156 |
| 579 | 3300046674 | Ga0495588_0044220 | Ga0495588_0044220_141_650 | 156 |
| 580 | 3300046679 | Ga0495623_0008695 | Ga0495623_0008695_2508_2996 | 156 |
| 581 | 3300046680 | Ga0495646_0028904 | Ga0495646_0028904_1324_1812 | 156 |
| 582 | 3300046684 | Ga0495669_0052388 | Ga0495669_0052388_84_593 | 156 |
| 583 | 3300046689 | Ga0495613_0014121 | Ga0495613_0014121_2034_2522 | 156 |
| 584 | 3300046691 | Ga0495670_0002041 | Ga0495670_0002041_7057_7566 | 156 |
| 585 | 3300046691 | Ga0495670_0545929 | Ga0495670_0545929_95_604 | 156 |
| 586 | 3300046692 | Ga0495671_0004879 | Ga0495671_0004879_3104_3613 | 156 |
| 587 | 3300046692 | Ga0495671_0008616 | Ga0495671_0008616_2528_3037 | 156 |
| 588 | 3300046692 | Ga0495671_0221633 | Ga0495671_0221633_166_675 | 156 |
| 589 | 3300046694 | Ga0495649_0004240 | Ga0495649_0004240_5968_6477 | 156 |
| 590 | 3300046694 | Ga0495649_0004547 | Ga0495649_0004547_5456_5965 | 156 |
| 591 | 3300046794 | Ga0495589_0003519 | Ga0495589_0003519_3145_3654 | 156 |
| 592 | 3300046794 | Ga0495589_0009785 | Ga0495589_0009785_3903_4412 | 156 |
| 593 | 3300046810 | Ga0495660_0002759 | Ga0495660_0002759_5218_5727 | 156 |
| 594 | 3300046810 | Ga0495660_0010521 | Ga0495660_0010521_4007_4495 | 156 |
| 595 | 3300047315 | Ga0495581_0000452 | Ga0495581_0000452_2843_3331 | 156 |
| 596 | 3300047319 | Ga0495674_0002341 | Ga0495674_0002341_11160_11648 | 156 |
| 597 | 3300047320 | Ga0495672_0000841 | Ga0495672_0000841_25412_25921 | 156 |
| 598 | 3300047320 | Ga0495672_0004386 | Ga0495672_0004386_5495_6004 | 156 |
| 599 | 3300047320 | Ga0495672_0005978 | Ga0495672_0005978_5563_6072 | 156 |
| 600 | 3300047320 | Ga0495672_0046569 | Ga0495672_0046569_1883_2392 | 156 |
| 601 | 3300047320 | Ga0495672_0238649 | Ga0495672_0238649_67_576 | 156 |
| 602 | 3300047323 | Ga0495683_0000131 | Ga0495683_0000131_38709_39218 | 156 |
| 603 | 3300047323 | Ga0495683_0018944 | Ga0495683_0018944_795_1283 | 156 |
| 604 | 3300047323 | Ga0495683_0074728 | Ga0495683_0074728_1002_1511 | 156 |
| 605 | 3300047323 | Ga0495683_0196466 | Ga0495683_0196466_43_552 | 156 |
| 606 | 3300047443 | Ga0495687_001097 | Ga0495687_001097_1873_2382 | 156 |
| 607 | 3300047444 | Ga0495675_0007804 | Ga0495675_0007804_3053_3541 | 156 |
| 608 | 3300047446 | Ga0495679_000434 | Ga0495679_000434_16569_17039 | 156 |
| 609 | 3300047446 | Ga0495679_022231 | Ga0495679_022231_212_721 | 156 |
| 610 | 3300047469 | Ga0495673_0000328 | Ga0495673_0000328_12231_12731 | 156 |
| 611 | 3300047469 | Ga0495673_0003594 | Ga0495673_0003594_4047_4535 | 156 |
| 612 | 3300047469 | Ga0495673_0003724 | Ga0495673_0003724_9066_9575 | 156 |
| 613 | 3300047470 | Ga0495681_0000581 | Ga0495681_0000581_6278_6787 | 156 |
| 614 | 3300047470 | Ga0495681_0003808 | Ga0495681_0003808_2861_3370 | 156 |
| 615 | 3300047470 | Ga0495681_0005884 | Ga0495681_0005884_5512_6021 | 156 |
| 616 | 3300047470 | Ga0495681_0210442 | Ga0495681_0210442_76_585 | 156 |
| 617 | 3300047472 | Ga0495686_0034296 | Ga0495686_0034296_1570_2079 | 156 |
| 618 | 3300047673 | Ga0495593_0012965 | Ga0495593_0012965_806_1294 | 156 |
| 619 | 3300048088 | Ga0495602_0152803 | Ga0495602_0152803_891_1379 | 156 |
| 620 | 3300048091 | Ga0495626_0000087 | Ga0495626_0000087_28550_29059 | 156 |
