F484968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 358 | 1790 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100005905|Ga0070697_1000059053 |
| Length | 147 |
| Sequence | MSTYFPKEGEIARKWYVVDASGQTLGRLASRVARVLMGKENPKYTPFIDTGDHVIVINAEKLKITGNSKPEAKKYQHYTGYPGGLRTEDFRKRFARKPELVVEEAVSRMLPKTRMGKQMFTKLKVYRGEKHPHQAQKPEAKVLEARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.73 |
| Metatranscriptomes | 9.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.03 |
| Rhizosphere | 92.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070697_100005905 | 3300005536 | Bacteria | 9451 |
| 2 | JGI24752J21851_1000333 | 3300001976 | Bacteria | 6577 |
| 3 | JGI24747J21853_1011667 | 3300001978 | Unclassified | 891 |
| 4 | JGI24737J22298_10128303 | 3300001990 | Unclassified | 749 |
| 5 | JGI24033J26618_1001119 | 3300002155 | Bacteria | 2604 |
| 6 | JGI24034J26672_10000133 | 3300002239 | Bacteria | 10958 |
| 7 | JGI24751J29686_10000539 | 3300002459 | Bacteria | 10617 |
| 8 | Ga0058863_11853307 | 3300004799 | Bacteria | 725 |
| 9 | Ga0058861_10015203 | 3300004800 | Bacteria | 696 |
| 10 | Ga0058861_10049083 | 3300004800 | Bacteria | 2743 |
| 11 | Ga0058860_10119967 | 3300004801 | Bacteria | 927 |
| 12 | Ga0058860_12152757 | 3300004801 | Bacteria | 581 |
| 13 | Ga0058860_12189591 | 3300004801 | Bacteria | 2063 |
| 14 | Ga0058862_10110909 | 3300004803 | Bacteria | 946 |
| 15 | Ga0058862_12265877 | 3300004803 | Unclassified | 588 |
| 16 | Ga0065712_10223510 | 3300005290 | Bacteria | 1033 |
| 17 | Ga0065715_10090978 | 3300005293 | Bacteria | 6252 |
| 18 | Ga0065707_10357863 | 3300005295 | Bacteria | 908 |
| 19 | Ga0070658_10834688 | 3300005327 | Bacteria | 801 |
| 20 | Ga0070676_10021768 | 3300005328 | Bacteria | 3591 |
| 21 | Ga0070676_10426347 | 3300005328 | Bacteria | 928 |
| 22 | Ga0070683_100056338 | 3300005329 | Bacteria | 3650 |
| 23 | Ga0070683_100182436 | 3300005329 | Bacteria | 1992 |
| 24 | Ga0070683_100395675 | 3300005329 | Unclassified | 1317 |
| 25 | Ga0070683_100436446 | 3300005329 | Bacteria | 1249 |
| 26 | Ga0070683_100916513 | 3300005329 | Bacteria | 841 |
| 27 | Ga0070683_101638090 | 3300005329 | Bacteria | 619 |
| 28 | Ga0070690_100000645 | 3300005330 | Bacteria | 17757 |
| 29 | Ga0070690_100287955 | 3300005330 | Bacteria | 1174 |
| 30 | Ga0070690_100865613 | 3300005330 | Bacteria | 705 |
| 31 | Ga0070670_100020546 | 3300005331 | Bacteria | 5678 |
| 32 | Ga0070670_100236661 | 3300005331 | Unclassified | 1589 |
| 33 | Ga0070670_100602059 | 3300005331 | Bacteria | 983 |
| 34 | Ga0068869_100001094 | 3300005334 | Bacteria | 15789 |
| 35 | Ga0068869_100001760 | 3300005334 | Bacteria | 12948 |
| 36 | Ga0070666_10019039 | 3300005335 | Bacteria | 4426 |
| 37 | Ga0070680_100358718 | 3300005336 | Bacteria | 1240 |
| 38 | Ga0070680_100385368 | 3300005336 | Bacteria | 1194 |
| 39 | Ga0070682_100059337 | 3300005337 | Bacteria | 2416 |
| 40 | Ga0070682_100094571 | 3300005337 | Bacteria | 1961 |
| 41 | Ga0070682_100193715 | 3300005337 | Bacteria | 1429 |
| 42 | Ga0068868_100006426 | 3300005338 | Bacteria | 8319 |
| 43 | Ga0068868_100015558 | 3300005338 | Bacteria | 5630 |
| 44 | Ga0068868_100018165 | 3300005338 | Bacteria | 5252 |
| 45 | Ga0068868_100036777 | 3300005338 | Bacteria | 3792 |
| 46 | Ga0068868_100327449 | 3300005338 | Bacteria | 1307 |
| 47 | Ga0070660_100037871 | 3300005339 | Bacteria | 3657 |
| 48 | Ga0070660_100162305 | 3300005339 | Bacteria | 1801 |
| 49 | Ga0070691_10089501 | 3300005341 | Bacteria | 1516 |
| 50 | Ga0070687_100440275 | 3300005343 | Bacteria | 864 |
| 51 | Ga0070687_100651952 | 3300005343 | Unclassified | 730 |
| 52 | Ga0070661_100048767 | 3300005344 | Bacteria | 3100 |
| 53 | Ga0070661_100130869 | 3300005344 | Bacteria | 1884 |
| 54 | Ga0070661_100928088 | 3300005344 | Unclassified | 719 |
| 55 | Ga0070692_10129252 | 3300005345 | Bacteria | 1418 |
| 56 | Ga0070668_100013356 | 3300005347 | Bacteria | 6128 |
| 57 | Ga0070668_100257077 | 3300005347 | Bacteria | 1451 |
| 58 | Ga0070669_100176130 | 3300005353 | Bacteria | 1670 |
| 59 | Ga0070669_101108216 | 3300005353 | Bacteria | 682 |
| 60 | Ga0070675_100004860 | 3300005354 | Bacteria | 10255 |
| 61 | Ga0070674_100003003 | 3300005356 | Bacteria | 9379 |
| 62 | Ga0070673_100062794 | 3300005364 | Bacteria | 2953 |
| 63 | Ga0070673_100243730 | 3300005364 | Bacteria | 1564 |
| 64 | Ga0070673_101171178 | 3300005364 | Bacteria | 719 |
| 65 | Ga0070688_100000522 | 3300005365 | Bacteria | 19426 |
| 66 | Ga0070688_100803696 | 3300005365 | Bacteria | 736 |
| 67 | Ga0070659_100005680 | 3300005366 | Bacteria | 8973 |
| 68 | Ga0070659_100394481 | 3300005366 | Bacteria | 1167 |
| 69 | Ga0070659_100646368 | 3300005366 | Bacteria | 912 |
| 70 | Ga0070667_100974782 | 3300005367 | Bacteria | 791 |
| 71 | Ga0070709_10034970 | 3300005434 | Bacteria | 3050 |
| 72 | Ga0070709_10065330 | 3300005434 | Bacteria | 2329 |
| 73 | Ga0070709_10069429 | 3300005434 | Bacteria | 2269 |
| 74 | Ga0070709_10086705 | 3300005434 | Bacteria | 2056 |
| 75 | Ga0070709_10161936 | 3300005434 | Bacteria | 1557 |
| 76 | Ga0070709_10169313 | 3300005434 | Bacteria | 1525 |
| 77 | Ga0070709_10404528 | 3300005434 | Bacteria | 1020 |
| 78 | Ga0070709_10418305 | 3300005434 | Bacteria | 1004 |
| 79 | Ga0070709_10449155 | 3300005434 | Bacteria | 971 |
| 80 | Ga0070714_100011365 | 3300005435 | Bacteria | 7063 |
| 81 | Ga0070714_100136370 | 3300005435 | Bacteria | 2198 |
| 82 | Ga0070714_100180346 | 3300005435 | Bacteria | 1921 |
| 83 | Ga0070714_100300752 | 3300005435 | Bacteria | 1496 |
| 84 | Ga0070714_100372638 | 3300005435 | Bacteria | 1344 |
| 85 | Ga0070714_100472161 | 3300005435 | Unclassified | 1194 |
| 86 | Ga0070714_100544404 | 3300005435 | Bacteria | 1111 |
| 87 | Ga0070714_100620325 | 3300005435 | Bacteria | 1040 |
| 88 | Ga0070714_100797588 | 3300005435 | Bacteria | 914 |
| 89 | Ga0070714_100832231 | 3300005435 | Unclassified | 895 |
| 90 | Ga0070714_101208436 | 3300005435 | Unclassified | 737 |
| 91 | Ga0070714_101340621 | 3300005435 | Bacteria | 698 |
| 92 | Ga0070713_100001466 | 3300005436 | Bacteria | 15072 |
| 93 | Ga0070713_100039322 | 3300005436 | Bacteria | 3838 |
| 94 | Ga0070713_100087851 | 3300005436 | Bacteria | 2667 |
| 95 | Ga0070713_100110484 | 3300005436 | Bacteria | 2396 |
| 96 | Ga0070713_100300995 | 3300005436 | Bacteria | 1476 |
| 97 | Ga0070713_100333025 | 3300005436 | Bacteria | 1405 |
| 98 | Ga0070713_100361455 | 3300005436 | Bacteria | 1349 |
| 99 | Ga0070713_100479556 | 3300005436 | Unclassified | 1171 |
| 100 | Ga0070713_100504859 | 3300005436 | Unclassified | 1141 |
| 101 | Ga0070713_100533891 | 3300005436 | Bacteria | 1109 |
| 102 | Ga0070710_10058048 | 3300005437 | Bacteria | 2194 |
| 103 | Ga0070710_10062029 | 3300005437 | Unclassified | 2131 |
| 104 | Ga0070710_10098188 | 3300005437 | Bacteria | 1740 |
| 105 | Ga0070710_10280919 | 3300005437 | Bacteria | 1080 |
| 106 | Ga0070710_10449083 | 3300005437 | Unclassified | 873 |
| 107 | Ga0070710_10828366 | 3300005437 | Bacteria | 663 |
| 108 | Ga0070710_11269993 | 3300005437 | Unclassified | 546 |
| 109 | Ga0070701_10757998 | 3300005438 | Bacteria | 658 |
| 110 | Ga0070711_100068504 | 3300005439 | Bacteria | 2493 |
| 111 | Ga0070711_100090051 | 3300005439 | Bacteria | 2208 |
| 112 | Ga0070711_100106142 | 3300005439 | Bacteria | 2053 |
| 113 | Ga0070711_100466480 | 3300005439 | Unclassified | 1036 |
| 114 | Ga0070711_100494487 | 3300005439 | Bacteria | 1007 |
| 115 | Ga0070705_100352680 | 3300005440 | Bacteria | 1073 |
| 116 | Ga0070694_100939755 | 3300005444 | Unclassified | 715 |
| 117 | Ga0070708_100003211 | 3300005445 | Bacteria | 12753 |
| 118 | Ga0070708_100026764 | 3300005445 | Bacteria | 4940 |
| 119 | Ga0070708_100042187 | 3300005445 | Bacteria | 4003 |
| 120 | Ga0070708_100045643 | 3300005445 | Bacteria | 3862 |
| 121 | Ga0070708_100168513 | 3300005445 | Bacteria | 2043 |
| 122 | Ga0070708_100245148 | 3300005445 | Bacteria | 1683 |
| 123 | Ga0070708_100423014 | 3300005445 | Bacteria | 1256 |
| 124 | Ga0070708_100471271 | 3300005445 | Unclassified | 1185 |
| 125 | Ga0070708_102128403 | 3300005445 | Unclassified | 519 |
| 126 | Ga0070663_101261915 | 3300005455 | Bacteria | 651 |
| 127 | Ga0070678_100445424 | 3300005456 | Bacteria | 1133 |
| 128 | Ga0070662_100034763 | 3300005457 | Bacteria | 3556 |
| 129 | Ga0070662_100105700 | 3300005457 | Bacteria | 2137 |
| 130 | Ga0070681_10016298 | 3300005458 | Bacteria | 7415 |
| 131 | Ga0068867_100001206 | 3300005459 | Bacteria | 17752 |
| 132 | Ga0068867_100012190 | 3300005459 | Bacteria | 6075 |
| 133 | Ga0068867_100140125 | 3300005459 | Bacteria | 1889 |
| 134 | Ga0070685_10005214 | 3300005466 | Bacteria | 6592 |
| 135 | Ga0070685_10107190 | 3300005466 | Bacteria | 1716 |
| 136 | Ga0070706_100001345 | 3300005467 | Bacteria | 26134 |
| 137 | Ga0070706_100262845 | 3300005467 | Bacteria | 1611 |
| 138 | Ga0070706_100277396 | 3300005467 | Bacteria | 1564 |
| 139 | Ga0070706_100982022 | 3300005467 | Bacteria | 779 |
| 140 | Ga0070706_101133809 | 3300005467 | Bacteria | 719 |
| 141 | Ga0070707_100013995 | 3300005468 | Bacteria | 7518 |
| 142 | Ga0070707_100066666 | 3300005468 | Bacteria | 3460 |
| 143 | Ga0070707_100252127 | 3300005468 | Bacteria | 1718 |
| 144 | Ga0070707_100272459 | 3300005468 | Bacteria | 1645 |
| 145 | Ga0070707_100297076 | 3300005468 | Bacteria | 1569 |
| 146 | Ga0070707_100380369 | 3300005468 | Bacteria | 1371 |
| 147 | Ga0070698_100000247 | 3300005471 | Bacteria | 54164 |
| 148 | Ga0070698_100445342 | 3300005471 | Unclassified | 1231 |
| 149 | Ga0070698_100656032 | 3300005471 | Unclassified | 991 |
| 150 | Ga0070698_100988112 | 3300005471 | Bacteria | 789 |
| 151 | Ga0070698_101071558 | 3300005471 | Bacteria | 754 |
| 152 | Ga0070699_100007000 | 3300005518 | Bacteria | 9800 |
| 153 | Ga0070699_100138983 | 3300005518 | Bacteria | 2144 |
| 154 | Ga0070699_100775072 | 3300005518 | Bacteria | 877 |
| 155 | Ga0070699_100948630 | 3300005518 | Unclassified | 788 |
| 156 | Ga0070679_100021464 | 3300005530 | Bacteria | 6305 |
| 157 | Ga0070679_100126928 | 3300005530 | Bacteria | 2533 |
| 158 | Ga0070679_100353145 | 3300005530 | Bacteria | 1418 |
| 159 | Ga0070679_100848819 | 3300005530 | Bacteria | 856 |
| 160 | Ga0070679_100961009 | 3300005530 | Bacteria | 798 |
| 161 | Ga0070684_100008449 | 3300005535 | Bacteria | 8049 |
| 162 | Ga0070684_100098068 | 3300005535 | Bacteria | 2614 |
| 163 | Ga0070697_100049641 | 3300005536 | Bacteria | 3406 |
| 164 | Ga0070697_100180037 | 3300005536 | Bacteria | 1792 |
| 165 | Ga0070697_100548507 | 3300005536 | Bacteria | 1013 |
| 166 | Ga0070697_100679535 | 3300005536 | Bacteria | 908 |
| 167 | Ga0070697_101365523 | 3300005536 | Unclassified | 632 |
| 168 | Ga0070697_101467189 | 3300005536 | Unclassified | 609 |
| 169 | Ga0068853_100007972 | 3300005539 | Bacteria | 8492 |
| 170 | Ga0068853_100274267 | 3300005539 | Bacteria | 1553 |
| 171 | Ga0068853_100387206 | 3300005539 | Bacteria | 1306 |
| 172 | Ga0068853_101860995 | 3300005539 | Bacteria | 583 |
| 173 | Ga0070672_100004674 | 3300005543 | Bacteria | 8978 |
| 174 | Ga0070672_100589020 | 3300005543 | Bacteria | 968 |
| 175 | Ga0070686_100003553 | 3300005544 | Bacteria | 8553 |
| 176 | Ga0070686_100291272 | 3300005544 | Bacteria | 1208 |
| 177 | Ga0070686_100456180 | 3300005544 | Bacteria | 984 |
| 178 | Ga0070695_100117342 | 3300005545 | Bacteria | 1816 |
| 179 | Ga0070695_100573138 | 3300005545 | Bacteria | 883 |
| 180 | Ga0070696_100031418 | 3300005546 | Bacteria | 3639 |
| 181 | Ga0070696_100236839 | 3300005546 | Bacteria | 1375 |
| 182 | Ga0070696_100335823 | 3300005546 | Bacteria | 1167 |
| 183 | Ga0070693_100197419 | 3300005547 | Bacteria | 1305 |
| 184 | Ga0070693_100247737 | 3300005547 | Bacteria | 1180 |
| 185 | Ga0070693_100891233 | 3300005547 | Bacteria | 666 |
| 186 | Ga0070704_100158377 | 3300005549 | Bacteria | 1788 |
| 187 | Ga0070704_100586745 | 3300005549 | Bacteria | 978 |
| 188 | Ga0068855_100000412 | 3300005563 | Bacteria | 52997 |
| 189 | Ga0068855_100000425 | 3300005563 | Bacteria | 52146 |
| 190 | Ga0068855_100012802 | 3300005563 | Bacteria | 10119 |
| 191 | Ga0068855_100099127 | 3300005563 | Bacteria | 3356 |
| 192 | Ga0068855_100210684 | 3300005563 | Bacteria | 2184 |
| 193 | Ga0068855_100364125 | 3300005563 | Bacteria | 1590 |
| 194 | Ga0068855_100609554 | 3300005563 | Bacteria | 1176 |
| 195 | Ga0068855_101100407 | 3300005563 | Bacteria | 831 |
| 196 | Ga0070664_100002954 | 3300005564 | Bacteria | 13751 |
| 197 | Ga0070664_100036049 | 3300005564 | Bacteria | 4154 |
| 198 | Ga0068857_100000880 | 3300005577 | Bacteria | 22656 |
| 199 | Ga0068857_101781311 | 3300005577 | Bacteria | 602 |
| 200 | Ga0068854_100281361 | 3300005578 | Bacteria | 1339 |
| 201 | Ga0068854_100320533 | 3300005578 | Bacteria | 1259 |
| 202 | Ga0068856_100000708 | 3300005614 | Bacteria | 36263 |
| 203 | Ga0068856_100009508 | 3300005614 | Bacteria | 9442 |
| 204 | Ga0068856_100011409 | 3300005614 | Bacteria | 8619 |
| 205 | Ga0068856_100026004 | 3300005614 | Bacteria | 5708 |
| 206 | Ga0068856_100119825 | 3300005614 | Bacteria | 2633 |
| 207 | Ga0068856_100313851 | 3300005614 | Bacteria | 1585 |
| 208 | Ga0068856_100377141 | 3300005614 | Bacteria | 1437 |
| 209 | Ga0070702_100003657 | 3300005615 | Bacteria | 6921 |
| 210 | Ga0070702_100075663 | 3300005615 | Bacteria | 2002 |
| 211 | Ga0068852_100004983 | 3300005616 | Bacteria | 9447 |
| 212 | Ga0068852_101235354 | 3300005616 | Bacteria | 768 |
| 213 | Ga0068859_100009521 | 3300005617 | Bacteria | 9810 |
| 214 | Ga0068859_100014277 | 3300005617 | Bacteria | 7965 |
| 215 | Ga0068859_100716740 | 3300005617 | Unclassified | 1090 |
| 216 | Ga0068864_100011951 | 3300005618 | Bacteria | 7167 |
| 217 | Ga0068864_100596428 | 3300005618 | Bacteria | 1071 |
| 218 | Ga0068864_101717425 | 3300005618 | Unclassified | 632 |
| 219 | Ga0068864_101717426 | 3300005618 | Bacteria | 632 |
| 220 | Ga0068866_10002761 | 3300005718 | Bacteria | 7238 |
| 221 | Ga0068861_101903618 | 3300005719 | Bacteria | 592 |
| 222 | Ga0068851_10000421 | 3300005834 | Bacteria | 18905 |
| 223 | Ga0068851_10074283 | 3300005834 | Bacteria | 1764 |
| 224 | Ga0068870_10001091 | 3300005840 | Bacteria | 10776 |
| 225 | Ga0068863_100021683 | 3300005841 | Bacteria | 6127 |
| 226 | Ga0068863_100029237 | 3300005841 | Bacteria | 5261 |
| 227 | Ga0068863_100030476 | 3300005841 | Bacteria | 5150 |
| 228 | Ga0068863_100135782 | 3300005841 | Bacteria | 2350 |
| 229 | Ga0068863_100755211 | 3300005841 | Bacteria | 969 |
| 230 | Ga0068858_100006453 | 3300005842 | Bacteria | 11420 |
| 231 | Ga0068858_100089425 | 3300005842 | Bacteria | 2865 |
| 232 | Ga0068858_100315659 | 3300005842 | Bacteria | 1493 |
| 233 | Ga0068858_101082742 | 3300005842 | Bacteria | 787 |
| 234 | Ga0068860_100521295 | 3300005843 | Bacteria | 1188 |
| 235 | Ga0068860_100620718 | 3300005843 | Bacteria | 1088 |
| 236 | Ga0068862_100107179 | 3300005844 | Bacteria | 2450 |
| 237 | Ga0081455_10065203 | 3300005937 | Bacteria | 3047 |
| 238 | Ga0070717_10008717 | 3300006028 | Bacteria | 7586 |
| 239 | Ga0070717_10019045 | 3300006028 | Bacteria | 5376 |
| 240 | Ga0070717_10030041 | 3300006028 | Bacteria | 4365 |
| 241 | Ga0070717_10033607 | 3300006028 | Bacteria | 4138 |
| 242 | Ga0070717_10060143 | 3300006028 | Bacteria | 3145 |
| 243 | Ga0070717_10067657 | 3300006028 | Bacteria | 2972 |
| 244 | Ga0070717_10088146 | 3300006028 | Bacteria | 2615 |
| 245 | Ga0070717_10134805 | 3300006028 | Bacteria | 2126 |
| 246 | Ga0070717_10364703 | 3300006028 | Bacteria | 1294 |
| 247 | Ga0070717_10440243 | 3300006028 | Bacteria | 1174 |
| 248 | Ga0070717_10640809 | 3300006028 | Bacteria | 964 |
| 249 | Ga0070717_11287724 | 3300006028 | Bacteria | 665 |
| 250 | Ga0070715_10653777 | 3300006163 | Bacteria | 623 |
| 251 | Ga0070716_100000337 | 3300006173 | Bacteria | 18968 |
| 252 | Ga0070716_100079952 | 3300006173 | Bacteria | 1948 |
| 253 | Ga0070716_100168265 | 3300006173 | Bacteria | 1428 |
| 254 | Ga0070716_100245736 | 3300006173 | Unclassified | 1216 |
| 255 | Ga0070716_100298334 | 3300006173 | Bacteria | 1120 |
| 256 | Ga0070716_100306097 | 3300006173 | Bacteria | 1107 |
| 257 | Ga0070716_100306257 | 3300006173 | Unclassified | 1107 |
| 258 | Ga0070716_100309238 | 3300006173 | Bacteria | 1103 |
| 259 | Ga0070716_100334886 | 3300006173 | Bacteria | 1065 |
| 260 | Ga0070716_100416571 | 3300006173 | Bacteria | 970 |
| 261 | Ga0070716_100529254 | 3300006173 | Bacteria | 875 |
| 262 | Ga0070712_100024231 | 3300006175 | Bacteria | 4018 |
| 263 | Ga0070712_100044371 | 3300006175 | Bacteria | 3065 |
| 264 | Ga0070712_100198333 | 3300006175 | Bacteria | 1575 |
| 265 | Ga0070712_100210610 | 3300006175 | Bacteria | 1532 |
| 266 | Ga0070712_100333047 | 3300006175 | Bacteria | 1237 |
| 267 | Ga0070712_100856901 | 3300006175 | Unclassified | 782 |
| 268 | Ga0097621_100001137 | 3300006237 | Bacteria | 18447 |
| 269 | Ga0097621_100002010 | 3300006237 | Bacteria | 13891 |
| 270 | Ga0097621_100028973 | 3300006237 | Bacteria | 4370 |
| 271 | Ga0097621_100343215 | 3300006237 | Bacteria | 1326 |
| 272 | Ga0068871_100004576 | 3300006358 | Bacteria | 9646 |
| 273 | Ga0068871_100005383 | 3300006358 | Bacteria | 8968 |
| 274 | Ga0068871_100039234 | 3300006358 | Bacteria | 3788 |
| 275 | Ga0068871_100382482 | 3300006358 | Bacteria | 1250 |
| 276 | Ga0068871_101473243 | 3300006358 | Bacteria | 643 |
| 277 | Ga0075433_10112609 | 3300006852 | Bacteria | 2414 |
| 278 | Ga0075434_100000969 | 3300006871 | Bacteria | 23145 |
| 279 | Ga0075434_101060960 | 3300006871 | Bacteria | 824 |
| 280 | Ga0075436_100000214 | 3300006914 | Bacteria | 35630 |
| 281 | Ga0075436_100000264 | 3300006914 | Bacteria | 32917 |
| 282 | Ga0075436_100047256 | 3300006914 | Unclassified | 2968 |
| 283 | Ga0075436_100063714 | 3300006914 | Unclassified | 2548 |
| 284 | Ga0097620_100009520 | 3300006931 | Bacteria | 9810 |
| 285 | Ga0097620_100014277 | 3300006931 | Bacteria | 7965 |
| 286 | Ga0097620_100716721 | 3300006931 | Unclassified | 1090 |
| 287 | Ga0075435_100006235 | 3300007076 | Bacteria | 8420 |
| 288 | Ga0075435_100061766 | 3300007076 | Bacteria | 3040 |
| 289 | Ga0075435_100237372 | 3300007076 | Bacteria | 1550 |
| 290 | Ga0075435_100307168 | 3300007076 | Bacteria | 1357 |
| 291 | Ga0075435_101193465 | 3300007076 | Unclassified | 666 |
| 292 | Ga0099794_10210383 | 3300007265 | Bacteria | 997 |
| 293 | Ga0099794_10317271 | 3300007265 | Bacteria | 808 |
| 294 | Ga0105250_10040512 | 3300009092 | Bacteria | 1868 |
| 295 | Ga0105240_10092584 | 3300009093 | Bacteria | 3691 |
| 296 | Ga0105240_10311254 | 3300009093 | Bacteria | 1798 |
| 297 | Ga0105240_10672217 | 3300009093 | Bacteria | 1133 |
| 298 | Ga0105240_10744806 | 3300009093 | Bacteria | 1066 |
| 299 | Ga0105240_11149948 | 3300009093 | Unclassified | 824 |
| 300 | Ga0105245_10003216 | 3300009098 | Bacteria | 14629 |
| 301 | Ga0105245_10011809 | 3300009098 | Bacteria | 7596 |
| 302 | Ga0105245_10145589 | 3300009098 | Bacteria | 2235 |
| 303 | Ga0105245_10388126 | 3300009098 | Bacteria | 1392 |
| 304 | Ga0105245_10722596 | 3300009098 | Bacteria | 1030 |
| 305 | Ga0105245_11505017 | 3300009098 | Bacteria | 724 |
| 306 | Ga0105247_10216564 | 3300009101 | Bacteria | 1294 |
| 307 | Ga0114129_10028282 | 3300009147 | Bacteria | 7943 |
| 308 | Ga0105241_10002278 | 3300009174 | Bacteria | 14426 |
| 309 | Ga0105241_10004801 | 3300009174 | Bacteria | 9955 |
| 310 | Ga0105241_10014672 | 3300009174 | Bacteria | 5735 |
| 311 | Ga0105241_10060423 | 3300009174 | Bacteria | 2916 |
| 312 | Ga0105241_10527586 | 3300009174 | Unclassified | 1057 |
| 313 | Ga0105242_10012662 | 3300009176 | Bacteria | 6496 |
| 314 | Ga0105242_11694290 | 3300009176 | Bacteria | 668 |
| 315 | Ga0105248_10007505 | 3300009177 | Bacteria | 11963 |
| 316 | Ga0105248_10011516 | 3300009177 | Bacteria | 9746 |
| 317 | Ga0105248_10098938 | 3300009177 | Bacteria | 3286 |
| 318 | Ga0105237_10011869 | 3300009545 | Bacteria | 9211 |
| 319 | Ga0105237_10046489 | 3300009545 | Unclassified | 4365 |
| 320 | Ga0105237_10051917 | 3300009545 | Bacteria | 4118 |
| 321 | Ga0105237_10093516 | 3300009545 | Bacteria | 2996 |
| 322 | Ga0105237_10626567 | 3300009545 | Bacteria | 1082 |
| 323 | Ga0105237_11086132 | 3300009545 | Bacteria | 807 |
| 324 | Ga0105237_11462330 | 3300009545 | Bacteria | 690 |
| 325 | Ga0105237_11665693 | 3300009545 | Bacteria | 645 |
| 326 | Ga0105238_10068820 | 3300009551 | Bacteria | 3541 |
| 327 | Ga0105238_10144555 | 3300009551 | Bacteria | 2355 |
| 328 | Ga0105238_10244559 | 3300009551 | Bacteria | 1772 |
| 329 | Ga0105238_10574837 | 3300009551 | Bacteria | 1133 |
| 330 | Ga0105249_10003703 | 3300009553 | Bacteria | 13185 |
| 331 | Ga0105249_10052936 | 3300009553 | Bacteria | 3709 |
| 332 | Ga0105249_11278890 | 3300009553 | Bacteria | 805 |
| 333 | Ga0099796_10532096 | 3300010159 | Bacteria | 528 |
| 334 | Ga0105239_10007920 | 3300010375 | Bacteria | 12147 |
| 335 | Ga0105239_10071004 | 3300010375 | Bacteria | 3825 |
| 336 | Ga0105239_10104774 | 3300010375 | Bacteria | 3132 |
| 337 | Ga0105239_10596993 | 3300010375 | Bacteria | 1259 |
| 338 | Ga0105246_10003185 | 3300011119 | Bacteria | 9972 |
| 339 | Ga0105246_10162164 | 3300011119 | Bacteria | 1704 |
| 340 | Ga0105246_10533408 | 3300011119 | Bacteria | 1003 |
| 341 | Ga0157373_10002194 | 3300013100 | Bacteria | 14779 |
| 342 | Ga0157373_10009640 | 3300013100 | Bacteria | 7127 |
| 343 | Ga0157373_10049350 | 3300013100 | Bacteria | 2999 |
| 344 | Ga0157373_10580315 | 3300013100 | Unclassified | 815 |
| 345 | Ga0157371_10004049 | 3300013102 | Bacteria | 12967 |
| 346 | Ga0157371_10186589 | 3300013102 | Bacteria | 1484 |
| 347 | Ga0157370_10054686 | 3300013104 | Bacteria | 3805 |
| 348 | Ga0157370_10091584 | 3300013104 | Bacteria | 2854 |
| 349 | Ga0157370_10393107 | 3300013104 | Bacteria | 1277 |
| 350 | Ga0157369_10023516 | 3300013105 | Bacteria | 6863 |
| 351 | Ga0157369_10023791 | 3300013105 | Bacteria | 6821 |
| 352 | Ga0157369_10032560 | 3300013105 | Bacteria | 5732 |
| 353 | Ga0157369_10057681 | 3300013105 | Bacteria | 4188 |
| 354 | Ga0157369_10062178 | 3300013105 | Bacteria | 4024 |
| 355 | Ga0157369_10198505 | 3300013105 | Bacteria | 2106 |
| 356 | Ga0157369_10279877 | 3300013105 | Bacteria | 1737 |
| 357 | Ga0157374_10001270 | 3300013296 | Bacteria | 21533 |
| 358 | Ga0157374_10002015 | 3300013296 | Bacteria | 17048 |
| 359 | Ga0157374_10002450 | 3300013296 | Bacteria | 15672 |
| 360 | Ga0157374_10029651 | 3300013296 | Bacteria | 4958 |
| 361 | Ga0157374_10340742 | 3300013296 | Bacteria | 1488 |
| 362 | Ga0157378_10000014 | 3300013297 | Bacteria | 144214 |
| 363 | Ga0157378_10006923 | 3300013297 | Bacteria | 9901 |
| 364 | Ga0157378_10089002 | 3300013297 | Bacteria | 2803 |
| 365 | Ga0157378_10215593 | 3300013297 | Bacteria | 1822 |
| 366 | Ga0157378_10265843 | 3300013297 | Bacteria | 1647 |
| 367 | Ga0163162_10061611 | 3300013306 | Bacteria | 3789 |
| 368 | Ga0163162_10240262 | 3300013306 | Unclassified | 1942 |
| 369 | Ga0163162_10291770 | 3300013306 | Bacteria | 1763 |
| 370 | Ga0163162_10306178 | 3300013306 | Bacteria | 1721 |
| 371 | Ga0163162_11570111 | 3300013306 | Bacteria | 750 |
| 372 | Ga0157372_10000641 | 3300013307 | Bacteria | 38393 |
| 373 | Ga0157372_10001892 | 3300013307 | Bacteria | 22713 |
| 374 | Ga0157372_10006851 | 3300013307 | Bacteria | 12126 |
| 375 | Ga0157372_10007257 | 3300013307 | Bacteria | 11801 |
| 376 | Ga0157372_10012316 | 3300013307 | Bacteria | 9114 |
| 377 | Ga0157372_10013531 | 3300013307 | Bacteria | 8719 |
| 378 | Ga0157372_10105242 | 3300013307 | Bacteria | 3227 |
| 379 | Ga0157372_10204060 | 3300013307 | Bacteria | 2290 |
| 380 | Ga0157372_10349991 | 3300013307 | Bacteria | 1721 |
| 381 | Ga0157372_10359310 | 3300013307 | Bacteria | 1697 |
| 382 | Ga0157375_10085013 | 3300013308 | Bacteria | 3213 |
| 383 | Ga0163163_10054270 | 3300014325 | Bacteria | 3959 |
| 384 | Ga0163163_10085695 | 3300014325 | Bacteria | 3158 |
| 385 | Ga0163163_10137842 | 3300014325 | Bacteria | 2481 |
| 386 | Ga0182008_10005969 | 3300014497 | Bacteria | 6865 |
| 387 | Ga0157377_10000286 | 3300014745 | Bacteria | 24143 |
| 388 | Ga0157377_10129718 | 3300014745 | Bacteria | 1538 |
| 389 | Ga0157379_10001394 | 3300014968 | Bacteria | 19786 |
| 390 | Ga0157379_10151934 | 3300014968 | Bacteria | 2088 |
| 391 | Ga0157379_10552304 | 3300014968 | Unclassified | 1072 |
| 392 | Ga0157379_12095781 | 3300014968 | Bacteria | 560 |
| 393 | Ga0157376_10347294 | 3300014969 | Unclassified | 1419 |
| 394 | Ga0157376_10478619 | 3300014969 | Bacteria | 1220 |
| 395 | Ga0157376_11165087 | 3300014969 | Bacteria | 798 |
| 396 | Ga0157376_11435259 | 3300014969 | Bacteria | 722 |
| 397 | Ga0157376_11864836 | 3300014969 | Unclassified | 638 |
| 398 | Ga0182006_1013304 | 3300015261 | Bacteria | 3573 |
| 399 | Ga0182007_10004030 | 3300015262 | Bacteria | 6776 |
| 400 | Ga0182005_1008788 | 3300015265 | Bacteria | 2966 |
| 401 | Ga0182005_1091612 | 3300015265 | Bacteria | 846 |
| 402 | Ga0163161_10001313 | 3300017792 | Bacteria | 18509 |
| 403 | Ga0197907_10259388 | 3300020069 | Bacteria | 1065 |
| 404 | Ga0197907_10379982 | 3300020069 | Unclassified | 655 |
| 405 | Ga0197907_10393248 | 3300020069 | Unclassified | 587 |
| 406 | Ga0206356_10280488 | 3300020070 | Bacteria | 2190 |
| 407 | Ga0206356_10496279 | 3300020070 | Bacteria | 1514 |
| 408 | Ga0206356_10746760 | 3300020070 | Bacteria | 762 |
| 409 | Ga0206356_11322473 | 3300020070 | Bacteria | 1528 |
| 410 | Ga0206356_11595700 | 3300020070 | Bacteria | 800 |
| 411 | Ga0206355_1205801 | 3300020076 | Unclassified | 712 |
| 412 | Ga0206355_1611145 | 3300020076 | Bacteria | 658 |
| 413 | Ga0206355_1710675 | 3300020076 | Bacteria | 1172 |
| 414 | Ga0206352_10099029 | 3300020078 | Bacteria | 674 |
| 415 | Ga0206352_10361514 | 3300020078 | Unclassified | 722 |
| 416 | Ga0206352_10379723 | 3300020078 | Unclassified | 560 |
| 417 | Ga0206352_10719253 | 3300020078 | Unclassified | 555 |
| 418 | Ga0206354_11155912 | 3300020081 | Unclassified | 632 |
| 419 | Ga0206353_10767450 | 3300020082 | Bacteria | 714 |
| 420 | Ga0213873_10014036 | 3300021358 | Bacteria | 1769 |
| 421 | Ga0213876_10257589 | 3300021384 | Unclassified | 927 |
| 422 | Ga0213871_10009484 | 3300021441 | Bacteria | 2182 |
| 423 | Ga0224712_10078995 | 3300022467 | Bacteria | 1354 |
| 424 | Ga0207656_10013653 | 3300025321 | Bacteria | 3110 |
| 425 | Ga0207656_10106029 | 3300025321 | Bacteria | 1293 |
| 426 | Ga0207696_1077647 | 3300025711 | Bacteria | 919 |
| 427 | Ga0207682_10010286 | 3300025893 | Bacteria | 3668 |
| 428 | Ga0207692_10066191 | 3300025898 | Bacteria | 1888 |
| 429 | Ga0207692_10067532 | 3300025898 | Bacteria | 1872 |
| 430 | Ga0207692_10093378 | 3300025898 | Bacteria | 1636 |
| 431 | Ga0207692_10273878 | 3300025898 | Bacteria | 1019 |
| 432 | Ga0207692_10354351 | 3300025898 | Unclassified | 905 |
| 433 | Ga0207710_10250204 | 3300025900 | Bacteria | 886 |
| 434 | Ga0207688_10014322 | 3300025901 | Bacteria | 4315 |
| 435 | Ga0207688_10135995 | 3300025901 | Bacteria | 1443 |
| 436 | Ga0207680_10004156 | 3300025903 | Bacteria | 6855 |
| 437 | Ga0207647_10001732 | 3300025904 | Bacteria | 16729 |
| 438 | Ga0207647_10002148 | 3300025904 | Bacteria | 15069 |
| 439 | Ga0207647_10163554 | 3300025904 | Bacteria | 1297 |
| 440 | Ga0207685_10010190 | 3300025905 | Unclassified | 2763 |
| 441 | Ga0207699_10017946 | 3300025906 | Bacteria | 3740 |
| 442 | Ga0207699_10126345 | 3300025906 | Bacteria | 1661 |
| 443 | Ga0207699_10154341 | 3300025906 | Bacteria | 1522 |
| 444 | Ga0207699_10248565 | 3300025906 | Unclassified | 1225 |
| 445 | Ga0207699_10269209 | 3300025906 | Bacteria | 1180 |
| 446 | Ga0207645_10000781 | 3300025907 | Bacteria | 26560 |
| 447 | Ga0207645_10683589 | 3300025907 | Bacteria | 697 |
| 448 | Ga0207643_10000331 | 3300025908 | Bacteria | 32383 |
| 449 | Ga0207643_10184219 | 3300025908 | Unclassified | 1265 |
| 450 | Ga0207705_10626657 | 3300025909 | Bacteria | 836 |
| 451 | Ga0207684_10000762 | 3300025910 | Bacteria | 37545 |
| 452 | Ga0207684_10410442 | 3300025910 | Unclassified | 1164 |
| 453 | Ga0207684_10481758 | 3300025910 | Bacteria | 1064 |
| 454 | Ga0207684_10581587 | 3300025910 | Bacteria | 957 |
| 455 | Ga0207684_10651965 | 3300025910 | Unclassified | 897 |
| 456 | Ga0207654_10058438 | 3300025911 | Bacteria | 2245 |
| 457 | Ga0207654_10136954 | 3300025911 | Bacteria | 1557 |
| 458 | Ga0207654_10633626 | 3300025911 | Bacteria | 765 |
| 459 | Ga0207707_10988062 | 3300025912 | Bacteria | 691 |
| 460 | Ga0207695_10025321 | 3300025913 | Bacteria | 6646 |
| 461 | Ga0207695_10046026 | 3300025913 | Unclassified | 4625 |
| 462 | Ga0207695_10091917 | 3300025913 | Bacteria | 3047 |
| 463 | Ga0207695_10296569 | 3300025913 | Bacteria | 1508 |
| 464 | Ga0207695_10749816 | 3300025913 | Bacteria | 857 |
| 465 | Ga0207695_11046992 | 3300025913 | Unclassified | 696 |
| 466 | Ga0207671_10211809 | 3300025914 | Bacteria | 1516 |
| 467 | Ga0207671_10256894 | 3300025914 | Bacteria | 1374 |
| 468 | Ga0207671_10283383 | 3300025914 | Bacteria | 1307 |
| 469 | Ga0207671_10625564 | 3300025914 | Bacteria | 858 |
| 470 | Ga0207671_10873400 | 3300025914 | Bacteria | 712 |
| 471 | Ga0207693_10056154 | 3300025915 | Bacteria | 3087 |
| 472 | Ga0207693_10136241 | 3300025915 | Bacteria | 1930 |
| 473 | Ga0207693_10161169 | 3300025915 | Bacteria | 1765 |
| 474 | Ga0207693_10395412 | 3300025915 | Bacteria | 1081 |
| 475 | Ga0207693_10871599 | 3300025915 | Unclassified | 692 |
| 476 | Ga0207693_10876502 | 3300025915 | Unclassified | 689 |
| 477 | Ga0207693_10941769 | 3300025915 | Unclassified | 661 |
| 478 | Ga0207663_10034935 | 3300025916 | Bacteria | 3011 |
| 479 | Ga0207663_10082926 | 3300025916 | Bacteria | 2105 |
| 480 | Ga0207663_10228003 | 3300025916 | Bacteria | 1359 |
| 481 | Ga0207663_10318813 | 3300025916 | Bacteria | 1167 |
| 482 | Ga0207663_11065462 | 3300025916 | Bacteria | 649 |
| 483 | Ga0207660_10684316 | 3300025917 | Bacteria | 837 |
| 484 | Ga0207662_10007837 | 3300025918 | Bacteria | 5819 |
| 485 | Ga0207662_11094865 | 3300025918 | Bacteria | 566 |
| 486 | Ga0207657_10000311 | 3300025919 | Bacteria | 51649 |
| 487 | Ga0207657_10001224 | 3300025919 | Bacteria | 27379 |
| 488 | Ga0207657_10726467 | 3300025919 | Unclassified | 770 |
| 489 | Ga0207649_10002645 | 3300025920 | Bacteria | 9951 |
| 490 | Ga0207649_10091645 | 3300025920 | Bacteria | 1991 |
| 491 | Ga0207649_10728825 | 3300025920 | Bacteria | 770 |
| 492 | Ga0207652_10053021 | 3300025921 | Bacteria | 3483 |
| 493 | Ga0207646_10000334 | 3300025922 | Bacteria | 63767 |
| 494 | Ga0207646_10169662 | 3300025922 | Bacteria | 1970 |
| 495 | Ga0207646_10188153 | 3300025922 | Bacteria | 1865 |
| 496 | Ga0207646_10246739 | 3300025922 | Bacteria | 1613 |
| 497 | Ga0207646_10574927 | 3300025922 | Bacteria | 1012 |
| 498 | Ga0207646_10717185 | 3300025922 | Bacteria | 894 |
| 499 | Ga0207681_10004446 | 3300025923 | Bacteria | 8628 |
| 500 | Ga0207694_10002449 | 3300025924 | Bacteria | 15136 |
| 501 | Ga0207694_10546176 | 3300025924 | Bacteria | 972 |
| 502 | Ga0207650_10000063 | 3300025925 | Bacteria | 146432 |
| 503 | Ga0207650_10130610 | 3300025925 | Bacteria | 1965 |
| 504 | Ga0207687_10118281 | 3300025927 | Bacteria | 1978 |
| 505 | Ga0207687_10277891 | 3300025927 | Bacteria | 1341 |
| 506 | Ga0207700_10006336 | 3300025928 | Bacteria | 7137 |
| 507 | Ga0207700_10023136 | 3300025928 | Bacteria | 4278 |
| 508 | Ga0207700_10036103 | 3300025928 | Bacteria | 3566 |
| 509 | Ga0207700_10194008 | 3300025928 | Bacteria | 1708 |
| 510 | Ga0207700_10212322 | 3300025928 | Bacteria | 1637 |
| 511 | Ga0207700_10233495 | 3300025928 | Unclassified | 1565 |
| 512 | Ga0207700_10246318 | 3300025928 | Bacteria | 1525 |
| 513 | Ga0207700_10249726 | 3300025928 | Bacteria | 1515 |
| 514 | Ga0207700_11964968 | 3300025928 | Unclassified | 511 |
| 515 | Ga0207664_10017981 | 3300025929 | Bacteria | 5194 |
| 516 | Ga0207664_10237584 | 3300025929 | Bacteria | 1586 |
| 517 | Ga0207664_10353084 | 3300025929 | Bacteria | 1302 |
| 518 | Ga0207664_10600581 | 3300025929 | Unclassified | 988 |
| 519 | Ga0207664_10605678 | 3300025929 | Unclassified | 984 |
| 520 | Ga0207664_10632236 | 3300025929 | Bacteria | 962 |
| 521 | Ga0207664_10853600 | 3300025929 | Bacteria | 818 |
| 522 | Ga0207664_11264284 | 3300025929 | Bacteria | 657 |
| 523 | Ga0207664_11483107 | 3300025929 | Unclassified | 600 |
| 524 | Ga0207644_10046541 | 3300025931 | Bacteria | 3092 |
