F485144

General Info

Members Datasets Scaffolds Average Seq Length
900 301 1800 165

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10933286|Ga0157372_109332861
Length 181
Sequence VKTELLPTPQERERKFMKMELIQPFINAADAVLSQGLQGTTKVGNLTMEEDAYRRKGVAGMIALTGDIEGRIILDLEPQTAVKVASHYAGTDLPESDELIKETIFELANQVVGNAVSALNDQGFHFRVHPPLLLTAQEGDKTSEDTEALMICFETSLGSVFMNVALRYNKKRMADHAAVGA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
126 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
127 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
128 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
197 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
198 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 18.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10933286 3300013307 Bacteria 1006
2 MBSR1b_contig_12373736 2162886012 Unclassified 1080
3 LJNas_1000607 3300000546 Bacteria 6099
4 JGI24743J22301_10000326 3300001991 Bacteria 5243
5 JGI24749J21850_1013365 3300002076 Bacteria 1152
6 JGI24033J26618_1034833 3300002155 Bacteria 687
7 JGI24034J26672_10001510 3300002239 Bacteria 3094
8 JGI24751J29686_10021546 3300002459 Bacteria 1336
9 Ga0065715_10091638 3300005293 Bacteria 5634
10 Ga0070658_10333721 3300005327 Bacteria 1296
11 Ga0070658_10969985 3300005327 Unclassified 739
12 Ga0070676_10010579 3300005328 Bacteria 5005
13 Ga0070676_10073015 3300005328 Unclassified 2064
14 Ga0070683_100008507 3300005329 Bacteria 8718
15 Ga0070683_100029649 3300005329 Bacteria 4957
16 Ga0070683_100505160 3300005329 Unclassified 1155
17 Ga0070690_100026557 3300005330 Bacteria 3573
18 Ga0070690_100454794 3300005330 Unclassified 950
19 Ga0070670_100014317 3300005331 Bacteria 6805
20 Ga0070670_100134527 3300005331 Bacteria 2136
21 Ga0070677_10013347 3300005333 Bacteria 2872
22 Ga0070677_10548777 3300005333 Bacteria 633
23 Ga0068869_100014661 3300005334 Bacteria 5241
24 Ga0070666_10028525 3300005335 Bacteria 3663
25 Ga0070666_10175835 3300005335 Unclassified 1501
26 Ga0070666_10206556 3300005335 Unclassified 1382
27 Ga0070680_100256127 3300005336 Unclassified 1480
28 Ga0070680_101260006 3300005336 Bacteria 640
29 Ga0070680_101373755 3300005336 Unclassified 611
30 Ga0070682_100021304 3300005337 Bacteria 3823
31 Ga0070682_101578708 3300005337 Unclassified 566
32 Ga0068868_100048560 3300005338 Bacteria 3329
33 Ga0068868_100232874 3300005338 Unclassified 1546
34 Ga0070660_100016361 3300005339 Bacteria 5382
35 Ga0070660_100162634 3300005339 Bacteria 1799
36 Ga0070689_100013364 3300005340 Bacteria 5938
37 Ga0070691_10112169 3300005341 Bacteria 1365
38 Ga0070687_100027361 3300005343 Bacteria 2754
39 Ga0070661_100012448 3300005344 Bacteria 5950
40 Ga0070661_100018311 3300005344 Unclassified 4978
41 Ga0070661_100216493 3300005344 Bacteria 1468
42 Ga0070668_100009738 3300005347 Bacteria 7125
43 Ga0070668_100049564 3300005347 Bacteria 3231
44 Ga0070669_100012969 3300005353 Bacteria 5920
45 Ga0070669_100183475 3300005353 Bacteria 1638
46 Ga0070675_100019172 3300005354 Bacteria 5449
47 Ga0070671_100219132 3300005355 Bacteria 1614
48 Ga0070674_100027611 3300005356 Bacteria 3720
49 Ga0070674_101901762 3300005356 Unclassified 541
50 Ga0070673_100010535 3300005364 Bacteria 6261
51 Ga0070688_100006794 3300005365 Bacteria 6136
52 Ga0070688_100089223 3300005365 Bacteria 2012
53 Ga0070659_100005924 3300005366 Bacteria 8812
54 Ga0070659_100134094 3300005366 Unclassified 2013
55 Ga0070667_100018445 3300005367 Bacteria 5786
56 Ga0070667_100205060 3300005367 Bacteria 1750
57 Ga0070709_10001876 3300005434 Bacteria 11392
58 Ga0070709_10006738 3300005434 Bacteria 6271
59 Ga0070709_10011458 3300005434 Bacteria 4942
60 Ga0070709_10012421 3300005434 Bacteria 4768
61 Ga0070709_10035701 3300005434 Bacteria 3023
62 Ga0070709_10076982 3300005434 Bacteria 2168
63 Ga0070709_10687645 3300005434 Bacteria 795
64 Ga0070709_10876434 3300005434 Unclassified 709
65 Ga0070714_100000172 3300005435 Bacteria 52540
66 Ga0070714_100046805 3300005435 Bacteria 3671
67 Ga0070714_100084131 3300005435 Bacteria 2775
68 Ga0070714_100310781 3300005435 Bacteria 1471
69 Ga0070714_100371348 3300005435 Bacteria 1347
70 Ga0070714_100688409 3300005435 Unclassified 986
71 Ga0070714_100726817 3300005435 Unclassified 959
72 Ga0070713_100000342 3300005436 Bacteria 30393
73 Ga0070713_100000449 3300005436 Bacteria 26293
74 Ga0070713_100000510 3300005436 Bacteria 24756
75 Ga0070713_100013833 3300005436 Bacteria 5972
76 Ga0070713_100045317 3300005436 Bacteria 3603
77 Ga0070713_100065002 3300005436 Bacteria 3063
78 Ga0070713_100101831 3300005436 Unclassified 2489
79 Ga0070713_100144760 3300005436 Bacteria 2108
80 Ga0070713_100198026 3300005436 Bacteria 1813
81 Ga0070713_100230160 3300005436 Bacteria 1684
82 Ga0070713_100413481 3300005436 Bacteria 1262
83 Ga0070713_100444628 3300005436 Bacteria 1217
84 Ga0070713_100446898 3300005436 Unclassified 1213
85 Ga0070713_100530247 3300005436 Bacteria 1113
86 Ga0070713_100567926 3300005436 Bacteria 1075
87 Ga0070713_100875083 3300005436 Bacteria 863
88 Ga0070710_10032513 3300005437 Bacteria 2827
89 Ga0070710_10109687 3300005437 Unclassified 1656
90 Ga0070710_10119208 3300005437 Unclassified 1595
91 Ga0070710_10294543 3300005437 Bacteria 1057
92 Ga0070710_10309313 3300005437 Bacteria 1034
93 Ga0070710_10362018 3300005437 Unclassified 963
94 Ga0070710_10394409 3300005437 Unclassified 926
95 Ga0070710_10782788 3300005437 Bacteria 680
96 Ga0070711_100000099 3300005439 Bacteria 45540
97 Ga0070711_100002049 3300005439 Bacteria 11371
98 Ga0070711_100017979 3300005439 Bacteria 4507
99 Ga0070711_100046051 3300005439 Bacteria 2970
100 Ga0070711_100072690 3300005439 Unclassified 2427
101 Ga0070711_100099388 3300005439 Bacteria 2114
102 Ga0070711_100140575 3300005439 Bacteria 1809
103 Ga0070711_100610301 3300005439 Bacteria 911
104 Ga0070711_100746168 3300005439 Unclassified 827
105 Ga0070694_100271550 3300005444 Bacteria 1290
106 Ga0070708_100000418 3300005445 Bacteria 31903
107 Ga0070708_100001401 3300005445 Bacteria 18432
108 Ga0070708_100002020 3300005445 Bacteria 15621
109 Ga0070708_100016302 3300005445 Bacteria 6163
110 Ga0070708_100044220 3300005445 Bacteria 3915
111 Ga0070708_100044658 3300005445 Bacteria 3898
112 Ga0070708_100095844 3300005445 Bacteria 2709
113 Ga0070708_100163052 3300005445 Bacteria 2078
114 Ga0070708_100164013 3300005445 Bacteria 2072
115 Ga0070708_100625578 3300005445 Bacteria 1015
116 Ga0070708_100962316 3300005445 Unclassified 801
117 Ga0070663_100010754 3300005455 Bacteria 5714
118 Ga0070663_100047085 3300005455 Bacteria 3054
119 Ga0070678_100022210 3300005456 Bacteria 4199
120 Ga0070678_100054141 3300005456 Bacteria 2921
121 Ga0070662_100003783 3300005457 Bacteria 9469
122 Ga0070662_100023119 3300005457 Bacteria 4266
123 Ga0070662_100071465 3300005457 Bacteria 2559
124 Ga0070681_10115544 3300005458 Bacteria 2621
125 Ga0070681_10535497 3300005458 Bacteria 1085
126 Ga0070681_10570204 3300005458 Unclassified 1046
127 Ga0070681_10723022 3300005458 Bacteria 912
128 Ga0068867_100011942 3300005459 Bacteria 6136
129 Ga0068867_100065906 3300005459 Bacteria 2696
130 Ga0070685_10005938 3300005466 Bacteria 6213
131 Ga0070685_10146971 3300005466 Bacteria 1490
132 Ga0070706_100000173 3300005467 Bacteria 81500
133 Ga0070706_100001295 3300005467 Bacteria 26667
134 Ga0070706_100013420 3300005467 Bacteria 7574
135 Ga0070706_100018639 3300005467 Bacteria 6398
136 Ga0070706_100060551 3300005467 Unclassified 3495
137 Ga0070706_100511527 3300005467 Bacteria 1117
138 Ga0070706_100538555 3300005467 Bacteria 1086
139 Ga0070707_100000719 3300005468 Bacteria 33081
140 Ga0070707_100002543 3300005468 Bacteria 17343
141 Ga0070707_100012053 3300005468 Bacteria 8070
142 Ga0070707_100057506 3300005468 Bacteria 3731
143 Ga0070707_100057513 3300005468 Bacteria 3730
144 Ga0070707_100297759 3300005468 Bacteria 1567
145 Ga0070698_100000162 3300005471 Bacteria 61345
146 Ga0070698_100007167 3300005471 Bacteria 12080
147 Ga0070698_100128893 3300005471 Bacteria 2486
148 Ga0070698_100136048 3300005471 Bacteria 2411
149 Ga0070698_100166556 3300005471 Bacteria 2146
150 Ga0070699_100001096 3300005518 Bacteria 25207
151 Ga0070699_100002540 3300005518 Bacteria 16392
152 Ga0070699_100004218 3300005518 Bacteria 12713
153 Ga0070699_100012258 3300005518 Bacteria 7396
154 Ga0070699_100048438 3300005518 Unclassified 3678
155 Ga0070699_100096093 3300005518 Unclassified 2595
156 Ga0070699_100158928 3300005518 Unclassified 2000
157 Ga0070699_100592358 3300005518 Unclassified 1011
158 Ga0070699_100625638 3300005518 Bacteria 982
159 Ga0070699_100752106 3300005518 Bacteria 891
160 Ga0070679_100256332 3300005530 Bacteria 1705
161 Ga0070679_100322810 3300005530 Bacteria 1493
162 Ga0070679_100978251 3300005530 Unclassified 790
163 Ga0070684_100006304 3300005535 Bacteria 9166
164 Ga0070684_100160446 3300005535 Unclassified 2040
165 Ga0070684_100820120 3300005535 Bacteria 870
166 Ga0070697_100000554 3300005536 Bacteria 28090
167 Ga0070697_100000872 3300005536 Bacteria 22677
168 Ga0070697_100001177 3300005536 Bacteria 19808
169 Ga0070697_100001505 3300005536 Bacteria 17701
170 Ga0070697_100002639 3300005536 Bacteria 13795
171 Ga0070697_100024244 3300005536 Bacteria 4829
172 Ga0070697_100174118 3300005536 Unclassified 1822
173 Ga0070697_100212204 3300005536 Bacteria 1648
174 Ga0068853_100016415 3300005539 Bacteria 6093
175 Ga0068853_100035889 3300005539 Bacteria 4213
176 Ga0068853_100035951 3300005539 Bacteria 4209
177 Ga0070672_100019833 3300005543 Bacteria 4891
178 Ga0070686_100030276 3300005544 Bacteria 3300
179 Ga0070686_100062316 3300005544 Bacteria 2413
180 Ga0070695_100161859 3300005545 Bacteria 1571
181 Ga0070695_100572691 3300005545 Unclassified 883
182 Ga0070696_100308363 3300005546 Bacteria 1214
183 Ga0070693_100117514 3300005547 Bacteria 1645
184 Ga0070693_100256189 3300005547 Unclassified 1162
185 Ga0070665_100384352 3300005548 Bacteria 1411
186 Ga0068855_100028151 3300005563 Bacteria 6721
187 Ga0068855_100082032 3300005563 Bacteria 3737
188 Ga0068855_100826772 3300005563 Bacteria 983
189 Ga0068855_101094456 3300005563 Unclassified 833
190 Ga0070664_100012980 3300005564 Bacteria 6778
191 Ga0070664_100017362 3300005564 Bacteria 5909
192 Ga0070664_100173686 3300005564 Bacteria 1912
193 Ga0068857_100002662 3300005577 Bacteria 14661
194 Ga0068857_100060124 3300005577 Bacteria 3376
195 Ga0068854_100009708 3300005578 Bacteria 6219
196 Ga0068854_100460332 3300005578 Bacteria 1064
197 Ga0068856_100019084 3300005614 Bacteria 6654
198 Ga0068856_100034355 3300005614 Bacteria 4966
199 Ga0068856_100035602 3300005614 Bacteria 4879
200 Ga0068856_100060078 3300005614 Bacteria 3756
201 Ga0068856_100060970 3300005614 Bacteria 3726
202 Ga0068856_100096241 3300005614 Bacteria 2949
203 Ga0070702_100138308 3300005615 Bacteria 1548
204 Ga0068852_100006784 3300005616 Bacteria 8307
205 Ga0068852_100015554 3300005616 Bacteria 5907
206 Ga0068852_100116529 3300005616 Bacteria 2438
207 Ga0068859_100037215 3300005617 Bacteria 4884
208 Ga0068864_100203828 3300005618 Bacteria 1818
209 Ga0068864_100462302 3300005618 Unclassified 1215
210 Ga0068864_100987147 3300005618 Unclassified 835
211 Ga0068866_10001944 3300005718 Bacteria 8612
212 Ga0068866_10326929 3300005718 Bacteria 966
213 Ga0068861_100009145 3300005719 Bacteria 6834
214 Ga0068851_10006235 3300005834 Bacteria 5441
215 Ga0068851_10017023 3300005834 Bacteria 3486
216 Ga0068851_10029284 3300005834 Bacteria 2726
217 Ga0068870_10012560 3300005840 Bacteria 3961
218 Ga0068863_100084025 3300005841 Bacteria 3017
219 Ga0068863_100112243 3300005841 Unclassified 2596
220 Ga0068863_100169230 3300005841 Bacteria 2095
221 Ga0068863_100335151 3300005841 Bacteria 1471
222 Ga0068858_100018536 3300005842 Bacteria 6516
223 Ga0068858_100818521 3300005842 Bacteria 909
224 Ga0068860_100033462 3300005843 Bacteria 4931
225 Ga0068860_100286630 3300005843 Bacteria 1610
226 Ga0068860_100462065 3300005843 Bacteria 1263
227 Ga0068862_100024154 3300005844 Bacteria 5098
228 Ga0068862_100125918 3300005844 Bacteria 2262
229 Ga0070717_10000612 3300006028 Bacteria 22915
230 Ga0070717_10000837 3300006028 Bacteria 20360
231 Ga0070717_10001449 3300006028 Bacteria 16366
232 Ga0070717_10005741 3300006028 Bacteria 9085
233 Ga0070717_10024145 3300006028 Bacteria 4824
234 Ga0070717_10045843 3300006028 Bacteria 3575
235 Ga0070717_10137148 3300006028 Bacteria 2108
236 Ga0070717_10146046 3300006028 Bacteria 2043
237 Ga0070717_10147941 3300006028 Bacteria 2030
238 Ga0070717_10224306 3300006028 Bacteria 1653
239 Ga0070717_10252654 3300006028 Bacteria 1558
240 Ga0070717_10496403 3300006028 Unclassified 1103
241 Ga0070717_10743396 3300006028 Bacteria 892
242 Ga0070717_10984018 3300006028 Bacteria 768
243 Ga0070715_10090802 3300006163 Bacteria 1405
244 Ga0070715_10095244 3300006163 Unclassified 1378
245 Ga0070716_100000315 3300006173 Bacteria 19472
246 Ga0070716_100002096 3300006173 Bacteria 9152
247 Ga0070716_100014273 3300006173 Bacteria 4067
248 Ga0070716_100037106 3300006173 Bacteria 2691
249 Ga0070716_100042111 3300006173 Bacteria 2548
250 Ga0070716_100092424 3300006173 Bacteria 1834
251 Ga0070716_100097798 3300006173 Bacteria 1792
252 Ga0070716_100120575 3300006173 Bacteria 1641
253 Ga0070716_100191504 3300006173 Bacteria 1352
254 Ga0070716_100281838 3300006173 Unclassified 1147
255 Ga0070716_100339825 3300006173 Bacteria 1059
256 Ga0070716_100449359 3300006173 Unclassified 939
257 Ga0070716_100530529 3300006173 Bacteria 874
258 Ga0070716_100880373 3300006173 Bacteria 699
259 Ga0070712_100000546 3300006175 Bacteria 21742
260 Ga0070712_100002960 3300006175 Bacteria 10514
261 Ga0070712_100003075 3300006175 Bacteria 10319
262 Ga0070712_100005278 3300006175 Bacteria 7994
263 Ga0070712_100031299 3300006175 Bacteria 3583
264 Ga0070712_100061623 3300006175 Bacteria 2651
265 Ga0070712_100233313 3300006175 Bacteria 1462
266 Ga0070712_100464965 3300006175 Bacteria 1055
267 Ga0070712_100505911 3300006175 Unclassified 1013
268 Ga0070712_100635624 3300006175 Bacteria 906
269 Ga0070712_100709718 3300006175 Unclassified 858
270 Ga0097621_100008160 3300006237 Bacteria 7529
271 Ga0097621_100190616 3300006237 Bacteria 1775
272 Ga0097621_100327422 3300006237 Bacteria 1358
273 Ga0097621_100404318 3300006237 Unclassified 1223
274 Ga0097621_100610893 3300006237 Unclassified 997
275 Ga0068871_100007947 3300006358 Bacteria 7605
276 Ga0068871_100040074 3300006358 Bacteria 3751
277 Ga0068871_100188544 3300006358 Bacteria 1775
278 Ga0068871_100256279 3300006358 Bacteria 1525
279 Ga0068871_100488464 3300006358 Bacteria 1108
280 Ga0075433_10001164 3300006852 Bacteria 19108
281 Ga0075433_10001954 3300006852 Bacteria 15504
282 Ga0075433_10572342 3300006852 Unclassified 992
283 Ga0075434_100000041 3300006871 Bacteria 59536
284 Ga0075434_100002766 3300006871 Bacteria 15521
285 Ga0075434_100008051 3300006871 Bacteria 9775
286 Ga0068865_100032569 3300006881 Bacteria 3483
287 Ga0068865_100296483 3300006881 Bacteria 1292
288 Ga0075436_100000526 3300006914 Bacteria 24961
289 Ga0075436_100006992 3300006914 Bacteria 7726
290 Ga0075436_100016670 3300006914 Bacteria 5029
291 Ga0075436_100070745 3300006914 Unclassified 2412
292 Ga0075436_100277786 3300006914 Bacteria 1197
293 Ga0075436_100734257 3300006914 Bacteria 733
294 Ga0097620_100037214 3300006931 Bacteria 4884
295 Ga0075435_100000105 3300007076 Bacteria 45736
296 Ga0075435_100023020 3300007076 Bacteria 4811
297 Ga0075435_100037240 3300007076 Bacteria 3872
298 Ga0075435_100347524 3300007076 Bacteria 1271
299 Ga0075435_100552641 3300007076 Unclassified 997
300 Ga0099794_10008610 3300007265 Bacteria 4247
301 Ga0099794_10111802 3300007265 Bacteria 1369
302 Ga0099794_10168120 3300007265 Unclassified 1117
303 Ga0099794_10236851 3300007265 Unclassified 940
304 Ga0099795_10036881 3300007788 Bacteria 1718
305 Ga0099795_10101684 3300007788 Bacteria 1128
306 Ga0105240_10074313 3300009093 Bacteria 4196
307 Ga0105240_10181112 3300009093 Bacteria 2486
308 Ga0105240_10256517 3300009093 Bacteria 2019
309 Ga0105240_10263184 3300009093 Unclassified 1989
310 Ga0105240_10593662 3300009093 Bacteria 1220
311 Ga0105240_11617565 3300009093 Unclassified 677
312 Ga0105240_12166851 3300009093 Unclassified 577
313 Ga0105245_10030920 3300009098 Bacteria 4736
314 Ga0105245_10140939 3300009098 Bacteria 2271
315 Ga0105245_10165140 3300009098 Bacteria 2104
316 Ga0105245_11021681 3300009098 Unclassified 872
317 Ga0105247_10006289 3300009101 Bacteria 7361
318 Ga0105247_10026851 3300009101 Bacteria 3480
319 Ga0105247_11103034 3300009101 Unclassified 626
320 Ga0114129_11407360 3300009147 Bacteria 860
321 Ga0105243_10058571 3300009148 Bacteria 3070
322 Ga0105243_11199285 3300009148 Bacteria 772
323 Ga0105241_10000916 3300009174 Bacteria 22311
324 Ga0105241_10013091 3300009174 Bacteria 6084
325 Ga0105241_10241944 3300009174 Bacteria 1526
326 Ga0105241_10328554 3300009174 Bacteria 1321
327 Ga0105241_10736991 3300009174 Bacteria 902
328 Ga0105241_10748814 3300009174 Unclassified 896
329 Ga0105241_11130602 3300009174 Unclassified 739
330 Ga0105242_10068669 3300009176 Bacteria 2933
331 Ga0105248_10010789 3300009177 Bacteria 10087
332 Ga0105248_10070138 3300009177 Bacteria 3936
333 Ga0105248_10610461 3300009177 Bacteria 1231
334 Ga0105248_11216137 3300009177 Bacteria 852
335 Ga0105237_10062864 3300009545 Bacteria 3711
336 Ga0105237_10617226 3300009545 Bacteria 1091
337 Ga0105237_10785869 3300009545 Bacteria 959
338 Ga0105237_11087867 3300009545 Bacteria 806
339 Ga0105237_11755320 3300009545 Unclassified 628
340 Ga0105238_10030598 3300009551 Bacteria 5481
341 Ga0105238_10091469 3300009551 Bacteria 3030
342 Ga0105238_10278522 3300009551 Bacteria 1653
343 Ga0105249_10011376 3300009553 Bacteria 7814
344 Ga0105249_10033432 3300009553 Bacteria 4655
345 Ga0105249_10118256 3300009553 Bacteria 2515
346 Ga0105249_11371650 3300009553 Unclassified 779
347 Ga0105239_10117684 3300010375 Bacteria 2949
348 Ga0105239_10460080 3300010375 Bacteria 1444
349 Ga0105239_10691320 3300010375 Unclassified 1166
350 Ga0105239_10768567 3300010375 Bacteria 1103
351 Ga0105239_12520334 3300010375 Unclassified 599
352 Ga0105246_10009260 3300011119 Bacteria 6066
353 Ga0105246_11729674 3300011119 Unclassified 595
354 Ga0157373_10000288 3300013100 Bacteria 40421
355 Ga0157373_10004158 3300013100 Bacteria 10914
356 Ga0157373_10112556 3300013100 Bacteria 1913
357 Ga0157373_10207528 3300013100 Bacteria 1381
358 Ga0157371_10031378 3300013102 Bacteria 3828
359 Ga0157371_10271571 3300013102 Unclassified 1224
360 Ga0157370_10045720 3300013104 Bacteria 4199
361 Ga0157370_10085697 3300013104 Unclassified 2960
362 Ga0157370_10677144 3300013104 Bacteria 942
363 Ga0157369_10008623 3300013105 Bacteria 11692
364 Ga0157369_10032939 3300013105 Bacteria 5695
365 Ga0157369_10048103 3300013105 Bacteria 4629
366 Ga0157369_10102365 3300013105 Bacteria 3052
367 Ga0157369_10119587 3300013105 Bacteria 2795
368 Ga0157374_10014241 3300013296 Bacteria 6954
369 Ga0157374_10049285 3300013296 Bacteria 3912
370 Ga0157374_10053326 3300013296 Bacteria 3770
371 Ga0157374_10186316 3300013296 Bacteria 2029
372 Ga0157374_10224493 3300013296 Bacteria 1844
373 Ga0157374_10288743 3300013296 Bacteria 1620
374 Ga0157374_11001050 3300013296 Bacteria 855
375 Ga0157378_10010049 3300013297 Bacteria 8247
376 Ga0157378_10103061 3300013297 Bacteria 2607
377 Ga0157378_10310375 3300013297 Bacteria 1529
378 Ga0163162_10029047 3300013306 Bacteria 5472
379 Ga0163162_10294833 3300013306 Bacteria 1753
380 Ga0163162_11370766 3300013306 Bacteria 804
381 Ga0157372_10015183 3300013307 Bacteria 8245
382 Ga0157372_10015214 3300013307 Bacteria 8240
383 Ga0157372_10072578 3300013307 Bacteria 3879
384 Ga0157372_10076790 3300013307 Bacteria 3772
385 Ga0157372_10242027 3300013307 Bacteria 2093
386 Ga0157372_10428455 3300013307 Bacteria 1542
387 Ga0157372_11143669 3300013307 Unclassified 900
388 Ga0157375_10027190 3300013308 Bacteria 5344
389 Ga0163163_10007476 3300014325 Bacteria 9642
390 Ga0163163_10011914 3300014325 Bacteria 7911
391 Ga0163163_10020058 3300014325 Bacteria 6291
392 Ga0163163_10022148 3300014325 Bacteria 6011
393 Ga0182008_10019449 3300014497 Bacteria 3504
394 Ga0182008_10107349 3300014497 Bacteria 1382
395 Ga0157377_10001020 3300014745 Bacteria 11815
396 Ga0157379_10007715 3300014968 Bacteria 9316
397 Ga0157379_10014150 3300014968 Bacteria 6996
398 Ga0157379_10653514 3300014968 Unclassified 984
399 Ga0157379_10692323 3300014968 Unclassified 956
400 Ga0157376_10009736 3300014969 Bacteria 6997
401 Ga0157376_10017009 3300014969 Bacteria 5536
402 Ga0157376_10035919 3300014969 Bacteria 4011
403 Ga0157376_10397162 3300014969 Bacteria 1332
404 Ga0157376_11458188 3300014969 Bacteria 717
405 Ga0182007_10005070 3300015262 Bacteria 5851
406 Ga0182007_10103770 3300015262 Bacteria 943
407 Ga0182005_1009626 3300015265 Bacteria 2805
408 Ga0163161_10019548 3300017792 Bacteria 4753
409 Ga0184594_100472 3300019181 Bacteria 1155
410 Ga0213873_10136317 3300021358 Unclassified 730
411 Ga0213874_10090537 3300021377 Unclassified 1004
412 Ga0224570_100064 3300022730 Bacteria 5809
413 Ga0224569_100403 3300022732 Bacteria 3665
414 Ga0224571_102100 3300022734 Bacteria 1262
415 Ga0224572_1005998 3300024225 Bacteria 2186
416 Ga0224572_1018321 3300024225 Unclassified 1345
417 Ga0228598_1000222 3300024227 Bacteria 10731
418 Ga0228598_1000502 3300024227 Bacteria 8089
419 Ga0228598_1000816 3300024227 Bacteria 6714
420 Ga0228598_1027302 3300024227 Unclassified 1122
421 Ga0228598_1041734 3300024227 Unclassified 906
422 Ga0207697_10007772 3300025315 Bacteria 4750
423 Ga0207656_10037664 3300025321 Bacteria 2036
424 Ga0207656_10211485 3300025321 Bacteria 940
425 Ga0207682_10029528 3300025893 Bacteria 2192
426 Ga0207682_10416653 3300025893 Bacteria 635
427 Ga0207692_10006597 3300025898 Bacteria 4715
428 Ga0207692_10068299 3300025898 Bacteria 1863
429 Ga0207692_10089120 3300025898 Unclassified 1669
430 Ga0207692_10325901 3300025898 Bacteria 941
431 Ga0207692_10391074 3300025898 Bacteria 865
432 Ga0207642_10104851 3300025899 Unclassified 1427
433 Ga0207642_10386144 3300025899 Bacteria 834
434 Ga0207710_10348901 3300025900 Unclassified 754
435 Ga0207688_10145853 3300025901 Bacteria 1395
436 Ga0207680_10015571 3300025903 Bacteria 3971
437 Ga0207680_10663459 3300025903 Bacteria 747
438 Ga0207647_10003441 3300025904 Bacteria 11878
439 Ga0207647_10085312 3300025904 Bacteria 1889
440 Ga0207685_10040513 3300025905 Bacteria 1736
441 Ga0207699_10001324 3300025906 Bacteria 11774
442 Ga0207699_10015400 3300025906 Bacteria 3970
443 Ga0207699_10020214 3300025906 Bacteria 3563
444 Ga0207699_10058713 3300025906 Bacteria 2302
445 Ga0207699_10060749 3300025906 Bacteria 2271
446 Ga0207699_10061138 3300025906 Bacteria 2265
447 Ga0207699_10094983 3300025906 Unclassified 1879
448 Ga0207699_10264602 3300025906 Bacteria 1190
449 Ga0207699_10362925 3300025906 Bacteria 1025
450 Ga0207699_10446256 3300025906 Bacteria 927
451 Ga0207699_10656955 3300025906 Unclassified 766
452 Ga0207699_10767960 3300025906 Bacteria 708
453 Ga0207645_10000181 3300025907 Bacteria 50200
454 Ga0207645_10019336 3300025907 Bacteria 4466
455 Ga0207643_10001458 3300025908 Bacteria 13565
456 Ga0207643_10109875 3300025908 Bacteria 1624
457 Ga0207705_10045425 3300025909 Bacteria 3157
458 Ga0207684_10000217 3300025910 Bacteria 88691
459 Ga0207684_10000267 3300025910 Bacteria 77172
460 Ga0207684_10004181 3300025910 Bacteria 13709
461 Ga0207684_10498628 3300025910 Bacteria 1044
462 Ga0207684_10779951 3300025910 Bacteria 809
463 Ga0207654_10006062 3300025911 Bacteria 6077
464 Ga0207654_10055269 3300025911 Bacteria 2298
465 Ga0207654_10058367 3300025911 Bacteria 2246
466 Ga0207654_10092107 3300025911 Bacteria 1850
467 Ga0207654_10166552 3300025911 Bacteria 1428
468 Ga0207654_10246661 3300025911 Bacteria 1195
469 Ga0207654_10548815 3300025911 Bacteria 821
470 Ga0207707_10015984 3300025912 Bacteria 6545
471 Ga0207707_10175218 3300025912 Unclassified 1873
472 Ga0207707_10470183 3300025912 Bacteria 1075
473 Ga0207707_10510704 3300025912 Bacteria 1024
474 Ga0207695_10027763 3300025913 Bacteria 6297
475 Ga0207695_10064718 3300025913 Bacteria 3763
476 Ga0207695_10299030 3300025913 Bacteria 1501
477 Ga0207695_10307560 3300025913 Bacteria 1475
478 Ga0207695_10545532 3300025913 Bacteria 1041
479 Ga0207695_10905542 3300025913 Bacteria 762
480 Ga0207671_10122728 3300025914 Bacteria 1987
481 Ga0207671_10125768 3300025914 Unclassified 1964
482 Ga0207671_10537801 3300025914 Bacteria 931
483 Ga0207693_10000089 3300025915 Bacteria 81143
484 Ga0207693_10000106 3300025915 Bacteria 75776
485 Ga0207693_10009582 3300025915 Bacteria 7887
486 Ga0207693_10013836 3300025915 Bacteria 6498
487 Ga0207693_10029134 3300025915 Bacteria 4363
488 Ga0207693_10075950 3300025915 Bacteria 2631
489 Ga0207693_10209793 3300025915 Bacteria 1531
490 Ga0207693_10286481 3300025915 Bacteria 1291
491 Ga0207693_10374723 3300025915 Bacteria 1113
492 Ga0207693_10761346 3300025915 Bacteria 748
493 Ga0207663_10002155 3300025916 Bacteria 9394
494 Ga0207663_10059922 3300025916 Bacteria 2410
495 Ga0207663_10079355 3300025916 Bacteria 2143
496 Ga0207663_10085695 3300025916 Bacteria 2075
497 Ga0207663_10124631 3300025916 Bacteria 1770
498 Ga0207663_10160137 3300025916 Bacteria 1588
499 Ga0207663_10320556 3300025916 Bacteria 1164
500 Ga0207663_10788727 3300025916 Unclassified 756
501 Ga0207660_10379430 3300025917 Bacteria 1136
502 Ga0207660_10761743 3300025917 Bacteria 790
503 Ga0207662_10026172 3300025918 Bacteria 3364
504 Ga0207657_10000535 3300025919 Bacteria 40427
505 Ga0207657_10001828 3300025919 Bacteria 22959
506 Ga0207657_10010586 3300025919 Bacteria 9195
507 Ga0207649_10000350 3300025920 Bacteria 34881
508 Ga0207649_10020780 3300025920 Unclassified 3769
509 Ga0207649_10114548 3300025920 Bacteria 1807
510 Ga0207652_10144604 3300025921 Bacteria 2127
511 Ga0207652_10471230 3300025921 Unclassified 1131
512 Ga0207646_10000296 3300025922 Bacteria 67683
513 Ga0207646_10001311 3300025922 Bacteria 30882
514 Ga0207646_10095550 3300025922 Bacteria 2662
515 Ga0207646_10132679 3300025922 Bacteria 2242
516 Ga0207646_10209420 3300025922 Bacteria 1761
517 Ga0207646_10272895 3300025922 Bacteria 1529
518 Ga0207646_10300814 3300025922 Bacteria 1449
519 Ga0207681_10079583 3300025923 Bacteria 2309
520 Ga0207694_10144453 3300025924 Bacteria 1914
521 Ga0207694_10182398 3300025924 Unclassified 1703
522 Ga0207694_10502618 3300025924 Unclassified 1015
523 Ga0207650_10000223 3300025925 Bacteria 64087
524 Ga0207650_10140577 3300025925 Bacteria 1898
525 Ga0207659_10007479 3300025926 Bacteria 6721
526 Ga0207687_10018290 3300025927 Bacteria 4624
527 Ga0207687_10077263 3300025927 Bacteria 2394
528 Ga0207700_10000289 3300025928 Bacteria 29760
529 Ga0207700_10000888 3300025928 Bacteria 17211
530 Ga0207700_10025835 3300025928 Bacteria 4086
531 Ga0207700_10030601 3300025928 Bacteria 3814
532 Ga0207700_10077108 3300025928 Bacteria 2588
533 Ga0207700_10153261 3300025928 Bacteria 1906
534 Ga0207700_10161029 3300025928 Unclassified 1864
535 Ga0207700_10255286 3300025928 Unclassified 1499
536 Ga0207700_10263812 3300025928 Bacteria 1476
537 Ga0207700_10301690 3300025928 Bacteria 1383
538 Ga0207700_10517468 3300025928 Bacteria 1057
539 Ga0207700_10618550 3300025928 Bacteria 964
540 Ga0207700_10657352 3300025928 Bacteria 935
541 Ga0207700_10737072 3300025928 Unclassified 880
542 Ga0207700_10845813 3300025928 Bacteria 819
543 Ga0207664_10000118 3300025929 Bacteria 69258
544 Ga0207664_10022203 3300025929 Bacteria 4735
545 Ga0207664_10141500 3300025929 Unclassified 2035
546 Ga0207664_10191181 3300025929 Bacteria 1762
547 Ga0207664_10234103 3300025929 Bacteria 1597
548 Ga0207664_10320035 3300025929 Bacteria 1369
549 Ga0207664_10332482 3300025929 Unclassified 1342
550 Ga0207664_10550611 3300025929 Unclassified 1035
551 Ga0207664_10650565 3300025929 Bacteria 947
552 Ga0207644_10011249 3300025931 Bacteria 5915
553 Ga0207644_10049864 3300025931 Unclassified 2999
554 Ga0207690_10029853 3300025932 Bacteria 3471
555 Ga0207690_10387278 3300025932 Bacteria 1112
556 Ga0207706_10000670 3300025933 Bacteria 35982
557 Ga0207706_10009803 3300025933 Bacteria 8789
558 Ga0207706_10014729 3300025933 Bacteria 7082
559 Ga0207709_10108511 3300025935 Bacteria 1851
560 Ga0207709_10823662 3300025935 Bacteria 750
561 Ga0207670_10015700 3300025936 Bacteria 4531
562 Ga0207669_10863890 3300025937 Unclassified 754
563 Ga0207704_10067564 3300025938 Bacteria 2249
564 Ga0207704_10176675 3300025938 Bacteria 1538
565 Ga0207665_10001480 3300025939 Bacteria 15799
566 Ga0207665_10001526 3300025939 Bacteria 15570
567 Ga0207665_10008599 3300025939 Bacteria 6720
568 Ga0207665_10044443 3300025939 Bacteria 2973
569 Ga0207665_10079547 3300025939 Bacteria 2253
570 Ga0207665_10138043 3300025939 Bacteria 1736
571 Ga0207665_10229042 3300025939 Bacteria 1365
572 Ga0207665_10255058 3300025939 Bacteria 1297
573 Ga0207665_10317031 3300025939 Bacteria 1169
574 Ga0207665_10347153 3300025939 Unclassified 1120
575 Ga0207665_10347731 3300025939 Bacteria 1119
576 Ga0207665_10883279 3300025939 Unclassified 709
577 Ga0207691_10000345 3300025940 Bacteria 46775
578 Ga0207711_10029037 3300025941 Bacteria 4661
579 Ga0207689_10000499 3300025942 Bacteria 37043
580 Ga0207689_10076620 3300025942 Bacteria 2749
581 Ga0207661_10059699 3300025944 Bacteria 3074
582 Ga0207661_10125076 3300025944 Unclassified 2195
583 Ga0207661_10357834 3300025944 Bacteria 1318
584 Ga0207679_10000115 3300025945 Bacteria 64466
585 Ga0207679_10192010 3300025945 Bacteria 1699
586 Ga0207679_10250551 3300025945 Bacteria 1505
587 Ga0207667_10040938 3300025949 Bacteria 4931
588 Ga0207667_10246893 3300025949 Unclassified 1826
589 Ga0207667_11555893 3300025949 Viruses 631
590 Ga0207651_10003270 3300025960 Bacteria 7932
591 Ga0207712_10030933 3300025961 Bacteria 3602
592 Ga0207712_10141863 3300025961 Bacteria 1845
593 Ga0207668_10029993 3300025972 Bacteria 3570
594 Ga0207668_10780986 3300025972 Unclassified 844
595 Ga0207640_10154868 3300025981 Bacteria 1688
596 Ga0207640_10416205 3300025981 Bacteria 1099
597 Ga0207640_10595314 3300025981 Unclassified 935
598 Ga0207658_10018432 3300025986 Bacteria 4819
599 Ga0207658_10385427 3300025986 Bacteria 1228
600 Ga0207677_10016957 3300026023 Bacteria 4328
601 Ga0207677_10033304 3300026023 Bacteria 3323
602 Ga0207677_10368197 3300026023 Bacteria 1209
603 Ga0207703_10020915 3300026035 Bacteria 5118
604 Ga0207703_10221807 3300026035 Bacteria 1691
605 Ga0207703_10261335 3300026035 Bacteria 1565
606 Ga0207639_10028794 3300026041 Bacteria 4059
607 Ga0207678_10000130 3300026067 Bacteria 63279
608 Ga0207678_10001418 3300026067 Bacteria 21972
609 Ga0207678_10105876 3300026067 Unclassified 2399
610 Ga0207678_11605438 3300026067 Unclassified 573
611 Ga0207708_10088371 3300026075 Bacteria 2387
612 Ga0207702_10002571 3300026078 Bacteria 17059
613 Ga0207702_10023735 3300026078 Bacteria 5088
614 Ga0207702_10109070 3300026078 Unclassified 2457
615 Ga0207702_10257982 3300026078 Bacteria 1640
616 Ga0207702_10291844 3300026078 Bacteria 1545
617 Ga0207702_10622993 3300026078 Unclassified 1060
618 Ga0207702_10627342 3300026078 Bacteria 1056
619 Ga0207641_10000287 3300026088 Bacteria 63251
620 Ga0207641_10233097 3300026088 Bacteria 1712
621 Ga0207641_10648956 3300026088 Bacteria 1036
622 Ga0207641_10830731 3300026088 Bacteria 915
623 Ga0207641_11057882 3300026088 Unclassified 809
624 Ga0207648_10001253 3300026089 Bacteria 28381
625 Ga0207648_10031139 3300026089 Bacteria 4717
626 Ga0207676_10019296 3300026095 Bacteria 4971
627 Ga0207676_10156803 3300026095 Bacteria 1968
628 Ga0207676_10433215 3300026095 Unclassified 1236
629 Ga0207674_10020692 3300026116 Bacteria 7100
630 Ga0207674_10025502 3300026116 Bacteria 6304
631 Ga0207674_10027829 3300026116 Bacteria 5973
632 Ga0207675_100008545 3300026118 Bacteria 9630
633 Ga0207675_100147149 3300026118 Bacteria 2240
634 Ga0207683_10000217 3300026121 Bacteria 50192
635 Ga0207683_10028620 3300026121 Bacteria 4820
636 Ga0207698_10057434 3300026142 Bacteria 3011
637 Ga0207698_10102194 3300026142 Bacteria 2379
638 Ga0207698_10249849 3300026142 Bacteria 1622
639 Ga0265354_1004182 3300028016 Bacteria 1536
640 Ga0265356_1000336 3300028017 Bacteria 8653
641 Ga0265356_1010488 3300028017 Bacteria 1032
642 Ga0265357_1018582 3300028023 Unclassified 751
643 Ga0268266_10008412 3300028379 Bacteria 9174
644 Ga0268266_10575144 3300028379 Bacteria 1081
645 Ga0268266_10937589 3300028379 Bacteria 837
646 Ga0268266_11726430 3300028379 Unclassified 601
647 Ga0268265_10044706 3300028380 Bacteria 3300
648 Ga0268265_10048037 3300028380 Bacteria 3201
649 Ga0268265_10450156 3300028380 Bacteria 1202
650 Ga0268264_10025038 3300028381 Bacteria 4876
651 Ga0268264_10029486 3300028381 Bacteria 4494
652 Ga0268264_10077395 3300028381 Bacteria 2833
653 Ga0268264_10814500 3300028381 Bacteria 933
654 Ga0265336_10044137 3300028666 Unclassified 1357
655 Ga0265338_10010626 3300028800 Bacteria 10759
656 Ga0265338_10012546 3300028800 Bacteria 9652
657 Ga0265338_10173197 3300028800 Unclassified 1652
658 Ga0265762_1002825 3300030760 Bacteria 3108
659 Ga0265762_1013435 3300030760 Bacteria 1474
660 Ga0265762_1020484 3300030760 Bacteria 1216
661 Ga0265775_103190 3300030762 Bacteria 879
662 Ga0265767_101478 3300030836 Bacteria 1159
663 Ga0265770_1003844 3300030878 Bacteria 2043
664 Ga0265770_1015093 3300030878 Bacteria 1172
665 Ga0265770_1085108 3300030878 Bacteria 623
666 Ga0265765_1009051 3300030879 Bacteria 1091
667 Ga0265771_1003369 3300031010 Bacteria 916
668 Ga0265760_10000331 3300031090 Bacteria 13250
669 Ga0265760_10001481 3300031090 Bacteria 6917
670 Ga0265760_10081793 3300031090 Unclassified 1001
671 Ga0265760_10092507 3300031090 Bacteria 948
672 Ga0265325_10010836 3300031241 Bacteria 5257
673 Ga0265325_10086051 3300031241 Bacteria 1556
674 Ga0265340_10078248 3300031247 Bacteria 1560
675 Ga0265340_10160945 3300031247 Bacteria 1020
676 Ga0265339_10015242 3300031249 Bacteria 4613
677 Ga0265339_10068251 3300031249 Bacteria 1900
678 Ga0265339_10161471 3300031249 Bacteria 1127
679 Ga0265316_10019190 3300031344 Bacteria 5855
680 Ga0265316_10568181 3300031344 Unclassified 806
681 Ga0265314_10114275 3300031711 Unclassified 1710
682 Ga0265342_10160925 3300031712 Bacteria 1241
683 Ga0307416_100551502 3300032002 Bacteria 1226
684 Ga0316214_1007710 3300033545 Bacteria 1441
685 Ga0373930_0127190 3300034816 Unclassified 625
686 Ga0373958_0017263 3300034819 Bacteria 1295
687 Ga0373938_0015032 3300034957 Bacteria 1494
688 Ga0373926_0028857 3300035083 Bacteria 1949
689 Ga0373926_0042062 3300035083 Bacteria 1634
690 Ga0373926_0145879 3300035083 Bacteria 900
691 Ga0373934_0039992 3300035086 Unclassified 1849
692 Ga0373944_0047625 3300035089 Bacteria 1343
693 Ga0373944_0200346 3300035089 Bacteria 723
694 Ga0373944_0245320 3300035089 Bacteria 660
695 Ga0373923_0018059 3300035111 Bacteria 2708
696 Ga0373932_0170061 3300035112 Unclassified 759
697 Ga0373932_0212282 3300035112 Bacteria 692
698 Ga0373936_0000966 3300035113 Bacteria 10244
699 Ga0373936_0006441 3300035113 Bacteria 4428
700 Ga0373953_0010005 3300035117 Bacteria 3287
701 Ga0373954_0078263 3300035118 Bacteria 1577
702 Ga0373956_0008841 3300035119 Bacteria 4080
703 Ga0373956_0138998 3300035119 Bacteria 1140
704 Ga0373957_0017150 3300035120 Bacteria 2517
705 Ga0373957_0027426 3300035120 Unclassified 2069
706 Ga0373957_0132135 3300035120 Unclassified 1017
707 Ga0373960_0075450 3300035121 Bacteria 1051
708 Ga0373943_0000054 3300035170 Bacteria 38966
709 Ga0373943_0083341 3300035170 Unclassified 1643
710 Ga0373946_0010120 3300035171 Bacteria 3487
711 Ga0373955_0028331 3300035172 Bacteria 2902
712 Ga0373955_0066887 3300035172 Bacteria 1999
713 Ga0373955_0093625 3300035172 Bacteria 1716
714 Ga0373955_0182572 3300035172 Bacteria 1245
715 Ga0373924_0016533 3300035410 Bacteria 2816
716 Ga0373924_0023333 3300035410 Bacteria 2426
717 Ga0373931_0658721 3300035691 Unclassified 688
718 Ga0373935_0004095 3300035692 Bacteria 8527
719 Ga0373935_0022633 3300035692 Bacteria 3856
720 Ga0373935_0031111 3300035692 Bacteria 3310
721 Ga0373935_0116917 3300035692 Bacteria 1777
722 Ga0373935_0151497 3300035692 Bacteria 1574
723 Ga0373927_0082280 3300035695 Bacteria 2087
724 Ga0373927_0136218 3300035695 Bacteria 1605
725 Ga0373927_0273549 3300035695 Bacteria 1111
726 Ga0373927_0275384 3300035695 Bacteria 1107
727 Ga0373927_0293803 3300035695 Unclassified 1069
728 Ga0373927_0463003 3300035695 Unclassified 838
729 Ga0373927_0569314 3300035695 Unclassified 749
730 Ga0373927_0908407 3300035695 Unclassified 581
731 Ga0373933_0014246 3300035724 Bacteria 4418
732 Ga0373933_0045238 3300035724 Bacteria 2610
733 Ga0373933_0100682 3300035724 Bacteria 1793
734 Ga0373933_0253078 3300035724 Bacteria 1134
735 Ga0373933_0309111 3300035724 Unclassified 1024
736 Ga0373933_0576410 3300035724 Unclassified 739
737 Ga0373933_0828794 3300035724 Unclassified 609
738 Ga0373947_0000496 3300035725 Bacteria 22749
739 Ga0373947_0014673 3300035725 Unclassified 4494
740 Ga0373947_0156647 3300035725 Bacteria 1470
741 Ga0373937_0041215 3300036401 Unclassified 4212
742 Ga0373937_0058242 3300036401 Bacteria 3549
743 Ga0373937_0218937 3300036401 Bacteria 1792
744 Ga0373937_0356387 3300036401 Bacteria 1386
745 Ga0373937_0401786 3300036401 Unclassified 1300
746 Ga0373937_0516119 3300036401 Bacteria 1135
747 Ga0373937_0623515 3300036401 Bacteria 1023
748 Ga0373937_0793375 3300036401 Bacteria 895
749 Ga0373925_0003546 3300037068 Bacteria 12039
750 Ga0373925_0018652 3300037068 Bacteria 5043
751 Ga0373925_0141462 3300037068 Bacteria 1883
752 Ga0373925_0234518 3300037068 Bacteria 1468
753 Ga0373925_0239178 3300037068 Unclassified 1454
754 Ga0373925_0542925 3300037068 Bacteria 956
755 Ga0373925_0733739 3300037068 Bacteria 814
756 Ga0395900_0930063 3300037418 Bacteria 792
757 Ga0395905_0745593 3300037471 Bacteria 882
758 Ga0436363_0310747 3300039450 Unclassified 811
759 Ga0436363_0859048 3300039450 Bacteria 5706
760 Ga0436363_1703454 3300039450 Bacteria 661
761 Ga0436362_0242382 3300039453 Bacteria 2184
762 Ga0466963_0510293 3300044694 Bacteria 849
763 Ga0466964_0091790 3300044706 Unclassified 1323
764 Ga0466964_0369952 3300044706 Unclassified 741
765 Ga0466968_0362720 3300044735 Unclassified 705
766 Ga0451576_0109127 3300045051 Bacteria 2880
767 Ga0451576_2472999 3300045051 Unclassified 531
768 Ga0466967_0075951 3300045976 Bacteria 3021
769 Ga0466967_0274981 3300045976 Unclassified 1615
770 Ga0495592_0651313 3300046454 Unclassified 638
771 Ga0495603_0089785 3300046455 Unclassified 1798
772 Ga0495629_0104434 3300046459 Bacteria 1976
773 Ga0495629_0247385 3300046459 Bacteria 1227
774 Ga0495651_0136996 3300046462 Bacteria 1780
775 Ga0495580_0000031 3300046472 Bacteria 76248
776 Ga0495580_0004216 3300046472 Bacteria 12090
777 Ga0495580_0009626 3300046472 Bacteria 7588
778 Ga0495580_0018579 3300046472 Bacteria 5174
779 Ga0495580_0019658 3300046472 Bacteria 5015
780 Ga0495580_0028922 3300046472 Bacteria 4026
781 Ga0495580_0171239 3300046472 Bacteria 1501
782 Ga0495580_0177389 3300046472 Bacteria 1472
783 Ga0495580_0239685 3300046472 Bacteria 1244
784 Ga0495580_0600474 3300046472 Unclassified 727
785 Ga0495582_0015585 3300046473 Bacteria 4173
786 Ga0495584_0018151 3300046491 Bacteria 3577
787 Ga0495594_0030407 3300046499 Bacteria 2922
788 Ga0495628_0476723 3300046516 Bacteria 903
789 Ga0495630_0050881 3300046517 Bacteria 3100
790 Ga0495630_0230553 3300046517 Unclassified 1415
791 Ga0495630_0427477 3300046517 Bacteria 1015
792 Ga0495630_0658930 3300046517 Bacteria 801
793 Ga0495665_0025377 3300046531 Bacteria 3183
794 Ga0495665_0192774 3300046531 Bacteria 1057
795 Ga0495640_0240644 3300046533 Bacteria 1136
796 Ga0495587_0604013 3300046536 Unclassified 604
797 Ga0495645_0147033 3300046543 Unclassified 1641
798 Ga0495645_0402031 3300046543 Bacteria 873
799 Ga0495634_0388071 3300046642 Unclassified 831
800 Ga0495635_0614387 3300046663 Bacteria 709
801 Ga0495588_0052053 3300046674 Bacteria 2110
802 Ga0495657_0204630 3300046675 Bacteria 1202
803 Ga0495657_0654267 3300046675 Unclassified 606
804 Ga0495623_0053862 3300046679 Bacteria 2540
805 Ga0495647_0028580 3300046681 Bacteria 2057
806 Ga0495669_0041066 3300046684 Bacteria 2053
807 Ga0495669_0274918 3300046684 Bacteria 810
808 Ga0495613_0122679 3300046689 Bacteria 1865
809 Ga0495624_0086185 3300046690 Bacteria 1940
810 Ga0495624_0580882 3300046690 Unclassified 668
811 Ga0495600_0180149 3300046809 Bacteria 1362
812 Ga0495600_0227709 3300046809 Bacteria 1191
813 Ga0495674_0080360 3300047319 Bacteria 2798
814 Ga0495674_0085250 3300047319 Bacteria 2706
815 Ga0495593_0221085 3300047673 Bacteria 950
816 Ga0495593_0289991 3300047673 Bacteria 818
817 Ga0495602_0042006 3300048088 Unclassified 4169
818 Ga0495602_0126933 3300048088 Bacteria 2042
819 Ga0495602_0194576 3300048088 Bacteria 1552
820 Ga0495602_0308844 3300048088 Bacteria 1155
821 Ga0495602_0938898 3300048088 Unclassified 574
822 Ga0496100_0009722 3300048903 Bacteria 5413
823 Ga0496100_0668647 3300048903 Bacteria 809
824 Ga0496100_0947093 3300048903 Unclassified 677
825 Ga0496101_0019851 3300048904 Bacteria 4595
826 Ga0496101_0029423 3300048904 Bacteria 3842
827 Ga0496101_0178095 3300048904 Bacteria 1636
828 Ga0496101_0210240 3300048904 Bacteria 1507
829 Ga0496102_0001424 3300048905 Bacteria 21214
830 Ga0496102_0032128 3300048905 Unclassified 4715
831 Ga0496102_0092665 3300048905 Bacteria 2798
832 Ga0496102_0116975 3300048905 Bacteria 2488
833 Ga0496102_0153647 3300048905 Unclassified 2163
834 Ga0496102_0322922 3300048905 Bacteria 1454
835 Ga0496102_0586833 3300048905 Bacteria 1037
836 Ga0496102_0852891 3300048905 Bacteria 833
837 Ga0496102_1197648 3300048905 Unclassified 679
838 Ga0496103_0004119 3300048906 Bacteria 8825
839 Ga0496103_0022334 3300048906 Unclassified 3810
840 Ga0496103_0137789 3300048906 Bacteria 1560
841 Ga0496103_0160422 3300048906 Bacteria 1442
842 Ga0496104_0157280 3300048907 Bacteria 2181
843 Ga0496104_0172435 3300048907 Unclassified 2074
844 Ga0496104_0220356 3300048907 Bacteria 1809
845 Ga0496104_0315597 3300048907 Bacteria 1476
846 Ga0496106_0056741 3300048909 Bacteria 2961
847 Ga0496106_0068846 3300048909 Bacteria 2700
848 Ga0496106_0083711 3300048909 Bacteria 2453
849 Ga0496106_0181273 3300048909 Bacteria 1672
850 Ga0496107_0052688 3300048910 Bacteria 2935
851 Ga0496107_0069126 3300048910 Bacteria 2563
852 Ga0496108_0020285 3300048911 Bacteria 5462
853 Ga0496108_0043628 3300048911 Bacteria 3745
854 Ga0496109_0000117 3300048912 Bacteria 82245
855 Ga0496109_0054749 3300048912 Bacteria 3639
856 Ga0496109_0106106 3300048912 Bacteria 2609
857 Ga0496109_0446946 3300048912 Bacteria 1221
858 Ga0496110_0004256 3300048913 Bacteria 11075
859 Ga0496110_0012731 3300048913 Bacteria 6925
860 Ga0496110_0115435 3300048913 Bacteria 2417
861 Ga0496111_0009763 3300048914 Bacteria 6415
862 Ga0496111_0076767 3300048914 Bacteria 2435
863 Ga0496112_0000283 3300048915 Bacteria 32864
864 Ga0496112_0069112 3300048915 Bacteria 3489
865 Ga0496112_0081816 3300048915 Bacteria 3194
866 Ga0496112_0114302 3300048915 Bacteria 2670
867 Ga0496112_0249986 3300048915 Bacteria 1724
868 Ga0496112_0341521 3300048915 Unclassified 1440
869 Ga0496112_0610245 3300048915 Unclassified 1022
870 Ga0496112_0756931 3300048915 Unclassified 897
871 Ga0496112_1386136 3300048915 Bacteria 618
872 Ga0496113_0002193 3300048916 Bacteria 11259
873 Ga0496113_0024930 3300048916 Unclassified 4258
874 Ga0496115_0003148 3300048918 Bacteria 11863
875 Ga0496115_0009800 3300048918 Bacteria 7134
876 Ga0496115_0191279 3300048918 Bacteria 1691
877 nmdc:mga0n895_10187_c1 3300050512 Bacteria 8280
878 nmdc:mga0n895_15801_c1 3300050512 Bacteria 6902
879 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
880 nmdc:mga0n895_539906_c1 3300050512 Bacteria 1172
881 nmdc:mga0rr50_317270_c1 3300050513 Bacteria 1306
882 nmdc:mga0rr50_421_c1 3300050513 Bacteria 22898
883 nmdc:mga0rr50_71996_c1 3300050513 Bacteria 2639
884 nmdc:mga0rr50_7786_c1 3300050513 Bacteria 6639
885 nmdc:mga0rr50_839055_c1 3300050513 Unclassified 784
886 nmdc:mga08x19_1461_c1 3300050514 Bacteria 14622
887 nmdc:mga08x19_184697_c1 3300050514 Bacteria 1425
888 nmdc:mga08x19_298231_c1 3300050514 Bacteria 1119
889 nmdc:mga08x19_601136_c1 3300050514 Bacteria 779
890 nmdc:mga08x19_751368_c1 3300050514 Bacteria 692
891 nmdc:mga08x19_8169_c1 3300050514 Bacteria 6219
892 nmdc:mga0a205_223264_c1 3300050515 Unclassified 1769
893 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
894 Ga0495601_0778046 3300053077 Unclassified 608
895 Ga0495612_0349153 3300053078 Unclassified 668
896 Ga0495612_0438881 3300053078 Unclassified 596
897 Ga0495595_0053173 3300053084 Bacteria 1881
898 Ga0495619_0075971 3300053085 Bacteria 2255
899 Ga0495619_0197349 3300053085 Bacteria 1393
900 Ga0495619_0739838 3300053085 Unclassified 667
901 Ga0157372_10933286
902 MBSR1b_contig_12373736
903 LJNas_1000607
904 JGI24743J22301_10000326
905 JGI24749J21850_1013365
906 JGI24033J26618_1034833
907 JGI24034J26672_10001510
908 JGI24751J29686_10021546
909 Ga0065715_10091638
910 Ga0070658_10333721
911 Ga0070658_10969985
912 Ga0070676_10010579
913 Ga0070676_10073015
914 Ga0070683_100008507
915 Ga0070683_100029649
916 Ga0070683_100505160
917 Ga0070690_100026557
918 Ga0070690_100454794
919 Ga0070670_100014317
920 Ga0070670_100134527
921 Ga0070677_10013347
922 Ga0070677_10548777
923 Ga0068869_100014661
924 Ga0070666_10028525
925 Ga0070666_10175835
926 Ga0070666_10206556
927 Ga0070680_100256127
928 Ga0070680_101260006
929 Ga0070680_101373755
930 Ga0070682_100021304
931 Ga0070682_101578708
932 Ga0068868_100048560
933 Ga0068868_100232874
934 Ga0070660_100016361
935 Ga0070660_100162634
936 Ga0070689_100013364
937 Ga0070691_10112169
938 Ga0070687_100027361
939 Ga0070661_100012448
940 Ga0070661_100018311
941 Ga0070661_100216493
942 Ga0070668_100009738
943 Ga0070668_100049564
944 Ga0070669_100012969
945 Ga0070669_100183475
946 Ga0070675_100019172
947 Ga0070671_100219132
948 Ga0070674_100027611
949 Ga0070674_101901762
950 Ga0070673_100010535
951 Ga0070688_100006794
952 Ga0070688_100089223
953 Ga0070659_100005924
954 Ga0070659_100134094
955 Ga0070667_100018445
956 Ga0070667_100205060
957 Ga0070709_10001876
958 Ga0070709_10006738
959 Ga0070709_10011458
960 Ga0070709_10012421
961 Ga0070709_10035701
962 Ga0070709_10076982
963 Ga0070709_10687645
964 Ga0070709_10876434
965 Ga0070714_100000172
966 Ga0070714_100046805
967 Ga0070714_100084131
968 Ga0070714_100310781
969 Ga0070714_100371348
970 Ga0070714_100688409
971 Ga0070714_100726817
972 Ga0070713_100000342
973 Ga0070713_100000449
974 Ga0070713_100000510
975 Ga0070713_100013833
976 Ga0070713_100045317
977 Ga0070713_100065002
978 Ga0070713_100101831
979 Ga0070713_100144760
980 Ga0070713_100198026
981 Ga0070713_100230160
982 Ga0070713_100413481
983 Ga0070713_100444628
984 Ga0070713_100446898
985 Ga0070713_100530247
986 Ga0070713_100567926
987 Ga0070713_100875083
988 Ga0070710_10032513
989 Ga0070710_10109687
990 Ga0070710_10119208
991 Ga0070710_10294543
992 Ga0070710_10309313
993 Ga0070710_10362018
994 Ga0070710_10394409
995 Ga0070710_10782788
996 Ga0070711_100000099
997 Ga0070711_100002049
998 Ga0070711_100017979
999 Ga0070711_100046051
1000 Ga0070711_100072690
1001 Ga0070711_100099388
1002 Ga0070711_100140575
1003 Ga0070711_100610301
1004 Ga0070711_100746168
1005 Ga0070694_100271550
1006 Ga0070708_100000418
1007 Ga0070708_100001401
1008 Ga0070708_100002020
1009 Ga0070708_100016302
1010 Ga0070708_100044220
1011 Ga0070708_100044658
1012 Ga0070708_100095844
1013 Ga0070708_100163052
1014 Ga0070708_100164013
1015 Ga0070708_100625578
1016 Ga0070708_100962316
1017 Ga0070663_100010754
1018 Ga0070663_100047085
1019 Ga0070678_100022210
1020 Ga0070678_100054141
1021 Ga0070662_100003783
1022 Ga0070662_100023119
1023 Ga0070662_100071465
1024 Ga0070681_10115544
1025 Ga0070681_10535497
1026 Ga0070681_10570204
1027 Ga0070681_10723022
1028 Ga0068867_100011942
1029 Ga0068867_100065906
1030 Ga0070685_10005938
1031 Ga0070685_10146971
1032 Ga0070706_100000173
1033 Ga0070706_100001295
1034 Ga0070706_100013420
1035 Ga0070706_100018639
1036 Ga0070706_100060551
1037 Ga0070706_100511527
1038 Ga0070706_100538555
1039 Ga0070707_100000719
1040 Ga0070707_100002543
1041 Ga0070707_100012053
1042 Ga0070707_100057506
1043 Ga0070707_100057513
1044 Ga0070707_100297759
1045 Ga0070698_100000162
1046 Ga0070698_100007167
1047 Ga0070698_100128893
1048 Ga0070698_100136048
1049 Ga0070698_100166556
1050 Ga0070699_100001096
1051 Ga0070699_100002540
1052 Ga0070699_100004218
1053 Ga0070699_100012258
1054 Ga0070699_100048438
1055 Ga0070699_100096093
1056 Ga0070699_100158928
1057 Ga0070699_100592358
1058 Ga0070699_100625638
1059 Ga0070699_100752106
1060 Ga0070679_100256332
1061 Ga0070679_100322810
1062 Ga0070679_100978251
1063 Ga0070684_100006304
1064 Ga0070684_100160446
1065 Ga0070684_100820120
1066 Ga0070697_100000554
1067 Ga0070697_100000872
1068 Ga0070697_100001177
1069 Ga0070697_100001505
1070 Ga0070697_100002639
1071 Ga0070697_100024244
1072 Ga0070697_100174118
1073 Ga0070697_100212204
1074 Ga0068853_100016415
1075 Ga0068853_100035889
1076 Ga0068853_100035951
1077 Ga0070672_100019833
1078 Ga0070686_100030276
1079 Ga0070686_100062316
1080 Ga0070695_100161859
1081 Ga0070695_100572691
1082 Ga0070696_100308363
1083 Ga0070693_100117514
1084 Ga0070693_100256189
1085 Ga0070665_100384352
1086 Ga0068855_100028151
1087 Ga0068855_100082032
1088 Ga0068855_100826772
1089 Ga0068855_101094456
1090 Ga0070664_100012980
1091 Ga0070664_100017362
1092 Ga0070664_100173686
1093 Ga0068857_100002662
1094 Ga0068857_100060124
1095 Ga0068854_100009708
1096 Ga0068854_100460332
1097 Ga0068856_100019084
1098 Ga0068856_100034355
1099 Ga0068856_100035602
1100 Ga0068856_100060078
1101 Ga0068856_100060970
1102 Ga0068856_100096241
1103 Ga0070702_100138308
1104 Ga0068852_100006784
1105 Ga0068852_100015554
1106 Ga0068852_100116529
1107 Ga0068859_100037215
1108 Ga0068864_100203828
1109 Ga0068864_100462302
1110 Ga0068864_100987147
1111 Ga0068866_10001944
1112 Ga0068866_10326929
1113 Ga0068861_100009145
1114 Ga0068851_10006235
1115 Ga0068851_10017023
1116 Ga0068851_10029284
1117 Ga0068870_10012560
1118 Ga0068863_100084025
1119 Ga0068863_100112243
1120 Ga0068863_100169230
1121 Ga0068863_100335151
1122 Ga0068858_100018536
1123 Ga0068858_100818521
1124 Ga0068860_100033462
1125 Ga0068860_100286630
1126 Ga0068860_100462065
1127 Ga0068862_100024154
1128 Ga0068862_100125918
1129 Ga0070717_10000612
1130 Ga0070717_10000837
1131 Ga0070717_10001449
1132 Ga0070717_10005741
1133 Ga0070717_10024145
1134 Ga0070717_10045843
1135 Ga0070717_10137148
1136 Ga0070717_10146046
1137 Ga0070717_10147941
1138 Ga0070717_10224306
1139 Ga0070717_10252654
1140 Ga0070717_10496403
1141 Ga0070717_10743396
1142 Ga0070717_10984018
1143 Ga0070715_10090802
1144 Ga0070715_10095244
1145 Ga0070716_100000315
1146 Ga0070716_100002096
1147 Ga0070716_100014273
1148 Ga0070716_100037106
1149 Ga0070716_100042111
1150 Ga0070716_100092424
1151 Ga0070716_100097798
1152 Ga0070716_100120575
1153 Ga0070716_100191504
1154 Ga0070716_100281838
1155 Ga0070716_100339825
1156 Ga0070716_100449359
1157 Ga0070716_100530529
1158 Ga0070716_100880373
1159 Ga0070712_100000546
1160 Ga0070712_100002960
1161 Ga0070712_100003075
1162 Ga0070712_100005278
1163 Ga0070712_100031299
1164 Ga0070712_100061623
1165 Ga0070712_100233313
1166 Ga0070712_100464965
1167 Ga0070712_100505911
1168 Ga0070712_100635624
1169 Ga0070712_100709718
1170 Ga0097621_100008160
1171 Ga0097621_100190616
1172 Ga0097621_100327422
1173 Ga0097621_100404318
1174 Ga0097621_100610893
1175 Ga0068871_100007947
1176 Ga0068871_100040074
1177 Ga0068871_100188544
1178 Ga0068871_100256279
1179 Ga0068871_100488464
1180 Ga0075433_10001164
1181 Ga0075433_10001954
1182 Ga0075433_10572342
1183 Ga0075434_100000041
1184 Ga0075434_100002766
1185 Ga0075434_100008051
1186 Ga0068865_100032569
1187 Ga0068865_100296483
1188 Ga0075436_100000526
1189 Ga0075436_100006992
1190 Ga0075436_100016670
1191 Ga0075436_100070745
1192 Ga0075436_100277786
1193 Ga0075436_100734257
1194 Ga0097620_100037214
1195 Ga0075435_100000105
1196 Ga0075435_100023020
1197 Ga0075435_100037240
1198 Ga0075435_100347524
1199 Ga0075435_100552641
1200 Ga0099794_10008610
1201 Ga0099794_10111802
1202 Ga0099794_10168120
1203 Ga0099794_10236851
1204 Ga0099795_10036881
1205 Ga0099795_10101684
1206 Ga0105240_10074313
1207 Ga0105240_10181112
1208 Ga0105240_10256517
1209 Ga0105240_10263184
1210 Ga0105240_10593662
1211 Ga0105240_11617565
1212 Ga0105240_12166851
1213 Ga0105245_10030920
1214 Ga0105245_10140939
1215 Ga0105245_10165140
1216 Ga0105245_11021681
1217 Ga0105247_10006289
1218 Ga0105247_10026851
1219 Ga0105247_11103034
1220 Ga0114129_11407360
1221 Ga0105243_10058571
1222 Ga0105243_11199285
1223 Ga0105241_10000916
1224 Ga0105241_10013091
1225 Ga0105241_10241944
1226 Ga0105241_10328554
1227 Ga0105241_10736991
1228 Ga0105241_10748814
1229 Ga0105241_11130602
1230 Ga0105242_10068669
1231 Ga0105248_10010789
1232 Ga0105248_10070138
1233 Ga0105248_10610461
1234 Ga0105248_11216137
1235 Ga0105237_10062864
1236 Ga0105237_10617226
1237 Ga0105237_10785869
1238 Ga0105237_11087867
1239 Ga0105237_11755320
1240 Ga0105238_10030598
1241 Ga0105238_10091469
1242 Ga0105238_10278522
1243 Ga0105249_10011376
1244 Ga0105249_10033432
1245 Ga0105249_10118256
1246 Ga0105249_11371650
1247 Ga0105239_10117684
1248 Ga0105239_10460080
1249 Ga0105239_10691320
1250 Ga0105239_10768567
1251 Ga0105239_12520334
1252 Ga0105246_10009260
1253 Ga0105246_11729674
1254 Ga0157373_10000288
1255 Ga0157373_10004158
1256 Ga0157373_10112556
1257 Ga0157373_10207528
1258 Ga0157371_10031378
1259 Ga0157371_10271571
1260 Ga0157370_10045720
1261 Ga0157370_10085697
1262 Ga0157370_10677144
1263 Ga0157369_10008623
1264 Ga0157369_10032939
1265 Ga0157369_10048103
1266 Ga0157369_10102365
1267 Ga0157369_10119587
1268 Ga0157374_10014241
1269 Ga0157374_10049285
1270 Ga0157374_10053326
1271 Ga0157374_10186316
1272 Ga0157374_10224493
1273 Ga0157374_10288743
1274 Ga0157374_11001050
1275 Ga0157378_10010049
1276 Ga0157378_10103061
1277 Ga0157378_10310375
1278 Ga0163162_10029047
1279 Ga0163162_10294833
1280 Ga0163162_11370766
1281 Ga0157372_10015183
1282 Ga0157372_10015214
1283 Ga0157372_10072578
1284 Ga0157372_10076790
1285 Ga0157372_10242027
1286 Ga0157372_10428455
1287 Ga0157372_11143669
1288 Ga0157375_10027190
1289 Ga0163163_10007476
1290 Ga0163163_10011914
1291 Ga0163163_10020058
1292 Ga0163163_10022148
1293 Ga0182008_10019449
1294 Ga0182008_10107349
1295 Ga0157377_10001020
1296 Ga0157379_10007715
1297 Ga0157379_10014150
1298 Ga0157379_10653514
1299 Ga0157379_10692323
1300 Ga0157376_10009736
1301 Ga0157376_10017009
1302 Ga0157376_10035919
1303 Ga0157376_10397162
1304 Ga0157376_11458188
1305 Ga0182007_10005070
1306 Ga0182007_10103770
1307 Ga0182005_1009626
1308 Ga0163161_10019548
1309 Ga0184594_100472
1310 Ga0213873_10136317
1311 Ga0213874_10090537
1312 Ga0224570_100064
1313 Ga0224569_100403
1314 Ga0224571_102100
1315 Ga0224572_1005998
1316 Ga0224572_1018321
1317 Ga0228598_1000222
1318 Ga0228598_1000502
1319 Ga0228598_1000816
1320 Ga0228598_1027302
1321 Ga0228598_1041734
1322 Ga0207697_10007772
1323 Ga0207656_10037664
1324 Ga0207656_10211485
1325 Ga0207682_10029528
1326 Ga0207682_10416653
1327 Ga0207692_10006597
1328 Ga0207692_10068299
1329 Ga0207692_10089120
1330 Ga0207692_10325901
1331 Ga0207692_10391074
1332 Ga0207642_10104851
1333 Ga0207642_10386144
1334 Ga0207710_10348901
1335 Ga0207688_10145853
1336 Ga0207680_10015571
1337 Ga0207680_10663459
1338 Ga0207647_10003441
1339 Ga0207647_10085312
1340 Ga0207685_10040513
1341 Ga0207699_10001324
1342 Ga0207699_10015400
1343 Ga0207699_10020214
1344 Ga0207699_10058713
1345 Ga0207699_10060749
1346 Ga0207699_10061138
1347 Ga0207699_10094983
1348 Ga0207699_10264602
1349 Ga0207699_10362925
1350 Ga0207699_10446256
1351 Ga0207699_10656955
1352 Ga0207699_10767960
1353 Ga0207645_10000181
1354 Ga0207645_10019336
1355 Ga0207643_10001458
1356 Ga0207643_10109875
1357 Ga0207705_10045425
1358 Ga0207684_10000217
1359 Ga0207684_10000267
1360 Ga0207684_10004181
1361 Ga0207684_10498628
1362 Ga0207684_10779951
1363 Ga0207654_10006062
1364 Ga0207654_10055269
1365 Ga0207654_10058367
1366 Ga0207654_10092107
1367 Ga0207654_10166552
1368 Ga0207654_10246661
1369 Ga0207654_10548815
1370 Ga0207707_10015984
1371 Ga0207707_10175218
1372 Ga0207707_10470183
1373 Ga0207707_10510704
1374 Ga0207695_10027763
1375 Ga0207695_10064718
1376 Ga0207695_10299030
1377 Ga0207695_10307560
1378 Ga0207695_10545532
1379 Ga0207695_10905542
1380 Ga0207671_10122728
1381 Ga0207671_10125768
1382 Ga0207671_10537801
1383 Ga0207693_10000089
1384 Ga0207693_10000106
1385 Ga0207693_10009582
1386 Ga0207693_10013836
1387 Ga0207693_10029134
1388 Ga0207693_10075950
1389 Ga0207693_10209793
1390 Ga0207693_10286481
1391 Ga0207693_10374723
1392 Ga0207693_10761346
1393 Ga0207663_10002155
1394 Ga0207663_10059922
1395 Ga0207663_10079355
1396 Ga0207663_10085695
1397 Ga0207663_10124631
1398 Ga0207663_10160137
1399 Ga0207663_10320556
1400 Ga0207663_10788727
1401 Ga0207660_10379430
1402 Ga0207660_10761743
1403 Ga0207662_10026172
1404 Ga0207657_10000535
1405 Ga0207657_10001828
1406 Ga0207657_10010586
1407 Ga0207649_10000350
1408 Ga0207649_10020780
1409 Ga0207649_10114548
1410 Ga0207652_10144604
1411 Ga0207652_10471230
1412 Ga0207646_10000296
1413 Ga0207646_10001311
1414 Ga0207646_10095550
1415 Ga0207646_10132679
1416 Ga0207646_10209420
1417 Ga0207646_10272895
1418 Ga0207646_10300814
1419 Ga0207681_10079583
1420 Ga0207694_10144453
1421 Ga0207694_10182398
1422 Ga0207694_10502618
1423 Ga0207650_10000223
1424 Ga0207650_10140577
1425 Ga0207659_10007479
1426 Ga0207687_10018290
1427 Ga0207687_10077263
1428 Ga0207700_10000289
1429 Ga0207700_10000888
1430 Ga0207700_10025835
1431 Ga0207700_10030601
1432 Ga0207700_10077108
1433 Ga0207700_10153261
1434 Ga0207700_10161029
1435 Ga0207700_10255286
1436 Ga0207700_10263812
1437 Ga0207700_10301690
1438 Ga0207700_10517468
1439 Ga0207700_10618550
1440 Ga0207700_10657352
1441 Ga0207700_10737072
1442 Ga0207700_10845813
1443 Ga0207664_10000118
1444 Ga0207664_10022203
1445 Ga0207664_10141500
1446 Ga0207664_10191181
1447 Ga0207664_10234103
1448 Ga0207664_10320035
1449 Ga0207664_10332482
1450 Ga0207664_10550611
1451 Ga0207664_10650565
1452 Ga0207644_10011249
1453 Ga0207644_10049864
1454 Ga0207690_10029853
1455 Ga0207690_10387278
1456 Ga0207706_10000670
1457 Ga0207706_10009803
1458 Ga0207706_10014729
1459 Ga0207709_10108511
1460 Ga0207709_10823662
1461 Ga0207670_10015700
1462 Ga0207669_10863890
1463 Ga0207704_10067564
1464 Ga0207704_10176675
1465 Ga0207665_10001480
1466 Ga0207665_10001526
1467 Ga0207665_10008599
1468 Ga0207665_10044443
1469 Ga0207665_10079547
1470 Ga0207665_10138043
1471 Ga0207665_10229042
1472 Ga0207665_10255058
1473 Ga0207665_10317031
1474 Ga0207665_10347153
1475 Ga0207665_10347731
1476 Ga0207665_10883279
1477 Ga0207691_10000345
1478 Ga0207711_10029037
1479 Ga0207689_10000499
1480 Ga0207689_10076620
1481 Ga0207661_10059699
1482 Ga0207661_10125076
1483 Ga0207661_10357834
1484 Ga0207679_10000115
1485 Ga0207679_10192010
1486 Ga0207679_10250551
1487 Ga0207667_10040938
1488 Ga0207667_10246893
1489 Ga0207667_11555893
1490 Ga0207651_10003270
1491 Ga0207712_10030933
1492 Ga0207712_10141863
1493 Ga0207668_10029993
1494 Ga0207668_10780986
1495 Ga0207640_10154868
1496 Ga0207640_10416205
1497 Ga0207640_10595314
1498 Ga0207658_10018432
1499 Ga0207658_10385427
1500 Ga0207677_10016957
1501 Ga0207677_10033304
1502 Ga0207677_10368197
1503 Ga0207703_10020915
1504 Ga0207703_10221807
1505 Ga0207703_10261335
1506 Ga0207639_10028794
1507 Ga0207678_10000130
1508 Ga0207678_10001418
1509 Ga0207678_10105876
1510 Ga0207678_11605438
1511 Ga0207708_10088371
1512 Ga0207702_10002571
1513 Ga0207702_10023735
1514 Ga0207702_10109070
1515 Ga0207702_10257982
1516 Ga0207702_10291844
1517 Ga0207702_10622993
1518 Ga0207702_10627342
1519 Ga0207641_10000287
1520 Ga0207641_10233097
1521 Ga0207641_10648956
1522 Ga0207641_10830731
1523 Ga0207641_11057882
1524 Ga0207648_10001253
1525 Ga0207648_10031139
1526 Ga0207676_10019296
1527 Ga0207676_10156803
1528 Ga0207676_10433215
1529 Ga0207674_10020692
1530 Ga0207674_10025502
1531 Ga0207674_10027829
1532 Ga0207675_100008545
1533 Ga0207675_100147149
1534 Ga0207683_10000217
1535 Ga0207683_10028620
1536 Ga0207698_10057434
1537 Ga0207698_10102194
1538 Ga0207698_10249849
1539 Ga0265354_1004182
1540 Ga0265356_1000336
1541 Ga0265356_1010488
1542 Ga0265357_1018582
1543 Ga0268266_10008412
1544 Ga0268266_10575144
1545 Ga0268266_10937589
1546 Ga0268266_11726430
1547 Ga0268265_10044706
1548 Ga0268265_10048037
1549 Ga0268265_10450156
1550 Ga0268264_10025038
1551 Ga0268264_10029486
1552 Ga0268264_10077395
1553 Ga0268264_10814500
1554 Ga0265336_10044137
1555 Ga0265338_10010626
1556 Ga0265338_10012546
1557 Ga0265338_10173197
1558 Ga0265762_1002825
1559 Ga0265762_1013435
1560 Ga0265762_1020484
1561 Ga0265775_103190
1562 Ga0265767_101478
1563 Ga0265770_1003844
1564 Ga0265770_1015093
1565 Ga0265770_1085108
1566 Ga0265765_1009051
1567 Ga0265771_1003369
1568 Ga0265760_10000331
1569 Ga0265760_10001481
1570 Ga0265760_10081793
1571 Ga0265760_10092507
1572 Ga0265325_10010836
1573 Ga0265325_10086051
1574 Ga0265340_10078248
1575 Ga0265340_10160945
1576 Ga0265339_10015242
1577 Ga0265339_10068251
1578 Ga0265339_10161471
1579 Ga0265316_10019190
1580 Ga0265316_10568181
1581 Ga0265314_10114275
1582 Ga0265342_10160925
1583 Ga0307416_100551502
1584 Ga0316214_1007710
1585 Ga0373930_0127190
1586 Ga0373958_0017263
1587 Ga0373938_0015032
1588 Ga0373926_0028857
1589 Ga0373926_0042062
1590 Ga0373926_0145879
1591 Ga0373934_0039992
1592 Ga0373944_0047625
1593 Ga0373944_0200346
1594 Ga0373944_0245320
1595 Ga0373923_0018059
1596 Ga0373932_0170061
1597 Ga0373932_0212282
1598 Ga0373936_0000966
1599 Ga0373936_0006441
1600 Ga0373953_0010005
1601 Ga0373954_0078263
1602 Ga0373956_0008841
1603 Ga0373956_0138998
1604 Ga0373957_0017150
1605 Ga0373957_0027426
1606 Ga0373957_0132135
1607 Ga0373960_0075450
1608 Ga0373943_0000054
1609 Ga0373943_0083341
1610 Ga0373946_0010120
1611 Ga0373955_0028331
1612 Ga0373955_0066887
1613 Ga0373955_0093625
1614 Ga0373955_0182572
1615 Ga0373924_0016533
1616 Ga0373924_0023333
1617 Ga0373931_0658721
1618 Ga0373935_0004095
1619 Ga0373935_0022633
1620 Ga0373935_0031111
1621 Ga0373935_0116917
1622 Ga0373935_0151497
1623 Ga0373927_0082280
1624 Ga0373927_0136218
1625 Ga0373927_0273549
1626 Ga0373927_0275384
1627 Ga0373927_0293803
1628 Ga0373927_0463003
1629 Ga0373927_0569314
1630 Ga0373927_0908407
1631 Ga0373933_0014246
1632 Ga0373933_0045238
1633 Ga0373933_0100682
1634 Ga0373933_0253078
1635 Ga0373933_0309111
1636 Ga0373933_0576410
1637 Ga0373933_0828794
1638 Ga0373947_0000496
1639 Ga0373947_0014673
1640 Ga0373947_0156647
1641 Ga0373937_0041215
1642 Ga0373937_0058242
1643 Ga0373937_0218937
1644 Ga0373937_0356387
1645 Ga0373937_0401786
1646 Ga0373937_0516119
1647 Ga0373937_0623515
1648 Ga0373937_0793375
1649 Ga0373925_0003546
1650 Ga0373925_0018652
1651 Ga0373925_0141462
1652 Ga0373925_0234518
1653 Ga0373925_0239178
1654 Ga0373925_0542925
1655 Ga0373925_0733739
1656 Ga0395900_0930063
1657 Ga0395905_0745593
1658 Ga0436363_0310747
1659 Ga0436363_0859048
1660 Ga0436363_1703454
1661 Ga0436362_0242382
1662 Ga0466963_0510293
1663 Ga0466964_0091790
1664 Ga0466964_0369952
1665 Ga0466968_0362720
1666 Ga0451576_0109127
1667 Ga0451576_2472999
1668 Ga0466967_0075951
1669 Ga0466967_0274981
1670 Ga0495592_0651313
1671 Ga0495603_0089785
1672 Ga0495629_0104434
1673 Ga0495629_0247385
1674 Ga0495651_0136996
1675 Ga0495580_0000031
1676 Ga0495580_0004216
1677 Ga0495580_0009626
1678 Ga0495580_0018579
1679 Ga0495580_0019658
1680 Ga0495580_0028922
1681 Ga0495580_0171239
1682 Ga0495580_0177389
1683 Ga0495580_0239685
1684 Ga0495580_0600474
1685 Ga0495582_0015585
1686 Ga0495584_0018151
1687 Ga0495594_0030407
1688 Ga0495628_0476723
1689 Ga0495630_0050881
1690 Ga0495630_0230553
1691 Ga0495630_0427477
1692 Ga0495630_0658930
1693 Ga0495665_0025377
1694 Ga0495665_0192774
1695 Ga0495640_0240644
1696 Ga0495587_0604013
1697 Ga0495645_0147033
1698 Ga0495645_0402031
1699 Ga0495634_0388071
1700 Ga0495635_0614387
1701 Ga0495588_0052053
1702 Ga0495657_0204630
1703 Ga0495657_0654267
1704 Ga0495623_0053862
1705 Ga0495647_0028580
1706 Ga0495669_0041066
1707 Ga0495669_0274918
1708 Ga0495613_0122679
1709 Ga0495624_0086185
1710 Ga0495624_0580882
1711 Ga0495600_0180149
1712 Ga0495600_0227709
1713 Ga0495674_0080360
1714 Ga0495674_0085250
1715 Ga0495593_0221085
1716 Ga0495593_0289991
1717 Ga0495602_0042006
1718 Ga0495602_0126933
1719 Ga0495602_0194576
1720 Ga0495602_0308844
1721 Ga0495602_0938898
1722 Ga0496100_0009722
1723 Ga0496100_0668647
1724 Ga0496100_0947093
1725 Ga0496101_0019851
1726 Ga0496101_0029423
1727 Ga0496101_0178095
1728 Ga0496101_0210240
1729 Ga0496102_0001424
1730 Ga0496102_0032128
1731 Ga0496102_0092665
1732 Ga0496102_0116975
1733 Ga0496102_0153647
1734 Ga0496102_0322922
1735 Ga0496102_0586833
1736 Ga0496102_0852891
1737 Ga0496102_1197648
1738 Ga0496103_0004119
1739 Ga0496103_0022334
1740 Ga0496103_0137789
1741 Ga0496103_0160422
1742 Ga0496104_0157280
1743 Ga0496104_0172435
1744 Ga0496104_0220356
1745 Ga0496104_0315597
1746 Ga0496106_0056741
1747 Ga0496106_0068846
1748 Ga0496106_0083711
1749 Ga0496106_0181273
1750 Ga0496107_0052688
1751 Ga0496107_0069126
1752 Ga0496108_0020285
1753 Ga0496108_0043628
1754 Ga0496109_0000117
1755 Ga0496109_0054749
1756 Ga0496109_0106106
1757 Ga0496109_0446946
1758 Ga0496110_0004256
1759 Ga0496110_0012731
1760 Ga0496110_0115435
1761 Ga0496111_0009763
1762 Ga0496111_0076767
1763 Ga0496112_0000283
1764 Ga0496112_0069112
1765 Ga0496112_0081816
1766 Ga0496112_0114302
1767 Ga0496112_0249986
1768 Ga0496112_0341521
1769 Ga0496112_0610245
1770 Ga0496112_0756931
1771 Ga0496112_1386136
1772 Ga0496113_0002193
1773 Ga0496113_0024930
1774 Ga0496115_0003148
1775 Ga0496115_0009800
1776 Ga0496115_0191279
1777 nmdc:mga0n895_10187_c1
1778 nmdc:mga0n895_15801_c1
1779 nmdc:mga0n895_47_c1
1780 nmdc:mga0n895_539906_c1
1781 nmdc:mga0rr50_317270_c1
1782 nmdc:mga0rr50_421_c1
1783 nmdc:mga0rr50_71996_c1
1784 nmdc:mga0rr50_7786_c1
1785 nmdc:mga0rr50_839055_c1
1786 nmdc:mga08x19_1461_c1
1787 nmdc:mga08x19_184697_c1
1788 nmdc:mga08x19_298231_c1
1789 nmdc:mga08x19_601136_c1
1790 nmdc:mga08x19_751368_c1
1791 nmdc:mga08x19_8169_c1
1792 nmdc:mga0a205_223264_c1
1793 nmdc:mga0a205_378_c1
1794 Ga0495601_0778046
1795 Ga0495612_0349153
1796 Ga0495612_0438881
1797 Ga0495595_0053173
1798 Ga0495619_0075971
1799 Ga0495619_0197349
1800 Ga0495619_0739838

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04509

CheC

CheC-like family

100

134

0.93

PF13690

CheX

Chemotaxis phosphatase CheX

58

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8766 1 150
1squ-assembly1.cif.gz_A structural genomics, crystal structure of the chex protein from thermotoga maritima 0.8579 1 151
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8504 1 150
1squ-assembly1.cif.gz_A structural genomics, crystal structure of the chex protein from thermotoga maritima 0.8474 1 151
3hzh-assembly1.cif.gz_B crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi 0.8464 6 151
ID Description Score Start End Superfamily
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8353 3 150 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8294 1 151 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8196 1 151 3.40.1550.10
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8093 3 150 3.40.1550.10
3hzhB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.7988 6 151 3.40.1550.10
ID Description Score Start End GO Terms
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.9818 1 149 GO:0006935
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.969 1 149 GO:0006935
AF-A0A1Y2T7J3-F1-model_v4 Chemotaxis protein 0.941 1 119 GO:0006935
AF-A0A1Y2T7J3-F1-model_v4 Chemotaxis protein 0.9335 1 119 GO:0006935
AF-A0A353BHD7-F1-model_v4 Chemotaxis protein CheX 0.9279 1 154 GO:0006935

Map