| 621 | 3300048091 | Ga0495626_0000544 | Ga0495626_0000544_18657_19145 | 156 |
| 622 | 3300048091 | Ga0495626_0002514 | Ga0495626_0002514_11938_12447 | 156 |
| 623 | 3300048091 | Ga0495626_0036229 | Ga0495626_0036229_736_1245 | 156 |
| 624 | 3300048905 | Ga0496102_0000799 | Ga0496102_0000799_24019_24507 | 156 |
| 625 | 3300048905 | Ga0496102_0399382 | Ga0496102_0399382_586_1095 | 156 |
| 626 | 3300048906 | Ga0496103_0001281 | Ga0496103_0001281_5174_5662 | 156 |
| 627 | 3300048909 | Ga0496106_0752034 | Ga0496106_0752034_182_670 | 156 |
| 628 | 3300048917 | Ga0496114_0194954 | Ga0496114_0194954_876_1364 | 156 |
| 629 | 3300048918 | Ga0496115_0033114 | Ga0496115_0033114_3197_3685 | 156 |
| 630 | 3300048919 | Ga0496116_0010620 | Ga0496116_0010620_4801_5289 | 156 |
| 631 | 3300048919 | Ga0496116_0316594 | Ga0496116_0316594_203_712 | 156 |
| 632 | 3300048920 | Ga0496117_0005546 | Ga0496117_0005546_7849_8337 | 156 |
| 633 | 3300048920 | Ga0496117_0033605 | Ga0496117_0033605_398_907 | 156 |
| 634 | 3300048921 | Ga0496118_0011019 | Ga0496118_0011019_3314_3802 | 156 |
| 635 | 3300048921 | Ga0496118_0018808 | Ga0496118_0018808_815_1324 | 156 |
| 636 | 3300048922 | Ga0496119_0261263 | Ga0496119_0261263_162_650 | 156 |
| 637 | 3300048924 | Ga0496121_0138498 | Ga0496121_0138498_224_712 | 156 |
| 638 | 3300048927 | Ga0496124_0035164 | Ga0496124_0035164_3187_3696 | 156 |
| 639 | 3300048929 | Ga0496126_0213283 | Ga0496126_0213283_471_959 | 156 |
| 640 | 3300049459 | Ga0495678_051035 | Ga0495678_051035_707_1195 | 156 |
| 641 | 3300049459 | Ga0495678_107823 | Ga0495678_107823_289_798 | 156 |
| 642 | 3300049460 | Ga0495682_0003606 | Ga0495682_0003606_6121_6630 | 156 |
| 643 | 3300049460 | Ga0495682_0026589 | Ga0495682_0026589_1562_2071 | 156 |
| 644 | 3300049460 | Ga0495682_0208762 | Ga0495682_0208762_111_620 | 156 |
| 645 | 3300050489 | nmdc:mga03683_3264_c1 | nmdc:mga03683_3264_c1_125_634 | 156 |
| 646 | 3300050491 | nmdc:mga00v17_3574_c1 | nmdc:mga00v17_3574_c1_3290_3799 | 156 |
| 647 | 3300050491 | nmdc:mga00v17_395857_c1 | nmdc:mga00v17_395857_c1_216_725 | 156 |
| 648 | 3300050491 | nmdc:mga00v17_68535_c1 | nmdc:mga00v17_68535_c1_831_1340 | 156 |
| 649 | 3300050516 | nmdc:mga0sz30_1001_c1 | nmdc:mga0sz30_1001_c1_2079_2588 | 156 |
| 650 | iso_pu_bacteria | 2511231007 | 2511274394 | 156 |
| 651 | iso_pu_bacteria | 2511231012 | 2511303642 | 156 |
| 652 | iso_pu_bacteria | 2511231014 | 2511316490 | 156 |
| 653 | iso_pu_bacteria | 2511231015 | 2511322413 | 156 |
| 654 | iso_pu_bacteria | 2511231017 | 2511335445 | 156 |
| 655 | iso_pu_bacteria | 2511231020 | 2511350745 | 156 |
| 656 | iso_pu_bacteria | 2623620446 | 2624492075 | 156 |
| 657 | iso_pu_bacteria | 2643221589 | 2643953463 | 156 |
| 658 | iso_pu_bacteria | 2643221602 | 2644021205 | 156 |
| 659 | iso_pu_bacteria | 2738543004 | 2739200135 | 156 |
| 660 | iso_pu_bacteria | 2738543015 | 2739261842 | 156 |
| 661 | iso_pu_bacteria | 2808606377 | 2808931491 | 156 |
| 662 | iso_pu_bacteria | 2808606381 | 2808953733 | 156 |
| 663 | iso_pu_bacteria | 2808606382 | 2808958355 | 156 |
| 664 | iso_pu_bacteria | 2860339153 | 2860342184 | 156 |
| 665 | iso_pu_bacteria | 2904550169 | 2904551915 | 156 |
| 666 | iso_pu_bacteria | 2919697872 | 2919698247 | 156 |
| 667 | iso_pu_bacteria | 2931396565 | 2931401120 | 156 |
| 668 | iso_pu_bacteria | 2939636861 | 2939641583 | 156 |
| 669 | iso_pu_bacteria | 8019775933 | 8019779866 | 156 |
| 670 | iso_pu_bacteria | 8052494512 | 8052496542 | 156 |
| 671 | iso_pu_bacteria | 8056125926 | 8056128216 | 156 |
| 672 | 3300003791 | Ga0055530_10000041 | Ga0055530_1000004152 | 157 |
| 673 | 3300003792 | Ga0055540_1000195 | Ga0055540_100019544 | 157 |
| 674 | 3300005289 | Ga0065704_10119359 | Ga0065704_101193591 | 157 |
| 675 | 3300005441 | Ga0070700_100171993 | Ga0070700_1001719931 | 157 |
| 676 | 3300005444 | Ga0070694_100219194 | Ga0070694_1002191941 | 157 |
| 677 | 3300005543 | Ga0070672_100353736 | Ga0070672_1003537362 | 157 |
| 678 | 3300005843 | Ga0068860_100822777 | Ga0068860_1008227771 | 157 |
| 679 | 3300006177 | Ga0075362_10294315 | Ga0075362_102943152 | 157 |
| 680 | 3300009098 | Ga0105245_10656334 | Ga0105245_106563341 | 157 |
| 681 | 3300009148 | Ga0105243_12033645 | Ga0105243_120336451 | 157 |
| 682 | 3300009176 | Ga0105242_10094770 | Ga0105242_100947702 | 157 |
| 683 | 3300013297 | Ga0157378_10334083 | Ga0157378_103340831 | 157 |
| 684 | 3300013306 | Ga0163162_10143362 | Ga0163162_101433623 | 157 |
| 685 | 3300014969 | Ga0157376_10186074 | Ga0157376_101860742 | 157 |
| 686 | 3300015261 | Ga0182006_1009488 | Ga0182006_10094885 | 157 |
| 687 | 3300025292 | Ga0209676_1000062 | Ga0209676_1000062101 | 157 |
| 688 | 3300025298 | Ga0209050_1000004 | Ga0209050_10000041402 | 157 |
| 689 | 3300025303 | Ga0209051_1000181 | Ga0209051_100018160 | 157 |
| 690 | 3300025914 | Ga0207671_10000060 | Ga0207671_1000006096 | 157 |
| 691 | 3300025934 | Ga0207686_10126878 | Ga0207686_101268782 | 157 |
| 692 | 3300025938 | Ga0207704_10067008 | Ga0207704_100670083 | 157 |
| 693 | 3300025940 | Ga0207691_10254933 | Ga0207691_102549332 | 157 |
| 694 | 3300028380 | Ga0268265_10308815 | Ga0268265_103088152 | 157 |
| 695 | 3300041411 | Ga0439466_0000243 | Ga0439466_0000243_1892_2383 | 157 |
| 696 | 3300042013 | Ga0439456_013477 | Ga0439456_013477_159_650 | 157 |
| 697 | 3300042016 | Ga0439463_000257 | Ga0439463_000257_12015_12506 | 157 |
| 698 | 3300042993 | Ga0439440_0000375 | Ga0439440_0000375_1309_1800 | 157 |
| 699 | iso_pu_bacteria | 2511231006 | 2511265072 | 157 |
| 700 | iso_pu_bacteria | 2512047018 | 2512327132 | 157 |
| 701 | iso_pu_bacteria | 2582580891 | 2583791654 | 157 |
| 702 | iso_pu_bacteria | 2597489887 | 2597857439 | 157 |
| 703 | iso_pu_bacteria | 2599185185 | 2599484623 | 157 |
| 704 | iso_pu_bacteria | 2599185257 | 2599802108 | 157 |
| 705 | iso_pu_bacteria | 2600254931 | 2600367404 | 157 |
| 706 | iso_pu_bacteria | 2671180172 | 2671769056 | 157 |
| 707 | iso_pu_bacteria | 2740892503 | 2743736865 | 157 |
| 708 | iso_pu_bacteria | 2923153595 | 2923155891 | 157 |
| 709 | iso_pu_bacteria | 2984286254 | 2984290132 | 157 |
| 710 | iso_pu_bacteria | 3007395558 | 3007401432 | 157 |
| 711 | iso_pu_bacteria | 8015687852 | 8015690133 | 157 |
| 712 | iso_pu_bacteria | 8055770955 | 8055773253 | 157 |
| 713 | 3300003781 | Ga0055536_1000115 | Ga0055536_100011519 | 158 |
| 714 | 3300003791 | Ga0055530_10003977 | Ga0055530_100039775 | 158 |
| 715 | 3300003792 | Ga0055540_1000204 | Ga0055540_10002049 | 158 |
| 716 | 3300003794 | Ga0055531_10000186 | Ga0055531_100001869 | 158 |
| 717 | 3300005288 | Ga0065714_10087459 | Ga0065714_100874592 | 158 |
| 718 | 3300005353 | Ga0070669_101093576 | Ga0070669_1010935761 | 158 |
| 719 | 3300009011 | Ga0105251_10254189 | Ga0105251_102541892 | 158 |
| 720 | 3300017792 | Ga0163161_10368723 | Ga0163161_103687232 | 158 |
| 721 | 3300025291 | Ga0209675_1010776 | Ga0209675_10107763 | 158 |
| 722 | 3300025292 | Ga0209676_1000102 | Ga0209676_100010219 | 158 |
| 723 | 3300025298 | Ga0209050_1000105 | Ga0209050_100010519 | 158 |
| 724 | 3300025303 | Ga0209051_1000066 | Ga0209051_100006619 | 158 |
| 725 | 3300025304 | Ga0209257_1000124 | Ga0209257_1000124171 | 158 |
| 726 | 3300025711 | Ga0207696_1001491 | Ga0207696_100149111 | 158 |
| 727 | 3300025711 | Ga0207696_1097355 | Ga0207696_10973552 | 158 |
| 728 | 3300025728 | Ga0207655_1002205 | Ga0207655_10022055 | 158 |
| 729 | 3300025735 | Ga0207713_1000199 | Ga0207713_100019919 | 158 |
| 730 | 3300025735 | Ga0207713_1026862 | Ga0207713_10268625 | 158 |
| 731 | 3300025735 | Ga0207713_1136376 | Ga0207713_11363762 | 158 |
| 732 | 3300025923 | Ga0207681_10989441 | Ga0207681_109894412 | 158 |
| 733 | 3300046794 | Ga0495589_0000297 | Ga0495589_0000297_18768_19244 | 158 |
| 734 | 3300047472 | Ga0495686_0562723 | Ga0495686_0562723_74_550 | 158 |
| 735 | 3300048925 | Ga0496122_0478571 | Ga0496122_0478571_102_578 | 158 |
| 736 | 3300048926 | Ga0496123_0427584 | Ga0496123_0427584_90_566 | 158 |
| 737 | 3300048927 | Ga0496124_0000309 | Ga0496124_0000309_57264_57740 | 158 |
| 738 | 3300005457 | Ga0070662_100050082 | Ga0070662_1000500825 | 159 |
| 739 | 3300005548 | Ga0070665_100171494 | Ga0070665_1001714941 | 159 |
| 740 | 3300009011 | Ga0105251_10011003 | Ga0105251_100110032 | 159 |
| 741 | 3300009036 | Ga0105244_10001447 | Ga0105244_100014477 | 159 |
| 742 | 3300009036 | Ga0105244_10018753 | Ga0105244_100187532 | 159 |
| 743 | 3300009092 | Ga0105250_10000506 | Ga0105250_100005066 | 159 |
| 744 | 3300009092 | Ga0105250_10001803 | Ga0105250_100018035 | 159 |
| 745 | 3300009148 | Ga0105243_10000491 | Ga0105243_100004917 | 159 |
| 746 | 3300011119 | Ga0105246_10000501 | Ga0105246_100005013 | 159 |
| 747 | 3300012498 | Ga0157345_1000004 | Ga0157345_100000411 | 159 |
| 748 | 3300013100 | Ga0157373_10016104 | Ga0157373_100161042 | 159 |
| 749 | 3300013100 | Ga0157373_10377092 | Ga0157373_103770922 | 159 |
| 750 | 3300013105 | Ga0157369_10706704 | Ga0157369_107067042 | 159 |
| 751 | 3300013307 | Ga0157372_10003028 | Ga0157372_100030285 | 159 |
| 752 | 3300014497 | Ga0182008_10000878 | Ga0182008_100008785 | 159 |
| 753 | 3300015261 | Ga0182006_1018318 | Ga0182006_10183181 | 159 |
| 754 | 3300017792 | Ga0163161_10129360 | Ga0163161_101293603 | 159 |
| 755 | 3300017792 | Ga0163161_10136904 | Ga0163161_101369042 | 159 |
| 756 | 3300025230 | Ga0209563_101430 | Ga0209563_1014304 | 159 |
| 757 | 3300025711 | Ga0207696_1000051 | Ga0207696_100005112 | 159 |
| 758 | 3300025711 | Ga0207696_1001893 | Ga0207696_10018937 | 159 |
| 759 | 3300025728 | Ga0207655_1000080 | Ga0207655_100008087 | 159 |