| 525 | Ga0207644_10159473 | 3300025931 | Bacteria | 1752 |
| 526 | Ga0207706_10001937 | 3300025933 | Bacteria | 20312 |
| 527 | Ga0207706_10011223 | 3300025933 | Bacteria | 8169 |
| 528 | Ga0207706_10188964 | 3300025933 | Bacteria | 1808 |
| 529 | Ga0207686_10031774 | 3300025934 | Bacteria | 3137 |
| 530 | Ga0207669_10155811 | 3300025937 | Bacteria | 1606 |
| 531 | Ga0207704_10051107 | 3300025938 | Bacteria | 2497 |
| 532 | Ga0207665_10000109 | 3300025939 | Bacteria | 53830 |
| 533 | Ga0207665_10018023 | 3300025939 | Bacteria | 4639 |
| 534 | Ga0207665_10163066 | 3300025939 | Unclassified | 1605 |
| 535 | Ga0207665_10177682 | 3300025939 | Bacteria | 1540 |
| 536 | Ga0207665_10326866 | 3300025939 | Bacteria | 1152 |
| 537 | Ga0207665_10342508 | 3300025939 | Unclassified | 1127 |
| 538 | Ga0207665_10406511 | 3300025939 | Bacteria | 1038 |
| 539 | Ga0207665_11041113 | 3300025939 | Bacteria | 652 |
| 540 | Ga0207691_10001123 | 3300025940 | Bacteria | 26596 |
| 541 | Ga0207691_10947800 | 3300025940 | Bacteria | 719 |
| 542 | Ga0207711_10008464 | 3300025941 | Bacteria | 8606 |
| 543 | Ga0207711_10071456 | 3300025941 | Bacteria | 3011 |
| 544 | Ga0207711_11283896 | 3300025941 | Bacteria | 674 |
| 545 | Ga0207711_11614070 | 3300025941 | Bacteria | 592 |
| 546 | Ga0207711_11943020 | 3300025941 | Bacteria | 531 |
| 547 | Ga0207689_10000788 | 3300025942 | Bacteria | 30435 |
| 548 | Ga0207689_10001298 | 3300025942 | Bacteria | 24081 |
| 549 | Ga0207689_10338529 | 3300025942 | Bacteria | 1250 |
| 550 | Ga0207661_10000156 | 3300025944 | Bacteria | 43880 |
| 551 | Ga0207661_10394330 | 3300025944 | Bacteria | 1254 |
| 552 | Ga0207661_11519669 | 3300025944 | Bacteria | 613 |
| 553 | Ga0207679_10000588 | 3300025945 | Bacteria | 24327 |
| 554 | Ga0207679_10019528 | 3300025945 | Bacteria | 4554 |
| 555 | Ga0207679_10042347 | 3300025945 | Bacteria | 3272 |
| 556 | Ga0207667_10000311 | 3300025949 | Bacteria | 67671 |
| 557 | Ga0207667_10002505 | 3300025949 | Bacteria | 22903 |
| 558 | Ga0207667_10039985 | 3300025949 | Bacteria | 4993 |
| 559 | Ga0207667_10065378 | 3300025949 | Bacteria | 3793 |
| 560 | Ga0207667_10177848 | 3300025949 | Bacteria | 2185 |
| 561 | Ga0207667_10208343 | 3300025949 | Bacteria | 2004 |
| 562 | Ga0207667_10357656 | 3300025949 | Bacteria | 1489 |
| 563 | Ga0207667_10578464 | 3300025949 | Bacteria | 1134 |
| 564 | Ga0207667_10657295 | 3300025949 | Bacteria | 1053 |
| 565 | Ga0207651_10013008 | 3300025960 | Bacteria | 4740 |
| 566 | Ga0207651_10145880 | 3300025960 | Bacteria | 1835 |
| 567 | Ga0207712_10004653 | 3300025961 | Bacteria | 8671 |
| 568 | Ga0207712_10908271 | 3300025961 | Bacteria | 778 |
| 569 | Ga0207668_10037181 | 3300025972 | Bacteria | 3256 |
| 570 | Ga0207668_10426863 | 3300025972 | Bacteria | 1126 |
| 571 | Ga0207640_10032417 | 3300025981 | Bacteria | 3240 |
| 572 | Ga0207640_10033382 | 3300025981 | Bacteria | 3202 |
| 573 | Ga0207640_10311812 | 3300025981 | Bacteria | 1249 |
| 574 | Ga0207640_10910510 | 3300025981 | Bacteria | 769 |
| 575 | Ga0207658_10007747 | 3300025986 | Bacteria | 7320 |
| 576 | Ga0207658_10218856 | 3300025986 | Bacteria | 1601 |
| 577 | Ga0207658_10799344 | 3300025986 | Bacteria | 856 |
| 578 | Ga0207677_10010740 | 3300026023 | Bacteria | 5190 |
| 579 | Ga0207677_10013130 | 3300026023 | Bacteria | 4788 |
| 580 | Ga0207677_10054589 | 3300026023 | Bacteria | 2727 |
| 581 | Ga0207677_10138460 | 3300026023 | Bacteria | 1860 |
| 582 | Ga0207677_10403739 | 3300026023 | Bacteria | 1159 |
| 583 | Ga0207703_10024629 | 3300026035 | Bacteria | 4734 |
| 584 | Ga0207703_10048979 | 3300026035 | Bacteria | 3414 |
| 585 | Ga0207703_10071441 | 3300026035 | Bacteria | 2867 |
| 586 | Ga0207703_10140315 | 3300026035 | Bacteria | 2096 |
| 587 | Ga0207703_10187592 | 3300026035 | Bacteria | 1829 |
| 588 | Ga0207639_10087303 | 3300026041 | Bacteria | 2486 |
| 589 | Ga0207639_10113851 | 3300026041 | Bacteria | 2210 |
| 590 | Ga0207639_10339503 | 3300026041 | Bacteria | 1339 |
| 591 | Ga0207639_10379256 | 3300026041 | Unclassified | 1269 |
| 592 | Ga0207678_10000443 | 3300026067 | Bacteria | 37711 |
| 593 | Ga0207678_10088544 | 3300026067 | Bacteria | 2646 |
| 594 | Ga0207702_10001803 | 3300026078 | Bacteria | 21088 |
| 595 | Ga0207702_10005756 | 3300026078 | Bacteria | 10785 |
| 596 | Ga0207702_10016352 | 3300026078 | Bacteria | 6142 |
| 597 | Ga0207702_10032318 | 3300026078 | Bacteria | 4366 |
| 598 | Ga0207702_10041367 | 3300026078 | Bacteria | 3865 |
| 599 | Ga0207702_10178860 | 3300026078 | Bacteria | 1952 |
| 600 | Ga0207702_10427422 | 3300026078 | Bacteria | 1282 |
| 601 | Ga0207702_11149992 | 3300026078 | Bacteria | 770 |
| 602 | Ga0207641_10000131 | 3300026088 | Bacteria | 110151 |
| 603 | Ga0207641_10024496 | 3300026088 | Bacteria | 4974 |
| 604 | Ga0207641_10031853 | 3300026088 | Bacteria | 4375 |
| 605 | Ga0207641_10071138 | 3300026088 | Bacteria | 2991 |
| 606 | Ga0207648_10000403 | 3300026089 | Bacteria | 48140 |
| 607 | Ga0207648_10025447 | 3300026089 | Bacteria | 5271 |
| 608 | Ga0207648_10150047 | 3300026089 | Bacteria | 2056 |
| 609 | Ga0207676_10000517 | 3300026095 | Bacteria | 32477 |
| 610 | Ga0207676_10002019 | 3300026095 | Bacteria | 14768 |
| 611 | Ga0207676_10191353 | 3300026095 | Unclassified | 1800 |
| 612 | Ga0207674_10000201 | 3300026116 | Bacteria | 74066 |
| 613 | Ga0207674_10043108 | 3300026116 | Bacteria | 4654 |
| 614 | Ga0207674_10440206 | 3300026116 | Bacteria | 1260 |
| 615 | Ga0207675_100020759 | 3300026118 | Bacteria | 6124 |
| 616 | Ga0207675_100131080 | 3300026118 | Bacteria | 2377 |
| 617 | Ga0207683_10000848 | 3300026121 | Bacteria | 28069 |
| 618 | Ga0207683_10243550 | 3300026121 | Bacteria | 1640 |
| 619 | Ga0207698_10193022 | 3300026142 | Bacteria | 1816 |
| 620 | Ga0207698_10330550 | 3300026142 | Unclassified | 1432 |
| 621 | Ga0268266_10002994 | 3300028379 | Bacteria | 17410 |
| 622 | Ga0268265_10001656 | 3300028380 | Bacteria | 18220 |
| 623 | Ga0268265_10083198 | 3300028380 | Bacteria | 2533 |
| 624 | Ga0268265_10280575 | 3300028380 | Bacteria | 1490 |
| 625 | Ga0268264_10007655 | 3300028381 | Bacteria | 9003 |
| 626 | Ga0268264_10011067 | 3300028381 | Bacteria | 7451 |
| 627 | Ga0268264_11918980 | 3300028381 | Bacteria | 602 |
| 628 | Ga0265338_10036611 | 3300028800 | Bacteria | 4692 |
| 629 | Ga0265338_10374675 | 3300028800 | Bacteria | 1019 |
| 630 | Ga0265324_10069415 | 3300029957 | Bacteria | 1201 |
| 631 | Ga0265328_10009410 | 3300031239 | Bacteria | 3982 |
| 632 | Ga0265340_10381627 | 3300031247 | Unclassified | 622 |
| 633 | Ga0265339_10021469 | 3300031249 | Bacteria | 3756 |
| 634 | Ga0265316_10132755 | 3300031344 | Bacteria | 1874 |
| 635 | Ga0265314_10044113 | 3300031711 | Bacteria | 3163 |
| 636 | Ga0265314_10082356 | 3300031711 | Bacteria | 2117 |
| 637 | Ga0265314_10120725 | 3300031711 | Bacteria | 1650 |
| 638 | Ga0265342_10392731 | 3300031712 | Bacteria | 717 |
| 639 | Ga0316596_1170269 | 3300033541 | Bacteria | 601 |
| 640 | Ga0316214_1023552 | 3300033545 | Bacteria | 866 |
| 641 | Ga0373926_0012789 | 3300035083 | Bacteria | 2840 |
| 642 | Ga0373926_0138165 | 3300035083 | Bacteria | 925 |
| 643 | Ga0373940_0080937 | 3300035088 | Bacteria | 960 |
| 644 | Ga0373923_0229584 | 3300035111 | Bacteria | 864 |
| 645 | Ga0373923_0424996 | 3300035111 | Unclassified | 642 |
| 646 | Ga0373932_0170126 | 3300035112 | Bacteria | 759 |
| 647 | Ga0373932_0211556 | 3300035112 | Bacteria | 693 |
| 648 | Ga0373936_0053999 | 3300035113 | Bacteria | 1629 |
| 649 | Ga0373936_0055321 | 3300035113 | Bacteria | 1611 |
| 650 | Ga0373936_0204904 | 3300035113 | Unclassified | 871 |
| 651 | Ga0373945_0045030 | 3300035116 | Bacteria | 1606 |
| 652 | Ga0373945_0396151 | 3300035116 | Bacteria | 604 |
| 653 | Ga0373954_0027583 | 3300035118 | Bacteria | 2608 |
| 654 | Ga0373960_0003592 | 3300035121 | Bacteria | 3515 |
| 655 | Ga0373960_0048433 | 3300035121 | Bacteria | 1254 |
| 656 | Ga0373943_0007494 | 3300035170 | Bacteria | 4902 |
| 657 | Ga0373943_0049591 | 3300035170 | Bacteria | 2061 |
| 658 | Ga0373943_0138718 | 3300035170 | Bacteria | 1308 |
| 659 | Ga0373946_0021343 | 3300035171 | Bacteria | 2511 |
| 660 | Ga0373946_0626938 | 3300035171 | Bacteria | 559 |
| 661 | Ga0316574_0660618 | 3300035398 | Bacteria | 643 |
| 662 | Ga0373931_0313469 | 3300035691 | Bacteria | 972 |
| 663 | Ga0373931_0355362 | 3300035691 | Bacteria | 918 |
| 664 | Ga0373935_0074198 | 3300035692 | Bacteria | 2199 |
| 665 | Ga0373935_0164212 | 3300035692 | Unclassified | 1515 |
| 666 | Ga0373935_0302885 | 3300035692 | Bacteria | 1130 |
| 667 | Ga0373927_0018456 | 3300035695 | Unclassified | 4585 |
| 668 | Ga0373927_0107053 | 3300035695 | Bacteria | 1821 |
| 669 | Ga0373927_0189028 | 3300035695 | Bacteria | 1351 |
| 670 | Ga0373933_0052829 | 3300035724 | Bacteria | 2432 |
| 671 | Ga0373933_0926142 | 3300035724 | Bacteria | 574 |
| 672 | Ga0373947_0002434 | 3300035725 | Bacteria | 11218 |
| 673 | Ga0373947_0056623 | 3300035725 | Unclassified | 2370 |
| 674 | Ga0373947_0642519 | 3300035725 | Unclassified | 723 |
| 675 | Ga0373937_0422066 | 3300036401 | Bacteria | 1266 |
| 676 | Ga0373925_0002805 | 3300037068 | Bacteria | 13763 |
| 677 | Ga0373925_0027712 | 3300037068 | Bacteria | 4147 |
| 678 | Ga0373925_0042592 | 3300037068 | Bacteria | 3368 |
| 679 | Ga0373925_0071289 | 3300037068 | Bacteria | 2628 |
| 680 | Ga0373925_0406952 | 3300037068 | Unclassified | 1110 |
| 681 | Ga0373925_0888453 | 3300037068 | Unclassified | 734 |
| 682 | Ga0436365_0211838 | 3300039437 | Unclassified | 1519 |
| 683 | Ga0436365_1140187 | 3300039437 | Bacteria | 1385 |
| 684 | Ga0436360_1315790 | 3300039438 | Bacteria | 2253 |
| 685 | Ga0436363_0762804 | 3300039450 | Bacteria | 19321 |
| 686 | Ga0436363_0981179 | 3300039450 | Bacteria | 4310 |
| 687 | Ga0436363_1477014 | 3300039450 | Bacteria | 1884 |
| 688 | Ga0436362_1226293 | 3300039453 | Bacteria | 6161 |
| 689 | Ga0453683_0028557 | 3300044673 | Bacteria | 3531 |
| 690 | Ga0453683_0049430 | 3300044673 | Bacteria | 2636 |
| 691 | Ga0466965_0203899 | 3300044683 | Bacteria | 1050 |
| 692 | Ga0466966_0097075 | 3300044684 | Bacteria | 1825 |
| 693 | Ga0466961_0171277 | 3300044693 | Bacteria | 1350 |
| 694 | Ga0466963_0083604 | 3300044694 | Bacteria | 2165 |
| 695 | Ga0466963_0291452 | 3300044694 | Bacteria | 1147 |
| 696 | Ga0466964_0014346 | 3300044706 | Bacteria | 3013 |
| 697 | Ga0466964_0197370 | 3300044706 | Bacteria | 964 |
| 698 | Ga0453684_0000289 | 3300044712 | Bacteria | 215476 |
| 699 | Ga0453684_0297133 | 3300044712 | Bacteria | 1837 |
| 700 | Ga0453684_2367404 | 3300044712 | Bacteria | 527 |
| 701 | Ga0466957_0130382 | 3300044842 | Unclassified | 1610 |
| 702 | Ga0466959_0043271 | 3300045049 | Bacteria | 3320 |
| 703 | Ga0451576_0003856 | 3300045051 | Bacteria | 20119 |
| 704 | Ga0451576_0359663 | 3300045051 | Bacteria | 1524 |
| 705 | Ga0451576_0529129 | 3300045051 | Bacteria | 1238 |
| 706 | Ga0451576_1572296 | 3300045051 | Bacteria | 682 |
| 707 | Ga0451576_2048307 | 3300045051 | Bacteria | 589 |
| 708 | Ga0466967_0061113 | 3300045976 | Bacteria | 3341 |
| 709 | Ga0466967_0283295 | 3300045976 | Bacteria | 1591 |
| 710 | Ga0466967_0372026 | 3300045976 | Bacteria | 1386 |
| 711 | Ga0466967_0564148 | 3300045976 | Bacteria | 1121 |
| 712 | Ga0466967_0756868 | 3300045976 | Bacteria | 963 |
| 713 | Ga0495603_0131033 | 3300046455 | Bacteria | 1460 |
| 714 | Ga0495603_0146791 | 3300046455 | Bacteria | 1371 |
| 715 | Ga0495651_0416695 | 3300046462 | Bacteria | 874 |
| 716 | Ga0495580_0000603 | 3300046472 | Bacteria | 30353 |
| 717 | Ga0495580_0000888 | 3300046472 | Bacteria | 25988 |
| 718 | Ga0495580_0005807 | 3300046472 | Bacteria | 10131 |
| 719 | Ga0495580_0010140 | 3300046472 | Bacteria | 7361 |
| 720 | Ga0495580_0010801 | 3300046472 | Bacteria | 7092 |
| 721 | Ga0495580_0015319 | 3300046472 | Bacteria | 5786 |
| 722 | Ga0495580_0046244 | 3300046472 | Bacteria | 3089 |
| 723 | Ga0495580_0077375 | 3300046472 | Bacteria | 2320 |
| 724 | Ga0495580_0151866 | 3300046472 | Bacteria | 1604 |
| 725 | Ga0495580_0626255 | 3300046472 | Bacteria | 709 |
| 726 | Ga0495582_0001770 | 3300046473 | Bacteria | 12194 |
| 727 | Ga0495584_0113210 | 3300046491 | Bacteria | 1373 |
| 728 | Ga0495585_0408559 | 3300046492 | Bacteria | 653 |
| 729 | Ga0495594_0154189 | 3300046499 | Bacteria | 1304 |
| 730 | Ga0495666_0101255 | 3300046526 | Bacteria | 1357 |
| 731 | Ga0495665_0004440 | 3300046531 | Bacteria | 7577 |
| 732 | Ga0495665_0093278 | 3300046531 | Unclassified | 1582 |
| 733 | Ga0495665_0481926 | 3300046531 | Unclassified | 626 |
| 734 | Ga0495586_0053408 | 3300046535 | Bacteria | 2189 |
| 735 | Ga0495635_0775584 | 3300046663 | Unclassified | 619 |
| 736 | Ga0495588_0382690 | 3300046674 | Bacteria | 739 |
| 737 | Ga0495623_0146069 | 3300046679 | Bacteria | 1402 |
| 738 | Ga0495623_0568405 | 3300046679 | Unclassified | 592 |
| 739 | Ga0495658_0323909 | 3300046683 | Unclassified | 977 |
| 740 | Ga0495669_0005780 | 3300046684 | Bacteria | 5158 |
| 741 | Ga0495669_0106950 | 3300046684 | Unclassified | 1303 |
| 742 | Ga0495669_0478472 | 3300046684 | Unclassified | 605 |
| 743 | Ga0495624_0328668 | 3300046690 | Unclassified | 920 |
| 744 | Ga0495581_0117280 | 3300047315 | Bacteria | 1548 |
| 745 | Ga0495604_0747202 | 3300047317 | Unclassified | 619 |
| 746 | Ga0495675_0042170 | 3300047444 | Bacteria | 2907 |
| 747 | Ga0495684_0597928 | 3300047471 | Bacteria | 745 |
| 748 | Ga0495602_0189185 | 3300048088 | Bacteria | 1580 |
| 749 | Ga0495614_0373064 | 3300048089 | Bacteria | 667 |
| 750 | Ga0496100_0341030 | 3300048903 | Bacteria | 1130 |
| 751 | Ga0496100_0343288 | 3300048903 | Bacteria | 1126 |
| 752 | Ga0496100_0839818 | 3300048903 | Unclassified | 720 |
| 753 | Ga0496101_0047710 | 3300048904 | Bacteria | 3076 |
| 754 | Ga0496101_0136618 | 3300048904 | Bacteria | 1866 |
| 755 | Ga0496102_0118577 | 3300048905 | Unclassified | 2470 |
| 756 | Ga0496102_0130215 | 3300048905 | Bacteria | 2354 |
| 757 | Ga0496102_0131624 | 3300048905 | Bacteria | 2342 |
| 758 | Ga0496102_0193293 | 3300048905 | Bacteria | 1918 |
| 759 | Ga0496102_0273506 | 3300048905 | Bacteria | 1592 |
| 760 | Ga0496102_0299081 | 3300048905 | Bacteria | 1517 |
| 761 | Ga0496103_0066240 | 3300048906 | Bacteria | 2254 |
| 762 | Ga0496103_0416872 | 3300048906 | Bacteria | 862 |
| 763 | Ga0496103_0542707 | 3300048906 | Bacteria | 743 |
| 764 | Ga0496103_0673226 | 3300048906 | Bacteria | 657 |
| 765 | Ga0496104_0050498 | 3300048907 | Bacteria | 3924 |
| 766 | Ga0496104_0097331 | 3300048907 | Bacteria | 2816 |
| 767 | Ga0496104_0516905 | 3300048907 | Bacteria | 1105 |
| 768 | Ga0496105_0056168 | 3300048908 | Bacteria | 3250 |
| 769 | Ga0496105_0250461 | 3300048908 | Bacteria | 1435 |
| 770 | Ga0496105_0536681 | 3300048908 | Bacteria | 915 |
| 771 | Ga0496106_0029489 | 3300048909 | Bacteria | 4089 |
| 772 | Ga0496106_0091601 | 3300048909 | Bacteria | 2347 |
| 773 | Ga0496106_0521477 | 3300048909 | Bacteria | 954 |
| 774 | Ga0496106_0629123 | 3300048909 | Bacteria | 858 |
| 775 | Ga0496107_0013011 | 3300048910 | Bacteria | 5814 |
| 776 | Ga0496107_0018796 | 3300048910 | Bacteria | 4871 |
| 777 | Ga0496108_0000038 | 3300048911 | Bacteria | 149482 |
| 778 | Ga0496108_0072539 | 3300048911 | Bacteria | 2906 |
| 779 | Ga0496108_0917281 | 3300048911 | Bacteria | 751 |
| 780 | Ga0496108_1526705 | 3300048911 | Bacteria | 555 |
| 781 | Ga0496108_1638367 | 3300048911 | Bacteria | 531 |
| 782 | Ga0496109_0000082 | 3300048912 | Bacteria | 99164 |
| 783 | Ga0496109_0179169 | 3300048912 | Bacteria | 1990 |
| 784 | Ga0496109_0287605 | 3300048912 | Bacteria | 1549 |
| 785 | Ga0496109_0538147 | 3300048912 | Unclassified | 1102 |
| 786 | Ga0496110_0004211 | 3300048913 | Bacteria | 11128 |
| 787 | Ga0496110_0009336 | 3300048913 | Bacteria | 7935 |
| 788 | Ga0496111_0013905 | 3300048914 | Bacteria | 5489 |
| 789 | Ga0496112_0000032 | 3300048915 | Bacteria | 116962 |
| 790 | Ga0496112_0001953 | 3300048915 | Bacteria | 16282 |
| 791 | Ga0496112_0027420 | 3300048915 | Bacteria | 5491 |
| 792 | Ga0496112_0033085 | 3300048915 | Bacteria | 5022 |
| 793 | Ga0496112_0036050 | 3300048915 | Bacteria | 4822 |
| 794 | Ga0496112_0088807 | 3300048915 | Bacteria | 3059 |
| 795 | Ga0496112_0136188 | 3300048915 | Bacteria | 2426 |
| 796 | Ga0496112_0340108 | 3300048915 | Bacteria | 1444 |
| 797 | Ga0496112_0603414 | 3300048915 | Bacteria | 1030 |
| 798 | Ga0496112_1062560 | 3300048915 | Bacteria | 728 |
| 799 | Ga0496112_1341432 | 3300048915 | Unclassified | 630 |
| 800 | Ga0496113_0000094 | 3300048916 | Bacteria | 38512 |
| 801 | Ga0496113_0037685 | 3300048916 | Bacteria | 3550 |
| 802 | Ga0496113_0274819 | 3300048916 | Bacteria | 1347 |
| 803 | Ga0496115_0839362 | 3300048918 | Bacteria | 712 |
| 804 | Ga0501309_051378 | 3300049129 | Bacteria | 648 |
| 805 | Ga0495682_0106691 | 3300049460 | Bacteria | 1004 |
| 806 | Ga0501336_022788 | 3300049552 | Bacteria | 579 |
| 807 | Ga0501033_0274626 | 3300049570 | Bacteria | 1191 |
| 808 | Ga0501034_0060547 | 3300049571 | Bacteria | 3803 |
| 809 | Ga0501038_0211766 | 3300049574 | Bacteria | 1550 |
| 810 | Ga0501041_0095153 | 3300049577 | Bacteria | 1840 |
| 811 | Ga0501042_0049324 | 3300049578 | Bacteria | 3003 |
| 812 | Ga0501043_0200303 | 3300049579 | Bacteria | 1550 |
| 813 | Ga0501047_0733967 | 3300049581 | Bacteria | 804 |
| 814 | Ga0501048_0026179 | 3300049582 | Bacteria | 4247 |
| 815 | Ga0501068_0054597 | 3300049584 | Bacteria | 2420 |
| 816 | Ga0501070_0221634 | 3300049586 | Bacteria | 1551 |
| 817 | Ga0501071_0033114 | 3300049587 | Bacteria | 3672 |
| 818 | Ga0501072_0038562 | 3300049588 | Bacteria | 3750 |
| 819 | Ga0501074_0093807 | 3300049590 | Bacteria | 2149 |
| 820 | Ga0501075_0091574 | 3300049591 | Bacteria | 2307 |
| 821 | Ga0501076_0045244 | 3300049592 | Bacteria | 3475 |
| 822 | Ga0501077_0029064 | 3300049593 | Bacteria | 3514 |
| 823 | Ga0501079_0032169 | 3300049741 | Bacteria | 4032 |
| 824 | Ga0501080_0020656 | 3300049742 | Bacteria | 6100 |
| 825 | Ga0501081_0025836 | 3300049743 | Bacteria | 3955 |
| 826 | nmdc:mga05p37_89941_c1 | 3300050507 | Bacteria | 3783 |
| 827 | nmdc:mga0n895_1153707_c1 | 3300050512 | Bacteria | 750 |
| 828 | nmdc:mga0n895_2935_c1 | 3300050512 | Bacteria | 13530 |
| 829 | nmdc:mga0rr50_16911_c1 | 3300050513 | Bacteria | 4857 |
| 830 | nmdc:mga0rr50_25346_c1 | 3300050513 | Bacteria | 4121 |
| 831 | nmdc:mga0rr50_278377_c1 | 3300050513 | Bacteria | 1396 |
| 832 | nmdc:mga0rr50_49481_c1 | 3300050513 | Bacteria | 3111 |
| 833 | nmdc:mga0rr50_897990_c1 | 3300050513 | Unclassified | 755 |
| 834 | nmdc:mga08x19_10565_c1 | 3300050514 | Bacteria | 5549 |
| 835 | nmdc:mga08x19_10619_c1 | 3300050514 | Bacteria | 5536 |
| 836 | nmdc:mga08x19_17486_c1 | 3300050514 | Bacteria | 4388 |
| 837 | nmdc:mga08x19_7103_c1 | 3300050514 | Bacteria | 6648 |
| 838 | nmdc:mga0a205_105333_c1 | 3300050515 | Bacteria | 2719 |
| 839 | Ga0495601_0075010 | 3300053077 | Bacteria | 2165 |
| 840 | Ga0501084_0059625 | 3300054114 | Bacteria | 3194 |
| 841 | Ga0587084_005627 | 3300059477 | Bacteria | 1491 |
| 842 | Ga0587093_092808 | 3300059478 | Bacteria | 536 |
| 843 | Ga0587066_074563 | 3300059490 | Bacteria | 722 |
| 844 | Ga0587066_082101 | 3300059490 | Bacteria | 700 |
| 845 | Ga0587070_050091 | 3300059491 | Bacteria | 831 |
| 846 | Ga0587070_071246 | 3300059491 | Bacteria | 742 |
| 847 | Ga0587073_0114385 | 3300059492 | Bacteria | 720 |
| 848 | Ga0587077_117703 | 3300059493 | Bacteria | 659 |
| 849 | Ga0587080_071306 | 3300059503 | Bacteria | 696 |
| 850 | Ga0587082_032959 | 3300059504 | Bacteria | 913 |
| 851 | Ga0587083_0051649 | 3300059505 | Bacteria | 898 |
| 852 | Ga0587085_074072 | 3300059506 | Bacteria | 672 |
| 853 | Ga0587086_059047 | 3300059507 | Bacteria | 635 |
| 854 | Ga0587086_084954 | 3300059507 | Bacteria | 563 |
| 855 | Ga0587088_048054 | 3300059508 | Bacteria | 827 |
| 856 | Ga0587089_013953 | 3300059509 | Bacteria | 1045 |
| 857 | Ga0587090_073618 | 3300059510 | Bacteria | 672 |
| 858 | Ga0587091_049162 | 3300059511 | Bacteria | 860 |
| 859 | Ga0587092_070919 | 3300059512 | Bacteria | 671 |
| 860 | Ga0587094_003055 | 3300059513 | Bacteria | 1788 |
| 861 | Ga0587095_032840 | 3300059514 | Bacteria | 543 |
| 862 | Ga0587098_026330 | 3300059604 | Bacteria | 774 |
| 863 | Ga0587106_082384 | 3300059605 | Bacteria | 629 |
| 864 | Ga0587121_09795 | 3300059606 | Bacteria | 596 |
| 865 | Ga0587129_014469 | 3300059608 | Bacteria | 649 |
| 866 | Ga0587101_067487 | 3300059623 | Bacteria | 652 |
| 867 | Ga0587109_014597 | 3300059624 | Bacteria | 1321 |
| 868 | Ga0587113_041067 | 3300059625 | Unclassified | 554 |
| 869 | Ga0587115_038317 | 3300059626 | Bacteria | 739 |
| 870 | Ga0587117_038615 | 3300059627 | Bacteria | 752 |
| 871 | Ga0587128_002672 | 3300059630 | Bacteria | 1885 |
| 872 | Ga0587130_041910 | 3300059631 | Bacteria | 555 |
| 873 | Ga0587067_021160 | 3300059640 | Bacteria | 1120 |
| 874 | Ga0587068_089638 | 3300059641 | Bacteria | 632 |
| 875 | Ga0587069_077580 | 3300059642 | Bacteria | 642 |
| 876 | Ga0587072_102452 | 3300059643 | Bacteria | 644 |
| 877 | Ga0587075_002426 | 3300059644 | Bacteria | 1967 |
| 878 | Ga0587075_052607 | 3300059644 | Bacteria | 715 |
| 879 | Ga0587076_047013 | 3300059645 | Bacteria | 828 |
| 880 | Ga0587079_101105 | 3300059647 | Bacteria | 688 |
| 881 | Ga0587079_113782 | 3300059647 | Bacteria | 661 |
| 882 | Ga0587079_125694 | 3300059647 | Bacteria | 639 |
| 883 | Ga0587105_014321 | 3300059651 | Bacteria | 641 |
| 884 | Ga0587107_030098 | 3300059652 | Bacteria | 821 |
| 885 | Ga0587110_000979 | 3300059654 | Bacteria | 1923 |
| 886 | Ga0587114_024436 | 3300059655 | Bacteria | 879 |
| 887 | Ga0587116_13436 | 3300059656 | Bacteria | 576 |
| 888 | Ga0587119_046092 | 3300059658 | Bacteria | 639 |
| 889 | Ga0587120_022357 | 3300059659 | Bacteria | 608 |
| 890 | Ga0587060_017897 | 3300060243 | Bacteria | 658 |
| 891 | Ga0587065_09255 | 3300060245 | Bacteria | 612 |
| 892 | Ga0587071_011718 | 3300060344 | Bacteria | 1483 |
| 893 | Ga0587071_060577 | 3300060344 | Bacteria | 804 |
| 894 | Ga0587111_0047834 | 3300060346 | Bacteria | 934 |
| 895 | Ga0501082_0061429 | 3300060353 | Bacteria | 3234 |
| 896 | Ga0070697_100005905 | |||
| 897 | JGI24752J21851_1000333 | |||
| 898 | JGI24747J21853_1011667 | |||
| 899 | JGI24737J22298_10128303 | |||
| 900 | JGI24033J26618_1001119 | |||
| 901 | JGI24034J26672_10000133 | |||
| 902 | JGI24751J29686_10000539 | |||
| 903 | Ga0058863_11853307 | |||
| 904 | Ga0058861_10015203 | |||
| 905 | Ga0058861_10049083 | |||
| 906 | Ga0058860_10119967 | |||
| 907 | Ga0058860_12152757 | |||
| 908 | Ga0058860_12189591 | |||
| 909 | Ga0058862_10110909 | |||
| 910 | Ga0058862_12265877 | |||
| 911 | Ga0065712_10223510 | |||
| 912 | Ga0065715_10090978 | |||
| 913 | Ga0065707_10357863 | |||
| 914 | Ga0070658_10834688 | |||
| 915 | Ga0070676_10021768 | |||
| 916 | Ga0070676_10426347 | |||
| 917 | Ga0070683_100056338 | |||
| 918 | Ga0070683_100182436 | |||
| 919 | Ga0070683_100395675 | |||
| 920 | Ga0070683_100436446 | |||
| 921 | Ga0070683_100916513 | |||
| 922 | Ga0070683_101638090 | |||
| 923 | Ga0070690_100000645 | |||
| 924 | Ga0070690_100287955 | |||
| 925 | Ga0070690_100865613 | |||
| 926 | Ga0070670_100020546 | |||
| 927 | Ga0070670_100236661 | |||
| 928 | Ga0070670_100602059 | |||
| 929 | Ga0068869_100001094 | |||
| 930 | Ga0068869_100001760 | |||
| 931 | Ga0070666_10019039 | |||
| 932 | Ga0070680_100358718 | |||
| 933 | Ga0070680_100385368 | |||
| 934 | Ga0070682_100059337 | |||
| 935 | Ga0070682_100094571 | |||
| 936 | Ga0070682_100193715 | |||
| 937 | Ga0068868_100006426 | |||
| 938 | Ga0068868_100015558 | |||
| 939 | Ga0068868_100018165 | |||
| 940 | Ga0068868_100036777 | |||
| 941 | Ga0068868_100327449 | |||
| 942 | Ga0070660_100037871 | |||
| 943 | Ga0070660_100162305 | |||
| 944 | Ga0070691_10089501 | |||
| 945 | Ga0070687_100440275 | |||
| 946 | Ga0070687_100651952 | |||
| 947 | Ga0070661_100048767 | |||
| 948 | Ga0070661_100130869 | |||
| 949 | Ga0070661_100928088 | |||
| 950 | Ga0070692_10129252 | |||
| 951 | Ga0070668_100013356 | |||
| 952 | Ga0070668_100257077 | |||
| 953 | Ga0070669_100176130 | |||
| 954 | Ga0070669_101108216 | |||
| 955 | Ga0070675_100004860 | |||
| 956 | Ga0070674_100003003 | |||
| 957 | Ga0070673_100062794 | |||
| 958 | Ga0070673_100243730 | |||
| 959 | Ga0070673_101171178 | |||
| 960 | Ga0070688_100000522 | |||
| 961 | Ga0070688_100803696 | |||
| 962 | Ga0070659_100005680 | |||
| 963 | Ga0070659_100394481 | |||
| 964 | Ga0070659_100646368 | |||
| 965 | Ga0070667_100974782 | |||
| 966 | Ga0070709_10034970 | |||
| 967 | Ga0070709_10065330 | |||
| 968 | Ga0070709_10069429 | |||
| 969 | Ga0070709_10086705 | |||
| 970 | Ga0070709_10161936 | |||
| 971 | Ga0070709_10169313 | |||
| 972 | Ga0070709_10404528 | |||
| 973 | Ga0070709_10418305 | |||
| 974 | Ga0070709_10449155 | |||
| 975 | Ga0070714_100011365 | |||
| 976 | Ga0070714_100136370 | |||
| 977 | Ga0070714_100180346 | |||
| 978 | Ga0070714_100300752 | |||
| 979 | Ga0070714_100372638 | |||
| 980 | Ga0070714_100472161 | |||
| 981 | Ga0070714_100544404 | |||
| 982 | Ga0070714_100620325 | |||
| 983 | Ga0070714_100797588 | |||
| 984 | Ga0070714_100832231 | |||
| 985 | Ga0070714_101208436 | |||
| 986 | Ga0070714_101340621 | |||
| 987 | Ga0070713_100001466 | |||
| 988 | Ga0070713_100039322 | |||
| 989 | Ga0070713_100087851 | |||
| 990 | Ga0070713_100110484 | |||
| 991 | Ga0070713_100300995 | |||
| 992 | Ga0070713_100333025 | |||
| 993 | Ga0070713_100361455 | |||
| 994 | Ga0070713_100479556 | |||
| 995 | Ga0070713_100504859 | |||
| 996 | Ga0070713_100533891 | |||
| 997 | Ga0070710_10058048 | |||
| 998 | Ga0070710_10062029 | |||
| 999 | Ga0070710_10098188 | |||
| 1000 | Ga0070710_10280919 | |||
| 1001 | Ga0070710_10449083 | |||
| 1002 | Ga0070710_10828366 | |||
| 1003 | Ga0070710_11269993 | |||
| 1004 | Ga0070701_10757998 | |||
| 1005 | Ga0070711_100068504 | |||
| 1006 | Ga0070711_100090051 | |||
| 1007 | Ga0070711_100106142 | |||
| 1008 | Ga0070711_100466480 | |||
| 1009 | Ga0070711_100494487 | |||
| 1010 | Ga0070705_100352680 | |||
| 1011 | Ga0070694_100939755 | |||
| 1012 | Ga0070708_100003211 | |||
| 1013 | Ga0070708_100026764 | |||
| 1014 | Ga0070708_100042187 | |||
| 1015 | Ga0070708_100045643 | |||
| 1016 | Ga0070708_100168513 | |||
| 1017 | Ga0070708_100245148 | |||
| 1018 | Ga0070708_100423014 | |||
| 1019 | Ga0070708_100471271 | |||
| 1020 | Ga0070708_102128403 | |||
| 1021 | Ga0070663_101261915 | |||
| 1022 | Ga0070678_100445424 | |||
| 1023 | Ga0070662_100034763 | |||
| 1024 | Ga0070662_100105700 | |||
| 1025 | Ga0070681_10016298 | |||
| 1026 | Ga0068867_100001206 | |||
| 1027 | Ga0068867_100012190 | |||
| 1028 | Ga0068867_100140125 | |||
| 1029 | Ga0070685_10005214 | |||
| 1030 | Ga0070685_10107190 | |||
| 1031 | Ga0070706_100001345 | |||
| 1032 | Ga0070706_100262845 | |||
| 1033 | Ga0070706_100277396 | |||
| 1034 | Ga0070706_100982022 | |||
| 1035 | Ga0070706_101133809 | |||
| 1036 | Ga0070707_100013995 | |||
| 1037 | Ga0070707_100066666 | |||
| 1038 | Ga0070707_100252127 | |||
| 1039 | Ga0070707_100272459 | |||
| 1040 | Ga0070707_100297076 | |||
| 1041 | Ga0070707_100380369 | |||
| 1042 | Ga0070698_100000247 | |||
| 1043 | Ga0070698_100445342 | |||
| 1044 | Ga0070698_100656032 | |||
| 1045 | Ga0070698_100988112 | |||
| 1046 | Ga0070698_101071558 | |||
| 1047 | Ga0070699_100007000 | |||
| 1048 | Ga0070699_100138983 | |||
| 1049 | Ga0070699_100775072 | |||
| 1050 | Ga0070699_100948630 | |||
| 1051 | Ga0070679_100021464 | |||
| 1052 | Ga0070679_100126928 | |||
| 1053 | Ga0070679_100353145 | |||
| 1054 | Ga0070679_100848819 | |||
| 1055 | Ga0070679_100961009 | |||
| 1056 | Ga0070684_100008449 | |||
| 1057 | Ga0070684_100098068 | |||
| 1058 | Ga0070697_100049641 | |||
| 1059 | Ga0070697_100180037 | |||
| 1060 | Ga0070697_100548507 | |||
| 1061 | Ga0070697_100679535 | |||
| 1062 | Ga0070697_101365523 | |||
| 1063 | Ga0070697_101467189 | |||
| 1064 | Ga0068853_100007972 | |||
| 1065 | Ga0068853_100274267 | |||
| 1066 | Ga0068853_100387206 | |||
| 1067 | Ga0068853_101860995 | |||
| 1068 | Ga0070672_100004674 | |||
| 1069 | Ga0070672_100589020 | |||
| 1070 | Ga0070686_100003553 | |||
| 1071 | Ga0070686_100291272 | |||
| 1072 | Ga0070686_100456180 | |||
| 1073 | Ga0070695_100117342 | |||
| 1074 | Ga0070695_100573138 | |||
| 1075 | Ga0070696_100031418 | |||
| 1076 | Ga0070696_100236839 | |||
| 1077 | Ga0070696_100335823 | |||
| 1078 | Ga0070693_100197419 | |||
| 1079 | Ga0070693_100247737 | |||
| 1080 | Ga0070693_100891233 | |||
| 1081 | Ga0070704_100158377 | |||
| 1082 | Ga0070704_100586745 | |||
| 1083 | Ga0068855_100000412 | |||
| 1084 | Ga0068855_100000425 | |||
| 1085 | Ga0068855_100012802 | |||
| 1086 | Ga0068855_100099127 | |||
| 1087 | Ga0068855_100210684 | |||
| 1088 | Ga0068855_100364125 | |||
| 1089 | Ga0068855_100609554 | |||
| 1090 | Ga0068855_101100407 | |||
| 1091 | Ga0070664_100002954 | |||
| 1092 | Ga0070664_100036049 | |||
| 1093 | Ga0068857_100000880 | |||
| 1094 | Ga0068857_101781311 | |||
| 1095 | Ga0068854_100281361 | |||
| 1096 | Ga0068854_100320533 | |||
| 1097 | Ga0068856_100000708 | |||
| 1098 | Ga0068856_100009508 | |||
| 1099 | Ga0068856_100011409 | |||
| 1100 | Ga0068856_100026004 | |||
| 1101 | Ga0068856_100119825 | |||
| 1102 | Ga0068856_100313851 | |||
| 1103 | Ga0068856_100377141 | |||
| 1104 | Ga0070702_100003657 | |||
| 1105 | Ga0070702_100075663 | |||
| 1106 | Ga0068852_100004983 | |||
| 1107 | Ga0068852_101235354 | |||
| 1108 | Ga0068859_100009521 | |||
| 1109 | Ga0068859_100014277 | |||
| 1110 | Ga0068859_100716740 | |||
| 1111 | Ga0068864_100011951 | |||
| 1112 | Ga0068864_100596428 | |||
| 1113 | Ga0068864_101717425 | |||
| 1114 | Ga0068864_101717426 | |||
| 1115 | Ga0068866_10002761 | |||
| 1116 | Ga0068861_101903618 | |||
| 1117 | Ga0068851_10000421 | |||
| 1118 | Ga0068851_10074283 | |||
| 1119 | Ga0068870_10001091 | |||
| 1120 | Ga0068863_100021683 | |||
| 1121 | Ga0068863_100029237 | |||
| 1122 | Ga0068863_100030476 | |||
| 1123 | Ga0068863_100135782 | |||
| 1124 | Ga0068863_100755211 | |||
| 1125 | Ga0068858_100006453 | |||
| 1126 | Ga0068858_100089425 | |||
| 1127 | Ga0068858_100315659 | |||
| 1128 | Ga0068858_101082742 | |||
| 1129 | Ga0068860_100521295 | |||
| 1130 | Ga0068860_100620718 | |||
| 1131 | Ga0068862_100107179 | |||
| 1132 | Ga0081455_10065203 | |||
| 1133 | Ga0070717_10008717 | |||
| 1134 | Ga0070717_10019045 | |||
| 1135 | Ga0070717_10030041 | |||
| 1136 | Ga0070717_10033607 | |||
| 1137 | Ga0070717_10060143 | |||
| 1138 | Ga0070717_10067657 | |||
| 1139 | Ga0070717_10088146 | |||
| 1140 | Ga0070717_10134805 | |||
| 1141 | Ga0070717_10364703 | |||
| 1142 | Ga0070717_10440243 | |||
| 1143 | Ga0070717_10640809 | |||
| 1144 | Ga0070717_11287724 | |||
| 1145 | Ga0070715_10653777 | |||
| 1146 | Ga0070716_100000337 | |||
| 1147 | Ga0070716_100079952 | |||
| 1148 | Ga0070716_100168265 | |||
| 1149 | Ga0070716_100245736 | |||
| 1150 | Ga0070716_100298334 | |||
| 1151 | Ga0070716_100306097 | |||
| 1152 | Ga0070716_100306257 | |||
| 1153 | Ga0070716_100309238 | |||
| 1154 | Ga0070716_100334886 | |||
| 1155 | Ga0070716_100416571 | |||
| 1156 | Ga0070716_100529254 | |||
| 1157 | Ga0070712_100024231 | |||
| 1158 | Ga0070712_100044371 | |||
| 1159 | Ga0070712_100198333 | |||
| 1160 | Ga0070712_100210610 | |||
| 1161 | Ga0070712_100333047 | |||
| 1162 | Ga0070712_100856901 | |||
| 1163 | Ga0097621_100001137 | |||
| 1164 | Ga0097621_100002010 | |||
| 1165 | Ga0097621_100028973 | |||
| 1166 | Ga0097621_100343215 | |||
| 1167 | Ga0068871_100004576 | |||
| 1168 | Ga0068871_100005383 | |||
| 1169 | Ga0068871_100039234 | |||
| 1170 | Ga0068871_100382482 | |||
| 1171 | Ga0068871_101473243 | |||
| 1172 | Ga0075433_10112609 | |||
| 1173 | Ga0075434_100000969 | |||
| 1174 | Ga0075434_101060960 | |||
| 1175 | Ga0075436_100000214 | |||
| 1176 | Ga0075436_100000264 | |||
| 1177 | Ga0075436_100047256 | |||
| 1178 | Ga0075436_100063714 | |||
| 1179 | Ga0097620_100009520 | |||
| 1180 | Ga0097620_100014277 | |||
| 1181 | Ga0097620_100716721 | |||
| 1182 | Ga0075435_100006235 | |||
| 1183 | Ga0075435_100061766 | |||
| 1184 | Ga0075435_100237372 | |||
| 1185 | Ga0075435_100307168 | |||
| 1186 | Ga0075435_101193465 | |||
| 1187 | Ga0099794_10210383 | |||
| 1188 | Ga0099794_10317271 | |||
| 1189 | Ga0105250_10040512 | |||
| 1190 | Ga0105240_10092584 | |||
| 1191 | Ga0105240_10311254 | |||
| 1192 | Ga0105240_10672217 | |||
| 1193 | Ga0105240_10744806 | |||
| 1194 | Ga0105240_11149948 | |||
| 1195 | Ga0105245_10003216 | |||
| 1196 | Ga0105245_10011809 | |||
| 1197 | Ga0105245_10145589 | |||
| 1198 | Ga0105245_10388126 | |||
| 1199 | Ga0105245_10722596 | |||
| 1200 | Ga0105245_11505017 | |||
| 1201 | Ga0105247_10216564 | |||
| 1202 | Ga0114129_10028282 | |||
| 1203 | Ga0105241_10002278 | |||
| 1204 | Ga0105241_10004801 | |||
| 1205 | Ga0105241_10014672 | |||
| 1206 | Ga0105241_10060423 | |||
| 1207 | Ga0105241_10527586 | |||
| 1208 | Ga0105242_10012662 | |||
| 1209 | Ga0105242_11694290 | |||
| 1210 | Ga0105248_10007505 | |||
| 1211 | Ga0105248_10011516 | |||
| 1212 | Ga0105248_10098938 | |||
| 1213 | Ga0105237_10011869 | |||
| 1214 | Ga0105237_10046489 | |||
| 1215 | Ga0105237_10051917 | |||
| 1216 | Ga0105237_10093516 | |||
| 1217 | Ga0105237_10626567 | |||
| 1218 | Ga0105237_11086132 | |||
| 1219 | Ga0105237_11462330 | |||
| 1220 | Ga0105237_11665693 | |||
| 1221 | Ga0105238_10068820 | |||
| 1222 | Ga0105238_10144555 | |||
| 1223 | Ga0105238_10244559 | |||
| 1224 | Ga0105238_10574837 | |||
| 1225 | Ga0105249_10003703 | |||
| 1226 | Ga0105249_10052936 | |||
| 1227 | Ga0105249_11278890 | |||
| 1228 | Ga0099796_10532096 | |||
| 1229 | Ga0105239_10007920 | |||
| 1230 | Ga0105239_10071004 | |||
| 1231 | Ga0105239_10104774 | |||
| 1232 | Ga0105239_10596993 | |||
| 1233 | Ga0105246_10003185 | |||
| 1234 | Ga0105246_10162164 | |||
| 1235 | Ga0105246_10533408 | |||
| 1236 | Ga0157373_10002194 | |||
| 1237 | Ga0157373_10009640 | |||
| 1238 | Ga0157373_10049350 | |||
| 1239 | Ga0157373_10580315 | |||
| 1240 | Ga0157371_10004049 | |||
| 1241 | Ga0157371_10186589 | |||
| 1242 | Ga0157370_10054686 | |||
| 1243 | Ga0157370_10091584 | |||
| 1244 | Ga0157370_10393107 | |||
| 1245 | Ga0157369_10023516 | |||
| 1246 | Ga0157369_10023791 | |||
| 1247 | Ga0157369_10032560 | |||
| 1248 | Ga0157369_10057681 | |||
| 1249 | Ga0157369_10062178 | |||
| 1250 | Ga0157369_10198505 | |||
| 1251 | Ga0157369_10279877 | |||
| 1252 | Ga0157374_10001270 | |||
| 1253 | Ga0157374_10002015 | |||
| 1254 | Ga0157374_10002450 | |||
| 1255 | Ga0157374_10029651 | |||
| 1256 | Ga0157374_10340742 | |||
| 1257 | Ga0157378_10000014 | |||
| 1258 | Ga0157378_10006923 | |||
| 1259 | Ga0157378_10089002 | |||
| 1260 | Ga0157378_10215593 | |||
| 1261 | Ga0157378_10265843 | |||
| 1262 | Ga0163162_10061611 | |||
| 1263 | Ga0163162_10240262 | |||
| 1264 | Ga0163162_10291770 | |||
| 1265 | Ga0163162_10306178 | |||
| 1266 | Ga0163162_11570111 | |||
| 1267 | Ga0157372_10000641 | |||
| 1268 | Ga0157372_10001892 | |||
| 1269 | Ga0157372_10006851 | |||
| 1270 | Ga0157372_10007257 | |||
| 1271 | Ga0157372_10012316 | |||
| 1272 | Ga0157372_10013531 | |||
| 1273 | Ga0157372_10105242 | |||
| 1274 | Ga0157372_10204060 | |||
| 1275 | Ga0157372_10349991 | |||
| 1276 | Ga0157372_10359310 | |||
| 1277 | Ga0157375_10085013 | |||
| 1278 | Ga0163163_10054270 | |||
| 1279 | Ga0163163_10085695 | |||
| 1280 | Ga0163163_10137842 | |||
| 1281 | Ga0182008_10005969 | |||
| 1282 | Ga0157377_10000286 | |||
| 1283 | Ga0157377_10129718 | |||
| 1284 | Ga0157379_10001394 | |||
| 1285 | Ga0157379_10151934 | |||
| 1286 | Ga0157379_10552304 | |||
| 1287 | Ga0157379_12095781 | |||
| 1288 | Ga0157376_10347294 | |||
| 1289 | Ga0157376_10478619 | |||
| 1290 | Ga0157376_11165087 | |||
| 1291 | Ga0157376_11435259 | |||
| 1292 | Ga0157376_11864836 | |||
| 1293 | Ga0182006_1013304 | |||
| 1294 | Ga0182007_10004030 | |||
| 1295 | Ga0182005_1008788 | |||
| 1296 | Ga0182005_1091612 | |||
| 1297 | Ga0163161_10001313 | |||
| 1298 | Ga0197907_10259388 | |||
| 1299 | Ga0197907_10379982 | |||
| 1300 | Ga0197907_10393248 | |||
| 1301 | Ga0206356_10280488 | |||
| 1302 | Ga0206356_10496279 | |||
| 1303 | Ga0206356_10746760 | |||
| 1304 | Ga0206356_11322473 | |||
| 1305 | Ga0206356_11595700 | |||
| 1306 | Ga0206355_1205801 | |||
| 1307 | Ga0206355_1611145 | |||
| 1308 | Ga0206355_1710675 | |||
| 1309 | Ga0206352_10099029 | |||
| 1310 | Ga0206352_10361514 | |||
| 1311 | Ga0206352_10379723 | |||
| 1312 | Ga0206352_10719253 | |||
| 1313 | Ga0206354_11155912 | |||
| 1314 | Ga0206353_10767450 | |||
| 1315 | Ga0213873_10014036 | |||
| 1316 | Ga0213876_10257589 | |||
| 1317 | Ga0213871_10009484 | |||
| 1318 | Ga0224712_10078995 | |||
| 1319 | Ga0207656_10013653 | |||
| 1320 | Ga0207656_10106029 | |||
| 1321 | Ga0207696_1077647 | |||
| 1322 | Ga0207682_10010286 | |||
| 1323 | Ga0207692_10066191 | |||
| 1324 | Ga0207692_10067532 | |||
| 1325 | Ga0207692_10093378 | |||
| 1326 | Ga0207692_10273878 | |||
| 1327 | Ga0207692_10354351 | |||
| 1328 | Ga0207710_10250204 | |||
| 1329 | Ga0207688_10014322 | |||
| 1330 | Ga0207688_10135995 | |||
| 1331 | Ga0207680_10004156 | |||
| 1332 | Ga0207647_10001732 | |||
| 1333 | Ga0207647_10002148 | |||
| 1334 | Ga0207647_10163554 | |||
| 1335 | Ga0207685_10010190 | |||
| 1336 | Ga0207699_10017946 | |||
| 1337 | Ga0207699_10126345 | |||
| 1338 | Ga0207699_10154341 | |||
| 1339 | Ga0207699_10248565 | |||
| 1340 | Ga0207699_10269209 | |||
| 1341 | Ga0207645_10000781 | |||
| 1342 | Ga0207645_10683589 | |||
| 1343 | Ga0207643_10000331 | |||
| 1344 | Ga0207643_10184219 | |||
| 1345 | Ga0207705_10626657 | |||
| 1346 | Ga0207684_10000762 | |||
| 1347 | Ga0207684_10410442 | |||
| 1348 | Ga0207684_10481758 | |||
| 1349 | Ga0207684_10581587 | |||
| 1350 | Ga0207684_10651965 | |||
| 1351 | Ga0207654_10058438 | |||
| 1352 | Ga0207654_10136954 | |||
| 1353 | Ga0207654_10633626 | |||
| 1354 | Ga0207707_10988062 | |||
| 1355 | Ga0207695_10025321 | |||
| 1356 | Ga0207695_10046026 | |||
| 1357 | Ga0207695_10091917 | |||
| 1358 | Ga0207695_10296569 | |||
| 1359 | Ga0207695_10749816 | |||
| 1360 | Ga0207695_11046992 | |||
| 1361 | Ga0207671_10211809 | |||
| 1362 | Ga0207671_10256894 | |||
| 1363 | Ga0207671_10283383 | |||
| 1364 | Ga0207671_10625564 | |||
| 1365 | Ga0207671_10873400 | |||
| 1366 | Ga0207693_10056154 | |||
| 1367 | Ga0207693_10136241 | |||
| 1368 | Ga0207693_10161169 | |||
| 1369 | Ga0207693_10395412 | |||
| 1370 | Ga0207693_10871599 | |||
| 1371 | Ga0207693_10876502 | |||
| 1372 | Ga0207693_10941769 | |||
| 1373 | Ga0207663_10034935 | |||
| 1374 | Ga0207663_10082926 | |||
| 1375 | Ga0207663_10228003 | |||
| 1376 | Ga0207663_10318813 | |||
| 1377 | Ga0207663_11065462 | |||
| 1378 | Ga0207660_10684316 | |||
| 1379 | Ga0207662_10007837 | |||
| 1380 | Ga0207662_11094865 | |||
| 1381 | Ga0207657_10000311 | |||
| 1382 | Ga0207657_10001224 | |||
| 1383 | Ga0207657_10726467 | |||
| 1384 | Ga0207649_10002645 | |||
| 1385 | Ga0207649_10091645 | |||
| 1386 | Ga0207649_10728825 | |||
| 1387 | Ga0207652_10053021 | |||
| 1388 | Ga0207646_10000334 | |||
| 1389 | Ga0207646_10169662 | |||
| 1390 | Ga0207646_10188153 | |||
| 1391 | Ga0207646_10246739 | |||
| 1392 | Ga0207646_10574927 | |||
| 1393 | Ga0207646_10717185 | |||
| 1394 | Ga0207681_10004446 | |||
| 1395 | Ga0207694_10002449 | |||
| 1396 | Ga0207694_10546176 | |||
| 1397 | Ga0207650_10000063 | |||
| 1398 | Ga0207650_10130610 | |||
| 1399 | Ga0207687_10118281 | |||
| 1400 | Ga0207687_10277891 | |||
| 1401 | Ga0207700_10006336 | |||
| 1402 | Ga0207700_10023136 | |||
| 1403 | Ga0207700_10036103 | |||
| 1404 | Ga0207700_10194008 | |||
| 1405 | Ga0207700_10212322 | |||
| 1406 | Ga0207700_10233495 | |||
| 1407 | Ga0207700_10246318 | |||
| 1408 | Ga0207700_10249726 | |||
| 1409 | Ga0207700_11964968 | |||
| 1410 | Ga0207664_10017981 | |||
| 1411 | Ga0207664_10237584 | |||
| 1412 | Ga0207664_10353084 | |||
| 1413 | Ga0207664_10600581 | |||
| 1414 | Ga0207664_10605678 | |||
| 1415 | Ga0207664_10632236 | |||
| 1416 | Ga0207664_10853600 | |||
| 1417 | Ga0207664_11264284 | |||
| 1418 | Ga0207664_11483107 | |||
| 1419 | Ga0207644_10046541 | |||
| 1420 | Ga0207644_10159473 | |||
| 1421 | Ga0207706_10001937 | |||
| 1422 | Ga0207706_10011223 | |||
| 1423 | Ga0207706_10188964 | |||
| 1424 | Ga0207686_10031774 | |||
| 1425 | Ga0207669_10155811 | |||
| 1426 | Ga0207704_10051107 | |||
| 1427 | Ga0207665_10000109 | |||
| 1428 | Ga0207665_10018023 | |||
| 1429 | Ga0207665_10163066 | |||
| 1430 | Ga0207665_10177682 | |||
| 1431 | Ga0207665_10326866 | |||
| 1432 | Ga0207665_10342508 | |||
| 1433 | Ga0207665_10406511 | |||
| 1434 | Ga0207665_11041113 | |||
| 1435 | Ga0207691_10001123 | |||
| 1436 | Ga0207691_10947800 | |||
| 1437 | Ga0207711_10008464 | |||
| 1438 | Ga0207711_10071456 | |||
| 1439 | Ga0207711_11283896 | |||
| 1440 | Ga0207711_11614070 | |||
| 1441 | Ga0207711_11943020 | |||
| 1442 | Ga0207689_10000788 | |||
| 1443 | Ga0207689_10001298 | |||
| 1444 | Ga0207689_10338529 | |||
| 1445 | Ga0207661_10000156 | |||
| 1446 | Ga0207661_10394330 | |||
| 1447 | Ga0207661_11519669 | |||
| 1448 | Ga0207679_10000588 | |||
| 1449 | Ga0207679_10019528 | |||
| 1450 | Ga0207679_10042347 | |||
| 1451 | Ga0207667_10000311 | |||
| 1452 | Ga0207667_10002505 | |||
| 1453 | Ga0207667_10039985 | |||
| 1454 | Ga0207667_10065378 | |||
| 1455 | Ga0207667_10177848 | |||
| 1456 | Ga0207667_10208343 | |||
| 1457 | Ga0207667_10357656 | |||
| 1458 | Ga0207667_10578464 | |||
| 1459 | Ga0207667_10657295 | |||
| 1460 | Ga0207651_10013008 | |||
| 1461 | Ga0207651_10145880 | |||
| 1462 | Ga0207712_10004653 | |||
| 1463 | Ga0207712_10908271 | |||
| 1464 | Ga0207668_10037181 | |||
| 1465 | Ga0207668_10426863 | |||
| 1466 | Ga0207640_10032417 | |||
| 1467 | Ga0207640_10033382 | |||
| 1468 | Ga0207640_10311812 | |||
| 1469 | Ga0207640_10910510 | |||
| 1470 | Ga0207658_10007747 | |||
| 1471 | Ga0207658_10218856 | |||
| 1472 | Ga0207658_10799344 | |||
| 1473 | Ga0207677_10010740 | |||
| 1474 | Ga0207677_10013130 | |||
| 1475 | Ga0207677_10054589 | |||
| 1476 | Ga0207677_10138460 | |||
| 1477 | Ga0207677_10403739 | |||
| 1478 | Ga0207703_10024629 | |||
| 1479 | Ga0207703_10048979 | |||
| 1480 | Ga0207703_10071441 | |||
| 1481 | Ga0207703_10140315 | |||
| 1482 | Ga0207703_10187592 | |||
| 1483 | Ga0207639_10087303 | |||
| 1484 | Ga0207639_10113851 | |||
| 1485 | Ga0207639_10339503 | |||
| 1486 | Ga0207639_10379256 | |||
| 1487 | Ga0207678_10000443 | |||
| 1488 | Ga0207678_10088544 | |||
| 1489 | Ga0207702_10001803 | |||
| 1490 | Ga0207702_10005756 | |||
| 1491 | Ga0207702_10016352 | |||
| 1492 | Ga0207702_10032318 | |||
| 1493 | Ga0207702_10041367 | |||
| 1494 | Ga0207702_10178860 | |||
| 1495 | Ga0207702_10427422 | |||
| 1496 | Ga0207702_11149992 | |||
| 1497 | Ga0207641_10000131 | |||
| 1498 | Ga0207641_10024496 | |||
| 1499 | Ga0207641_10031853 | |||
| 1500 | Ga0207641_10071138 | |||
| 1501 | Ga0207648_10000403 | |||
| 1502 | Ga0207648_10025447 | |||
| 1503 | Ga0207648_10150047 | |||
| 1504 | Ga0207676_10000517 | |||
| 1505 | Ga0207676_10002019 | |||
| 1506 | Ga0207676_10191353 | |||
| 1507 | Ga0207674_10000201 | |||
| 1508 | Ga0207674_10043108 | |||
| 1509 | Ga0207674_10440206 | |||
| 1510 | Ga0207675_100020759 | |||
| 1511 | Ga0207675_100131080 | |||
| 1512 | Ga0207683_10000848 | |||
| 1513 | Ga0207683_10243550 | |||
| 1514 | Ga0207698_10193022 | |||
| 1515 | Ga0207698_10330550 | |||
| 1516 | Ga0268266_10002994 | |||
| 1517 | Ga0268265_10001656 | |||
| 1518 | Ga0268265_10083198 | |||
| 1519 | Ga0268265_10280575 | |||
| 1520 | Ga0268264_10007655 | |||
| 1521 | Ga0268264_10011067 | |||
| 1522 | Ga0268264_11918980 | |||
| 1523 | Ga0265338_10036611 | |||
| 1524 | Ga0265338_10374675 | |||
| 1525 | Ga0265324_10069415 | |||
| 1526 | Ga0265328_10009410 | |||
| 1527 | Ga0265340_10381627 | |||
| 1528 | Ga0265339_10021469 | |||
| 1529 | Ga0265316_10132755 | |||
| 1530 | Ga0265314_10044113 | |||
| 1531 | Ga0265314_10082356 | |||
| 1532 | Ga0265314_10120725 | |||
| 1533 | Ga0265342_10392731 | |||
| 1534 | Ga0316596_1170269 | |||
| 1535 | Ga0316214_1023552 | |||
| 1536 | Ga0373926_0012789 | |||
| 1537 | Ga0373926_0138165 | |||
| 1538 | Ga0373940_0080937 | |||
| 1539 | Ga0373923_0229584 | |||
| 1540 | Ga0373923_0424996 | |||
| 1541 | Ga0373932_0170126 | |||
| 1542 | Ga0373932_0211556 | |||
| 1543 | Ga0373936_0053999 | |||
| 1544 | Ga0373936_0055321 | |||
| 1545 | Ga0373936_0204904 | |||
| 1546 | Ga0373945_0045030 | |||
| 1547 | Ga0373945_0396151 | |||
| 1548 | Ga0373954_0027583 | |||
| 1549 | Ga0373960_0003592 | |||
| 1550 | Ga0373960_0048433 | |||
| 1551 | Ga0373943_0007494 | |||
| 1552 | Ga0373943_0049591 | |||
| 1553 | Ga0373943_0138718 | |||
| 1554 | Ga0373946_0021343 | |||
| 1555 | Ga0373946_0626938 | |||
| 1556 | Ga0316574_0660618 | |||
| 1557 | Ga0373931_0313469 | |||
| 1558 | Ga0373931_0355362 | |||
| 1559 | Ga0373935_0074198 | |||
| 1560 | Ga0373935_0164212 | |||
| 1561 | Ga0373935_0302885 | |||
| 1562 | Ga0373927_0018456 | |||
| 1563 | Ga0373927_0107053 | |||
| 1564 | Ga0373927_0189028 | |||
| 1565 | Ga0373933_0052829 | |||
| 1566 | Ga0373933_0926142 | |||
| 1567 | Ga0373947_0002434 | |||
| 1568 | Ga0373947_0056623 | |||
| 1569 | Ga0373947_0642519 | |||
| 1570 | Ga0373937_0422066 | |||
| 1571 | Ga0373925_0002805 | |||
| 1572 | Ga0373925_0027712 | |||
| 1573 | Ga0373925_0042592 | |||
| 1574 | Ga0373925_0071289 | |||
| 1575 | Ga0373925_0406952 | |||
| 1576 | Ga0373925_0888453 | |||
| 1577 | Ga0436365_0211838 | |||
| 1578 | Ga0436365_1140187 | |||
| 1579 | Ga0436360_1315790 | |||
| 1580 | Ga0436363_0762804 | |||
| 1581 | Ga0436363_0981179 | |||
| 1582 | Ga0436363_1477014 | |||
| 1583 | Ga0436362_1226293 | |||
| 1584 | Ga0453683_0028557 | |||
| 1585 | Ga0453683_0049430 | |||
| 1586 | Ga0466965_0203899 | |||
| 1587 | Ga0466966_0097075 | |||
| 1588 | Ga0466961_0171277 | |||
| 1589 | Ga0466963_0083604 | |||
| 1590 | Ga0466963_0291452 | |||
| 1591 | Ga0466964_0014346 | |||
| 1592 | Ga0466964_0197370 | |||
| 1593 | Ga0453684_0000289 | |||
| 1594 | Ga0453684_0297133 | |||
| 1595 | Ga0453684_2367404 | |||
| 1596 | Ga0466957_0130382 | |||
| 1597 | Ga0466959_0043271 | |||
| 1598 | Ga0451576_0003856 | |||
| 1599 | Ga0451576_0359663 | |||
| 1600 | Ga0451576_0529129 | |||
| 1601 | Ga0451576_1572296 | |||
| 1602 | Ga0451576_2048307 | |||
| 1603 | Ga0466967_0061113 | |||
| 1604 | Ga0466967_0283295 | |||
| 1605 | Ga0466967_0372026 | |||
| 1606 | Ga0466967_0564148 | |||
| 1607 | Ga0466967_0756868 | |||
| 1608 | Ga0495603_0131033 | |||
| 1609 | Ga0495603_0146791 | |||
| 1610 | Ga0495651_0416695 | |||
| 1611 | Ga0495580_0000603 | |||
| 1612 | Ga0495580_0000888 | |||
| 1613 | Ga0495580_0005807 | |||
| 1614 | Ga0495580_0010140 | |||
| 1615 | Ga0495580_0010801 | |||
| 1616 | Ga0495580_0015319 | |||
| 1617 | Ga0495580_0046244 | |||
| 1618 | Ga0495580_0077375 | |||
| 1619 | Ga0495580_0151866 | |||
| 1620 | Ga0495580_0626255 | |||
| 1621 | Ga0495582_0001770 | |||
| 1622 | Ga0495584_0113210 | |||
| 1623 | Ga0495585_0408559 | |||
| 1624 | Ga0495594_0154189 | |||
| 1625 | Ga0495666_0101255 | |||
| 1626 | Ga0495665_0004440 | |||
| 1627 | Ga0495665_0093278 | |||
| 1628 | Ga0495665_0481926 | |||
| 1629 | Ga0495586_0053408 | |||
| 1630 | Ga0495635_0775584 | |||
| 1631 | Ga0495588_0382690 | |||
| 1632 | Ga0495623_0146069 | |||
| 1633 | Ga0495623_0568405 | |||
| 1634 | Ga0495658_0323909 | |||
| 1635 | Ga0495669_0005780 | |||
| 1636 | Ga0495669_0106950 | |||
| 1637 | Ga0495669_0478472 | |||
| 1638 | Ga0495624_0328668 | |||
| 1639 | Ga0495581_0117280 | |||
| 1640 | Ga0495604_0747202 | |||
| 1641 | Ga0495675_0042170 | |||
| 1642 | Ga0495684_0597928 | |||
| 1643 | Ga0495602_0189185 | |||
| 1644 | Ga0495614_0373064 | |||
| 1645 | Ga0496100_0341030 | |||
| 1646 | Ga0496100_0343288 | |||
| 1647 | Ga0496100_0839818 | |||
| 1648 | Ga0496101_0047710 | |||
| 1649 | Ga0496101_0136618 | |||
| 1650 | Ga0496102_0118577 | |||
| 1651 | Ga0496102_0130215 | |||
| 1652 | Ga0496102_0131624 | |||
| 1653 | Ga0496102_0193293 | |||
| 1654 | Ga0496102_0273506 | |||
| 1655 | Ga0496102_0299081 | |||
| 1656 | Ga0496103_0066240 | |||
| 1657 | Ga0496103_0416872 | |||
| 1658 | Ga0496103_0542707 | |||
| 1659 | Ga0496103_0673226 | |||
| 1660 | Ga0496104_0050498 | |||
| 1661 | Ga0496104_0097331 | |||
| 1662 | Ga0496104_0516905 | |||
| 1663 | Ga0496105_0056168 | |||
| 1664 | Ga0496105_0250461 | |||
| 1665 | Ga0496105_0536681 | |||
| 1666 | Ga0496106_0029489 | |||
| 1667 | Ga0496106_0091601 | |||
| 1668 | Ga0496106_0521477 | |||
| 1669 | Ga0496106_0629123 | |||
| 1670 | Ga0496107_0013011 | |||
| 1671 | Ga0496107_0018796 | |||
| 1672 | Ga0496108_0000038 | |||
| 1673 | Ga0496108_0072539 | |||
| 1674 | Ga0496108_0917281 | |||
| 1675 | Ga0496108_1526705 | |||
| 1676 | Ga0496108_1638367 | |||
| 1677 | Ga0496109_0000082 | |||
| 1678 | Ga0496109_0179169 | |||
| 1679 | Ga0496109_0287605 | |||
| 1680 | Ga0496109_0538147 | |||
| 1681 | Ga0496110_0004211 | |||
| 1682 | Ga0496110_0009336 | |||
| 1683 | Ga0496111_0013905 | |||
| 1684 | Ga0496112_0000032 | |||
| 1685 | Ga0496112_0001953 | |||
| 1686 | Ga0496112_0027420 | |||
| 1687 | Ga0496112_0033085 | |||
| 1688 | Ga0496112_0036050 | |||
| 1689 | Ga0496112_0088807 | |||
| 1690 | Ga0496112_0136188 | |||
| 1691 | Ga0496112_0340108 | |||
| 1692 | Ga0496112_0603414 | |||
| 1693 | Ga0496112_1062560 | |||
| 1694 | Ga0496112_1341432 | |||
| 1695 | Ga0496113_0000094 | |||
| 1696 | Ga0496113_0037685 | |||
| 1697 | Ga0496113_0274819 | |||
| 1698 | Ga0496115_0839362 | |||
| 1699 | Ga0501309_051378 | |||
| 1700 | Ga0495682_0106691 | |||
| 1701 | Ga0501336_022788 | |||
| 1702 | Ga0501033_0274626 | |||
| 1703 | Ga0501034_0060547 | |||
| 1704 | Ga0501038_0211766 | |||
| 1705 | Ga0501041_0095153 | |||
| 1706 | Ga0501042_0049324 | |||
| 1707 | Ga0501043_0200303 | |||
| 1708 | Ga0501047_0733967 | |||
| 1709 | Ga0501048_0026179 | |||
| 1710 | Ga0501068_0054597 | |||
| 1711 | Ga0501070_0221634 | |||
| 1712 | Ga0501071_0033114 | |||
| 1713 | Ga0501072_0038562 | |||
| 1714 | Ga0501074_0093807 | |||
| 1715 | Ga0501075_0091574 | |||
| 1716 | Ga0501076_0045244 | |||
| 1717 | Ga0501077_0029064 | |||
| 1718 | Ga0501079_0032169 | |||
| 1719 | Ga0501080_0020656 | |||
| 1720 | Ga0501081_0025836 | |||
| 1721 | nmdc:mga05p37_89941_c1 | |||
| 1722 | nmdc:mga0n895_1153707_c1 | |||
| 1723 | nmdc:mga0n895_2935_c1 | |||
| 1724 | nmdc:mga0rr50_16911_c1 | |||
| 1725 | nmdc:mga0rr50_25346_c1 | |||
| 1726 | nmdc:mga0rr50_278377_c1 | |||
| 1727 | nmdc:mga0rr50_49481_c1 | |||
| 1728 | nmdc:mga0rr50_897990_c1 | |||
| 1729 | nmdc:mga08x19_10565_c1 | |||
| 1730 | nmdc:mga08x19_10619_c1 | |||
| 1731 | nmdc:mga08x19_17486_c1 | |||
| 1732 | nmdc:mga08x19_7103_c1 | |||
| 1733 | nmdc:mga0a205_105333_c1 | |||
| 1734 | Ga0495601_0075010 | |||
| 1735 | Ga0501084_0059625 | |||
| 1736 | Ga0587084_005627 | |||
| 1737 | Ga0587093_092808 | |||
| 1738 | Ga0587066_074563 | |||
| 1739 | Ga0587066_082101 | |||
| 1740 | Ga0587070_050091 | |||
| 1741 | Ga0587070_071246 | |||
| 1742 | Ga0587073_0114385 | |||
| 1743 | Ga0587077_117703 | |||
| 1744 | Ga0587080_071306 | |||
| 1745 | Ga0587082_032959 | |||
| 1746 | Ga0587083_0051649 | |||
| 1747 | Ga0587085_074072 | |||
| 1748 | Ga0587086_059047 | |||
| 1749 | Ga0587086_084954 | |||
| 1750 | Ga0587088_048054 | |||
| 1751 | Ga0587089_013953 | |||
| 1752 | Ga0587090_073618 | |||
| 1753 | Ga0587091_049162 | |||
| 1754 | Ga0587092_070919 | |||
| 1755 | Ga0587094_003055 | |||
| 1756 | Ga0587095_032840 | |||
| 1757 | Ga0587098_026330 | |||
| 1758 | Ga0587106_082384 | |||
| 1759 | Ga0587121_09795 | |||
| 1760 | Ga0587129_014469 | |||
| 1761 | Ga0587101_067487 | |||
| 1762 | Ga0587109_014597 | |||
| 1763 | Ga0587113_041067 | |||
| 1764 | Ga0587115_038317 | |||
| 1765 | Ga0587117_038615 | |||
| 1766 | Ga0587128_002672 | |||
| 1767 | Ga0587130_041910 | |||
| 1768 | Ga0587067_021160 | |||
| 1769 | Ga0587068_089638 | |||
| 1770 | Ga0587069_077580 | |||
| 1771 | Ga0587072_102452 | |||
| 1772 | Ga0587075_002426 | |||
| 1773 | Ga0587075_052607 | |||
| 1774 | Ga0587076_047013 | |||
| 1775 | Ga0587079_101105 | |||
| 1776 | Ga0587079_113782 | |||
| 1777 | Ga0587079_125694 | |||
| 1778 | Ga0587105_014321 | |||
| 1779 | Ga0587107_030098 | |||
| 1780 | Ga0587110_000979 | |||
| 1781 | Ga0587114_024436 | |||
| 1782 | Ga0587116_13436 | |||
| 1783 | Ga0587119_046092 | |||
| 1784 | Ga0587120_022357 | |||
| 1785 | Ga0587060_017897 | |||
| 1786 | Ga0587065_09255 | |||
| 1787 | Ga0587071_011718 | |||
| 1788 | Ga0587071_060577 | |||
| 1789 | Ga0587111_0047834 | |||
| 1790 | Ga0501082_0061429 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9614 | 11 | 139 |
| 8fn2-assembly1.cif.gz_L | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9579 | 2 | 140 |
| 5xym-assembly1.cif.gz_J | large subunit of mycobacterium smegmatis | 0.9562 | 3 | 143 |
| 7jql-assembly2.cif.gz_2N | crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution | 0.9558 | 1 | 142 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9543 | 1 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9581 | 1 | 142 | 3.90.1180.10 |
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9558 | 12 | 143 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9515 | 1 | 142 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9513 | 12 | 143 | 3.90.1180.10 |
| af_O96222_56_212_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9464 | 8 | 140 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N5K8K8-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9773 | 1 | 143 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A2S8ST45-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9773 | 2 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A538B112-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9765 | 1 | 140 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A2V7AX71-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9755 | 5 | 140 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-Q83GU7-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9754 | 11 | 143 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |