F484968

General Info

Members Datasets Scaffolds Average Seq Length
895 358 1790 144

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100005905|Ga0070697_1000059053
Length 147
Sequence MSTYFPKEGEIARKWYVVDASGQTLGRLASRVARVLMGKENPKYTPFIDTGDHVIVINAEKLKITGNSKPEAKKYQHYTGYPGGLRTEDFRKRFARKPELVVEEAVSRMLPKTRMGKQMFTKLKVYRGEKHPHQAQKPEAKVLEARA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
284 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 9.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.03
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100005905 3300005536 Bacteria 9451
2 JGI24752J21851_1000333 3300001976 Bacteria 6577
3 JGI24747J21853_1011667 3300001978 Unclassified 891
4 JGI24737J22298_10128303 3300001990 Unclassified 749
5 JGI24033J26618_1001119 3300002155 Bacteria 2604
6 JGI24034J26672_10000133 3300002239 Bacteria 10958
7 JGI24751J29686_10000539 3300002459 Bacteria 10617
8 Ga0058863_11853307 3300004799 Bacteria 725
9 Ga0058861_10015203 3300004800 Bacteria 696
10 Ga0058861_10049083 3300004800 Bacteria 2743
11 Ga0058860_10119967 3300004801 Bacteria 927
12 Ga0058860_12152757 3300004801 Bacteria 581
13 Ga0058860_12189591 3300004801 Bacteria 2063
14 Ga0058862_10110909 3300004803 Bacteria 946
15 Ga0058862_12265877 3300004803 Unclassified 588
16 Ga0065712_10223510 3300005290 Bacteria 1033
17 Ga0065715_10090978 3300005293 Bacteria 6252
18 Ga0065707_10357863 3300005295 Bacteria 908
19 Ga0070658_10834688 3300005327 Bacteria 801
20 Ga0070676_10021768 3300005328 Bacteria 3591
21 Ga0070676_10426347 3300005328 Bacteria 928
22 Ga0070683_100056338 3300005329 Bacteria 3650
23 Ga0070683_100182436 3300005329 Bacteria 1992
24 Ga0070683_100395675 3300005329 Unclassified 1317
25 Ga0070683_100436446 3300005329 Bacteria 1249
26 Ga0070683_100916513 3300005329 Bacteria 841
27 Ga0070683_101638090 3300005329 Bacteria 619
28 Ga0070690_100000645 3300005330 Bacteria 17757
29 Ga0070690_100287955 3300005330 Bacteria 1174
30 Ga0070690_100865613 3300005330 Bacteria 705
31 Ga0070670_100020546 3300005331 Bacteria 5678
32 Ga0070670_100236661 3300005331 Unclassified 1589
33 Ga0070670_100602059 3300005331 Bacteria 983
34 Ga0068869_100001094 3300005334 Bacteria 15789
35 Ga0068869_100001760 3300005334 Bacteria 12948
36 Ga0070666_10019039 3300005335 Bacteria 4426
37 Ga0070680_100358718 3300005336 Bacteria 1240
38 Ga0070680_100385368 3300005336 Bacteria 1194
39 Ga0070682_100059337 3300005337 Bacteria 2416
40 Ga0070682_100094571 3300005337 Bacteria 1961
41 Ga0070682_100193715 3300005337 Bacteria 1429
42 Ga0068868_100006426 3300005338 Bacteria 8319
43 Ga0068868_100015558 3300005338 Bacteria 5630
44 Ga0068868_100018165 3300005338 Bacteria 5252
45 Ga0068868_100036777 3300005338 Bacteria 3792
46 Ga0068868_100327449 3300005338 Bacteria 1307
47 Ga0070660_100037871 3300005339 Bacteria 3657
48 Ga0070660_100162305 3300005339 Bacteria 1801
49 Ga0070691_10089501 3300005341 Bacteria 1516
50 Ga0070687_100440275 3300005343 Bacteria 864
51 Ga0070687_100651952 3300005343 Unclassified 730
52 Ga0070661_100048767 3300005344 Bacteria 3100
53 Ga0070661_100130869 3300005344 Bacteria 1884
54 Ga0070661_100928088 3300005344 Unclassified 719
55 Ga0070692_10129252 3300005345 Bacteria 1418
56 Ga0070668_100013356 3300005347 Bacteria 6128
57 Ga0070668_100257077 3300005347 Bacteria 1451
58 Ga0070669_100176130 3300005353 Bacteria 1670
59 Ga0070669_101108216 3300005353 Bacteria 682
60 Ga0070675_100004860 3300005354 Bacteria 10255
61 Ga0070674_100003003 3300005356 Bacteria 9379
62 Ga0070673_100062794 3300005364 Bacteria 2953
63 Ga0070673_100243730 3300005364 Bacteria 1564
64 Ga0070673_101171178 3300005364 Bacteria 719
65 Ga0070688_100000522 3300005365 Bacteria 19426
66 Ga0070688_100803696 3300005365 Bacteria 736
67 Ga0070659_100005680 3300005366 Bacteria 8973
68 Ga0070659_100394481 3300005366 Bacteria 1167
69 Ga0070659_100646368 3300005366 Bacteria 912
70 Ga0070667_100974782 3300005367 Bacteria 791
71 Ga0070709_10034970 3300005434 Bacteria 3050
72 Ga0070709_10065330 3300005434 Bacteria 2329
73 Ga0070709_10069429 3300005434 Bacteria 2269
74 Ga0070709_10086705 3300005434 Bacteria 2056
75 Ga0070709_10161936 3300005434 Bacteria 1557
76 Ga0070709_10169313 3300005434 Bacteria 1525
77 Ga0070709_10404528 3300005434 Bacteria 1020
78 Ga0070709_10418305 3300005434 Bacteria 1004
79 Ga0070709_10449155 3300005434 Bacteria 971
80 Ga0070714_100011365 3300005435 Bacteria 7063
81 Ga0070714_100136370 3300005435 Bacteria 2198
82 Ga0070714_100180346 3300005435 Bacteria 1921
83 Ga0070714_100300752 3300005435 Bacteria 1496
84 Ga0070714_100372638 3300005435 Bacteria 1344
85 Ga0070714_100472161 3300005435 Unclassified 1194
86 Ga0070714_100544404 3300005435 Bacteria 1111
87 Ga0070714_100620325 3300005435 Bacteria 1040
88 Ga0070714_100797588 3300005435 Bacteria 914
89 Ga0070714_100832231 3300005435 Unclassified 895
90 Ga0070714_101208436 3300005435 Unclassified 737
91 Ga0070714_101340621 3300005435 Bacteria 698
92 Ga0070713_100001466 3300005436 Bacteria 15072
93 Ga0070713_100039322 3300005436 Bacteria 3838
94 Ga0070713_100087851 3300005436 Bacteria 2667
95 Ga0070713_100110484 3300005436 Bacteria 2396
96 Ga0070713_100300995 3300005436 Bacteria 1476
97 Ga0070713_100333025 3300005436 Bacteria 1405
98 Ga0070713_100361455 3300005436 Bacteria 1349
99 Ga0070713_100479556 3300005436 Unclassified 1171
100 Ga0070713_100504859 3300005436 Unclassified 1141
101 Ga0070713_100533891 3300005436 Bacteria 1109
102 Ga0070710_10058048 3300005437 Bacteria 2194
103 Ga0070710_10062029 3300005437 Unclassified 2131
104 Ga0070710_10098188 3300005437 Bacteria 1740
105 Ga0070710_10280919 3300005437 Bacteria 1080
106 Ga0070710_10449083 3300005437 Unclassified 873
107 Ga0070710_10828366 3300005437 Bacteria 663
108 Ga0070710_11269993 3300005437 Unclassified 546
109 Ga0070701_10757998 3300005438 Bacteria 658
110 Ga0070711_100068504 3300005439 Bacteria 2493
111 Ga0070711_100090051 3300005439 Bacteria 2208
112 Ga0070711_100106142 3300005439 Bacteria 2053
113 Ga0070711_100466480 3300005439 Unclassified 1036
114 Ga0070711_100494487 3300005439 Bacteria 1007
115 Ga0070705_100352680 3300005440 Bacteria 1073
116 Ga0070694_100939755 3300005444 Unclassified 715
117 Ga0070708_100003211 3300005445 Bacteria 12753
118 Ga0070708_100026764 3300005445 Bacteria 4940
119 Ga0070708_100042187 3300005445 Bacteria 4003
120 Ga0070708_100045643 3300005445 Bacteria 3862
121 Ga0070708_100168513 3300005445 Bacteria 2043
122 Ga0070708_100245148 3300005445 Bacteria 1683
123 Ga0070708_100423014 3300005445 Bacteria 1256
124 Ga0070708_100471271 3300005445 Unclassified 1185
125 Ga0070708_102128403 3300005445 Unclassified 519
126 Ga0070663_101261915 3300005455 Bacteria 651
127 Ga0070678_100445424 3300005456 Bacteria 1133
128 Ga0070662_100034763 3300005457 Bacteria 3556
129 Ga0070662_100105700 3300005457 Bacteria 2137
130 Ga0070681_10016298 3300005458 Bacteria 7415
131 Ga0068867_100001206 3300005459 Bacteria 17752
132 Ga0068867_100012190 3300005459 Bacteria 6075
133 Ga0068867_100140125 3300005459 Bacteria 1889
134 Ga0070685_10005214 3300005466 Bacteria 6592
135 Ga0070685_10107190 3300005466 Bacteria 1716
136 Ga0070706_100001345 3300005467 Bacteria 26134
137 Ga0070706_100262845 3300005467 Bacteria 1611
138 Ga0070706_100277396 3300005467 Bacteria 1564
139 Ga0070706_100982022 3300005467 Bacteria 779
140 Ga0070706_101133809 3300005467 Bacteria 719
141 Ga0070707_100013995 3300005468 Bacteria 7518
142 Ga0070707_100066666 3300005468 Bacteria 3460
143 Ga0070707_100252127 3300005468 Bacteria 1718
144 Ga0070707_100272459 3300005468 Bacteria 1645
145 Ga0070707_100297076 3300005468 Bacteria 1569
146 Ga0070707_100380369 3300005468 Bacteria 1371
147 Ga0070698_100000247 3300005471 Bacteria 54164
148 Ga0070698_100445342 3300005471 Unclassified 1231
149 Ga0070698_100656032 3300005471 Unclassified 991
150 Ga0070698_100988112 3300005471 Bacteria 789
151 Ga0070698_101071558 3300005471 Bacteria 754
152 Ga0070699_100007000 3300005518 Bacteria 9800
153 Ga0070699_100138983 3300005518 Bacteria 2144
154 Ga0070699_100775072 3300005518 Bacteria 877
155 Ga0070699_100948630 3300005518 Unclassified 788
156 Ga0070679_100021464 3300005530 Bacteria 6305
157 Ga0070679_100126928 3300005530 Bacteria 2533
158 Ga0070679_100353145 3300005530 Bacteria 1418
159 Ga0070679_100848819 3300005530 Bacteria 856
160 Ga0070679_100961009 3300005530 Bacteria 798
161 Ga0070684_100008449 3300005535 Bacteria 8049
162 Ga0070684_100098068 3300005535 Bacteria 2614
163 Ga0070697_100049641 3300005536 Bacteria 3406
164 Ga0070697_100180037 3300005536 Bacteria 1792
165 Ga0070697_100548507 3300005536 Bacteria 1013
166 Ga0070697_100679535 3300005536 Bacteria 908
167 Ga0070697_101365523 3300005536 Unclassified 632
168 Ga0070697_101467189 3300005536 Unclassified 609
169 Ga0068853_100007972 3300005539 Bacteria 8492
170 Ga0068853_100274267 3300005539 Bacteria 1553
171 Ga0068853_100387206 3300005539 Bacteria 1306
172 Ga0068853_101860995 3300005539 Bacteria 583
173 Ga0070672_100004674 3300005543 Bacteria 8978
174 Ga0070672_100589020 3300005543 Bacteria 968
175 Ga0070686_100003553 3300005544 Bacteria 8553
176 Ga0070686_100291272 3300005544 Bacteria 1208
177 Ga0070686_100456180 3300005544 Bacteria 984
178 Ga0070695_100117342 3300005545 Bacteria 1816
179 Ga0070695_100573138 3300005545 Bacteria 883
180 Ga0070696_100031418 3300005546 Bacteria 3639
181 Ga0070696_100236839 3300005546 Bacteria 1375
182 Ga0070696_100335823 3300005546 Bacteria 1167
183 Ga0070693_100197419 3300005547 Bacteria 1305
184 Ga0070693_100247737 3300005547 Bacteria 1180
185 Ga0070693_100891233 3300005547 Bacteria 666
186 Ga0070704_100158377 3300005549 Bacteria 1788
187 Ga0070704_100586745 3300005549 Bacteria 978
188 Ga0068855_100000412 3300005563 Bacteria 52997
189 Ga0068855_100000425 3300005563 Bacteria 52146
190 Ga0068855_100012802 3300005563 Bacteria 10119
191 Ga0068855_100099127 3300005563 Bacteria 3356
192 Ga0068855_100210684 3300005563 Bacteria 2184
193 Ga0068855_100364125 3300005563 Bacteria 1590
194 Ga0068855_100609554 3300005563 Bacteria 1176
195 Ga0068855_101100407 3300005563 Bacteria 831
196 Ga0070664_100002954 3300005564 Bacteria 13751
197 Ga0070664_100036049 3300005564 Bacteria 4154
198 Ga0068857_100000880 3300005577 Bacteria 22656
199 Ga0068857_101781311 3300005577 Bacteria 602
200 Ga0068854_100281361 3300005578 Bacteria 1339
201 Ga0068854_100320533 3300005578 Bacteria 1259
202 Ga0068856_100000708 3300005614 Bacteria 36263
203 Ga0068856_100009508 3300005614 Bacteria 9442
204 Ga0068856_100011409 3300005614 Bacteria 8619
205 Ga0068856_100026004 3300005614 Bacteria 5708
206 Ga0068856_100119825 3300005614 Bacteria 2633
207 Ga0068856_100313851 3300005614 Bacteria 1585
208 Ga0068856_100377141 3300005614 Bacteria 1437
209 Ga0070702_100003657 3300005615 Bacteria 6921
210 Ga0070702_100075663 3300005615 Bacteria 2002
211 Ga0068852_100004983 3300005616 Bacteria 9447
212 Ga0068852_101235354 3300005616 Bacteria 768
213 Ga0068859_100009521 3300005617 Bacteria 9810
214 Ga0068859_100014277 3300005617 Bacteria 7965
215 Ga0068859_100716740 3300005617 Unclassified 1090
216 Ga0068864_100011951 3300005618 Bacteria 7167
217 Ga0068864_100596428 3300005618 Bacteria 1071
218 Ga0068864_101717425 3300005618 Unclassified 632
219 Ga0068864_101717426 3300005618 Bacteria 632
220 Ga0068866_10002761 3300005718 Bacteria 7238
221 Ga0068861_101903618 3300005719 Bacteria 592
222 Ga0068851_10000421 3300005834 Bacteria 18905
223 Ga0068851_10074283 3300005834 Bacteria 1764
224 Ga0068870_10001091 3300005840 Bacteria 10776
225 Ga0068863_100021683 3300005841 Bacteria 6127
226 Ga0068863_100029237 3300005841 Bacteria 5261
227 Ga0068863_100030476 3300005841 Bacteria 5150
228 Ga0068863_100135782 3300005841 Bacteria 2350
229 Ga0068863_100755211 3300005841 Bacteria 969
230 Ga0068858_100006453 3300005842 Bacteria 11420
231 Ga0068858_100089425 3300005842 Bacteria 2865
232 Ga0068858_100315659 3300005842 Bacteria 1493
233 Ga0068858_101082742 3300005842 Bacteria 787
234 Ga0068860_100521295 3300005843 Bacteria 1188
235 Ga0068860_100620718 3300005843 Bacteria 1088
236 Ga0068862_100107179 3300005844 Bacteria 2450
237 Ga0081455_10065203 3300005937 Bacteria 3047
238 Ga0070717_10008717 3300006028 Bacteria 7586
239 Ga0070717_10019045 3300006028 Bacteria 5376
240 Ga0070717_10030041 3300006028 Bacteria 4365
241 Ga0070717_10033607 3300006028 Bacteria 4138
242 Ga0070717_10060143 3300006028 Bacteria 3145
243 Ga0070717_10067657 3300006028 Bacteria 2972
244 Ga0070717_10088146 3300006028 Bacteria 2615
245 Ga0070717_10134805 3300006028 Bacteria 2126
246 Ga0070717_10364703 3300006028 Bacteria 1294
247 Ga0070717_10440243 3300006028 Bacteria 1174
248 Ga0070717_10640809 3300006028 Bacteria 964
249 Ga0070717_11287724 3300006028 Bacteria 665
250 Ga0070715_10653777 3300006163 Bacteria 623
251 Ga0070716_100000337 3300006173 Bacteria 18968
252 Ga0070716_100079952 3300006173 Bacteria 1948
253 Ga0070716_100168265 3300006173 Bacteria 1428
254 Ga0070716_100245736 3300006173 Unclassified 1216
255 Ga0070716_100298334 3300006173 Bacteria 1120
256 Ga0070716_100306097 3300006173 Bacteria 1107
257 Ga0070716_100306257 3300006173 Unclassified 1107
258 Ga0070716_100309238 3300006173 Bacteria 1103
259 Ga0070716_100334886 3300006173 Bacteria 1065
260 Ga0070716_100416571 3300006173 Bacteria 970
261 Ga0070716_100529254 3300006173 Bacteria 875
262 Ga0070712_100024231 3300006175 Bacteria 4018
263 Ga0070712_100044371 3300006175 Bacteria 3065
264 Ga0070712_100198333 3300006175 Bacteria 1575
265 Ga0070712_100210610 3300006175 Bacteria 1532
266 Ga0070712_100333047 3300006175 Bacteria 1237
267 Ga0070712_100856901 3300006175 Unclassified 782
268 Ga0097621_100001137 3300006237 Bacteria 18447
269 Ga0097621_100002010 3300006237 Bacteria 13891
270 Ga0097621_100028973 3300006237 Bacteria 4370
271 Ga0097621_100343215 3300006237 Bacteria 1326
272 Ga0068871_100004576 3300006358 Bacteria 9646
273 Ga0068871_100005383 3300006358 Bacteria 8968
274 Ga0068871_100039234 3300006358 Bacteria 3788
275 Ga0068871_100382482 3300006358 Bacteria 1250
276 Ga0068871_101473243 3300006358 Bacteria 643
277 Ga0075433_10112609 3300006852 Bacteria 2414
278 Ga0075434_100000969 3300006871 Bacteria 23145
279 Ga0075434_101060960 3300006871 Bacteria 824
280 Ga0075436_100000214 3300006914 Bacteria 35630
281 Ga0075436_100000264 3300006914 Bacteria 32917
282 Ga0075436_100047256 3300006914 Unclassified 2968
283 Ga0075436_100063714 3300006914 Unclassified 2548
284 Ga0097620_100009520 3300006931 Bacteria 9810
285 Ga0097620_100014277 3300006931 Bacteria 7965
286 Ga0097620_100716721 3300006931 Unclassified 1090
287 Ga0075435_100006235 3300007076 Bacteria 8420
288 Ga0075435_100061766 3300007076 Bacteria 3040
289 Ga0075435_100237372 3300007076 Bacteria 1550
290 Ga0075435_100307168 3300007076 Bacteria 1357
291 Ga0075435_101193465 3300007076 Unclassified 666
292 Ga0099794_10210383 3300007265 Bacteria 997
293 Ga0099794_10317271 3300007265 Bacteria 808
294 Ga0105250_10040512 3300009092 Bacteria 1868
295 Ga0105240_10092584 3300009093 Bacteria 3691
296 Ga0105240_10311254 3300009093 Bacteria 1798
297 Ga0105240_10672217 3300009093 Bacteria 1133
298 Ga0105240_10744806 3300009093 Bacteria 1066
299 Ga0105240_11149948 3300009093 Unclassified 824
300 Ga0105245_10003216 3300009098 Bacteria 14629
301 Ga0105245_10011809 3300009098 Bacteria 7596
302 Ga0105245_10145589 3300009098 Bacteria 2235
303 Ga0105245_10388126 3300009098 Bacteria 1392
304 Ga0105245_10722596 3300009098 Bacteria 1030
305 Ga0105245_11505017 3300009098 Bacteria 724
306 Ga0105247_10216564 3300009101 Bacteria 1294
307 Ga0114129_10028282 3300009147 Bacteria 7943
308 Ga0105241_10002278 3300009174 Bacteria 14426
309 Ga0105241_10004801 3300009174 Bacteria 9955
310 Ga0105241_10014672 3300009174 Bacteria 5735
311 Ga0105241_10060423 3300009174 Bacteria 2916
312 Ga0105241_10527586 3300009174 Unclassified 1057
313 Ga0105242_10012662 3300009176 Bacteria 6496
314 Ga0105242_11694290 3300009176 Bacteria 668
315 Ga0105248_10007505 3300009177 Bacteria 11963
316 Ga0105248_10011516 3300009177 Bacteria 9746
317 Ga0105248_10098938 3300009177 Bacteria 3286
318 Ga0105237_10011869 3300009545 Bacteria 9211
319 Ga0105237_10046489 3300009545 Unclassified 4365
320 Ga0105237_10051917 3300009545 Bacteria 4118
321 Ga0105237_10093516 3300009545 Bacteria 2996
322 Ga0105237_10626567 3300009545 Bacteria 1082
323 Ga0105237_11086132 3300009545 Bacteria 807
324 Ga0105237_11462330 3300009545 Bacteria 690
325 Ga0105237_11665693 3300009545 Bacteria 645
326 Ga0105238_10068820 3300009551 Bacteria 3541
327 Ga0105238_10144555 3300009551 Bacteria 2355
328 Ga0105238_10244559 3300009551 Bacteria 1772
329 Ga0105238_10574837 3300009551 Bacteria 1133
330 Ga0105249_10003703 3300009553 Bacteria 13185
331 Ga0105249_10052936 3300009553 Bacteria 3709
332 Ga0105249_11278890 3300009553 Bacteria 805
333 Ga0099796_10532096 3300010159 Bacteria 528
334 Ga0105239_10007920 3300010375 Bacteria 12147
335 Ga0105239_10071004 3300010375 Bacteria 3825
336 Ga0105239_10104774 3300010375 Bacteria 3132
337 Ga0105239_10596993 3300010375 Bacteria 1259
338 Ga0105246_10003185 3300011119 Bacteria 9972
339 Ga0105246_10162164 3300011119 Bacteria 1704
340 Ga0105246_10533408 3300011119 Bacteria 1003
341 Ga0157373_10002194 3300013100 Bacteria 14779
342 Ga0157373_10009640 3300013100 Bacteria 7127
343 Ga0157373_10049350 3300013100 Bacteria 2999
344 Ga0157373_10580315 3300013100 Unclassified 815
345 Ga0157371_10004049 3300013102 Bacteria 12967
346 Ga0157371_10186589 3300013102 Bacteria 1484
347 Ga0157370_10054686 3300013104 Bacteria 3805
348 Ga0157370_10091584 3300013104 Bacteria 2854
349 Ga0157370_10393107 3300013104 Bacteria 1277
350 Ga0157369_10023516 3300013105 Bacteria 6863
351 Ga0157369_10023791 3300013105 Bacteria 6821
352 Ga0157369_10032560 3300013105 Bacteria 5732
353 Ga0157369_10057681 3300013105 Bacteria 4188
354 Ga0157369_10062178 3300013105 Bacteria 4024
355 Ga0157369_10198505 3300013105 Bacteria 2106
356 Ga0157369_10279877 3300013105 Bacteria 1737
357 Ga0157374_10001270 3300013296 Bacteria 21533
358 Ga0157374_10002015 3300013296 Bacteria 17048
359 Ga0157374_10002450 3300013296 Bacteria 15672
360 Ga0157374_10029651 3300013296 Bacteria 4958
361 Ga0157374_10340742 3300013296 Bacteria 1488
362 Ga0157378_10000014 3300013297 Bacteria 144214
363 Ga0157378_10006923 3300013297 Bacteria 9901
364 Ga0157378_10089002 3300013297 Bacteria 2803
365 Ga0157378_10215593 3300013297 Bacteria 1822
366 Ga0157378_10265843 3300013297 Bacteria 1647
367 Ga0163162_10061611 3300013306 Bacteria 3789
368 Ga0163162_10240262 3300013306 Unclassified 1942
369 Ga0163162_10291770 3300013306 Bacteria 1763
370 Ga0163162_10306178 3300013306 Bacteria 1721
371 Ga0163162_11570111 3300013306 Bacteria 750
372 Ga0157372_10000641 3300013307 Bacteria 38393
373 Ga0157372_10001892 3300013307 Bacteria 22713
374 Ga0157372_10006851 3300013307 Bacteria 12126
375 Ga0157372_10007257 3300013307 Bacteria 11801
376 Ga0157372_10012316 3300013307 Bacteria 9114
377 Ga0157372_10013531 3300013307 Bacteria 8719
378 Ga0157372_10105242 3300013307 Bacteria 3227
379 Ga0157372_10204060 3300013307 Bacteria 2290
380 Ga0157372_10349991 3300013307 Bacteria 1721
381 Ga0157372_10359310 3300013307 Bacteria 1697
382 Ga0157375_10085013 3300013308 Bacteria 3213
383 Ga0163163_10054270 3300014325 Bacteria 3959
384 Ga0163163_10085695 3300014325 Bacteria 3158
385 Ga0163163_10137842 3300014325 Bacteria 2481
386 Ga0182008_10005969 3300014497 Bacteria 6865
387 Ga0157377_10000286 3300014745 Bacteria 24143
388 Ga0157377_10129718 3300014745 Bacteria 1538
389 Ga0157379_10001394 3300014968 Bacteria 19786
390 Ga0157379_10151934 3300014968 Bacteria 2088
391 Ga0157379_10552304 3300014968 Unclassified 1072
392 Ga0157379_12095781 3300014968 Bacteria 560
393 Ga0157376_10347294 3300014969 Unclassified 1419
394 Ga0157376_10478619 3300014969 Bacteria 1220
395 Ga0157376_11165087 3300014969 Bacteria 798
396 Ga0157376_11435259 3300014969 Bacteria 722
397 Ga0157376_11864836 3300014969 Unclassified 638
398 Ga0182006_1013304 3300015261 Bacteria 3573
399 Ga0182007_10004030 3300015262 Bacteria 6776
400 Ga0182005_1008788 3300015265 Bacteria 2966
401 Ga0182005_1091612 3300015265 Bacteria 846
402 Ga0163161_10001313 3300017792 Bacteria 18509
403 Ga0197907_10259388 3300020069 Bacteria 1065
404 Ga0197907_10379982 3300020069 Unclassified 655
405 Ga0197907_10393248 3300020069 Unclassified 587
406 Ga0206356_10280488 3300020070 Bacteria 2190
407 Ga0206356_10496279 3300020070 Bacteria 1514
408 Ga0206356_10746760 3300020070 Bacteria 762
409 Ga0206356_11322473 3300020070 Bacteria 1528
410 Ga0206356_11595700 3300020070 Bacteria 800
411 Ga0206355_1205801 3300020076 Unclassified 712
412 Ga0206355_1611145 3300020076 Bacteria 658
413 Ga0206355_1710675 3300020076 Bacteria 1172
414 Ga0206352_10099029 3300020078 Bacteria 674
415 Ga0206352_10361514 3300020078 Unclassified 722
416 Ga0206352_10379723 3300020078 Unclassified 560
417 Ga0206352_10719253 3300020078 Unclassified 555
418 Ga0206354_11155912 3300020081 Unclassified 632
419 Ga0206353_10767450 3300020082 Bacteria 714
420 Ga0213873_10014036 3300021358 Bacteria 1769
421 Ga0213876_10257589 3300021384 Unclassified 927
422 Ga0213871_10009484 3300021441 Bacteria 2182
423 Ga0224712_10078995 3300022467 Bacteria 1354
424 Ga0207656_10013653 3300025321 Bacteria 3110
425 Ga0207656_10106029 3300025321 Bacteria 1293
426 Ga0207696_1077647 3300025711 Bacteria 919
427 Ga0207682_10010286 3300025893 Bacteria 3668
428 Ga0207692_10066191 3300025898 Bacteria 1888
429 Ga0207692_10067532 3300025898 Bacteria 1872
430 Ga0207692_10093378 3300025898 Bacteria 1636
431 Ga0207692_10273878 3300025898 Bacteria 1019
432 Ga0207692_10354351 3300025898 Unclassified 905
433 Ga0207710_10250204 3300025900 Bacteria 886
434 Ga0207688_10014322 3300025901 Bacteria 4315
435 Ga0207688_10135995 3300025901 Bacteria 1443
436 Ga0207680_10004156 3300025903 Bacteria 6855
437 Ga0207647_10001732 3300025904 Bacteria 16729
438 Ga0207647_10002148 3300025904 Bacteria 15069
439 Ga0207647_10163554 3300025904 Bacteria 1297
440 Ga0207685_10010190 3300025905 Unclassified 2763
441 Ga0207699_10017946 3300025906 Bacteria 3740
442 Ga0207699_10126345 3300025906 Bacteria 1661
443 Ga0207699_10154341 3300025906 Bacteria 1522
444 Ga0207699_10248565 3300025906 Unclassified 1225
445 Ga0207699_10269209 3300025906 Bacteria 1180
446 Ga0207645_10000781 3300025907 Bacteria 26560
447 Ga0207645_10683589 3300025907 Bacteria 697
448 Ga0207643_10000331 3300025908 Bacteria 32383
449 Ga0207643_10184219 3300025908 Unclassified 1265
450 Ga0207705_10626657 3300025909 Bacteria 836
451 Ga0207684_10000762 3300025910 Bacteria 37545
452 Ga0207684_10410442 3300025910 Unclassified 1164
453 Ga0207684_10481758 3300025910 Bacteria 1064
454 Ga0207684_10581587 3300025910 Bacteria 957
455 Ga0207684_10651965 3300025910 Unclassified 897
456 Ga0207654_10058438 3300025911 Bacteria 2245
457 Ga0207654_10136954 3300025911 Bacteria 1557
458 Ga0207654_10633626 3300025911 Bacteria 765
459 Ga0207707_10988062 3300025912 Bacteria 691
460 Ga0207695_10025321 3300025913 Bacteria 6646
461 Ga0207695_10046026 3300025913 Unclassified 4625
462 Ga0207695_10091917 3300025913 Bacteria 3047
463 Ga0207695_10296569 3300025913 Bacteria 1508
464 Ga0207695_10749816 3300025913 Bacteria 857
465 Ga0207695_11046992 3300025913 Unclassified 696
466 Ga0207671_10211809 3300025914 Bacteria 1516
467 Ga0207671_10256894 3300025914 Bacteria 1374
468 Ga0207671_10283383 3300025914 Bacteria 1307
469 Ga0207671_10625564 3300025914 Bacteria 858
470 Ga0207671_10873400 3300025914 Bacteria 712
471 Ga0207693_10056154 3300025915 Bacteria 3087
472 Ga0207693_10136241 3300025915 Bacteria 1930
473 Ga0207693_10161169 3300025915 Bacteria 1765
474 Ga0207693_10395412 3300025915 Bacteria 1081
475 Ga0207693_10871599 3300025915 Unclassified 692
476 Ga0207693_10876502 3300025915 Unclassified 689
477 Ga0207693_10941769 3300025915 Unclassified 661
478 Ga0207663_10034935 3300025916 Bacteria 3011
479 Ga0207663_10082926 3300025916 Bacteria 2105
480 Ga0207663_10228003 3300025916 Bacteria 1359
481 Ga0207663_10318813 3300025916 Bacteria 1167
482 Ga0207663_11065462 3300025916 Bacteria 649
483 Ga0207660_10684316 3300025917 Bacteria 837
484 Ga0207662_10007837 3300025918 Bacteria 5819
485 Ga0207662_11094865 3300025918 Bacteria 566
486 Ga0207657_10000311 3300025919 Bacteria 51649
487 Ga0207657_10001224 3300025919 Bacteria 27379
488 Ga0207657_10726467 3300025919 Unclassified 770
489 Ga0207649_10002645 3300025920 Bacteria 9951
490 Ga0207649_10091645 3300025920 Bacteria 1991
491 Ga0207649_10728825 3300025920 Bacteria 770
492 Ga0207652_10053021 3300025921 Bacteria 3483
493 Ga0207646_10000334 3300025922 Bacteria 63767
494 Ga0207646_10169662 3300025922 Bacteria 1970
495 Ga0207646_10188153 3300025922 Bacteria 1865
496 Ga0207646_10246739 3300025922 Bacteria 1613
497 Ga0207646_10574927 3300025922 Bacteria 1012
498 Ga0207646_10717185 3300025922 Bacteria 894
499 Ga0207681_10004446 3300025923 Bacteria 8628
500 Ga0207694_10002449 3300025924 Bacteria 15136
501 Ga0207694_10546176 3300025924 Bacteria 972
502 Ga0207650_10000063 3300025925 Bacteria 146432
503 Ga0207650_10130610 3300025925 Bacteria 1965
504 Ga0207687_10118281 3300025927 Bacteria 1978
505 Ga0207687_10277891 3300025927 Bacteria 1341
506 Ga0207700_10006336 3300025928 Bacteria 7137
507 Ga0207700_10023136 3300025928 Bacteria 4278
508 Ga0207700_10036103 3300025928 Bacteria 3566
509 Ga0207700_10194008 3300025928 Bacteria 1708
510 Ga0207700_10212322 3300025928 Bacteria 1637
511 Ga0207700_10233495 3300025928 Unclassified 1565
512 Ga0207700_10246318 3300025928 Bacteria 1525
513 Ga0207700_10249726 3300025928 Bacteria 1515
514 Ga0207700_11964968 3300025928 Unclassified 511
515 Ga0207664_10017981 3300025929 Bacteria 5194
516 Ga0207664_10237584 3300025929 Bacteria 1586
517 Ga0207664_10353084 3300025929 Bacteria 1302
518 Ga0207664_10600581 3300025929 Unclassified 988
519 Ga0207664_10605678 3300025929 Unclassified 984
520 Ga0207664_10632236 3300025929 Bacteria 962
521 Ga0207664_10853600 3300025929 Bacteria 818
522 Ga0207664_11264284 3300025929 Bacteria 657
523 Ga0207664_11483107 3300025929 Unclassified 600
524 Ga0207644_10046541 3300025931 Bacteria 3092
525 Ga0207644_10159473 3300025931 Bacteria 1752
526 Ga0207706_10001937 3300025933 Bacteria 20312
527 Ga0207706_10011223 3300025933 Bacteria 8169
528 Ga0207706_10188964 3300025933 Bacteria 1808
529 Ga0207686_10031774 3300025934 Bacteria 3137
530 Ga0207669_10155811 3300025937 Bacteria 1606
531 Ga0207704_10051107 3300025938 Bacteria 2497
532 Ga0207665_10000109 3300025939 Bacteria 53830
533 Ga0207665_10018023 3300025939 Bacteria 4639
534 Ga0207665_10163066 3300025939 Unclassified 1605
535 Ga0207665_10177682 3300025939 Bacteria 1540
536 Ga0207665_10326866 3300025939 Bacteria 1152
537 Ga0207665_10342508 3300025939 Unclassified 1127
538 Ga0207665_10406511 3300025939 Bacteria 1038
539 Ga0207665_11041113 3300025939 Bacteria 652
540 Ga0207691_10001123 3300025940 Bacteria 26596
541 Ga0207691_10947800 3300025940 Bacteria 719
542 Ga0207711_10008464 3300025941 Bacteria 8606
543 Ga0207711_10071456 3300025941 Bacteria 3011
544 Ga0207711_11283896 3300025941 Bacteria 674
545 Ga0207711_11614070 3300025941 Bacteria 592
546 Ga0207711_11943020 3300025941 Bacteria 531
547 Ga0207689_10000788 3300025942 Bacteria 30435
548 Ga0207689_10001298 3300025942 Bacteria 24081
549 Ga0207689_10338529 3300025942 Bacteria 1250
550 Ga0207661_10000156 3300025944 Bacteria 43880
551 Ga0207661_10394330 3300025944 Bacteria 1254
552 Ga0207661_11519669 3300025944 Bacteria 613
553 Ga0207679_10000588 3300025945 Bacteria 24327
554 Ga0207679_10019528 3300025945 Bacteria 4554
555 Ga0207679_10042347 3300025945 Bacteria 3272
556 Ga0207667_10000311 3300025949 Bacteria 67671
557 Ga0207667_10002505 3300025949 Bacteria 22903
558 Ga0207667_10039985 3300025949 Bacteria 4993
559 Ga0207667_10065378 3300025949 Bacteria 3793
560 Ga0207667_10177848 3300025949 Bacteria 2185
561 Ga0207667_10208343 3300025949 Bacteria 2004
562 Ga0207667_10357656 3300025949 Bacteria 1489
563 Ga0207667_10578464 3300025949 Bacteria 1134
564 Ga0207667_10657295 3300025949 Bacteria 1053
565 Ga0207651_10013008 3300025960 Bacteria 4740
566 Ga0207651_10145880 3300025960 Bacteria 1835
567 Ga0207712_10004653 3300025961 Bacteria 8671
568 Ga0207712_10908271 3300025961 Bacteria 778
569 Ga0207668_10037181 3300025972 Bacteria 3256
570 Ga0207668_10426863 3300025972 Bacteria 1126
571 Ga0207640_10032417 3300025981 Bacteria 3240
572 Ga0207640_10033382 3300025981 Bacteria 3202
573 Ga0207640_10311812 3300025981 Bacteria 1249
574 Ga0207640_10910510 3300025981 Bacteria 769
575 Ga0207658_10007747 3300025986 Bacteria 7320
576 Ga0207658_10218856 3300025986 Bacteria 1601
577 Ga0207658_10799344 3300025986 Bacteria 856
578 Ga0207677_10010740 3300026023 Bacteria 5190
579 Ga0207677_10013130 3300026023 Bacteria 4788
580 Ga0207677_10054589 3300026023 Bacteria 2727
581 Ga0207677_10138460 3300026023 Bacteria 1860
582 Ga0207677_10403739 3300026023 Bacteria 1159
583 Ga0207703_10024629 3300026035 Bacteria 4734
584 Ga0207703_10048979 3300026035 Bacteria 3414
585 Ga0207703_10071441 3300026035 Bacteria 2867
586 Ga0207703_10140315 3300026035 Bacteria 2096
587 Ga0207703_10187592 3300026035 Bacteria 1829
588 Ga0207639_10087303 3300026041 Bacteria 2486
589 Ga0207639_10113851 3300026041 Bacteria 2210
590 Ga0207639_10339503 3300026041 Bacteria 1339
591 Ga0207639_10379256 3300026041 Unclassified 1269
592 Ga0207678_10000443 3300026067 Bacteria 37711
593 Ga0207678_10088544 3300026067 Bacteria 2646
594 Ga0207702_10001803 3300026078 Bacteria 21088
595 Ga0207702_10005756 3300026078 Bacteria 10785
596 Ga0207702_10016352 3300026078 Bacteria 6142
597 Ga0207702_10032318 3300026078 Bacteria 4366
598 Ga0207702_10041367 3300026078 Bacteria 3865
599 Ga0207702_10178860 3300026078 Bacteria 1952
600 Ga0207702_10427422 3300026078 Bacteria 1282
601 Ga0207702_11149992 3300026078 Bacteria 770
602 Ga0207641_10000131 3300026088 Bacteria 110151
603 Ga0207641_10024496 3300026088 Bacteria 4974
604 Ga0207641_10031853 3300026088 Bacteria 4375
605 Ga0207641_10071138 3300026088 Bacteria 2991
606 Ga0207648_10000403 3300026089 Bacteria 48140
607 Ga0207648_10025447 3300026089 Bacteria 5271
608 Ga0207648_10150047 3300026089 Bacteria 2056
609 Ga0207676_10000517 3300026095 Bacteria 32477
610 Ga0207676_10002019 3300026095 Bacteria 14768
611 Ga0207676_10191353 3300026095 Unclassified 1800
612 Ga0207674_10000201 3300026116 Bacteria 74066
613 Ga0207674_10043108 3300026116 Bacteria 4654
614 Ga0207674_10440206 3300026116 Bacteria 1260
615 Ga0207675_100020759 3300026118 Bacteria 6124
616 Ga0207675_100131080 3300026118 Bacteria 2377
617 Ga0207683_10000848 3300026121 Bacteria 28069
618 Ga0207683_10243550 3300026121 Bacteria 1640
619 Ga0207698_10193022 3300026142 Bacteria 1816
620 Ga0207698_10330550 3300026142 Unclassified 1432
621 Ga0268266_10002994 3300028379 Bacteria 17410
622 Ga0268265_10001656 3300028380 Bacteria 18220
623 Ga0268265_10083198 3300028380 Bacteria 2533
624 Ga0268265_10280575 3300028380 Bacteria 1490
625 Ga0268264_10007655 3300028381 Bacteria 9003
626 Ga0268264_10011067 3300028381 Bacteria 7451
627 Ga0268264_11918980 3300028381 Bacteria 602
628 Ga0265338_10036611 3300028800 Bacteria 4692
629 Ga0265338_10374675 3300028800 Bacteria 1019
630 Ga0265324_10069415 3300029957 Bacteria 1201
631 Ga0265328_10009410 3300031239 Bacteria 3982
632 Ga0265340_10381627 3300031247 Unclassified 622
633 Ga0265339_10021469 3300031249 Bacteria 3756
634 Ga0265316_10132755 3300031344 Bacteria 1874
635 Ga0265314_10044113 3300031711 Bacteria 3163
636 Ga0265314_10082356 3300031711 Bacteria 2117
637 Ga0265314_10120725 3300031711 Bacteria 1650
638 Ga0265342_10392731 3300031712 Bacteria 717
639 Ga0316596_1170269 3300033541 Bacteria 601
640 Ga0316214_1023552 3300033545 Bacteria 866
641 Ga0373926_0012789 3300035083 Bacteria 2840
642 Ga0373926_0138165 3300035083 Bacteria 925
643 Ga0373940_0080937 3300035088 Bacteria 960
644 Ga0373923_0229584 3300035111 Bacteria 864
645 Ga0373923_0424996 3300035111 Unclassified 642
646 Ga0373932_0170126 3300035112 Bacteria 759
647 Ga0373932_0211556 3300035112 Bacteria 693
648 Ga0373936_0053999 3300035113 Bacteria 1629
649 Ga0373936_0055321 3300035113 Bacteria 1611
650 Ga0373936_0204904 3300035113 Unclassified 871
651 Ga0373945_0045030 3300035116 Bacteria 1606
652 Ga0373945_0396151 3300035116 Bacteria 604
653 Ga0373954_0027583 3300035118 Bacteria 2608
654 Ga0373960_0003592 3300035121 Bacteria 3515
655 Ga0373960_0048433 3300035121 Bacteria 1254
656 Ga0373943_0007494 3300035170 Bacteria 4902
657 Ga0373943_0049591 3300035170 Bacteria 2061
658 Ga0373943_0138718 3300035170 Bacteria 1308
659 Ga0373946_0021343 3300035171 Bacteria 2511
660 Ga0373946_0626938 3300035171 Bacteria 559
661 Ga0316574_0660618 3300035398 Bacteria 643
662 Ga0373931_0313469 3300035691 Bacteria 972
663 Ga0373931_0355362 3300035691 Bacteria 918
664 Ga0373935_0074198 3300035692 Bacteria 2199
665 Ga0373935_0164212 3300035692 Unclassified 1515
666 Ga0373935_0302885 3300035692 Bacteria 1130
667 Ga0373927_0018456 3300035695 Unclassified 4585
668 Ga0373927_0107053 3300035695 Bacteria 1821
669 Ga0373927_0189028 3300035695 Bacteria 1351
670 Ga0373933_0052829 3300035724 Bacteria 2432
671 Ga0373933_0926142 3300035724 Bacteria 574
672 Ga0373947_0002434 3300035725 Bacteria 11218
673 Ga0373947_0056623 3300035725 Unclassified 2370
674 Ga0373947_0642519 3300035725 Unclassified 723
675 Ga0373937_0422066 3300036401 Bacteria 1266
676 Ga0373925_0002805 3300037068 Bacteria 13763
677 Ga0373925_0027712 3300037068 Bacteria 4147
678 Ga0373925_0042592 3300037068 Bacteria 3368
679 Ga0373925_0071289 3300037068 Bacteria 2628
680 Ga0373925_0406952 3300037068 Unclassified 1110
681 Ga0373925_0888453 3300037068 Unclassified 734
682 Ga0436365_0211838 3300039437 Unclassified 1519
683 Ga0436365_1140187 3300039437 Bacteria 1385
684 Ga0436360_1315790 3300039438 Bacteria 2253
685 Ga0436363_0762804 3300039450 Bacteria 19321
686 Ga0436363_0981179 3300039450 Bacteria 4310
687 Ga0436363_1477014 3300039450 Bacteria 1884
688 Ga0436362_1226293 3300039453 Bacteria 6161
689 Ga0453683_0028557 3300044673 Bacteria 3531
690 Ga0453683_0049430 3300044673 Bacteria 2636
691 Ga0466965_0203899 3300044683 Bacteria 1050
692 Ga0466966_0097075 3300044684 Bacteria 1825
693 Ga0466961_0171277 3300044693 Bacteria 1350
694 Ga0466963_0083604 3300044694 Bacteria 2165
695 Ga0466963_0291452 3300044694 Bacteria 1147
696 Ga0466964_0014346 3300044706 Bacteria 3013
697 Ga0466964_0197370 3300044706 Bacteria 964
698 Ga0453684_0000289 3300044712 Bacteria 215476
699 Ga0453684_0297133 3300044712 Bacteria 1837
700 Ga0453684_2367404 3300044712 Bacteria 527
701 Ga0466957_0130382 3300044842 Unclassified 1610
702 Ga0466959_0043271 3300045049 Bacteria 3320
703 Ga0451576_0003856 3300045051 Bacteria 20119
704 Ga0451576_0359663 3300045051 Bacteria 1524
705 Ga0451576_0529129 3300045051 Bacteria 1238
706 Ga0451576_1572296 3300045051 Bacteria 682
707 Ga0451576_2048307 3300045051 Bacteria 589
708 Ga0466967_0061113 3300045976 Bacteria 3341
709 Ga0466967_0283295 3300045976 Bacteria 1591
710 Ga0466967_0372026 3300045976 Bacteria 1386
711 Ga0466967_0564148 3300045976 Bacteria 1121
712 Ga0466967_0756868 3300045976 Bacteria 963
713 Ga0495603_0131033 3300046455 Bacteria 1460
714 Ga0495603_0146791 3300046455 Bacteria 1371
715 Ga0495651_0416695 3300046462 Bacteria 874
716 Ga0495580_0000603 3300046472 Bacteria 30353
717 Ga0495580_0000888 3300046472 Bacteria 25988
718 Ga0495580_0005807 3300046472 Bacteria 10131
719 Ga0495580_0010140 3300046472 Bacteria 7361
720 Ga0495580_0010801 3300046472 Bacteria 7092
721 Ga0495580_0015319 3300046472 Bacteria 5786
722 Ga0495580_0046244 3300046472 Bacteria 3089
723 Ga0495580_0077375 3300046472 Bacteria 2320
724 Ga0495580_0151866 3300046472 Bacteria 1604
725 Ga0495580_0626255 3300046472 Bacteria 709
726 Ga0495582_0001770 3300046473 Bacteria 12194
727 Ga0495584_0113210 3300046491 Bacteria 1373
728 Ga0495585_0408559 3300046492 Bacteria 653
729 Ga0495594_0154189 3300046499 Bacteria 1304
730 Ga0495666_0101255 3300046526 Bacteria 1357
731 Ga0495665_0004440 3300046531 Bacteria 7577
732 Ga0495665_0093278 3300046531 Unclassified 1582
733 Ga0495665_0481926 3300046531 Unclassified 626
734 Ga0495586_0053408 3300046535 Bacteria 2189
735 Ga0495635_0775584 3300046663 Unclassified 619
736 Ga0495588_0382690 3300046674 Bacteria 739
737 Ga0495623_0146069 3300046679 Bacteria 1402
738 Ga0495623_0568405 3300046679 Unclassified 592
739 Ga0495658_0323909 3300046683 Unclassified 977
740 Ga0495669_0005780 3300046684 Bacteria 5158
741 Ga0495669_0106950 3300046684 Unclassified 1303
742 Ga0495669_0478472 3300046684 Unclassified 605
743 Ga0495624_0328668 3300046690 Unclassified 920
744 Ga0495581_0117280 3300047315 Bacteria 1548
745 Ga0495604_0747202 3300047317 Unclassified 619
746 Ga0495675_0042170 3300047444 Bacteria 2907
747 Ga0495684_0597928 3300047471 Bacteria 745
748 Ga0495602_0189185 3300048088 Bacteria 1580
749 Ga0495614_0373064 3300048089 Bacteria 667
750 Ga0496100_0341030 3300048903 Bacteria 1130
751 Ga0496100_0343288 3300048903 Bacteria 1126
752 Ga0496100_0839818 3300048903 Unclassified 720
753 Ga0496101_0047710 3300048904 Bacteria 3076
754 Ga0496101_0136618 3300048904 Bacteria 1866
755 Ga0496102_0118577 3300048905 Unclassified 2470
756 Ga0496102_0130215 3300048905 Bacteria 2354
757 Ga0496102_0131624 3300048905 Bacteria 2342
758 Ga0496102_0193293 3300048905 Bacteria 1918
759 Ga0496102_0273506 3300048905 Bacteria 1592
760 Ga0496102_0299081 3300048905 Bacteria 1517
761 Ga0496103_0066240 3300048906 Bacteria 2254
762 Ga0496103_0416872 3300048906 Bacteria 862
763 Ga0496103_0542707 3300048906 Bacteria 743
764 Ga0496103_0673226 3300048906 Bacteria 657
765 Ga0496104_0050498 3300048907 Bacteria 3924
766 Ga0496104_0097331 3300048907 Bacteria 2816
767 Ga0496104_0516905 3300048907 Bacteria 1105
768 Ga0496105_0056168 3300048908 Bacteria 3250
769 Ga0496105_0250461 3300048908 Bacteria 1435
770 Ga0496105_0536681 3300048908 Bacteria 915
771 Ga0496106_0029489 3300048909 Bacteria 4089
772 Ga0496106_0091601 3300048909 Bacteria 2347
773 Ga0496106_0521477 3300048909 Bacteria 954
774 Ga0496106_0629123 3300048909 Bacteria 858
775 Ga0496107_0013011 3300048910 Bacteria 5814
776 Ga0496107_0018796 3300048910 Bacteria 4871
777 Ga0496108_0000038 3300048911 Bacteria 149482
778 Ga0496108_0072539 3300048911 Bacteria 2906
779 Ga0496108_0917281 3300048911 Bacteria 751
780 Ga0496108_1526705 3300048911 Bacteria 555
781 Ga0496108_1638367 3300048911 Bacteria 531
782 Ga0496109_0000082 3300048912 Bacteria 99164
783 Ga0496109_0179169 3300048912 Bacteria 1990
784 Ga0496109_0287605 3300048912 Bacteria 1549
785 Ga0496109_0538147 3300048912 Unclassified 1102
786 Ga0496110_0004211 3300048913 Bacteria 11128
787 Ga0496110_0009336 3300048913 Bacteria 7935
788 Ga0496111_0013905 3300048914 Bacteria 5489
789 Ga0496112_0000032 3300048915 Bacteria 116962
790 Ga0496112_0001953 3300048915 Bacteria 16282
791 Ga0496112_0027420 3300048915 Bacteria 5491
792 Ga0496112_0033085 3300048915 Bacteria 5022
793 Ga0496112_0036050 3300048915 Bacteria 4822
794 Ga0496112_0088807 3300048915 Bacteria 3059
795 Ga0496112_0136188 3300048915 Bacteria 2426
796 Ga0496112_0340108 3300048915 Bacteria 1444
797 Ga0496112_0603414 3300048915 Bacteria 1030
798 Ga0496112_1062560 3300048915 Bacteria 728
799 Ga0496112_1341432 3300048915 Unclassified 630
800 Ga0496113_0000094 3300048916 Bacteria 38512
801 Ga0496113_0037685 3300048916 Bacteria 3550
802 Ga0496113_0274819 3300048916 Bacteria 1347
803 Ga0496115_0839362 3300048918 Bacteria 712
804 Ga0501309_051378 3300049129 Bacteria 648
805 Ga0495682_0106691 3300049460 Bacteria 1004
806 Ga0501336_022788 3300049552 Bacteria 579
807 Ga0501033_0274626 3300049570 Bacteria 1191
808 Ga0501034_0060547 3300049571 Bacteria 3803
809 Ga0501038_0211766 3300049574 Bacteria 1550
810 Ga0501041_0095153 3300049577 Bacteria 1840
811 Ga0501042_0049324 3300049578 Bacteria 3003
812 Ga0501043_0200303 3300049579 Bacteria 1550
813 Ga0501047_0733967 3300049581 Bacteria 804
814 Ga0501048_0026179 3300049582 Bacteria 4247
815 Ga0501068_0054597 3300049584 Bacteria 2420
816 Ga0501070_0221634 3300049586 Bacteria 1551
817 Ga0501071_0033114 3300049587 Bacteria 3672
818 Ga0501072_0038562 3300049588 Bacteria 3750
819 Ga0501074_0093807 3300049590 Bacteria 2149
820 Ga0501075_0091574 3300049591 Bacteria 2307
821 Ga0501076_0045244 3300049592 Bacteria 3475
822 Ga0501077_0029064 3300049593 Bacteria 3514
823 Ga0501079_0032169 3300049741 Bacteria 4032
824 Ga0501080_0020656 3300049742 Bacteria 6100
825 Ga0501081_0025836 3300049743 Bacteria 3955
826 nmdc:mga05p37_89941_c1 3300050507 Bacteria 3783
827 nmdc:mga0n895_1153707_c1 3300050512 Bacteria 750
828 nmdc:mga0n895_2935_c1 3300050512 Bacteria 13530
829 nmdc:mga0rr50_16911_c1 3300050513 Bacteria 4857
830 nmdc:mga0rr50_25346_c1 3300050513 Bacteria 4121
831 nmdc:mga0rr50_278377_c1 3300050513 Bacteria 1396
832 nmdc:mga0rr50_49481_c1 3300050513 Bacteria 3111
833 nmdc:mga0rr50_897990_c1 3300050513 Unclassified 755
834 nmdc:mga08x19_10565_c1 3300050514 Bacteria 5549
835 nmdc:mga08x19_10619_c1 3300050514 Bacteria 5536
836 nmdc:mga08x19_17486_c1 3300050514 Bacteria 4388
837 nmdc:mga08x19_7103_c1 3300050514 Bacteria 6648
838 nmdc:mga0a205_105333_c1 3300050515 Bacteria 2719
839 Ga0495601_0075010 3300053077 Bacteria 2165
840 Ga0501084_0059625 3300054114 Bacteria 3194
841 Ga0587084_005627 3300059477 Bacteria 1491
842 Ga0587093_092808 3300059478 Bacteria 536
843 Ga0587066_074563 3300059490 Bacteria 722
844 Ga0587066_082101 3300059490 Bacteria 700
845 Ga0587070_050091 3300059491 Bacteria 831
846 Ga0587070_071246 3300059491 Bacteria 742
847 Ga0587073_0114385 3300059492 Bacteria 720
848 Ga0587077_117703 3300059493 Bacteria 659
849 Ga0587080_071306 3300059503 Bacteria 696
850 Ga0587082_032959 3300059504 Bacteria 913
851 Ga0587083_0051649 3300059505 Bacteria 898
852 Ga0587085_074072 3300059506 Bacteria 672
853 Ga0587086_059047 3300059507 Bacteria 635
854 Ga0587086_084954 3300059507 Bacteria 563
855 Ga0587088_048054 3300059508 Bacteria 827
856 Ga0587089_013953 3300059509 Bacteria 1045
857 Ga0587090_073618 3300059510 Bacteria 672
858 Ga0587091_049162 3300059511 Bacteria 860
859 Ga0587092_070919 3300059512 Bacteria 671
860 Ga0587094_003055 3300059513 Bacteria 1788
861 Ga0587095_032840 3300059514 Bacteria 543
862 Ga0587098_026330 3300059604 Bacteria 774
863 Ga0587106_082384 3300059605 Bacteria 629
864 Ga0587121_09795 3300059606 Bacteria 596
865 Ga0587129_014469 3300059608 Bacteria 649
866 Ga0587101_067487 3300059623 Bacteria 652
867 Ga0587109_014597 3300059624 Bacteria 1321
868 Ga0587113_041067 3300059625 Unclassified 554
869 Ga0587115_038317 3300059626 Bacteria 739
870 Ga0587117_038615 3300059627 Bacteria 752
871 Ga0587128_002672 3300059630 Bacteria 1885
872 Ga0587130_041910 3300059631 Bacteria 555
873 Ga0587067_021160 3300059640 Bacteria 1120
874 Ga0587068_089638 3300059641 Bacteria 632
875 Ga0587069_077580 3300059642 Bacteria 642
876 Ga0587072_102452 3300059643 Bacteria 644
877 Ga0587075_002426 3300059644 Bacteria 1967
878 Ga0587075_052607 3300059644 Bacteria 715
879 Ga0587076_047013 3300059645 Bacteria 828
880 Ga0587079_101105 3300059647 Bacteria 688
881 Ga0587079_113782 3300059647 Bacteria 661
882 Ga0587079_125694 3300059647 Bacteria 639
883 Ga0587105_014321 3300059651 Bacteria 641
884 Ga0587107_030098 3300059652 Bacteria 821
885 Ga0587110_000979 3300059654 Bacteria 1923
886 Ga0587114_024436 3300059655 Bacteria 879
887 Ga0587116_13436 3300059656 Bacteria 576
888 Ga0587119_046092 3300059658 Bacteria 639
889 Ga0587120_022357 3300059659 Bacteria 608
890 Ga0587060_017897 3300060243 Bacteria 658
891 Ga0587065_09255 3300060245 Bacteria 612
892 Ga0587071_011718 3300060344 Bacteria 1483
893 Ga0587071_060577 3300060344 Bacteria 804
894 Ga0587111_0047834 3300060346 Bacteria 934
895 Ga0501082_0061429 3300060353 Bacteria 3234
896 Ga0070697_100005905
897 JGI24752J21851_1000333
898 JGI24747J21853_1011667
899 JGI24737J22298_10128303
900 JGI24033J26618_1001119
901 JGI24034J26672_10000133
902 JGI24751J29686_10000539
903 Ga0058863_11853307
904 Ga0058861_10015203
905 Ga0058861_10049083
906 Ga0058860_10119967
907 Ga0058860_12152757
908 Ga0058860_12189591
909 Ga0058862_10110909
910 Ga0058862_12265877
911 Ga0065712_10223510
912 Ga0065715_10090978
913 Ga0065707_10357863
914 Ga0070658_10834688
915 Ga0070676_10021768
916 Ga0070676_10426347
917 Ga0070683_100056338
918 Ga0070683_100182436
919 Ga0070683_100395675
920 Ga0070683_100436446
921 Ga0070683_100916513
922 Ga0070683_101638090
923 Ga0070690_100000645
924 Ga0070690_100287955
925 Ga0070690_100865613
926 Ga0070670_100020546
927 Ga0070670_100236661
928 Ga0070670_100602059
929 Ga0068869_100001094
930 Ga0068869_100001760
931 Ga0070666_10019039
932 Ga0070680_100358718
933 Ga0070680_100385368
934 Ga0070682_100059337
935 Ga0070682_100094571
936 Ga0070682_100193715
937 Ga0068868_100006426
938 Ga0068868_100015558
939 Ga0068868_100018165
940 Ga0068868_100036777
941 Ga0068868_100327449
942 Ga0070660_100037871
943 Ga0070660_100162305
944 Ga0070691_10089501
945 Ga0070687_100440275
946 Ga0070687_100651952
947 Ga0070661_100048767
948 Ga0070661_100130869
949 Ga0070661_100928088
950 Ga0070692_10129252
951 Ga0070668_100013356
952 Ga0070668_100257077
953 Ga0070669_100176130
954 Ga0070669_101108216
955 Ga0070675_100004860
956 Ga0070674_100003003
957 Ga0070673_100062794
958 Ga0070673_100243730
959 Ga0070673_101171178
960 Ga0070688_100000522
961 Ga0070688_100803696
962 Ga0070659_100005680
963 Ga0070659_100394481
964 Ga0070659_100646368
965 Ga0070667_100974782
966 Ga0070709_10034970
967 Ga0070709_10065330
968 Ga0070709_10069429
969 Ga0070709_10086705
970 Ga0070709_10161936
971 Ga0070709_10169313
972 Ga0070709_10404528
973 Ga0070709_10418305
974 Ga0070709_10449155
975 Ga0070714_100011365
976 Ga0070714_100136370
977 Ga0070714_100180346
978 Ga0070714_100300752
979 Ga0070714_100372638
980 Ga0070714_100472161
981 Ga0070714_100544404
982 Ga0070714_100620325
983 Ga0070714_100797588
984 Ga0070714_100832231
985 Ga0070714_101208436
986 Ga0070714_101340621
987 Ga0070713_100001466
988 Ga0070713_100039322
989 Ga0070713_100087851
990 Ga0070713_100110484
991 Ga0070713_100300995
992 Ga0070713_100333025
993 Ga0070713_100361455
994 Ga0070713_100479556
995 Ga0070713_100504859
996 Ga0070713_100533891
997 Ga0070710_10058048
998 Ga0070710_10062029
999 Ga0070710_10098188
1000 Ga0070710_10280919
1001 Ga0070710_10449083
1002 Ga0070710_10828366
1003 Ga0070710_11269993
1004 Ga0070701_10757998
1005 Ga0070711_100068504
1006 Ga0070711_100090051
1007 Ga0070711_100106142
1008 Ga0070711_100466480
1009 Ga0070711_100494487
1010 Ga0070705_100352680
1011 Ga0070694_100939755
1012 Ga0070708_100003211
1013 Ga0070708_100026764
1014 Ga0070708_100042187
1015 Ga0070708_100045643
1016 Ga0070708_100168513
1017 Ga0070708_100245148
1018 Ga0070708_100423014
1019 Ga0070708_100471271
1020 Ga0070708_102128403
1021 Ga0070663_101261915
1022 Ga0070678_100445424
1023 Ga0070662_100034763
1024 Ga0070662_100105700
1025 Ga0070681_10016298
1026 Ga0068867_100001206
1027 Ga0068867_100012190
1028 Ga0068867_100140125
1029 Ga0070685_10005214
1030 Ga0070685_10107190
1031 Ga0070706_100001345
1032 Ga0070706_100262845
1033 Ga0070706_100277396
1034 Ga0070706_100982022
1035 Ga0070706_101133809
1036 Ga0070707_100013995
1037 Ga0070707_100066666
1038 Ga0070707_100252127
1039 Ga0070707_100272459
1040 Ga0070707_100297076
1041 Ga0070707_100380369
1042 Ga0070698_100000247
1043 Ga0070698_100445342
1044 Ga0070698_100656032
1045 Ga0070698_100988112
1046 Ga0070698_101071558
1047 Ga0070699_100007000
1048 Ga0070699_100138983
1049 Ga0070699_100775072
1050 Ga0070699_100948630
1051 Ga0070679_100021464
1052 Ga0070679_100126928
1053 Ga0070679_100353145
1054 Ga0070679_100848819
1055 Ga0070679_100961009
1056 Ga0070684_100008449
1057 Ga0070684_100098068
1058 Ga0070697_100049641
1059 Ga0070697_100180037
1060 Ga0070697_100548507
1061 Ga0070697_100679535
1062 Ga0070697_101365523
1063 Ga0070697_101467189
1064 Ga0068853_100007972
1065 Ga0068853_100274267
1066 Ga0068853_100387206
1067 Ga0068853_101860995
1068 Ga0070672_100004674
1069 Ga0070672_100589020
1070 Ga0070686_100003553
1071 Ga0070686_100291272
1072 Ga0070686_100456180
1073 Ga0070695_100117342
1074 Ga0070695_100573138
1075 Ga0070696_100031418
1076 Ga0070696_100236839
1077 Ga0070696_100335823
1078 Ga0070693_100197419
1079 Ga0070693_100247737
1080 Ga0070693_100891233
1081 Ga0070704_100158377
1082 Ga0070704_100586745
1083 Ga0068855_100000412
1084 Ga0068855_100000425
1085 Ga0068855_100012802
1086 Ga0068855_100099127
1087 Ga0068855_100210684
1088 Ga0068855_100364125
1089 Ga0068855_100609554
1090 Ga0068855_101100407
1091 Ga0070664_100002954
1092 Ga0070664_100036049
1093 Ga0068857_100000880
1094 Ga0068857_101781311
1095 Ga0068854_100281361
1096 Ga0068854_100320533
1097 Ga0068856_100000708
1098 Ga0068856_100009508
1099 Ga0068856_100011409
1100 Ga0068856_100026004
1101 Ga0068856_100119825
1102 Ga0068856_100313851
1103 Ga0068856_100377141
1104 Ga0070702_100003657
1105 Ga0070702_100075663
1106 Ga0068852_100004983
1107 Ga0068852_101235354
1108 Ga0068859_100009521
1109 Ga0068859_100014277
1110 Ga0068859_100716740
1111 Ga0068864_100011951
1112 Ga0068864_100596428
1113 Ga0068864_101717425
1114 Ga0068864_101717426
1115 Ga0068866_10002761
1116 Ga0068861_101903618
1117 Ga0068851_10000421
1118 Ga0068851_10074283
1119 Ga0068870_10001091
1120 Ga0068863_100021683
1121 Ga0068863_100029237
1122 Ga0068863_100030476
1123 Ga0068863_100135782
1124 Ga0068863_100755211
1125 Ga0068858_100006453
1126 Ga0068858_100089425
1127 Ga0068858_100315659
1128 Ga0068858_101082742
1129 Ga0068860_100521295
1130 Ga0068860_100620718
1131 Ga0068862_100107179
1132 Ga0081455_10065203
1133 Ga0070717_10008717
1134 Ga0070717_10019045
1135 Ga0070717_10030041
1136 Ga0070717_10033607
1137 Ga0070717_10060143
1138 Ga0070717_10067657
1139 Ga0070717_10088146
1140 Ga0070717_10134805
1141 Ga0070717_10364703
1142 Ga0070717_10440243
1143 Ga0070717_10640809
1144 Ga0070717_11287724
1145 Ga0070715_10653777
1146 Ga0070716_100000337
1147 Ga0070716_100079952
1148 Ga0070716_100168265
1149 Ga0070716_100245736
1150 Ga0070716_100298334
1151 Ga0070716_100306097
1152 Ga0070716_100306257
1153 Ga0070716_100309238
1154 Ga0070716_100334886
1155 Ga0070716_100416571
1156 Ga0070716_100529254
1157 Ga0070712_100024231
1158 Ga0070712_100044371
1159 Ga0070712_100198333
1160 Ga0070712_100210610
1161 Ga0070712_100333047
1162 Ga0070712_100856901
1163 Ga0097621_100001137
1164 Ga0097621_100002010
1165 Ga0097621_100028973
1166 Ga0097621_100343215
1167 Ga0068871_100004576
1168 Ga0068871_100005383
1169 Ga0068871_100039234
1170 Ga0068871_100382482
1171 Ga0068871_101473243
1172 Ga0075433_10112609
1173 Ga0075434_100000969
1174 Ga0075434_101060960
1175 Ga0075436_100000214
1176 Ga0075436_100000264
1177 Ga0075436_100047256
1178 Ga0075436_100063714
1179 Ga0097620_100009520
1180 Ga0097620_100014277
1181 Ga0097620_100716721
1182 Ga0075435_100006235
1183 Ga0075435_100061766
1184 Ga0075435_100237372
1185 Ga0075435_100307168
1186 Ga0075435_101193465
1187 Ga0099794_10210383
1188 Ga0099794_10317271
1189 Ga0105250_10040512
1190 Ga0105240_10092584
1191 Ga0105240_10311254
1192 Ga0105240_10672217
1193 Ga0105240_10744806
1194 Ga0105240_11149948
1195 Ga0105245_10003216
1196 Ga0105245_10011809
1197 Ga0105245_10145589
1198 Ga0105245_10388126
1199 Ga0105245_10722596
1200 Ga0105245_11505017
1201 Ga0105247_10216564
1202 Ga0114129_10028282
1203 Ga0105241_10002278
1204 Ga0105241_10004801
1205 Ga0105241_10014672
1206 Ga0105241_10060423
1207 Ga0105241_10527586
1208 Ga0105242_10012662
1209 Ga0105242_11694290
1210 Ga0105248_10007505
1211 Ga0105248_10011516
1212 Ga0105248_10098938
1213 Ga0105237_10011869
1214 Ga0105237_10046489
1215 Ga0105237_10051917
1216 Ga0105237_10093516
1217 Ga0105237_10626567
1218 Ga0105237_11086132
1219 Ga0105237_11462330
1220 Ga0105237_11665693
1221 Ga0105238_10068820
1222 Ga0105238_10144555
1223 Ga0105238_10244559
1224 Ga0105238_10574837
1225 Ga0105249_10003703
1226 Ga0105249_10052936
1227 Ga0105249_11278890
1228 Ga0099796_10532096
1229 Ga0105239_10007920
1230 Ga0105239_10071004
1231 Ga0105239_10104774
1232 Ga0105239_10596993
1233 Ga0105246_10003185
1234 Ga0105246_10162164
1235 Ga0105246_10533408
1236 Ga0157373_10002194
1237 Ga0157373_10009640
1238 Ga0157373_10049350
1239 Ga0157373_10580315
1240 Ga0157371_10004049
1241 Ga0157371_10186589
1242 Ga0157370_10054686
1243 Ga0157370_10091584
1244 Ga0157370_10393107
1245 Ga0157369_10023516
1246 Ga0157369_10023791
1247 Ga0157369_10032560
1248 Ga0157369_10057681
1249 Ga0157369_10062178
1250 Ga0157369_10198505
1251 Ga0157369_10279877
1252 Ga0157374_10001270
1253 Ga0157374_10002015
1254 Ga0157374_10002450
1255 Ga0157374_10029651
1256 Ga0157374_10340742
1257 Ga0157378_10000014
1258 Ga0157378_10006923
1259 Ga0157378_10089002
1260 Ga0157378_10215593
1261 Ga0157378_10265843
1262 Ga0163162_10061611
1263 Ga0163162_10240262
1264 Ga0163162_10291770
1265 Ga0163162_10306178
1266 Ga0163162_11570111
1267 Ga0157372_10000641
1268 Ga0157372_10001892
1269 Ga0157372_10006851
1270 Ga0157372_10007257
1271 Ga0157372_10012316
1272 Ga0157372_10013531
1273 Ga0157372_10105242
1274 Ga0157372_10204060
1275 Ga0157372_10349991
1276 Ga0157372_10359310
1277 Ga0157375_10085013
1278 Ga0163163_10054270
1279 Ga0163163_10085695
1280 Ga0163163_10137842
1281 Ga0182008_10005969
1282 Ga0157377_10000286
1283 Ga0157377_10129718
1284 Ga0157379_10001394
1285 Ga0157379_10151934
1286 Ga0157379_10552304
1287 Ga0157379_12095781
1288 Ga0157376_10347294
1289 Ga0157376_10478619
1290 Ga0157376_11165087
1291 Ga0157376_11435259
1292 Ga0157376_11864836
1293 Ga0182006_1013304
1294 Ga0182007_10004030
1295 Ga0182005_1008788
1296 Ga0182005_1091612
1297 Ga0163161_10001313
1298 Ga0197907_10259388
1299 Ga0197907_10379982
1300 Ga0197907_10393248
1301 Ga0206356_10280488
1302 Ga0206356_10496279
1303 Ga0206356_10746760
1304 Ga0206356_11322473
1305 Ga0206356_11595700
1306 Ga0206355_1205801
1307 Ga0206355_1611145
1308 Ga0206355_1710675
1309 Ga0206352_10099029
1310 Ga0206352_10361514
1311 Ga0206352_10379723
1312 Ga0206352_10719253
1313 Ga0206354_11155912
1314 Ga0206353_10767450
1315 Ga0213873_10014036
1316 Ga0213876_10257589
1317 Ga0213871_10009484
1318 Ga0224712_10078995
1319 Ga0207656_10013653
1320 Ga0207656_10106029
1321 Ga0207696_1077647
1322 Ga0207682_10010286
1323 Ga0207692_10066191
1324 Ga0207692_10067532
1325 Ga0207692_10093378
1326 Ga0207692_10273878
1327 Ga0207692_10354351
1328 Ga0207710_10250204
1329 Ga0207688_10014322
1330 Ga0207688_10135995
1331 Ga0207680_10004156
1332 Ga0207647_10001732
1333 Ga0207647_10002148
1334 Ga0207647_10163554
1335 Ga0207685_10010190
1336 Ga0207699_10017946
1337 Ga0207699_10126345
1338 Ga0207699_10154341
1339 Ga0207699_10248565
1340 Ga0207699_10269209
1341 Ga0207645_10000781
1342 Ga0207645_10683589
1343 Ga0207643_10000331
1344 Ga0207643_10184219
1345 Ga0207705_10626657
1346 Ga0207684_10000762
1347 Ga0207684_10410442
1348 Ga0207684_10481758
1349 Ga0207684_10581587
1350 Ga0207684_10651965
1351 Ga0207654_10058438
1352 Ga0207654_10136954
1353 Ga0207654_10633626
1354 Ga0207707_10988062
1355 Ga0207695_10025321
1356 Ga0207695_10046026
1357 Ga0207695_10091917
1358 Ga0207695_10296569
1359 Ga0207695_10749816
1360 Ga0207695_11046992
1361 Ga0207671_10211809
1362 Ga0207671_10256894
1363 Ga0207671_10283383
1364 Ga0207671_10625564
1365 Ga0207671_10873400
1366 Ga0207693_10056154
1367 Ga0207693_10136241
1368 Ga0207693_10161169
1369 Ga0207693_10395412
1370 Ga0207693_10871599
1371 Ga0207693_10876502
1372 Ga0207693_10941769
1373 Ga0207663_10034935
1374 Ga0207663_10082926
1375 Ga0207663_10228003
1376 Ga0207663_10318813
1377 Ga0207663_11065462
1378 Ga0207660_10684316
1379 Ga0207662_10007837
1380 Ga0207662_11094865
1381 Ga0207657_10000311
1382 Ga0207657_10001224
1383 Ga0207657_10726467
1384 Ga0207649_10002645
1385 Ga0207649_10091645
1386 Ga0207649_10728825
1387 Ga0207652_10053021
1388 Ga0207646_10000334
1389 Ga0207646_10169662
1390 Ga0207646_10188153
1391 Ga0207646_10246739
1392 Ga0207646_10574927
1393 Ga0207646_10717185
1394 Ga0207681_10004446
1395 Ga0207694_10002449
1396 Ga0207694_10546176
1397 Ga0207650_10000063
1398 Ga0207650_10130610
1399 Ga0207687_10118281
1400 Ga0207687_10277891
1401 Ga0207700_10006336
1402 Ga0207700_10023136
1403 Ga0207700_10036103
1404 Ga0207700_10194008
1405 Ga0207700_10212322
1406 Ga0207700_10233495
1407 Ga0207700_10246318
1408 Ga0207700_10249726
1409 Ga0207700_11964968
1410 Ga0207664_10017981
1411 Ga0207664_10237584
1412 Ga0207664_10353084
1413 Ga0207664_10600581
1414 Ga0207664_10605678
1415 Ga0207664_10632236
1416 Ga0207664_10853600
1417 Ga0207664_11264284
1418 Ga0207664_11483107
1419 Ga0207644_10046541
1420 Ga0207644_10159473
1421 Ga0207706_10001937
1422 Ga0207706_10011223
1423 Ga0207706_10188964
1424 Ga0207686_10031774
1425 Ga0207669_10155811
1426 Ga0207704_10051107
1427 Ga0207665_10000109
1428 Ga0207665_10018023
1429 Ga0207665_10163066
1430 Ga0207665_10177682
1431 Ga0207665_10326866
1432 Ga0207665_10342508
1433 Ga0207665_10406511
1434 Ga0207665_11041113
1435 Ga0207691_10001123
1436 Ga0207691_10947800
1437 Ga0207711_10008464
1438 Ga0207711_10071456
1439 Ga0207711_11283896
1440 Ga0207711_11614070
1441 Ga0207711_11943020
1442 Ga0207689_10000788
1443 Ga0207689_10001298
1444 Ga0207689_10338529
1445 Ga0207661_10000156
1446 Ga0207661_10394330
1447 Ga0207661_11519669
1448 Ga0207679_10000588
1449 Ga0207679_10019528
1450 Ga0207679_10042347
1451 Ga0207667_10000311
1452 Ga0207667_10002505
1453 Ga0207667_10039985
1454 Ga0207667_10065378
1455 Ga0207667_10177848
1456 Ga0207667_10208343
1457 Ga0207667_10357656
1458 Ga0207667_10578464
1459 Ga0207667_10657295
1460 Ga0207651_10013008
1461 Ga0207651_10145880
1462 Ga0207712_10004653
1463 Ga0207712_10908271
1464 Ga0207668_10037181
1465 Ga0207668_10426863
1466 Ga0207640_10032417
1467 Ga0207640_10033382
1468 Ga0207640_10311812
1469 Ga0207640_10910510
1470 Ga0207658_10007747
1471 Ga0207658_10218856
1472 Ga0207658_10799344
1473 Ga0207677_10010740
1474 Ga0207677_10013130
1475 Ga0207677_10054589
1476 Ga0207677_10138460
1477 Ga0207677_10403739
1478 Ga0207703_10024629
1479 Ga0207703_10048979
1480 Ga0207703_10071441
1481 Ga0207703_10140315
1482 Ga0207703_10187592
1483 Ga0207639_10087303
1484 Ga0207639_10113851
1485 Ga0207639_10339503
1486 Ga0207639_10379256
1487 Ga0207678_10000443
1488 Ga0207678_10088544
1489 Ga0207702_10001803
1490 Ga0207702_10005756
1491 Ga0207702_10016352
1492 Ga0207702_10032318
1493 Ga0207702_10041367
1494 Ga0207702_10178860
1495 Ga0207702_10427422
1496 Ga0207702_11149992
1497 Ga0207641_10000131
1498 Ga0207641_10024496
1499 Ga0207641_10031853
1500 Ga0207641_10071138
1501 Ga0207648_10000403
1502 Ga0207648_10025447
1503 Ga0207648_10150047
1504 Ga0207676_10000517
1505 Ga0207676_10002019
1506 Ga0207676_10191353
1507 Ga0207674_10000201
1508 Ga0207674_10043108
1509 Ga0207674_10440206
1510 Ga0207675_100020759
1511 Ga0207675_100131080
1512 Ga0207683_10000848
1513 Ga0207683_10243550
1514 Ga0207698_10193022
1515 Ga0207698_10330550
1516 Ga0268266_10002994
1517 Ga0268265_10001656
1518 Ga0268265_10083198
1519 Ga0268265_10280575
1520 Ga0268264_10007655
1521 Ga0268264_10011067
1522 Ga0268264_11918980
1523 Ga0265338_10036611
1524 Ga0265338_10374675
1525 Ga0265324_10069415
1526 Ga0265328_10009410
1527 Ga0265340_10381627
1528 Ga0265339_10021469
1529 Ga0265316_10132755
1530 Ga0265314_10044113
1531 Ga0265314_10082356
1532 Ga0265314_10120725
1533 Ga0265342_10392731
1534 Ga0316596_1170269
1535 Ga0316214_1023552
1536 Ga0373926_0012789
1537 Ga0373926_0138165
1538 Ga0373940_0080937
1539 Ga0373923_0229584
1540 Ga0373923_0424996
1541 Ga0373932_0170126
1542 Ga0373932_0211556
1543 Ga0373936_0053999
1544 Ga0373936_0055321
1545 Ga0373936_0204904
1546 Ga0373945_0045030
1547 Ga0373945_0396151
1548 Ga0373954_0027583
1549 Ga0373960_0003592
1550 Ga0373960_0048433
1551 Ga0373943_0007494
1552 Ga0373943_0049591
1553 Ga0373943_0138718
1554 Ga0373946_0021343
1555 Ga0373946_0626938
1556 Ga0316574_0660618
1557 Ga0373931_0313469
1558 Ga0373931_0355362
1559 Ga0373935_0074198
1560 Ga0373935_0164212
1561 Ga0373935_0302885
1562 Ga0373927_0018456
1563 Ga0373927_0107053
1564 Ga0373927_0189028
1565 Ga0373933_0052829
1566 Ga0373933_0926142
1567 Ga0373947_0002434
1568 Ga0373947_0056623
1569 Ga0373947_0642519
1570 Ga0373937_0422066
1571 Ga0373925_0002805
1572 Ga0373925_0027712
1573 Ga0373925_0042592
1574 Ga0373925_0071289
1575 Ga0373925_0406952
1576 Ga0373925_0888453
1577 Ga0436365_0211838
1578 Ga0436365_1140187
1579 Ga0436360_1315790
1580 Ga0436363_0762804
1581 Ga0436363_0981179
1582 Ga0436363_1477014
1583 Ga0436362_1226293
1584 Ga0453683_0028557
1585 Ga0453683_0049430
1586 Ga0466965_0203899
1587 Ga0466966_0097075
1588 Ga0466961_0171277
1589 Ga0466963_0083604
1590 Ga0466963_0291452
1591 Ga0466964_0014346
1592 Ga0466964_0197370
1593 Ga0453684_0000289
1594 Ga0453684_0297133
1595 Ga0453684_2367404
1596 Ga0466957_0130382
1597 Ga0466959_0043271
1598 Ga0451576_0003856
1599 Ga0451576_0359663
1600 Ga0451576_0529129
1601 Ga0451576_1572296
1602 Ga0451576_2048307
1603 Ga0466967_0061113
1604 Ga0466967_0283295
1605 Ga0466967_0372026
1606 Ga0466967_0564148
1607 Ga0466967_0756868
1608 Ga0495603_0131033
1609 Ga0495603_0146791
1610 Ga0495651_0416695
1611 Ga0495580_0000603
1612 Ga0495580_0000888
1613 Ga0495580_0005807
1614 Ga0495580_0010140
1615 Ga0495580_0010801
1616 Ga0495580_0015319
1617 Ga0495580_0046244
1618 Ga0495580_0077375
1619 Ga0495580_0151866
1620 Ga0495580_0626255
1621 Ga0495582_0001770
1622 Ga0495584_0113210
1623 Ga0495585_0408559
1624 Ga0495594_0154189
1625 Ga0495666_0101255
1626 Ga0495665_0004440
1627 Ga0495665_0093278
1628 Ga0495665_0481926
1629 Ga0495586_0053408
1630 Ga0495635_0775584
1631 Ga0495588_0382690
1632 Ga0495623_0146069
1633 Ga0495623_0568405
1634 Ga0495658_0323909
1635 Ga0495669_0005780
1636 Ga0495669_0106950
1637 Ga0495669_0478472
1638 Ga0495624_0328668
1639 Ga0495581_0117280
1640 Ga0495604_0747202
1641 Ga0495675_0042170
1642 Ga0495684_0597928
1643 Ga0495602_0189185
1644 Ga0495614_0373064
1645 Ga0496100_0341030
1646 Ga0496100_0343288
1647 Ga0496100_0839818
1648 Ga0496101_0047710
1649 Ga0496101_0136618
1650 Ga0496102_0118577
1651 Ga0496102_0130215
1652 Ga0496102_0131624
1653 Ga0496102_0193293
1654 Ga0496102_0273506
1655 Ga0496102_0299081
1656 Ga0496103_0066240
1657 Ga0496103_0416872
1658 Ga0496103_0542707
1659 Ga0496103_0673226
1660 Ga0496104_0050498
1661 Ga0496104_0097331
1662 Ga0496104_0516905
1663 Ga0496105_0056168
1664 Ga0496105_0250461
1665 Ga0496105_0536681
1666 Ga0496106_0029489
1667 Ga0496106_0091601
1668 Ga0496106_0521477
1669 Ga0496106_0629123
1670 Ga0496107_0013011
1671 Ga0496107_0018796
1672 Ga0496108_0000038
1673 Ga0496108_0072539
1674 Ga0496108_0917281
1675 Ga0496108_1526705
1676 Ga0496108_1638367
1677 Ga0496109_0000082
1678 Ga0496109_0179169
1679 Ga0496109_0287605
1680 Ga0496109_0538147
1681 Ga0496110_0004211
1682 Ga0496110_0009336
1683 Ga0496111_0013905
1684 Ga0496112_0000032
1685 Ga0496112_0001953
1686 Ga0496112_0027420
1687 Ga0496112_0033085
1688 Ga0496112_0036050
1689 Ga0496112_0088807
1690 Ga0496112_0136188
1691 Ga0496112_0340108
1692 Ga0496112_0603414
1693 Ga0496112_1062560
1694 Ga0496112_1341432
1695 Ga0496113_0000094
1696 Ga0496113_0037685
1697 Ga0496113_0274819
1698 Ga0496115_0839362
1699 Ga0501309_051378
1700 Ga0495682_0106691
1701 Ga0501336_022788
1702 Ga0501033_0274626
1703 Ga0501034_0060547
1704 Ga0501038_0211766
1705 Ga0501041_0095153
1706 Ga0501042_0049324
1707 Ga0501043_0200303
1708 Ga0501047_0733967
1709 Ga0501048_0026179
1710 Ga0501068_0054597
1711 Ga0501070_0221634
1712 Ga0501071_0033114
1713 Ga0501072_0038562
1714 Ga0501074_0093807
1715 Ga0501075_0091574
1716 Ga0501076_0045244
1717 Ga0501077_0029064
1718 Ga0501079_0032169
1719 Ga0501080_0020656
1720 Ga0501081_0025836
1721 nmdc:mga05p37_89941_c1
1722 nmdc:mga0n895_1153707_c1
1723 nmdc:mga0n895_2935_c1
1724 nmdc:mga0rr50_16911_c1
1725 nmdc:mga0rr50_25346_c1
1726 nmdc:mga0rr50_278377_c1
1727 nmdc:mga0rr50_49481_c1
1728 nmdc:mga0rr50_897990_c1
1729 nmdc:mga08x19_10565_c1
1730 nmdc:mga08x19_10619_c1
1731 nmdc:mga08x19_17486_c1
1732 nmdc:mga08x19_7103_c1
1733 nmdc:mga0a205_105333_c1
1734 Ga0495601_0075010
1735 Ga0501084_0059625
1736 Ga0587084_005627
1737 Ga0587093_092808
1738 Ga0587066_074563
1739 Ga0587066_082101
1740 Ga0587070_050091
1741 Ga0587070_071246
1742 Ga0587073_0114385
1743 Ga0587077_117703
1744 Ga0587080_071306
1745 Ga0587082_032959
1746 Ga0587083_0051649
1747 Ga0587085_074072
1748 Ga0587086_059047
1749 Ga0587086_084954
1750 Ga0587088_048054
1751 Ga0587089_013953
1752 Ga0587090_073618
1753 Ga0587091_049162
1754 Ga0587092_070919
1755 Ga0587094_003055
1756 Ga0587095_032840
1757 Ga0587098_026330
1758 Ga0587106_082384
1759 Ga0587121_09795
1760 Ga0587129_014469
1761 Ga0587101_067487
1762 Ga0587109_014597
1763 Ga0587113_041067
1764 Ga0587115_038317
1765 Ga0587117_038615
1766 Ga0587128_002672
1767 Ga0587130_041910
1768 Ga0587067_021160
1769 Ga0587068_089638
1770 Ga0587069_077580
1771 Ga0587072_102452
1772 Ga0587075_002426
1773 Ga0587075_052607
1774 Ga0587076_047013
1775 Ga0587079_101105
1776 Ga0587079_113782
1777 Ga0587079_125694
1778 Ga0587105_014321
1779 Ga0587107_030098
1780 Ga0587110_000979
1781 Ga0587114_024436
1782 Ga0587116_13436
1783 Ga0587119_046092
1784 Ga0587120_022357
1785 Ga0587060_017897
1786 Ga0587065_09255
1787 Ga0587071_011718
1788 Ga0587071_060577
1789 Ga0587111_0047834
1790 Ga0501082_0061429

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

13

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9614 11 139
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9579 2 140
5xym-assembly1.cif.gz_J large subunit of mycobacterium smegmatis 0.9562 3 143
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9558 1 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9543 1 140
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9581 1 142 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9558 12 143 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9515 1 142 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9513 12 143 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9464 8 140 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A2N5K8K8-F1-model_v4 Large ribosomal subunit protein uL13 0.9773 1 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A2S8ST45-F1-model_v4 Large ribosomal subunit protein uL13 0.9773 2 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A538B112-F1-model_v4 Large ribosomal subunit protein uL13 0.9765 1 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A2V7AX71-F1-model_v4 Large ribosomal subunit protein uL13 0.9755 5 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-Q83GU7-F1-model_v4 Large ribosomal subunit protein uL13 0.9754 11 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map