| 760 | 3300025728 | Ga0207655_1002480 | Ga0207655_10024806 | 159 |
| 761 | 3300025735 | Ga0207713_1021403 | Ga0207713_10214035 | 159 |
| 762 | 3300025735 | Ga0207713_1057320 | Ga0207713_10573202 | 159 |
| 763 | 3300025933 | Ga0207706_10051270 | Ga0207706_100512709 | 159 |
| 764 | 3300025935 | Ga0207709_10000011 | Ga0207709_1000001178 | 159 |
| 765 | 3300028379 | Ga0268266_10059082 | Ga0268266_100590823 | 159 |
| 766 | 3300030734 | Ga0316179_1024534 | Ga0316179_10245341 | 159 |
| 767 | 3300031548 | Ga0307408_100004965 | Ga0307408_1000049657 | 159 |
| 768 | 3300031548 | Ga0307408_100032029 | Ga0307408_1000320296 | 159 |
| 769 | 3300031824 | Ga0307413_11151411 | Ga0307413_111514112 | 159 |
| 770 | 3300031901 | Ga0307406_10748779 | Ga0307406_107487792 | 159 |
| 771 | 3300031911 | Ga0307412_10182834 | Ga0307412_101828342 | 159 |
| 772 | 3300031995 | Ga0307409_101686090 | Ga0307409_1016860902 | 159 |
| 773 | 3300032002 | Ga0307416_102411748 | Ga0307416_1024117481 | 159 |
| 774 | 3300032004 | Ga0307414_10022107 | Ga0307414_100221072 | 159 |
| 775 | 3300032005 | Ga0307411_10009261 | Ga0307411_100092612 | 159 |
| 776 | 3300038705 | Ga0237819_00233 | Ga0237819_00233_302_781 | 159 |
| 777 | 3300041405 | Ga0439438_006478 | Ga0439438_006478_628_1107 | 159 |
| 778 | 3300041407 | Ga0439447_023816 | Ga0439447_023816_277_756 | 159 |
| 779 | 3300041411 | Ga0439466_0019324 | Ga0439466_0019324_1909_2388 | 159 |
| 780 | 3300042010 | Ga0439452_000081 | Ga0439452_000081_73677_74156 | 159 |
| 781 | 3300042013 | Ga0439456_001343 | Ga0439456_001343_2418_2897 | 159 |
| 782 | 3300042016 | Ga0439463_038882 | Ga0439463_038882_138_617 | 159 |
| 783 | 3300042115 | Ga0450911_000488 | Ga0450911_000488_7506_7985 | 159 |
| 784 | 3300042136 | Ga0450900_008085 | Ga0450900_008085_62_541 | 159 |
| 785 | 3300042137 | Ga0450902_006363 | Ga0450902_006363_196_675 | 159 |
| 786 | 3300042145 | Ga0450906_000446 | Ga0450906_000446_7816_8295 | 159 |
| 787 | 3300046452 | Ga0495617_021389 | Ga0495617_021389_383_862 | 159 |
| 788 | 3300046453 | Ga0495627_005742 | Ga0495627_005742_3988_4467 | 159 |
| 789 | 3300046457 | Ga0495590_0008013 | Ga0495590_0008013_2168_2647 | 159 |
| 790 | 3300046458 | Ga0495591_000032 | Ga0495591_000032_12462_12941 | 159 |
| 791 | 3300046458 | Ga0495591_000082 | Ga0495591_000082_94839_95318 | 159 |
| 792 | 3300046458 | Ga0495591_000120 | Ga0495591_000120_14861_15340 | 159 |
| 793 | 3300046458 | Ga0495591_019213 | Ga0495591_019213_1561_2040 | 159 |
| 794 | 3300046458 | Ga0495591_037727 | Ga0495591_037727_771_1250 | 159 |
| 795 | 3300046460 | Ga0495638_0000449 | Ga0495638_0000449_17506_17985 | 159 |
| 796 | 3300046460 | Ga0495638_0085430 | Ga0495638_0085430_1288_1767 | 159 |
| 797 | 3300046463 | Ga0495653_0000151 | Ga0495653_0000151_3397_3876 | 159 |
| 798 | 3300046471 | Ga0495650_0005553 | Ga0495650_0005553_5558_6037 | 159 |
| 799 | 3300046474 | Ga0495605_0000147 | Ga0495605_0000147_78186_78665 | 159 |
| 800 | 3300046492 | Ga0495585_0000234 | Ga0495585_0000234_31351_31830 | 159 |
| 801 | 3300046492 | Ga0495585_0003811 | Ga0495585_0003811_9039_9518 | 159 |
| 802 | 3300046492 | Ga0495585_0020869 | Ga0495585_0020869_514_993 | 159 |
| 803 | 3300046501 | Ga0495607_0006134 | Ga0495607_0006134_5687_6166 | 159 |
| 804 | 3300046507 | Ga0495606_0000634 | Ga0495606_0000634_2183_2662 | 159 |
| 805 | 3300046507 | Ga0495606_0003122 | Ga0495606_0003122_16496_16975 | 159 |
| 806 | 3300046507 | Ga0495606_0029928 | Ga0495606_0029928_3229_3708 | 159 |
| 807 | 3300046507 | Ga0495606_0164399 | Ga0495606_0164399_57_536 | 159 |
| 808 | 3300046512 | Ga0495610_0000133 | Ga0495610_0000133_16330_16809 | 159 |
| 809 | 3300046513 | Ga0495616_0001757 | Ga0495616_0001757_13573_14052 | 159 |
| 810 | 3300046513 | Ga0495616_0004524 | Ga0495616_0004524_5692_6171 | 159 |
| 811 | 3300046513 | Ga0495616_0004535 | Ga0495616_0004535_458_937 | 159 |
| 812 | 3300046515 | Ga0495620_0000127 | Ga0495620_0000127_11577_12056 | 159 |
| 813 | 3300046519 | Ga0495632_0007976 | Ga0495632_0007976_1138_1617 | 159 |
| 814 | 3300046519 | Ga0495632_0053888 | Ga0495632_0053888_983_1462 | 159 |
| 815 | 3300046519 | Ga0495632_0073255 | Ga0495632_0073255_923_1402 | 159 |
| 816 | 3300046519 | Ga0495632_0096096 | Ga0495632_0096096_483_962 | 159 |
| 817 | 3300046520 | Ga0495637_0000710 | Ga0495637_0000710_278_757 | 159 |
| 818 | 3300046520 | Ga0495637_0004752 | Ga0495637_0004752_779_1258 | 159 |
| 819 | 3300046522 | Ga0495643_0004314 | Ga0495643_0004314_831_1310 | 159 |
| 820 | 3300046522 | Ga0495643_0085119 | Ga0495643_0085119_591_1070 | 159 |
| 821 | 3300046524 | Ga0495648_0000259 | Ga0495648_0000259_20504_20983 | 159 |
| 822 | 3300046524 | Ga0495648_0006035 | Ga0495648_0006035_8423_8902 | 159 |
| 823 | 3300046524 | Ga0495648_0116622 | Ga0495648_0116622_129_608 | 159 |
| 824 | 3300046526 | Ga0495666_0022607 | Ga0495666_0022607_2604_3083 | 159 |
| 825 | 3300046530 | Ga0495654_0000104 | Ga0495654_0000104_14421_14900 | 159 |
| 826 | 3300046530 | Ga0495654_0073450 | Ga0495654_0073450_673_1152 | 159 |
| 827 | 3300046530 | Ga0495654_0171299 | Ga0495654_0171299_332_811 | 159 |
| 828 | 3300046538 | Ga0495609_0007370 | Ga0495609_0007370_4685_5164 | 159 |
| 829 | 3300046538 | Ga0495609_0129890 | Ga0495609_0129890_129_608 | 159 |
| 830 | 3300046542 | Ga0495597_0000965 | Ga0495597_0000965_20887_21366 | 159 |
| 831 | 3300046557 | Ga0495622_0000047 | Ga0495622_0000047_10208_10687 | 159 |
| 832 | 3300046557 | Ga0495622_0109725 | Ga0495622_0109725_270_749 | 159 |
| 833 | 3300046616 | Ga0495668_0002358 | Ga0495668_0002358_4848_5327 | 159 |
| 834 | 3300046648 | Ga0495611_0064734 | Ga0495611_0064734_771_1250 | 159 |
| 835 | 3300046660 | Ga0495625_0000103 | Ga0495625_0000103_122290_122769 | 159 |
| 836 | 3300046660 | Ga0495625_0077378 | Ga0495625_0077378_546_1025 | 159 |
| 837 | 3300046665 | Ga0495661_0234801 | Ga0495661_0234801_29_508 | 159 |
| 838 | 3300046680 | Ga0495646_0008791 | Ga0495646_0008791_2232_2711 | 159 |
| 839 | 3300046689 | Ga0495613_0001739 | Ga0495613_0001739_9632_10111 | 159 |
| 840 | 3300046690 | Ga0495624_0000172 | Ga0495624_0000172_9129_9608 | 159 |
| 841 | 3300046690 | Ga0495624_0203911 | Ga0495624_0203911_422_901 | 159 |
| 842 | 3300046692 | Ga0495671_0000541 | Ga0495671_0000541_24206_24685 | 159 |
| 843 | 3300046692 | Ga0495671_0000799 | Ga0495671_0000799_2835_3314 | 159 |
| 844 | 3300046692 | Ga0495671_0008285 | Ga0495671_0008285_4710_5189 | 159 |
| 845 | 3300046694 | Ga0495649_0002309 | Ga0495649_0002309_12540_13019 | 159 |
| 846 | 3300046694 | Ga0495649_0005390 | Ga0495649_0005390_5689_6168 | 159 |
| 847 | 3300046694 | Ga0495649_0007150 | Ga0495649_0007150_4012_4491 | 159 |
| 848 | 3300046794 | Ga0495589_0002333 | Ga0495589_0002333_9494_9973 | 159 |
| 849 | 3300046809 | Ga0495600_0021302 | Ga0495600_0021302_1280_1759 | 159 |
| 850 | 3300046810 | Ga0495660_0000785 | Ga0495660_0000785_2179_2658 | 159 |
| 851 | 3300046810 | Ga0495660_0108915 | Ga0495660_0108915_156_635 | 159 |
| 852 | 3300047317 | Ga0495604_0182626 | Ga0495604_0182626_139_618 | 159 |
| 853 | 3300047320 | Ga0495672_0000174 | Ga0495672_0000174_8958_9437 | 159 |
| 854 | 3300047320 | Ga0495672_0003653 | Ga0495672_0003653_12439_12918 | 159 |
| 855 | 3300047321 | Ga0495676_0002653 | Ga0495676_0002653_6583_7062 | 159 |
| 856 | 3300047322 | Ga0495680_0005627 | Ga0495680_0005627_8724_9203 | 159 |
| 857 | 3300047323 | Ga0495683_0011172 | Ga0495683_0011172_3989_4468 | 159 |
| 858 | 3300047446 | Ga0495679_000612 | Ga0495679_000612_10302_10781 | 159 |
| 859 | 3300047446 | Ga0495679_004870 | Ga0495679_004870_5505_5984 | 159 |
| 860 | 3300047469 | Ga0495673_0002039 | Ga0495673_0002039_13520_13999 | 159 |
| 861 | 3300047469 | Ga0495673_0036415 | Ga0495673_0036415_158_637 | 159 |
| 862 | 3300047469 | Ga0495673_0045651 | Ga0495673_0045651_1162_1641 | 159 |
| 863 | 3300047470 | Ga0495681_0005691 | Ga0495681_0005691_2196_2675 | 159 |
| 864 | 3300047471 | Ga0495684_0010927 | Ga0495684_0010927_22_501 | 159 |
| 865 | 3300047472 | Ga0495686_0000266 | Ga0495686_0000266_82884_83363 | 159 |
| 866 | 3300048088 | Ga0495602_0000750 | Ga0495602_0000750_21563_22042 | 159 |
| 867 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_9786_10265 | 159 |
| 868 | 3300048091 | Ga0495626_0007211 | Ga0495626_0007211_3957_4436 | 159 |
| 869 | 3300048091 | Ga0495626_0060625 | Ga0495626_0060625_400_879 | 159 |
| 870 | 3300048091 | Ga0495626_0106021 | Ga0495626_0106021_645_1124 | 159 |
| 871 | 3300048919 | Ga0496116_0000255 | Ga0496116_0000255_61828_62307 | 159 |
| 872 | 3300048919 | Ga0496116_0001015 | Ga0496116_0001015_5940_6419 | 159 |
| 873 | 3300048919 | Ga0496116_0007951 | Ga0496116_0007951_122_601 | 159 |
| 874 | 3300048920 | Ga0496117_0000475 | Ga0496117_0000475_49227_49706 | 159 |
| 875 | 3300048920 | Ga0496117_0028925 | Ga0496117_0028925_3138_3617 | 159 |
| 876 | 3300048921 | Ga0496118_0000482 | Ga0496118_0000482_49291_49770 | 159 |
| 877 | 3300048921 | Ga0496118_0004092 | Ga0496118_0004092_14753_15232 | 159 |
| 878 | 3300048923 | Ga0496120_0081872 | Ga0496120_0081872_1251_1730 | 159 |
| 879 | 3300048924 | Ga0496121_0007471 | Ga0496121_0007471_9616_10095 | 159 |
| 880 | 3300048925 | Ga0496122_0009192 | Ga0496122_0009192_1764_2243 | 159 |
| 881 | 3300048926 | Ga0496123_0003395 | Ga0496123_0003395_16292_16771 | 159 |
| 882 | 3300048926 | Ga0496123_0145418 | Ga0496123_0145418_759_1238 | 159 |
| 883 | 3300048927 | Ga0496124_0021538 | Ga0496124_0021538_4796_5275 | 159 |
| 884 | 3300049459 | Ga0495678_000222 | Ga0495678_000222_51456_51935 | 159 |
| 885 | 3300049459 | Ga0495678_001994 | Ga0495678_001994_676_1155 | 159 |
| 886 | 3300049459 | Ga0495678_008180 | Ga0495678_008180_4698_5177 | 159 |
| 887 | 3300049459 | Ga0495678_014258 | Ga0495678_014258_107_586 | 159 |
| 888 | 3300049459 | Ga0495678_035033 | Ga0495678_035033_1223_1702 | 159 |
| 889 | 3300049459 | Ga0495678_048215 | Ga0495678_048215_765_1244 | 159 |
| 890 | 3300049460 | Ga0495682_0000425 | Ga0495682_0000425_9433_9912 | 159 |
| 891 | 3300049460 | Ga0495682_0026255 | Ga0495682_0026255_384_863 | 159 |
| 892 | 3300049460 | Ga0495682_0040999 | Ga0495682_0040999_231_710 | 159 |
| 893 | 3300049758 | Ga0501241_000247 | Ga0501241_000247_5214_5693 | 159 |
| 894 | 3300050491 | nmdc:mga00v17_419715_c1 | nmdc:mga00v17_419715_c1_276_755 | 159 |
| 895 | 3300053111 | Ga0500572_000029 | Ga0500572_000029_672_1151 | 159 |
| 896 | 3300053145 | Ga0500586_072460 | Ga0500586_072460_293_772 | 159 |
| 897 | 3300046558 | Ga0495633_0004004 | Ga0495633_0004004_6607_7092 | 160 |
| 898 | 3300047320 | Ga0495672_0002969 | Ga0495672_0002969_6217_6702 | 160 |
| 899 | 3300009148 | Ga0105243_10013616 | Ga0105243_100136167 | 161 |
| 900 | 3300025711 | Ga0207696_1000023 | Ga0207696_1000023227 | 161 |
| 901 | 2162886007 | SwRhRL2b_contig_1296335 | SwRhRL2b_0544.00003170 | 162 |
| 902 | 3300009092 | Ga0105250_10190021 | Ga0105250_101900211 | 162 |
| 903 | 3300025711 | Ga0207696_1026827 | Ga0207696_10268273 | 162 |
| 904 | 3300025728 | Ga0207655_1012613 | Ga0207655_10126136 | 162 |
| 905 | 3300048922 | Ga0496119_0045464 | Ga0496119_0045464_328_816 | 162 |
| 906 | 3300048927 | Ga0496124_0135104 | Ga0496124_0135104_622_1110 | 162 |
| 907 | 3300048929 | Ga0496126_0365625 | Ga0496126_0365625_314_802 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s5z-assembly2.cif.gz_B | structure of rib r28n from streptococcus pyogenes | 0.9071 | 120 | 144 |
| 3zja-assembly1.cif.gz_A | the crystal structure of a cu(i) metallochaperone from streptomyces lividans | 0.9066 | 26 | 146 |
| 3zja-assembly1.cif.gz_A | the crystal structure of a cu(i) metallochaperone from streptomyces lividans | 0.8916 | 26 | 146 |
| 6sx1-assembly1.cif.gz_A | structure of rib standard, a rib domain from lactobacillus acidophilus | 0.8649 | 120 | 144 |
| 6p1g-assembly2.cif.gz_B | copper-bound pcuac domain from pmof2 | 0.8635 | 28 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zk0A01 | Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone | 0.8945 | 34 | 145 | 2.60.40.1890 |
| 3zk0A01 | Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone | 0.8708 | 34 | 145 | 2.60.40.1890 |
| 2k6zA01 | Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone | 0.8231 | 34 | 145 | 2.60.40.1890 |
| 2k6zA01 | Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone | 0.8032 | 34 | 145 | 2.60.40.1890 |
| af_Q9TZQ1_71_373_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.7318 | 121 | 148 | 3.90.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K8NV28-F1-model_v4 | Copper metallochaperone | 0.9674 | 29 | 145 |
|
| AF-A0A1F3YZ32-F1-model_v4 | Transporter | 0.9657 | 28 | 150 |
|
| AF-A0A0B7IZJ8-F1-model_v4 | Copper chaperone PCu(A)C | 0.9579 | 15 | 145 |
|
| AF-A0A0T2QF31-F1-model_v4 | Copper chaperone PCu(A)C | 0.9437 | 31 | 149 |
|
| AF-A0A3M4C9F5-F1-model_v4 | deleted | 0.9417 | 17 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar