F484953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 894 | 414 | 673 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0421199|Ga0501043_0421199_234_872 |
| Length | 204 |
| Sequence | MEKQMSKPYVRLDKNNAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALADLAAYFKLPTILTTSFEDGPNGPLVPELKQIVPGQINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIAEGFDVFVVTDASGTFNAITRDAAWERMTAAGAQLMSWFGVACELHRDWRNDVEGLGALFSNHIPDYRNLITAYTTVSSKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 5 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 6 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 7 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 8 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 9 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 10 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 11 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 12 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 13 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 14 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 15 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 16 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 17 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 18 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 19 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 20 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 21 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 22 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 23 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 24 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 25 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 26 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 27 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 28 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 29 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 30 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 31 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 32 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 33 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 34 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 35 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 36 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 37 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 38 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 39 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 40 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 41 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 42 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 43 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 44 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 45 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 46 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 47 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 48 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 49 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 50 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 51 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 52 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 53 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 54 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 55 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 56 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 57 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 58 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 59 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 60 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 61 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 62 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 63 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 64 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 65 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 66 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 67 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 68 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 69 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 70 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 71 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 72 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 73 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 74 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 75 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 76 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 77 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 78 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 79 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 80 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 81 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 82 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 83 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 84 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 85 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 86 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 87 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 88 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 89 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 90 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 91 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 92 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 93 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 94 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 95 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 96 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 97 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 98 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 99 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 100 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 101 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 102 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 103 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 104 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 105 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 106 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 107 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 108 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 109 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 110 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 111 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 112 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 113 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 114 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 115 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 116 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 117 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 118 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 119 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 120 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 121 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 122 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 123 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 124 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 125 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 126 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 127 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 128 | 2941479691 | |||
| 129 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 130 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 131 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 132 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 133 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 134 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 135 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 136 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 137 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 138 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 139 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 140 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 141 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 142 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 143 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 144 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 145 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 146 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 147 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 148 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 149 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 150 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 151 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 152 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 153 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 154 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 155 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 156 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 157 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 158 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 159 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 160 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 161 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 162 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 164 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 165 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 171 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 172 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 174 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 175 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 176 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 177 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 178 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 179 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 180 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 181 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 183 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 184 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 185 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 186 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 197 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 205 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 250 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 260 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 261 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 262 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 263 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 264 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 265 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 274 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 281 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 395 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 396 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 397 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 398 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 399 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 400 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 401 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 402 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 403 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 404 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 405 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 406 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 407 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 408 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 409 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 410 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 411 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 412 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 413 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 414 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.17 |
| Metatranscriptomes | 0.56 |
| Isolates | 23.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.61 |
| Nodule | 3.13 |
| Rhizoplane | 2.46 |
| Rhizosphere | 63.53 |
| Stem | 0.11 |
| Stem Tuber | 0 |
| Unclassified | 22.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1285905 | 2162886007 | Bacteria | 1774 |
| 2 | SwRhRL2b_contig_150973 | 2162886007 | Bacteria | 882 |
| 3 | SwRhRL2b_contig_2968351 | 2162886007 | Bacteria | 3334 |
| 4 | SwRhRL2b_contig_3730156 | 2162886007 | Bacteria | 1552 |
| 5 | JGI25158J39367_1000331 | 3300002739 | Bacteria | 10490 |
| 6 | JGI25152J39213_1000856 | 3300002773 | Bacteria | 15060 |
| 7 | JGI25159J45721_1002851 | 3300002987 | Bacteria | 6344 |
| 8 | JGI25151J46595_10003449 | 3300003187 | Bacteria | 8735 |
| 9 | rootH2_10069019 | 3300003320 | Bacteria | 6274 |
| 10 | rootH1_10142104 | 3300003323 | Bacteria | 1685 |
| 11 | JGI25161J50226_1000500 | 3300003374 | Bacteria | 17353 |
| 12 | Ga0006562J51391_1139573 | 3300003578 | Bacteria | 2046 |
| 13 | Ga0055538_1001219 | 3300003751 | Bacteria | 5363 |
| 14 | Ga0055526_1001559 | 3300003771 | Bacteria | 16179 |
| 15 | Ga0055526_1001572 | 3300003771 | Bacteria | 16064 |
| 16 | Ga0055526_1005545 | 3300003771 | Bacteria | 7215 |
| 17 | Ga0055526_1007392 | 3300003771 | Bacteria | 5720 |
| 18 | Ga0055537_1002144 | 3300003773 | Bacteria | 6892 |
| 19 | Ga0055524_1000731 | 3300003775 | Bacteria | 22525 |
| 20 | Ga0055524_1004607 | 3300003775 | Bacteria | 6337 |
| 21 | Ga0055536_1000058 | 3300003781 | Bacteria | 104496 |
| 22 | Ga0055536_1000458 | 3300003781 | Bacteria | 28710 |
| 23 | Ga0055534_1000751 | 3300003784 | Bacteria | 15491 |
| 24 | Ga0055534_1010125 | 3300003784 | Bacteria | 1998 |
| 25 | Ga0055530_10001636 | 3300003791 | Bacteria | 16017 |
| 26 | Ga0055540_1000344 | 3300003792 | Bacteria | 39592 |
| 27 | Ga0055541_1001161 | 3300003841 | Bacteria | 5904 |
| 28 | Ga0058692_1002490 | 3300003856 | Bacteria | 6142 |
| 29 | Ga0055543_1001678 | 3300004625 | Bacteria | 8401 |
| 30 | Ga0065165_1003101 | 3300005262 | Bacteria | 12363 |
| 31 | Ga0065165_1034065 | 3300005262 | Bacteria | 1579 |
| 32 | Ga0065703_1000561 | 3300005272 | Bacteria | 6166 |
| 33 | Ga0065714_10002206 | 3300005288 | Bacteria | 60276 |
| 34 | Ga0065714_10070299 | 3300005288 | Bacteria | 3906 |
| 35 | Ga0065704_10004276 | 3300005289 | Bacteria | 6405 |
| 36 | Ga0065704_10079174 | 3300005289 | Bacteria | 4220 |
| 37 | Ga0065704_10096582 | 3300005289 | Bacteria | 2426 |
| 38 | Ga0065704_10098658 | 3300005289 | Bacteria | 2344 |
| 39 | Ga0065704_10124566 | 3300005289 | Bacteria | 1702 |
| 40 | Ga0065704_10163538 | 3300005289 | Bacteria | 1338 |
| 41 | Ga0070669_100584433 | 3300005353 | Bacteria | 934 |
| 42 | Ga0070662_100865934 | 3300005457 | Bacteria | 770 |
| 43 | Ga0070665_100151506 | 3300005548 | Bacteria | 2322 |
| 44 | Ga0068859_100190329 | 3300005617 | Bacteria | 2136 |
| 45 | Ga0081455_10017544 | 3300005937 | Bacteria | 6858 |
| 46 | Ga0081455_10092321 | 3300005937 | Bacteria | 2449 |
| 47 | Ga0070717_10667348 | 3300006028 | Bacteria | 944 |
| 48 | Ga0075363_100009224 | 3300006048 | Bacteria | 4635 |
| 49 | Ga0075364_10077656 | 3300006051 | Bacteria | 2192 |
| 50 | Ga0075364_10169985 | 3300006051 | Bacteria | 1473 |
| 51 | Ga0075364_10219983 | 3300006051 | Bacteria | 1289 |
| 52 | Ga0075364_10393324 | 3300006051 | Bacteria | 946 |
| 53 | Ga0075432_10033565 | 3300006058 | Bacteria | 1781 |
| 54 | Ga0075432_10076629 | 3300006058 | Bacteria | 1207 |
| 55 | Ga0075432_10089266 | 3300006058 | Bacteria | 1127 |
| 56 | Ga0075362_10058435 | 3300006177 | Bacteria | 1739 |
| 57 | Ga0075362_10174184 | 3300006177 | Bacteria | 1040 |
| 58 | Ga0075370_10347356 | 3300006353 | Bacteria | 886 |
| 59 | Ga0075430_100310557 | 3300006846 | Bacteria | 1304 |
| 60 | Ga0075431_100599436 | 3300006847 | Bacteria | 1086 |
| 61 | Ga0075436_100240524 | 3300006914 | Bacteria | 1287 |
| 62 | Ga0075436_100366636 | 3300006914 | Bacteria | 1040 |
| 63 | Ga0097620_100190318 | 3300006931 | Bacteria | 2136 |
| 64 | Ga0099823_1000275 | 3300006944 | Bacteria | 30639 |
| 65 | Ga0099823_1032813 | 3300006944 | Bacteria | 4205 |
| 66 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 67 | Ga0079104_1000176 | 3300006946 | Bacteria | 91230 |
| 68 | Ga0079104_1000700 | 3300006946 | Bacteria | 30527 |
| 69 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 70 | Ga0075435_100802479 | 3300007076 | Bacteria | 819 |
| 71 | Ga0105251_10000042 | 3300009011 | Bacteria | 114031 |
| 72 | Ga0105251_10000073 | 3300009011 | Bacteria | 97270 |
| 73 | Ga0105251_10000391 | 3300009011 | Bacteria | 42881 |
| 74 | Ga0105251_10000582 | 3300009011 | Bacteria | 33639 |
| 75 | Ga0105251_10000666 | 3300009011 | Bacteria | 31657 |
| 76 | Ga0105251_10015013 | 3300009011 | Bacteria | 4250 |
| 77 | Ga0105251_10113377 | 3300009011 | Bacteria | 1234 |
| 78 | Ga0105244_10000026 | 3300009036 | Bacteria | 216056 |
| 79 | Ga0105244_10000071 | 3300009036 | Bacteria | 117110 |
| 80 | Ga0105244_10000799 | 3300009036 | Bacteria | 26810 |
| 81 | Ga0105244_10009450 | 3300009036 | Bacteria | 5992 |
| 82 | Ga0105244_10013896 | 3300009036 | Bacteria | 4678 |
| 83 | Ga0105244_10014292 | 3300009036 | Bacteria | 4597 |
| 84 | Ga0105244_10040086 | 3300009036 | Bacteria | 2434 |
| 85 | Ga0105244_10106183 | 3300009036 | Bacteria | 1370 |
| 86 | Ga0105244_10109731 | 3300009036 | Bacteria | 1343 |
| 87 | Ga0105244_10225347 | 3300009036 | Bacteria | 878 |
| 88 | Ga0105250_10000059 | 3300009092 | Bacteria | 109549 |
| 89 | Ga0105250_10000310 | 3300009092 | Bacteria | 38190 |
| 90 | Ga0105250_10011998 | 3300009092 | Bacteria | 3587 |
| 91 | Ga0105250_10013843 | 3300009092 | Bacteria | 3322 |
| 92 | Ga0105250_10033127 | 3300009092 | Bacteria | 2074 |
| 93 | Ga0105250_10035365 | 3300009092 | Bacteria | 2004 |
| 94 | Ga0105250_10037558 | 3300009092 | Bacteria | 1944 |
| 95 | Ga0105250_10130841 | 3300009092 | Bacteria | 1036 |
| 96 | Ga0111539_10015990 | 3300009094 | Bacteria | 9321 |
| 97 | Ga0111539_10089953 | 3300009094 | Bacteria | 3608 |
| 98 | Ga0105247_10000187 | 3300009101 | Bacteria | 60332 |
| 99 | Ga0114129_10026761 | 3300009147 | Bacteria | 8169 |
| 100 | Ga0114129_11236404 | 3300009147 | Bacteria | 929 |
| 101 | Ga0105243_10000547 | 3300009148 | Bacteria | 37977 |
| 102 | Ga0105243_10000736 | 3300009148 | Bacteria | 31344 |
| 103 | Ga0105243_10001371 | 3300009148 | Bacteria | 21570 |
| 104 | Ga0105243_10001783 | 3300009148 | Bacteria | 18473 |
| 105 | Ga0105243_10039987 | 3300009148 | Bacteria | 3659 |
| 106 | Ga0105243_10048163 | 3300009148 | Bacteria | 3359 |
| 107 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 108 | Ga0105248_10971349 | 3300009177 | Bacteria | 959 |
| 109 | Ga0105249_10000138 | 3300009553 | Bacteria | 95736 |
| 110 | Ga0157345_1000004 | 3300012498 | Bacteria | 80365 |
| 111 | Ga0157373_10000039 | 3300013100 | Bacteria | 117160 |
| 112 | Ga0157373_10062091 | 3300013100 | Bacteria | 2646 |
| 113 | Ga0157373_10260503 | 3300013100 | Bacteria | 1227 |
| 114 | Ga0157371_10026820 | 3300013102 | Bacteria | 4184 |
| 115 | Ga0157371_10431531 | 3300013102 | Bacteria | 967 |
| 116 | Ga0157370_10001493 | 3300013104 | Bacteria | 28957 |
| 117 | Ga0157370_10001741 | 3300013104 | Bacteria | 26789 |
| 118 | Ga0157370_10031541 | 3300013104 | Bacteria | 5182 |
| 119 | Ga0157369_10007171 | 3300013105 | Bacteria | 12844 |
| 120 | Ga0157374_10201811 | 3300013296 | Bacteria | 1947 |
| 121 | Ga0163162_10000067 | 3300013306 | Bacteria | 99435 |
| 122 | Ga0157372_10000672 | 3300013307 | Bacteria | 37619 |
| 123 | Ga0182008_10013747 | 3300014497 | Bacteria | 4252 |
| 124 | Ga0182008_10033799 | 3300014497 | Bacteria | 2565 |
| 125 | Ga0182008_10034689 | 3300014497 | Bacteria | 2529 |
| 126 | Ga0182006_1023968 | 3300015261 | Bacteria | 2522 |
| 127 | Ga0182006_1080183 | 3300015261 | Bacteria | 1192 |
| 128 | Ga0163161_10000004 | 3300017792 | Bacteria | 333149 |
| 129 | Ga0163161_10000066 | 3300017792 | Bacteria | 107442 |
| 130 | Ga0209436_100445 | 3300025208 | Bacteria | 18569 |
| 131 | Ga0209784_100360 | 3300025224 | Bacteria | 21994 |
| 132 | Ga0209566_100666 | 3300025225 | Bacteria | 20564 |
| 133 | Ga0209674_102378 | 3300025226 | Bacteria | 4083 |
| 134 | Ga0207425_1010707 | 3300025245 | Bacteria | 2220 |
| 135 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 136 | Ga0209565_1000053 | 3300025263 | Bacteria | 210249 |
| 137 | Ga0209565_1000176 | 3300025263 | Bacteria | 81062 |
| 138 | Ga0209565_1002293 | 3300025263 | Bacteria | 7026 |
| 139 | Ga0209673_1020634 | 3300025273 | Bacteria | 2328 |
| 140 | Ga0209130_1001179 | 3300025284 | Bacteria | 18686 |
| 141 | Ga0209675_1000091 | 3300025291 | Bacteria | 146390 |
| 142 | Ga0209675_1000167 | 3300025291 | Bacteria | 79477 |
| 143 | Ga0209675_1000328 | 3300025291 | Bacteria | 41805 |
| 144 | Ga0209675_1015036 | 3300025291 | Bacteria | 2321 |
| 145 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 146 | Ga0209676_1000210 | 3300025292 | Bacteria | 130159 |
| 147 | Ga0209676_1001409 | 3300025292 | Bacteria | 23191 |
| 148 | Ga0209676_1002285 | 3300025292 | Bacteria | 14011 |
| 149 | Ga0209676_1003474 | 3300025292 | Bacteria | 9667 |
| 150 | Ga0209676_1035086 | 3300025292 | Bacteria | 1475 |
| 151 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 152 | Ga0209025_1000085 | 3300025294 | Bacteria | 263782 |
| 153 | Ga0209025_1000098 | 3300025294 | Bacteria | 233886 |
| 154 | Ga0209564_1000084 | 3300025295 | Bacteria | 252729 |
| 155 | Ga0209564_1000376 | 3300025295 | Bacteria | 82120 |
| 156 | Ga0209564_1000421 | 3300025295 | Bacteria | 74558 |
| 157 | Ga0209564_1000666 | 3300025295 | Bacteria | 50795 |
| 158 | Ga0209564_1001130 | 3300025295 | Bacteria | 31388 |
| 159 | Ga0209564_1016648 | 3300025295 | Bacteria | 2910 |
| 160 | Ga0209050_1000754 | 3300025298 | Bacteria | 46538 |
| 161 | Ga0209050_1002114 | 3300025298 | Bacteria | 18120 |
| 162 | Ga0209050_1008876 | 3300025298 | Bacteria | 5263 |
| 163 | Ga0209256_1000073 | 3300025299 | Bacteria | 237553 |
| 164 | Ga0209256_1000517 | 3300025299 | Bacteria | 56494 |
| 165 | Ga0209256_1001071 | 3300025299 | Bacteria | 31723 |
| 166 | Ga0209256_1001352 | 3300025299 | Bacteria | 25972 |
| 167 | Ga0207426_1034175 | 3300025302 | Bacteria | 1633 |
| 168 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 169 | Ga0209051_1019117 | 3300025303 | Bacteria | 3002 |
| 170 | Ga0209257_1021335 | 3300025304 | Bacteria | 2356 |
| 171 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 172 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 173 | Ga0207696_1000033 | 3300025711 | Bacteria | 360689 |
| 174 | Ga0207696_1000172 | 3300025711 | Bacteria | 102404 |
| 175 | Ga0207696_1003553 | 3300025711 | Bacteria | 7044 |
| 176 | Ga0207696_1009804 | 3300025711 | Bacteria | 3553 |
| 177 | Ga0207696_1011818 | 3300025711 | Bacteria | 3122 |
| 178 | Ga0207696_1029204 | 3300025711 | Bacteria | 1686 |
| 179 | Ga0207655_1000027 | 3300025728 | Bacteria | 444552 |
| 180 | Ga0207655_1000057 | 3300025728 | Bacteria | 273598 |
| 181 | Ga0207655_1000445 | 3300025728 | Bacteria | 54522 |
| 182 | Ga0207655_1000523 | 3300025728 | Bacteria | 48957 |
| 183 | Ga0207655_1004927 | 3300025728 | Bacteria | 9261 |
| 184 | Ga0207655_1010084 | 3300025728 | Bacteria | 5775 |
| 185 | Ga0207655_1011659 | 3300025728 | Bacteria | 5210 |
| 186 | Ga0207655_1015132 | 3300025728 | Bacteria | 4310 |
| 187 | Ga0207655_1045291 | 3300025728 | Bacteria | 1838 |
| 188 | Ga0207655_1122658 | 3300025728 | Bacteria | 858 |
| 189 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 190 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 191 | Ga0207713_1000065 | 3300025735 | Bacteria | 196128 |
| 192 | Ga0207713_1000108 | 3300025735 | Bacteria | 137268 |
| 193 | Ga0207713_1004928 | 3300025735 | Bacteria | 8533 |
| 194 | Ga0207713_1012399 | 3300025735 | Bacteria | 4563 |
| 195 | Ga0207713_1024772 | 3300025735 | Bacteria | 2787 |
| 196 | Ga0207713_1031802 | 3300025735 | Bacteria | 2327 |
| 197 | Ga0207713_1078765 | 3300025735 | Bacteria | 1192 |
| 198 | Ga0207713_1104403 | 3300025735 | Bacteria | 973 |
| 199 | Ga0207710_10000016 | 3300025900 | Bacteria | 388568 |
| 200 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 201 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 202 | Ga0207709_10000130 | 3300025935 | Bacteria | 110843 |
| 203 | Ga0207709_10000565 | 3300025935 | Bacteria | 31347 |
| 204 | Ga0207709_10002073 | 3300025935 | Bacteria | 12946 |
| 205 | Ga0207709_10363427 | 3300025935 | Bacteria | 1096 |
| 206 | Ga0207709_10452497 | 3300025935 | Bacteria | 993 |
| 207 | Ga0207712_10000103 | 3300025961 | Bacteria | 95707 |
| 208 | Ga0207668_10959223 | 3300025972 | Bacteria | 763 |
| 209 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 210 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 211 | Ga0209281_1000294 | 3300027111 | Bacteria | 91244 |
| 212 | Ga0209281_1007658 | 3300027111 | Bacteria | 2692 |
| 213 | Ga0209389_1000125 | 3300027296 | Bacteria | 68494 |
| 214 | Ga0209371_1000046 | 3300027312 | Bacteria | 306549 |
| 215 | Ga0209371_1000959 | 3300027312 | Bacteria | 22434 |
| 216 | Ga0209371_1008116 | 3300027312 | Bacteria | 3538 |
| 217 | Ga0209371_1011506 | 3300027312 | Bacteria | 2625 |
| 218 | Ga0209371_1012687 | 3300027312 | Bacteria | 2419 |
| 219 | Ga0209371_1019651 | 3300027312 | Bacteria | 1680 |
| 220 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 221 | Ga0209974_10009818 | 3300027876 | Bacteria | 3240 |
| 222 | Ga0207428_10171731 | 3300027907 | Bacteria | 1642 |
| 223 | Ga0207428_10172086 | 3300027907 | Bacteria | 1640 |
| 224 | Ga0207428_10179370 | 3300027907 | Bacteria | 1601 |
| 225 | Ga0207428_10217958 | 3300027907 | Bacteria | 1432 |
| 226 | Ga0268266_10083946 | 3300028379 | Bacteria | 2781 |
| 227 | Ga0307517_10030228 | 3300028786 | Bacteria | 6360 |
| 228 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 229 | Ga0268256_1005632 | 3300030500 | Bacteria | 4864 |
| 230 | Ga0268256_1012555 | 3300030500 | Bacteria | 2614 |
| 231 | Ga0268256_1013855 | 3300030500 | Bacteria | 2419 |
| 232 | Ga0316176_1013952 | 3300030732 | Bacteria | 1047 |
| 233 | Ga0307509_10149488 | 3300031507 | Bacteria | 2254 |
| 234 | Ga0307408_100000103 | 3300031548 | Bacteria | 93203 |
| 235 | Ga0307408_100011698 | 3300031548 | Bacteria | 5802 |
| 236 | Ga0307508_10239705 | 3300031616 | Bacteria | 1411 |
| 237 | Ga0307405_10048028 | 3300031731 | Bacteria | 2630 |
| 238 | Ga0307406_10002676 | 3300031901 | Bacteria | 9700 |
| 239 | Ga0307406_10548543 | 3300031901 | Bacteria | 945 |
| 240 | Ga0307412_10010689 | 3300031911 | Bacteria | 5290 |
| 241 | Ga0307412_10247750 | 3300031911 | Bacteria | 1382 |
| 242 | Ga0307412_10338074 | 3300031911 | Bacteria | 1204 |
| 243 | Ga0307409_100041740 | 3300031995 | Bacteria | 3429 |
| 244 | Ga0307416_100631951 | 3300032002 | Bacteria | 1154 |
| 245 | Ga0307411_10073542 | 3300032005 | Bacteria | 2326 |
| 246 | Ga0307411_10222313 | 3300032005 | Bacteria | 1466 |
| 247 | Ga0307510_10000324 | 3300033180 | Bacteria | 44451 |
| 248 | Ga0307510_10056331 | 3300033180 | Bacteria | 4095 |
| 249 | Ga0436365_1873831 | 3300039437 | Bacteria | 1657 |
| 250 | Ga0439438_000894 | 3300041405 | Bacteria | 13245 |
| 251 | Ga0439438_008226 | 3300041405 | Bacteria | 3482 |
| 252 | Ga0439447_000588 | 3300041407 | Bacteria | 13574 |
| 253 | Ga0439466_0024049 | 3300041411 | Bacteria | 2139 |
| 254 | Ga0451837_1686659 | 3300041494 | Bacteria | 1467 |
| 255 | Ga0439432_000442 | 3300042006 | Bacteria | 15354 |
| 256 | Ga0439432_006057 | 3300042006 | Bacteria | 4338 |
| 257 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 258 | Ga0439452_001772 | 3300042010 | Bacteria | 8413 |
| 259 | Ga0439452_006872 | 3300042010 | Bacteria | 3528 |
| 260 | Ga0450911_000820 | 3300042115 | Bacteria | 8549 |
| 261 | Ga0450920_008740 | 3300042122 | Bacteria | 1855 |
| 262 | Ga0450922_000031 | 3300042124 | Bacteria | 12294 |
| 263 | Ga0450900_003341 | 3300042136 | Bacteria | 1776 |
| 264 | Ga0450902_000234 | 3300042137 | Bacteria | 6554 |
| 265 | Ga0450905_000549 | 3300042142 | Bacteria | 4622 |
| 266 | Ga0450905_004491 | 3300042142 | Bacteria | 1852 |
| 267 | Ga0450905_012351 | 3300042142 | Bacteria | 1202 |
| 268 | Ga0450907_029959 | 3300042146 | Bacteria | 924 |
| 269 | Ga0450910_001840 | 3300042147 | Bacteria | 2737 |
| 270 | Ga0450908_007926 | 3300042184 | Bacteria | 1992 |
| 271 | Ga0439464_0011602 | 3300042439 | Bacteria | 2336 |
| 272 | Ga0439464_0033500 | 3300042439 | Bacteria | 1446 |
| 273 | Ga0439460_0006245 | 3300042461 | Bacteria | 2949 |
| 274 | Ga0451577_0004339 | 3300042876 | Bacteria | 15036 |
| 275 | Ga0466969_0031452 | 3300044656 | Bacteria | 2701 |
| 276 | Ga0466977_0356395 | 3300044666 | Bacteria | 862 |
| 277 | Ga0466981_0000007 | 3300044669 | Bacteria | 155983 |
| 278 | Ga0453683_0085262 | 3300044673 | Bacteria | 1979 |
| 279 | Ga0466965_0017394 | 3300044683 | Bacteria | 3436 |
| 280 | Ga0466961_0000028 | 3300044693 | Bacteria | 86793 |
| 281 | Ga0466964_0027344 | 3300044706 | Bacteria | 2239 |
| 282 | Ga0453684_0027406 | 3300044712 | Bacteria | 8173 |
| 283 | Ga0453684_0042921 | 3300044712 | Bacteria | 6087 |
| 284 | Ga0453684_0157005 | 3300044712 | Bacteria | 2696 |
| 285 | Ga0453684_0234536 | 3300044712 | Bacteria | 2116 |
| 286 | Ga0453684_0395903 | 3300044712 | Bacteria | 1548 |
| 287 | Ga0453684_0536361 | 3300044712 | Bacteria | 1291 |
| 288 | Ga0466971_0013057 | 3300044719 | Bacteria | 3643 |
| 289 | Ga0466968_0009173 | 3300044735 | Bacteria | 3803 |
| 290 | Ga0466970_0017001 | 3300044765 | Bacteria | 3755 |
| 291 | Ga0466960_0062595 | 3300044901 | Bacteria | 1829 |
| 292 | Ga0466959_0107157 | 3300045049 | Bacteria | 1997 |
| 293 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 294 | Ga0451576_0661975 | 3300045051 | Bacteria | 1097 |
| 295 | Ga0495617_002042 | 3300046452 | Bacteria | 8382 |
| 296 | Ga0495627_000101 | 3300046453 | Bacteria | 105414 |
| 297 | Ga0495627_000133 | 3300046453 | Bacteria | 89977 |
| 298 | Ga0495627_000141 | 3300046453 | Bacteria | 85993 |
| 299 | Ga0495627_000624 | 3300046453 | Bacteria | 28116 |
| 300 | Ga0495590_0001183 | 3300046457 | Bacteria | 11416 |
| 301 | Ga0495590_0011347 | 3300046457 | Bacteria | 3334 |
| 302 | Ga0495590_0014819 | 3300046457 | Bacteria | 2841 |
| 303 | Ga0495590_0109123 | 3300046457 | Bacteria | 987 |
| 304 | Ga0495591_000082 | 3300046458 | Bacteria | 107579 |
| 305 | Ga0495591_000120 | 3300046458 | Bacteria | 86214 |
| 306 | Ga0495591_000618 | 3300046458 | Bacteria | 26645 |
| 307 | Ga0495591_003774 | 3300046458 | Bacteria | 7661 |
| 308 | Ga0495591_005827 | 3300046458 | Bacteria | 5600 |
| 309 | Ga0495591_006921 | 3300046458 | Bacteria | 4907 |
| 310 | Ga0495591_023707 | 3300046458 | Bacteria | 1960 |
| 311 | Ga0495638_0005031 | 3300046460 | Bacteria | 9919 |
| 312 | Ga0495638_0005146 | 3300046460 | Bacteria | 9779 |
| 313 | Ga0495638_0015269 | 3300046460 | Bacteria | 5159 |
| 314 | Ga0495650_0005106 | 3300046471 | Bacteria | 8679 |
| 315 | Ga0495650_0009781 | 3300046471 | Bacteria | 5420 |
| 316 | Ga0495650_0119151 | 3300046471 | Bacteria | 973 |
| 317 | Ga0495605_0001069 | 3300046474 | Bacteria | 18288 |
| 318 | Ga0495605_0002868 | 3300046474 | Bacteria | 10479 |
| 319 | Ga0495605_0003306 | 3300046474 | Bacteria | 9652 |
| 320 | Ga0495605_0120567 | 3300046474 | Bacteria | 1189 |
| 321 | Ga0495584_0000739 | 3300046491 | Bacteria | 21572 |
| 322 | Ga0495584_0007072 | 3300046491 | Bacteria | 5864 |
| 323 | Ga0495584_0011219 | 3300046491 | Bacteria | 4589 |
| 324 | Ga0495584_0028404 | 3300046491 | Bacteria | 2834 |
| 325 | Ga0495584_0039536 | 3300046491 | Bacteria | 2383 |
| 326 | Ga0495584_0044068 | 3300046491 | Bacteria | 2251 |
| 327 | Ga0495585_0001688 | 3300046492 | Bacteria | 16875 |
| 328 | Ga0495585_0075423 | 3300046492 | Bacteria | 1833 |
| 329 | Ga0495596_0000058 | 3300046500 | Bacteria | 80763 |
| 330 | Ga0495596_0003510 | 3300046500 | Bacteria | 7905 |
| 331 | Ga0495596_0004956 | 3300046500 | Bacteria | 6382 |
| 332 | Ga0495596_0009510 | 3300046500 | Bacteria | 4272 |
| 333 | Ga0495596_0009749 | 3300046500 | Bacteria | 4214 |
| 334 | Ga0495596_0020487 | 3300046500 | Bacteria | 2706 |
| 335 | Ga0495607_0000209 | 3300046501 | Bacteria | 62350 |
| 336 | Ga0495607_0000517 | 3300046501 | Bacteria | 38004 |
| 337 | Ga0495607_0003558 | 3300046501 | Bacteria | 11864 |
| 338 | Ga0495607_0009070 | 3300046501 | Bacteria | 6761 |
| 339 | Ga0495607_0014501 | 3300046501 | Bacteria | 5124 |
| 340 | Ga0495607_0076480 | 3300046501 | Bacteria | 1851 |
| 341 | Ga0495607_0111875 | 3300046501 | Bacteria | 1447 |
| 342 | Ga0495607_0284551 | 3300046501 | Bacteria | 783 |
| 343 | Ga0495607_0297737 | 3300046501 | Bacteria | 760 |
| 344 | Ga0495583_0000852 | 3300046506 | Bacteria | 37144 |
| 345 | Ga0495583_0005886 | 3300046506 | Bacteria | 8166 |
| 346 | Ga0495583_0023359 | 3300046506 | Bacteria | 3129 |
| 347 | Ga0495606_0000634 | 3300046507 | Bacteria | 55249 |
| 348 | Ga0495606_0000656 | 3300046507 | Bacteria | 54383 |
| 349 | Ga0495606_0000861 | 3300046507 | Bacteria | 45459 |
| 350 | Ga0495606_0000965 | 3300046507 | Bacteria | 42060 |
| 351 | Ga0495606_0003705 | 3300046507 | Bacteria | 15962 |
| 352 | Ga0495606_0009752 | 3300046507 | Bacteria | 8076 |
| 353 | Ga0495606_0032404 | 3300046507 | Bacteria | 3620 |
| 354 | Ga0495606_0034716 | 3300046507 | Bacteria | 3458 |
| 355 | Ga0495610_0000173 | 3300046512 | Bacteria | 72402 |
| 356 | Ga0495610_0000563 | 3300046512 | Bacteria | 37173 |
| 357 | Ga0495610_0001764 | 3300046512 | Bacteria | 18932 |
| 358 | Ga0495610_0002756 | 3300046512 | Bacteria | 14409 |
| 359 | Ga0495610_0005706 | 3300046512 | Bacteria | 8771 |
| 360 | Ga0495610_0006280 | 3300046512 | Bacteria | 8226 |
| 361 | Ga0495610_0024812 | 3300046512 | Bacteria | 3229 |
| 362 | Ga0495610_0073590 | 3300046512 | Bacteria | 1587 |
| 363 | Ga0495616_0000041 | 3300046513 | Bacteria | 122413 |
| 364 | Ga0495616_0000166 | 3300046513 | Bacteria | 57340 |
| 365 | Ga0495616_0004221 | 3300046513 | Bacteria | 9092 |
| 366 | Ga0495616_0011508 | 3300046513 | Bacteria | 5064 |
| 367 | Ga0495620_0000124 | 3300046515 | Bacteria | 62374 |
| 368 | Ga0495620_0003915 | 3300046515 | Bacteria | 8484 |
| 369 | Ga0495620_0050319 | 3300046515 | Bacteria | 1778 |
| 370 | Ga0495631_0000013 | 3300046518 | Bacteria | 109794 |
| 371 | Ga0495631_0032002 | 3300046518 | Bacteria | 2373 |
| 372 | Ga0495631_0084525 | 3300046518 | Bacteria | 1367 |
| 373 | Ga0495632_0000097 | 3300046519 | Bacteria | 88746 |
| 374 | Ga0495632_0000466 | 3300046519 | Bacteria | 38410 |
| 375 | Ga0495632_0000475 | 3300046519 | Bacteria | 38064 |
| 376 | Ga0495632_0012301 | 3300046519 | Bacteria | 4939 |
| 377 | Ga0495632_0014299 | 3300046519 | Bacteria | 4493 |
| 378 | Ga0495632_0098094 | 3300046519 | Bacteria | 1382 |
| 379 | Ga0495632_0254226 | 3300046519 | Bacteria | 787 |
| 380 | Ga0495637_0001309 | 3300046520 | Bacteria | 14938 |
| 381 | Ga0495637_0011326 | 3300046520 | Bacteria | 4288 |
| 382 | Ga0495637_0017909 | 3300046520 | Bacteria | 3292 |
| 383 | Ga0495637_0030284 | 3300046520 | Bacteria | 2401 |
| 384 | Ga0495637_0038309 | 3300046520 | Bacteria | 2076 |
| 385 | Ga0495637_0048735 | 3300046520 | Bacteria | 1783 |
| 386 | Ga0495637_0070329 | 3300046520 | Bacteria | 1414 |
| 387 | Ga0495643_0000625 | 3300046522 | Bacteria | 42011 |
| 388 | Ga0495643_0000810 | 3300046522 | Bacteria | 34361 |
| 389 | Ga0495643_0001821 | 3300046522 | Bacteria | 18154 |
| 390 | Ga0495643_0001848 | 3300046522 | Bacteria | 17969 |
| 391 | Ga0495643_0002462 | 3300046522 | Bacteria | 14658 |
| 392 | Ga0495643_0113234 | 3300046522 | Bacteria | 1377 |
| 393 | Ga0495643_0153739 | 3300046522 | Bacteria | 1137 |
| 394 | Ga0495644_0003352 | 3300046523 | Bacteria | 6331 |
| 395 | Ga0495648_0000172 | 3300046524 | Bacteria | 74485 |
| 396 | Ga0495648_0000606 | 3300046524 | Bacteria | 38334 |
| 397 | Ga0495648_0001295 | 3300046524 | Bacteria | 24874 |
| 398 | Ga0495648_0001927 | 3300046524 | Bacteria | 19765 |
| 399 | Ga0495648_0004144 | 3300046524 | Bacteria | 12465 |
| 400 | Ga0495648_0004767 | 3300046524 | Bacteria | 11480 |
| 401 | Ga0495648_0006760 | 3300046524 | Bacteria | 9273 |
| 402 | Ga0495648_0042903 | 3300046524 | Bacteria | 2841 |
| 403 | Ga0495648_0075551 | 3300046524 | Bacteria | 1937 |
| 404 | Ga0495642_0000670 | 3300046528 | Bacteria | 17084 |
| 405 | Ga0495642_0009438 | 3300046528 | Bacteria | 3735 |
| 406 | Ga0495654_0000104 | 3300046530 | Bacteria | 95266 |
| 407 | Ga0495654_0000353 | 3300046530 | Bacteria | 39769 |
| 408 | Ga0495654_0003209 | 3300046530 | Bacteria | 10123 |
| 409 | Ga0495654_0003366 | 3300046530 | Bacteria | 9850 |
| 410 | Ga0495654_0007391 | 3300046530 | Bacteria | 6138 |
| 411 | Ga0495654_0008186 | 3300046530 | Bacteria | 5789 |
| 412 | Ga0495654_0016695 | 3300046530 | Bacteria | 3872 |
| 413 | Ga0495654_0034197 | 3300046530 | Bacteria | 2566 |
| 414 | Ga0495654_0092845 | 3300046530 | Bacteria | 1398 |
| 415 | Ga0495654_0104707 | 3300046530 | Bacteria | 1297 |
| 416 | Ga0495654_0161252 | 3300046530 | Bacteria | 984 |
| 417 | Ga0495609_0000286 | 3300046538 | Bacteria | 46726 |
| 418 | Ga0495609_0001705 | 3300046538 | Bacteria | 14247 |
| 419 | Ga0495609_0002472 | 3300046538 | Bacteria | 11352 |
| 420 | Ga0495609_0049806 | 3300046538 | Bacteria | 1868 |
| 421 | Ga0495597_0000117 | 3300046542 | Bacteria | 71911 |
| 422 | Ga0495597_0000560 | 3300046542 | Bacteria | 30875 |
| 423 | Ga0495597_0006351 | 3300046542 | Bacteria | 6119 |
| 424 | Ga0495597_0020676 | 3300046542 | Bacteria | 3063 |
| 425 | Ga0495597_0031569 | 3300046542 | Bacteria | 2409 |
| 426 | Ga0495597_0066529 | 3300046542 | Bacteria | 1561 |
| 427 | Ga0495597_0144141 | 3300046542 | Bacteria | 981 |
| 428 | Ga0495597_0190612 | 3300046542 | Bacteria | 825 |
| 429 | Ga0495622_0000047 | 3300046557 | Bacteria | 109638 |
| 430 | Ga0495622_0135966 | 3300046557 | Bacteria | 1117 |
| 431 | Ga0495622_0257586 | 3300046557 | Bacteria | 766 |
| 432 | Ga0495633_0000564 | 3300046558 | Bacteria | 36203 |
| 433 | Ga0495656_0058820 | 3300046615 | Bacteria | 1670 |
| 434 | Ga0495668_0010707 | 3300046616 | Bacteria | 5538 |
| 435 | Ga0495668_0010888 | 3300046616 | Bacteria | 5476 |
| 436 | Ga0495668_0015087 | 3300046616 | Bacteria | 4518 |
| 437 | Ga0495611_0000024 | 3300046648 | Bacteria | 118898 |
| 438 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 439 | Ga0495625_0000861 | 3300046660 | Bacteria | 41279 |
| 440 | Ga0495625_0003017 | 3300046660 | Bacteria | 17334 |
| 441 | Ga0495625_0006238 | 3300046660 | Bacteria | 10678 |
| 442 | Ga0495625_0007003 | 3300046660 | Bacteria | 9935 |
| 443 | Ga0495625_0007929 | 3300046660 | Bacteria | 9128 |
| 444 | Ga0495625_0023549 | 3300046660 | Bacteria | 4702 |
| 445 | Ga0495659_0003039 | 3300046664 | Bacteria | 5380 |
| 446 | Ga0495661_0005184 | 3300046665 | Bacteria | 9286 |
| 447 | Ga0495661_0038532 | 3300046665 | Bacteria | 2976 |
| 448 | Ga0495661_0095793 | 3300046665 | Bacteria | 1679 |
| 449 | Ga0495588_0026797 | 3300046674 | Bacteria | 2878 |
| 450 | Ga0495669_0012970 | 3300046684 | Bacteria | 3549 |
| 451 | Ga0495669_0100189 | 3300046684 | Bacteria | 1345 |
| 452 | Ga0495669_0148916 | 3300046684 | Bacteria | 1107 |
| 453 | Ga0495613_0000001 | 3300046689 | Eukaryota | 436313 |
| 454 | Ga0495624_0037776 | 3300046690 | Bacteria | 3105 |
| 455 | Ga0495670_0000020 | 3300046691 | Bacteria | 110171 |
| 456 | Ga0495671_0004837 | 3300046692 | Bacteria | 7962 |
| 457 | Ga0495671_0005338 | 3300046692 | Bacteria | 7541 |
| 458 | Ga0495671_0179470 | 3300046692 | Bacteria | 1028 |
| 459 | Ga0495671_0202893 | 3300046692 | Bacteria | 961 |
| 460 | Ga0495649_0000108 | 3300046694 | Bacteria | 73708 |
| 461 | Ga0495649_0000894 | 3300046694 | Bacteria | 23680 |
| 462 | Ga0495649_0001346 | 3300046694 | Bacteria | 18674 |
| 463 | Ga0495649_0002635 | 3300046694 | Bacteria | 12511 |
| 464 | Ga0495649_0007422 | 3300046694 | Bacteria | 6683 |
| 465 | Ga0495649_0021658 | 3300046694 | Bacteria | 3600 |
| 466 | Ga0495649_0028631 | 3300046694 | Bacteria | 3087 |
| 467 | Ga0495649_0043143 | 3300046694 | Bacteria | 2462 |
| 468 | Ga0495649_0051256 | 3300046694 | Bacteria | 2238 |
| 469 | Ga0495649_0239909 | 3300046694 | Bacteria | 933 |
| 470 | Ga0495649_0293715 | 3300046694 | Bacteria | 828 |
| 471 | Ga0495589_0000006 | 3300046794 | Bacteria | 303635 |
| 472 | Ga0495589_0009008 | 3300046794 | Bacteria | 5191 |
| 473 | Ga0495589_0011171 | 3300046794 | Bacteria | 4658 |
| 474 | Ga0495589_0013308 | 3300046794 | Bacteria | 4246 |
| 475 | Ga0495589_0163821 | 3300046794 | Bacteria | 1058 |
| 476 | Ga0495660_0001349 | 3300046810 | Bacteria | 16870 |
| 477 | Ga0495660_0002399 | 3300046810 | Bacteria | 11962 |
| 478 | Ga0495660_0004217 | 3300046810 | Bacteria | 8735 |
| 479 | Ga0495660_0004243 | 3300046810 | Bacteria | 8700 |
| 480 | Ga0495660_0013192 | 3300046810 | Bacteria | 4787 |
| 481 | Ga0495660_0025582 | 3300046810 | Bacteria | 3351 |
| 482 | Ga0495660_0040326 | 3300046810 | Bacteria | 2588 |
| 483 | Ga0495660_0112541 | 3300046810 | Bacteria | 1387 |
| 484 | Ga0495636_0008837 | 3300047318 | Bacteria | 3968 |
| 485 | Ga0495672_0003616 | 3300047320 | Bacteria | 13109 |
| 486 | Ga0495672_0003859 | 3300047320 | Bacteria | 12600 |
| 487 | Ga0495672_0012420 | 3300047320 | Bacteria | 5942 |
| 488 | Ga0495672_0024227 | 3300047320 | Bacteria | 3914 |
| 489 | Ga0495672_0029375 | 3300047320 | Bacteria | 3462 |
| 490 | Ga0495672_0043623 | 3300047320 | Bacteria | 2695 |
| 491 | Ga0495672_0051954 | 3300047320 | Bacteria | 2410 |
| 492 | Ga0495676_0000058 | 3300047321 | Bacteria | 86045 |
| 493 | Ga0495683_0000199 | 3300047323 | Bacteria | 56834 |
| 494 | Ga0495683_0002985 | 3300047323 | Bacteria | 9985 |
| 495 | Ga0495677_0003548 | 3300047445 | Bacteria | 6051 |
| 496 | Ga0495679_000945 | 3300047446 | Bacteria | 18048 |
| 497 | Ga0495679_005691 | 3300047446 | Bacteria | 5494 |
| 498 | Ga0495679_006942 | 3300047446 | Bacteria | 4798 |
| 499 | Ga0495679_007151 | 3300047446 | Bacteria | 4693 |
| 500 | Ga0495679_007973 | 3300047446 | Bacteria | 4355 |
| 501 | Ga0495685_016605 | 3300047447 | Bacteria | 2516 |
| 502 | Ga0495685_029585 | 3300047447 | Bacteria | 1883 |
| 503 | Ga0495673_0005992 | 3300047469 | Bacteria | 7230 |
| 504 | Ga0495673_0006535 | 3300047469 | Bacteria | 6837 |
| 505 | Ga0495673_0007428 | 3300047469 | Bacteria | 6301 |
| 506 | Ga0495673_0019474 | 3300047469 | Bacteria | 3399 |
| 507 | Ga0495681_0001171 | 3300047470 | Bacteria | 19926 |
| 508 | Ga0495681_0001795 | 3300047470 | Bacteria | 15813 |
| 509 | Ga0495681_0005497 | 3300047470 | Bacteria | 8472 |
| 510 | Ga0495681_0010489 | 3300047470 | Bacteria | 5605 |
| 511 | Ga0495681_0153462 | 3300047470 | Bacteria | 964 |
| 512 | Ga0495686_0000266 | 3300047472 | Bacteria | 93781 |
| 513 | Ga0495686_0002608 | 3300047472 | Bacteria | 16715 |
| 514 | Ga0495686_0008113 | 3300047472 | Bacteria | 7765 |
| 515 | Ga0495686_0011409 | 3300047472 | Bacteria | 6262 |
| 516 | Ga0495686_0020167 | 3300047472 | Bacteria | 4447 |
| 517 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 518 | Ga0495626_0000366 | 3300048091 | Bacteria | 47327 |
| 519 | Ga0495626_0001013 | 3300048091 | Bacteria | 24145 |
| 520 | Ga0495626_0002162 | 3300048091 | Bacteria | 14153 |
| 521 | Ga0495626_0002404 | 3300048091 | Bacteria | 13042 |
| 522 | Ga0495626_0031832 | 3300048091 | Bacteria | 2535 |
| 523 | Ga0495626_0064485 | 3300048091 | Bacteria | 1659 |
| 524 | Ga0496104_0000368 | 3300048907 | Bacteria | 39833 |
| 525 | Ga0496104_0022954 | 3300048907 | Bacteria | 5734 |
| 526 | Ga0496105_0064629 | 3300048908 | Bacteria | 3019 |
| 527 | Ga0496110_0080476 | 3300048913 | Bacteria | 2903 |
| 528 | Ga0496114_0064744 | 3300048917 | Bacteria | 3062 |
| 529 | Ga0496114_0136116 | 3300048917 | Bacteria | 2124 |
| 530 | Ga0496116_0000031 | 3300048919 | Bacteria | 420043 |
| 531 | Ga0496116_0000255 | 3300048919 | Bacteria | 94048 |
| 532 | Ga0496116_0001333 | 3300048919 | Bacteria | 28080 |
| 533 | Ga0496116_0001738 | 3300048919 | Bacteria | 23730 |
| 534 | Ga0496116_0004739 | 3300048919 | Bacteria | 12843 |
| 535 | Ga0496116_0018151 | 3300048919 | Bacteria | 5433 |
| 536 | Ga0496116_0043455 | 3300048919 | Eukaryota | 3061 |
| 537 | Ga0496116_0061807 | 3300048919 | Bacteria | 2422 |
| 538 | Ga0496116_0185320 | 3300048919 | Bacteria | 1108 |
| 539 | Ga0496116_0185561 | 3300048919 | Bacteria | 1107 |
| 540 | Ga0496117_0001129 | 3300048920 | Bacteria | 40277 |
| 541 | Ga0496117_0002101 | 3300048920 | Bacteria | 26223 |
| 542 | Ga0496117_0006088 | 3300048920 | Bacteria | 12358 |
| 543 | Ga0496117_0007023 | 3300048920 | Bacteria | 11146 |
| 544 | Ga0496117_0009911 | 3300048920 | Bacteria | 8767 |
| 545 | Ga0496117_0033569 | 3300048920 | Bacteria | 3878 |
| 546 | Ga0496117_0045706 | 3300048920 | Bacteria | 3158 |
| 547 | Ga0496117_0318653 | 3300048920 | Bacteria | 816 |
| 548 | Ga0496118_0000752 | 3300048921 | Bacteria | 52469 |
| 549 | Ga0496118_0003476 | 3300048921 | Bacteria | 19765 |
| 550 | Ga0496118_0006939 | 3300048921 | Bacteria | 12245 |
| 551 | Ga0496118_0011847 | 3300048921 | Bacteria | 8453 |
| 552 | Ga0496118_0039084 | 3300048921 | Bacteria | 3791 |
| 553 | Ga0496118_0041857 | 3300048921 | Bacteria | 3621 |
| 554 | Ga0496119_0000032 | 3300048922 | Bacteria | 222289 |
| 555 | Ga0496119_0000230 | 3300048922 | Bacteria | 78527 |
| 556 | Ga0496119_0000258 | 3300048922 | Bacteria | 75132 |
| 557 | Ga0496119_0015888 | 3300048922 | Bacteria | 5764 |
| 558 | Ga0496119_0088545 | 3300048922 | Bacteria | 1764 |
| 559 | Ga0496120_0000228 | 3300048923 | Bacteria | 96403 |
| 560 | Ga0496120_0000255 | 3300048923 | Bacteria | 89200 |
| 561 | Ga0496120_0000324 | 3300048923 | Bacteria | 79261 |
| 562 | Ga0496120_0009427 | 3300048923 | Bacteria | 6925 |
| 563 | Ga0496120_0014871 | 3300048923 | Bacteria | 5160 |
| 564 | Ga0496120_0069875 | 3300048923 | Bacteria | 1932 |
| 565 | Ga0496121_0000140 | 3300048924 | Bacteria | 162689 |
| 566 | Ga0496121_0009355 | 3300048924 | Bacteria | 11285 |
| 567 | Ga0496121_0056192 | 3300048924 | Bacteria | 3271 |
| 568 | Ga0496121_0315061 | 3300048924 | Bacteria | 1055 |
| 569 | Ga0496122_0000582 | 3300048925 | Bacteria | 74845 |
| 570 | Ga0496122_0000908 | 3300048925 | Bacteria | 54441 |
| 571 | Ga0496122_0001471 | 3300048925 | Bacteria | 37928 |
| 572 | Ga0496122_0011350 | 3300048925 | Bacteria | 9035 |
| 573 | Ga0496122_0012075 | 3300048925 | Bacteria | 8657 |
| 574 | Ga0496122_0018888 | 3300048925 | Bacteria | 6333 |
| 575 | Ga0496122_0064436 | 3300048925 | Bacteria | 2666 |
| 576 | Ga0496122_0082195 | 3300048925 | Bacteria | 2238 |
| 577 | Ga0496122_0143043 | 3300048925 | Bacteria | 1492 |
| 578 | Ga0496122_0190743 | 3300048925 | Bacteria | 1210 |
| 579 | Ga0496123_0000412 | 3300048926 | Bacteria | 78170 |
| 580 | Ga0496123_0000479 | 3300048926 | Bacteria | 69250 |
| 581 | Ga0496123_0000567 | 3300048926 | Bacteria | 63083 |
| 582 | Ga0496123_0007217 | 3300048926 | Bacteria | 10544 |
| 583 | Ga0496123_0011868 | 3300048926 | Bacteria | 7493 |
| 584 | Ga0496123_0022316 | 3300048926 | Bacteria | 4883 |
| 585 | Ga0496123_0069202 | 3300048926 | Bacteria | 2218 |
| 586 | Ga0496123_0099822 | 3300048926 | Bacteria | 1693 |
| 587 | Ga0496123_0205864 | 3300048926 | Bacteria | 1004 |
| 588 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 589 | Ga0496124_0000122 | 3300048927 | Bacteria | 161741 |
| 590 | Ga0496124_0000332 | 3300048927 | Bacteria | 87485 |
| 591 | Ga0496124_0005761 | 3300048927 | Bacteria | 13791 |
| 592 | Ga0496124_0006362 | 3300048927 | Bacteria | 12884 |
| 593 | Ga0496124_0015667 | 3300048927 | Bacteria | 7252 |
| 594 | Ga0496124_0025233 | 3300048927 | Bacteria | 5387 |
| 595 | Ga0496124_0032726 | 3300048927 | Bacteria | 4585 |
| 596 | Ga0496124_0047518 | 3300048927 | Bacteria | 3671 |
| 597 | Ga0496124_0052871 | 3300048927 | Bacteria | 3448 |
| 598 | Ga0496124_0053134 | 3300048927 | Bacteria | 3437 |
| 599 | Ga0496124_0212040 | 3300048927 | Bacteria | 1464 |
| 600 | Ga0496125_0000016 | 3300048928 | Bacteria | 512512 |
| 601 | Ga0496125_0000190 | 3300048928 | Bacteria | 132540 |
| 602 | Ga0496125_0002428 | 3300048928 | Bacteria | 24231 |
| 603 | Ga0496125_0005878 | 3300048928 | Bacteria | 13466 |
| 604 | Ga0496125_0009349 | 3300048928 | Bacteria | 10098 |
| 605 | Ga0496125_0010853 | 3300048928 | Bacteria | 9170 |
| 606 | Ga0496125_0018504 | 3300048928 | Bacteria | 6616 |
| 607 | Ga0496125_0026879 | 3300048928 | Bacteria | 5227 |
| 608 | Ga0496125_0066411 | 3300048928 | Bacteria | 2850 |
| 609 | Ga0496125_0070390 | 3300048928 | Eukaryota | 2739 |
| 610 | Ga0496125_0080299 | 3300048928 | Bacteria | 2497 |
| 611 | Ga0496125_0190764 | 3300048928 | Bacteria | 1353 |
| 612 | Ga0496126_0007121 | 3300048929 | Bacteria | 12321 |
| 613 | Ga0496126_0010848 | 3300048929 | Bacteria | 9499 |
| 614 | Ga0496126_0011107 | 3300048929 | Eukaryota | 9356 |
| 615 | Ga0496126_0019975 | 3300048929 | Bacteria | 6582 |
| 616 | Ga0496126_0050226 | 3300048929 | Bacteria | 3802 |
| 617 | Ga0496126_0116878 | 3300048929 | Bacteria | 2318 |
| 618 | Ga0496126_0247596 | 3300048929 | Bacteria | 1486 |
| 619 | Ga0496126_0334349 | 3300048929 | Bacteria | 1242 |
| 620 | Ga0501309_003594 | 3300049129 | Bacteria | 1763 |
| 621 | Ga0501304_017235 | 3300049160 | Bacteria | 690 |
| 622 | Ga0501305_004359 | 3300049161 | Bacteria | 1660 |
| 623 | Ga0495678_000222 | 3300049459 | Bacteria | 65798 |
| 624 | Ga0495678_000359 | 3300049459 | Bacteria | 46686 |
| 625 | Ga0495678_000500 | 3300049459 | Bacteria | 38668 |
| 626 | Ga0495678_029021 | 3300049459 | Bacteria | 2327 |
| 627 | Ga0495678_059444 | 3300049459 | Bacteria | 1441 |
| 628 | Ga0495682_0001555 | 3300049460 | Bacteria | 12042 |
| 629 | Ga0501312_002565 | 3300049528 | Bacteria | 1972 |
| 630 | Ga0501032_0373673 | 3300049569 | Bacteria | 917 |
| 631 | Ga0501032_0402812 | 3300049569 | Bacteria | 879 |
| 632 | Ga0501033_0083798 | 3300049570 | Bacteria | 2337 |
| 633 | Ga0501034_0000131 | 3300049571 | Bacteria | 139479 |
| 634 | Ga0501034_0003332 | 3300049571 | Bacteria | 18336 |
| 635 | Ga0501036_0453174 | 3300049572 | Bacteria | 1069 |
| 636 | Ga0501038_0002404 | 3300049574 | Bacteria | 17444 |
| 637 | Ga0501039_0033404 | 3300049575 | Bacteria | 3967 |
| 638 | Ga0501040_0340552 | 3300049576 | Bacteria | 1074 |
| 639 | Ga0501040_0358361 | 3300049576 | Bacteria | 1045 |
| 640 | Ga0501040_0656410 | 3300049576 | Bacteria | 758 |
| 641 | Ga0501041_0069703 | 3300049577 | Bacteria | 2158 |
| 642 | Ga0501041_0243440 | 3300049577 | Bacteria | 1130 |
| 643 | Ga0501042_0098375 | 3300049578 | Bacteria | 2104 |
| 644 | Ga0501042_0344445 | 3300049578 | Bacteria | 1078 |
| 645 | Ga0501043_0421199 | 3300049579 | Bacteria | 1007 |
| 646 | Ga0501048_0231662 | 3300049582 | Bacteria | 1311 |
| 647 | Ga0501071_0786166 | 3300049587 | Bacteria | 733 |
| 648 | Ga0501072_0112231 | 3300049588 | Bacteria | 2170 |
| 649 | Ga0501072_0330996 | 3300049588 | Bacteria | 1210 |
| 650 | Ga0501075_0019354 | 3300049591 | Bacteria | 4938 |
| 651 | Ga0501075_0045078 | 3300049591 | Bacteria | 3310 |
| 652 | Ga0501075_0315845 | 3300049591 | Bacteria | 1191 |
| 653 | Ga0501076_0016082 | 3300049592 | Bacteria | 5665 |
| 654 | Ga0501077_0040832 | 3300049593 | Bacteria | 2954 |
| 655 | Ga0501198_005122 | 3300049649 | Bacteria | 1837 |
| 656 | Ga0501227_000545 | 3300049665 | Bacteria | 8167 |
| 657 | Ga0501080_0298737 | 3300049742 | Bacteria | 1461 |
| 658 | Ga0501083_0421295 | 3300049744 | Bacteria | 869 |
| 659 | Ga0501241_000247 | 3300049758 | Bacteria | 12110 |
| 660 | Ga0501269_001191 | 3300049766 | Bacteria | 3556 |
| 661 | Ga0501035_0149620 | 3300049822 | Bacteria | 2027 |
| 662 | Ga0501035_0310409 | 3300049822 | Bacteria | 1327 |
| 663 | Ga0501035_0350285 | 3300049822 | Bacteria | 1236 |
| 664 | Ga0501044_0458963 | 3300049823 | Bacteria | 1180 |
| 665 | nmdc:mga03683_251448_c1 | 3300050489 | Bacteria | 821 |
| 666 | nmdc:mga00v17_527_c1 | 3300050491 | Bacteria | 21481 |
| 667 | nmdc:mga05p37_533047_c1 | 3300050507 | Bacteria | 1340 |
| 668 | nmdc:mga0qj67_282046_c1 | 3300050509 | Bacteria | 1346 |
| 669 | nmdc:mga06r32_231069_c1 | 3300050510 | Bacteria | 1837 |
| 670 | nmdc:mga08y16_176298_c1 | 3300050511 | Bacteria | 2220 |
| 671 | nmdc:mga0sz30_18806_c1 | 3300050516 | Bacteria | 2768 |
| 672 | Ga0500659_0000087 | 3300053135 | Bacteria | 46315 |
| 673 | Ga0501084_0972787 | 3300054114 | Bacteria | 713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009092 | Ga0105250_10011998 | Ga0105250_100119984 | 196 |
| 2 | 3300049579 | Ga0501043_0421199 | Ga0501043_0421199_234_872 | 200 |
| 3 | 3300002739 | JGI25158J39367_1000331 | JGI25158J39367_10003313 | 201 |
| 4 | 3300002987 | JGI25159J45721_1002851 | JGI25159J45721_10028513 | 201 |
| 5 | 3300003374 | JGI25161J50226_1000500 | JGI25161J50226_100050018 | 201 |
| 6 | 3300003771 | Ga0055526_1001572 | Ga0055526_100157217 | 201 |
| 7 | 3300003773 | Ga0055537_1002144 | Ga0055537_10021448 | 201 |
| 8 | 3300003775 | Ga0055524_1004607 | Ga0055524_10046073 | 201 |
| 9 | 3300003784 | Ga0055534_1010125 | Ga0055534_10101253 | 201 |
| 10 | 3300003791 | Ga0055530_10001636 | Ga0055530_1000163617 | 201 |
| 11 | 3300004625 | Ga0055543_1001678 | Ga0055543_10016782 | 201 |
| 12 | 3300005262 | Ga0065165_1003101 | Ga0065165_10031013 | 201 |
| 13 | 3300005262 | Ga0065165_1034065 | Ga0065165_10340652 | 201 |
| 14 | 3300025208 | Ga0209436_100445 | Ga0209436_10044519 | 201 |
| 15 | 3300025263 | Ga0209565_1002293 | Ga0209565_10022937 | 201 |
| 16 | 3300025284 | Ga0209130_1001179 | Ga0209130_100117919 | 201 |
| 17 | 3300025291 | Ga0209675_1015036 | Ga0209675_10150362 | 201 |
| 18 | 3300025295 | Ga0209564_1000376 | Ga0209564_100037665 | 201 |
| 19 | 3300025295 | Ga0209564_1016648 | Ga0209564_10166482 | 201 |
| 20 | 3300025298 | Ga0209050_1002114 | Ga0209050_100211418 | 201 |
| 21 | 3300025299 | Ga0209256_1001352 | Ga0209256_100135219 | 201 |
| 22 | 3300025302 | Ga0207426_1034175 | Ga0207426_10341752 | 201 |
| 23 | 3300031548 | Ga0307408_100000103 | Ga0307408_10000010318 | 201 |
| 24 | 3300048927 | Ga0496124_0015667 | Ga0496124_0015667_1800_2405 | 201 |
| 25 | iso_pu_bacteria | 2554235132 | 2554816530 | 201 |
| 26 | iso_pu_bacteria | 2606217733 | 2608380157 | 201 |
| 27 | iso_pu_bacteria | 2738543020 | 2739290057 | 201 |
| 28 | iso_pu_bacteria | 2738543021 | 2739295369 | 201 |
| 29 | iso_pu_bacteria | 2786546517 | 2787438038 | 201 |
| 30 | iso_pu_bacteria | 2808606385 | 2808978660 | 201 |
| 31 | iso_pu_bacteria | 2808606388 | 2808994392 | 201 |
| 32 | iso_pu_bacteria | 2852612431 | 2852614048 | 201 |
| 33 | iso_pu_bacteria | 2852667396 | 2852668215 | 201 |
| 34 | iso_pu_bacteria | 2920107658 | 2920110847 | 201 |
| 35 | iso_pu_bacteria | 8056131705 | 8056134348 | 201 |
| 36 | iso_pu_bacteria | 2554235231 | 2555248905 | 202 |
| 37 | iso_pu_bacteria | 2765235841 | 2765581915 | 202 |
| 38 | iso_pu_bacteria | 2806310737 | 2807406571 | 202 |
| 39 | iso_pu_bacteria | 2806310745 | 2807454903 | 202 |
| 40 | iso_pu_bacteria | 2842805378 | 2842806892 | 202 |
| 41 | iso_pu_bacteria | 8052494512 | 8052499233 | 202 |
| 42 | iso_pu_bacteria | 8054929484 | 8054930928 | 202 |
| 43 | iso_pu_bacteria | 8056115690 | 8056120578 | 202 |
| 44 | iso_pu_bacteria | 8056120720 | 8056121599 | 202 |
| 45 | 3300046522 | Ga0495643_0001848 | Ga0495643_0001848_2167_2784 | 203 |
| 46 | 3300046660 | Ga0495625_0023549 | Ga0495625_0023549_592_1209 | 203 |
| 47 | 3300046692 | Ga0495671_0005338 | Ga0495671_0005338_5714_6331 | 203 |
| 48 | 3300046694 | Ga0495649_0239909 | Ga0495649_0239909_268_885 | 203 |
| 49 | iso_pu_bacteria | 2547132181 | 2547698207 | 203 |
| 50 | iso_pu_bacteria | 2554235234 | 2555258045 | 203 |
| 51 | iso_pu_bacteria | 2561511199 | 2562465501 | 203 |
| 52 | iso_pu_bacteria | 2600255256 | 2601536180 | 203 |
| 53 | iso_pu_bacteria | 2600255257 | 2601541214 | 203 |
| 54 | iso_pu_bacteria | 2600255310 | 2601759838 | 203 |
| 55 | iso_pu_bacteria | 2600255311 | 2601765270 | 203 |
| 56 | iso_pu_bacteria | 2602042046 | 2603640828 | 203 |
| 57 | iso_pu_bacteria | 2602042109 | 2603867041 | 203 |
| 58 | iso_pu_bacteria | 2791355010 | 2792314099 | 203 |
| 59 | iso_pu_bacteria | 2811995292 | 2813731099 | 203 |
| 60 | iso_pu_bacteria | 2814123068 | 2814698757 | 203 |
| 61 | iso_pu_bacteria | 2888373701 | 2888378525 | 203 |
| 62 | iso_pu_bacteria | 2919108558 | 2919109287 | 203 |
| 63 | iso_pu_bacteria | 2935625433 | 2935628935 | 203 |
| 64 | iso_pu_bacteria | 2939617950 | 2939620056 | 203 |
| 65 | iso_pu_bacteria | 2971820967 | 2971823846 | 203 |
| 66 | iso_pu_bacteria | 2974435778 | 2974436552 | 203 |
| 67 | iso_pu_bacteria | 3003665799 | 3003669552 | 203 |
| 68 | iso_pu_bacteria | 8015394850 | 8015397589 | 203 |
| 69 | iso_pu_bacteria | 8019504834 | 8019506422 | 203 |
| 70 | 2162886007 | SwRhRL2b_contig_150973 | SwRhRL2b_0750.00003370 | 204 |
| 71 | 3300005289 | Ga0065704_10098658 | Ga0065704_100986582 | 204 |
| 72 | 3300005457 | Ga0070662_100865934 | Ga0070662_1008659341 | 204 |
| 73 | 3300006846 | Ga0075430_100310557 | Ga0075430_1003105572 | 204 |
| 74 | 3300006847 | Ga0075431_100599436 | Ga0075431_1005994362 | 204 |
| 75 | 3300009094 | Ga0111539_10089953 | Ga0111539_100899533 | 204 |
| 76 | 3300009147 | Ga0114129_11236404 | Ga0114129_112364042 | 204 |
| 77 | 3300013102 | Ga0157371_10026820 | Ga0157371_100268202 | 204 |
| 78 | 3300013104 | Ga0157370_10001741 | Ga0157370_1000174117 | 204 |
| 79 | 3300015261 | Ga0182006_1080183 | Ga0182006_10801832 | 204 |
| 80 | 3300025972 | Ga0207668_10959223 | Ga0207668_109592231 | 204 |
| 81 | 3300030732 | Ga0316176_1013952 | Ga0316176_10139522 | 204 |
| 82 | 3300031548 | Ga0307408_100011698 | Ga0307408_1000116983 | 204 |
| 83 | 3300031901 | Ga0307406_10002676 | Ga0307406_100026764 | 204 |
| 84 | 3300031901 | Ga0307406_10548543 | Ga0307406_105485432 | 204 |
| 85 | 3300031995 | Ga0307409_100041740 | Ga0307409_1000417403 | 204 |
| 86 | 3300042876 | Ga0451577_0004339 | Ga0451577_0004339_6572_7195 | 204 |
| 87 | 3300044673 | Ga0453683_0085262 | Ga0453683_0085262_243_866 | 204 |
| 88 | 3300044712 | Ga0453684_0027406 | Ga0453684_0027406_5306_5929 | 204 |
| 89 | 3300044712 | Ga0453684_0157005 | Ga0453684_0157005_1772_2395 | 204 |
| 90 | 3300044712 | Ga0453684_0234536 | Ga0453684_0234536_1058_1750 | 204 |
| 91 | 3300045051 | Ga0451576_0000034 | Ga0451576_0000034_322531_323154 | 204 |
| 92 | 3300046507 | Ga0495606_0000861 | Ga0495606_0000861_14689_15309 | 204 |
| 93 | 3300046522 | Ga0495643_0113234 | Ga0495643_0113234_198_818 | 204 |
| 94 | 3300046694 | Ga0495649_0002635 | Ga0495649_0002635_2637_3257 | 204 |
| 95 | 3300048920 | Ga0496117_0045706 | Ga0496117_0045706_2436_3053 | 204 |
| 96 | 3300049459 | Ga0495678_059444 | Ga0495678_059444_607_1227 | 204 |
| 97 | 3300049649 | Ga0501198_005122 | Ga0501198_005122_170_805 | 204 |
| 98 | 3300049822 | Ga0501035_0310409 | Ga0501035_0310409_422_1045 | 204 |
| 99 | 3300050507 | nmdc:mga05p37_533047_c1 | nmdc:mga05p37_533047_c1_194_817 | 204 |
| 100 | 3300050509 | nmdc:mga0qj67_282046_c1 | nmdc:mga0qj67_282046_c1_94_717 | 204 |
| 101 | 3300050510 | nmdc:mga06r32_231069_c1 | nmdc:mga06r32_231069_c1_1049_1672 | 204 |
| 102 | iso_pu_bacteria | 2506520007 | 2506576971 | 204 |
| 103 | iso_pu_bacteria | 2506520008 | 2506582109 | 204 |
| 104 | iso_pu_bacteria | 2508501071 | 2508850934 | 204 |
| 105 | iso_pu_bacteria | 2511231011 | 2511296864 | 204 |
| 106 | iso_pu_bacteria | 2511231012 | 2511303586 | 204 |
| 107 | iso_pu_bacteria | 2511231017 | 2511331451 | 204 |
| 108 | iso_pu_bacteria | 2511231023 | 2511368980 | 204 |
| 109 | iso_pu_bacteria | 2511231031 | 2511414473 | 204 |
| 110 | iso_pu_bacteria | 2511231031 | 2511414487 | 204 |
| 111 | iso_pu_bacteria | 2511231031 | 2511414492 | 204 |
| 112 | iso_pu_bacteria | 2513237150 | 2513953306 | 204 |
| 113 | iso_pu_bacteria | 2513237150 | 2513955373 | 204 |
| 114 | iso_pu_bacteria | 2513237165 | 2514040704 | 204 |
| 115 | iso_pu_bacteria | 2597489888 | 2597866213 | 204 |
| 116 | iso_pu_bacteria | 2597489889 | 2597872051 | 204 |
| 117 | iso_pu_bacteria | 2599185167 | 2599401299 | 204 |
| 118 | iso_pu_bacteria | 2599185189 | 2599509778 | 204 |
| 119 | iso_pu_bacteria | 2599185191 | 2599520190 | 204 |
| 120 | iso_pu_bacteria | 2599185288 | 2599881622 | 204 |
| 121 | iso_pu_bacteria | 2599185292 | 2599904095 | 204 |
| 122 | iso_pu_bacteria | 2599185303 | 2599949247 | 204 |
| 123 | iso_pu_bacteria | 2599185352 | 2600192668 | 204 |
| 124 | iso_pu_bacteria | 2600255296 | 2601693851 | 204 |
| 125 | iso_pu_bacteria | 2619619299 | 2621297243 | 204 |
| 126 | iso_pu_bacteria | 2643221557 | 2643804680 | 204 |
| 127 | iso_pu_bacteria | 2643221571 | 2643870838 | 204 |
| 128 | iso_pu_bacteria | 2643221571 | 2643870849 | 204 |
| 129 | iso_pu_bacteria | 2643221589 | 2643953199 | 204 |
| 130 | iso_pu_bacteria | 2643221594 | 2643982739 | 204 |
| 131 | iso_pu_bacteria | 2643221602 | 2644025197 | 204 |
| 132 | iso_pu_bacteria | 2643221610 | 2644064043 | 204 |
| 133 | iso_pu_bacteria | 2643221618 | 2644104836 | 204 |
| 134 | iso_pu_bacteria | 2643221621 | 2644120799 | 204 |
| 135 | iso_pu_bacteria | 2643221626 | 2644151267 | 204 |
| 136 | iso_pu_bacteria | 2643221655 | 2644313255 | 204 |
| 137 | iso_pu_bacteria | 2643221659 | 2644336341 | 204 |
| 138 | iso_pu_bacteria | 2643221668 | 2644375649 | 204 |
| 139 | iso_pu_bacteria | 2643221675 | 2644415875 | 204 |
| 140 | iso_pu_bacteria | 2643221680 | 2644448916 | 204 |
| 141 | iso_pu_bacteria | 2643221683 | 2644464771 | 204 |
| 142 | iso_pu_bacteria | 2643221698 | 2644547177 | 204 |
| 143 | iso_pu_bacteria | 2643221712 | 2644612878 | 204 |
| 144 | iso_pu_bacteria | 2643221726 | 2644686560 | 204 |
| 145 | iso_pu_bacteria | 2643221736 | 2644745288 | 204 |
| 146 | iso_pu_bacteria | 2654587920 | 2656279341 | 204 |
| 147 | iso_pu_bacteria | 2687453601 | 2689443370 | 204 |
| 148 | iso_pu_bacteria | 2713897148 | 2715753493 | 204 |
| 149 | iso_pu_bacteria | 2713897148 | 2715753504 | 204 |
| 150 | iso_pu_bacteria | 2718217725 | 2718634506 | 204 |
| 151 | iso_pu_bacteria | 2718217725 | 2718634527 | 204 |
| 152 | iso_pu_bacteria | 2721755523 | 2722884471 | 204 |
| 153 | iso_pu_bacteria | 2721755607 | 2723250947 | 204 |
| 154 | iso_pu_bacteria | 2738541265 | 2738673013 | 204 |
| 155 | iso_pu_bacteria | 2738541282 | 2738751406 | 204 |
| 156 | iso_pu_bacteria | 2738541294 | 2738810174 | 204 |
| 157 | iso_pu_bacteria | 2738541303 | 2738860447 | 204 |
| 158 | iso_pu_bacteria | 2738541309 | 2738897534 | 204 |
| 159 | iso_pu_bacteria | 2738543015 | 2739261928 | 204 |
| 160 | iso_pu_bacteria | 2738543025 | 2739313190 | 204 |
| 161 | iso_pu_bacteria | 2738543025 | 2739313207 | 204 |
| 162 | iso_pu_bacteria | 2739367655 | 2739610493 | 204 |
| 163 | iso_pu_bacteria | 2772190666 | 2772437502 | 204 |
| 164 | iso_pu_bacteria | 2773857673 | 2774138333 | 204 |
| 165 | iso_pu_bacteria | 2784132063 | 2784264915 | 204 |
| 166 | iso_pu_bacteria | 2806310673 | 2807178360 | 204 |
| 167 | iso_pu_bacteria | 2808606385 | 2808977499 | 204 |
| 168 | iso_pu_bacteria | 2808606388 | 2808992843 | 204 |
| 169 | iso_pu_bacteria | 2808606395 | 2809034848 | 204 |
| 170 | iso_pu_bacteria | 2816332298 | 2817493639 | 204 |
| 171 | iso_pu_bacteria | 2839138175 | 2839143067 | 204 |
| 172 | iso_pu_bacteria | 2842826826 | 2842829062 | 204 |
| 173 | iso_pu_bacteria | 2842832357 | 2842835296 | 204 |
| 174 | iso_pu_bacteria | 2842832357 | 2842835307 | 204 |
| 175 | iso_pu_bacteria | 2842837860 | 2842840499 | 204 |
| 176 | iso_pu_bacteria | 2842843487 | 2842843613 | 204 |
| 177 | iso_pu_bacteria | 2842843487 | 2842844115 | 204 |
| 178 | iso_pu_bacteria | 2842843487 | 2842844126 | 204 |
| 179 | iso_pu_bacteria | 2844163670 | 2844169611 | 204 |
| 180 | iso_pu_bacteria | 2852612431 | 2852618061 | 204 |
| 181 | iso_pu_bacteria | 2852657418 | 2852662162 | 204 |
| 182 | iso_pu_bacteria | 2852667396 | 2852673119 | 204 |
| 183 | iso_pu_bacteria | 2854911287 | 2854916185 | 204 |
| 184 | iso_pu_bacteria | 2857537821 | 2857542021 | 204 |
| 185 | iso_pu_bacteria | 2857542790 | 2857543307 | 204 |
| 186 | iso_pu_bacteria | 2858950400 | 2858956753 | 204 |
| 187 | iso_pu_bacteria | 2860867994 | 2860872619 | 204 |
| 188 | iso_pu_bacteria | 2861691609 | 2861696025 | 204 |
| 189 | iso_pu_bacteria | 2869551831 | 2869552780 | 204 |
| 190 | iso_pu_bacteria | 2880230671 | 2880233052 | 204 |
| 191 | iso_pu_bacteria | 2888366609 | 2888367517 | 204 |
| 192 | iso_pu_bacteria | 2888366609 | 2888370691 | 204 |
| 193 | iso_pu_bacteria | 2904518522 | 2904523433 | 204 |
| 194 | iso_pu_bacteria | 2919385768 | 2919386928 | 204 |
| 195 | iso_pu_bacteria | 2919385768 | 2919391029 | 204 |
| 196 | iso_pu_bacteria | 2919487758 | 2919492212 | 204 |
| 197 | iso_pu_bacteria | 2919487758 | 2919492921 | 204 |
| 198 | iso_pu_bacteria | 2920822456 | 2920827004 | 204 |
| 199 | iso_pu_bacteria | 2929189879 | 2929194731 | 204 |
| 200 | iso_pu_bacteria | 2932406140 | 2932407490 | 204 |
| 201 | iso_pu_bacteria | 2937967321 | 2937969192 | 204 |
| 202 | iso_pu_bacteria | 2939573065 | 2939574432 | 204 |
| 203 | iso_pu_bacteria | 2939577877 | 2939579400 | 204 |
| 204 | iso_pu_bacteria | 2939636861 | 2939642409 | 204 |
| 205 | iso_pu_bacteria | 2941479691 | 2941480649 | 204 |
| 206 | iso_pu_bacteria | 2941499720 | 2941504472 | 204 |
| 207 | iso_pu_bacteria | 2945928738 | 2945931324 | 204 |
| 208 | iso_pu_bacteria | 2946027586 | 2946033223 | 204 |
| 209 | iso_pu_bacteria | 2947233263 | 2947233995 | 204 |
| 210 | iso_pu_bacteria | 2947233263 | 2947234006 | 204 |
| 211 | iso_pu_bacteria | 2969304461 | 2969307041 | 204 |
| 212 | iso_pu_bacteria | 2969304461 | 2969307065 | 204 |
| 213 | iso_pu_bacteria | 2974289157 | 2974291542 | 204 |
| 214 | iso_pu_bacteria | 2974289157 | 2974291552 | 204 |
| 215 | iso_pu_bacteria | 2998139840 | 2998142226 | 204 |
| 216 | iso_pu_bacteria | 2998139840 | 2998142236 | 204 |
| 217 | iso_pu_bacteria | 3007614139 | 3007619258 | 204 |
| 218 | iso_pu_bacteria | 3007614139 | 3007619272 | 204 |
| 219 | iso_pu_bacteria | 3007855910 | 3007856431 | 204 |
| 220 | iso_pu_bacteria | 3007861166 | 3007862473 | 204 |
| 221 | iso_pu_bacteria | 640753048 | 640936520 | 204 |
| 222 | iso_pu_bacteria | 644736347 | 644747007 | 204 |
| 223 | iso_pu_bacteria | 644736347 | 644751647 | 204 |
| 224 | iso_pu_bacteria | 8004592986 | 8004594200 | 204 |
| 225 | iso_pu_bacteria | 8011350971 | 8011351962 | 204 |
| 226 | iso_pu_bacteria | 8011350971 | 8011353698 | 204 |
| 227 | iso_pu_bacteria | 8015394850 | 8015396723 | 204 |
| 228 | iso_pu_bacteria | 8015394850 | 8015396776 | 204 |
| 229 | iso_pu_bacteria | 8029995093 | 8029998474 | 204 |
| 230 | iso_pu_bacteria | 8029995093 | 8029998484 | 204 |
| 231 | iso_pu_bacteria | 8054347763 | 8054352938 | 204 |
| 232 | iso_pu_bacteria | 8054503363 | 8054508506 | 204 |
| 233 | iso_pu_bacteria | 8055817908 | 8055823473 | 204 |
| 234 | iso_pu_bacteria | 8055878733 | 8055878776 | 204 |
| 235 | iso_pu_bacteria | 8056125926 | 8056129979 | 204 |
| 236 | iso_pu_bacteria | 8056131705 | 8056136910 | 204 |
| 237 | iso_pu_bacteria | 8056148874 | 8056150140 | 204 |
| 238 | iso_pu_bacteria | 8056166840 | 8056168836 | 204 |
| 239 | iso_pu_bacteria | 8056166840 | 8056168846 | 204 |
| 240 | iso_pu_bacteria | 8056177738 | 8056181397 | 204 |
| 241 | 3300003323 | rootH1_10142104 | rootH1_101421043 | 205 |
| 242 | 3300006048 | Ga0075363_100009224 | Ga0075363_1000092244 | 205 |
| 243 | 3300044712 | Ga0453684_0395903 | Ga0453684_0395903_778_1401 | 205 |
| 244 | 3300045051 | Ga0451576_0661975 | Ga0451576_0661975_131_787 | 205 |
| 245 | 3300046615 | Ga0495656_0058820 | Ga0495656_0058820_79_696 | 205 |
| 246 | 3300048920 | Ga0496117_0001129 | Ga0496117_0001129_9718_10335 | 205 |
| 247 | 3300049576 | Ga0501040_0340552 | Ga0501040_0340552_356_979 | 205 |
| 248 | 3300049577 | Ga0501041_0069703 | Ga0501041_0069703_618_1241 | 205 |
| 249 | 3300049578 | Ga0501042_0344445 | Ga0501042_0344445_86_709 | 205 |
| 250 | 3300049582 | Ga0501048_0231662 | Ga0501048_0231662_628_1251 | 205 |
| 251 | 3300049591 | Ga0501075_0315845 | Ga0501075_0315845_472_1095 | 205 |
| 252 | 3300049665 | Ga0501227_000545 | Ga0501227_000545_4613_5341 | 205 |
| 253 | 3300049744 | Ga0501083_0421295 | Ga0501083_0421295_217_840 | 205 |
| 254 | 3300054114 | Ga0501084_0972787 | Ga0501084_0972787_68_691 | 205 |
| 255 | iso_pu_bacteria | 2511231024 | 2511373348 | 205 |
| 256 | iso_pu_bacteria | 2511231024 | 2511373352 | 205 |
| 257 | iso_pu_bacteria | 2554235231 | 2555248209 | 205 |
| 258 | iso_pu_bacteria | 2643221565 | 2643841125 | 205 |
| 259 | iso_pu_bacteria | 2738541300 | 2738846718 | 205 |
| 260 | iso_pu_bacteria | 2738543018 | 2739277624 | 205 |
| 261 | iso_pu_bacteria | 2738543030 | 2739346691 | 205 |
| 262 | iso_pu_bacteria | 2765235841 | 2765586650 | 205 |
| 263 | iso_pu_bacteria | 2765235841 | 2765586657 | 205 |
| 264 | iso_pu_bacteria | 2806310737 | 2807405908 | 205 |
| 265 | iso_pu_bacteria | 2806310745 | 2807454243 | 205 |
| 266 | iso_pu_bacteria | 2894023352 | 2894024940 | 205 |
| 267 | iso_pu_bacteria | 2919155634 | 2919155969 | 205 |
| 268 | iso_pu_bacteria | 2932422444 | 2932422480 | 205 |
| 269 | iso_pu_bacteria | 3007803356 | 3007807637 | 205 |
| 270 | iso_pu_bacteria | 3007803356 | 3007807644 | 205 |
| 271 | iso_pu_bacteria | 3007872151 | 3007873260 | 205 |
| 272 | iso_pu_bacteria | 8052494512 | 8052494765 | 205 |
| 273 | iso_pu_bacteria | 8052494512 | 8052494772 | 205 |
| 274 | iso_pu_bacteria | 8054929484 | 8054931244 | 205 |
| 275 | iso_pu_bacteria | 8054929484 | 8054931252 | 205 |
| 276 | iso_pu_bacteria | 8056115690 | 8056116208 | 205 |
| 277 | iso_pu_bacteria | 8056120720 | 8056120837 | 205 |
| 278 | iso_pu_bacteria | 8056137416 | 8056142873 | 205 |
| 279 | iso_pu_bacteria | 8056137416 | 8056142874 | 205 |
| 280 | iso_pu_bacteria | 8056137416 | 8056142881 | 205 |
| 281 | 2162886007 | SwRhRL2b_contig_2968351 | SwRhRL2b_0145.00002800 | 206 |
| 282 | 2162886007 | SwRhRL2b_contig_3730156 | SwRhRL2b_0310.00006310 | 206 |
| 283 | 3300005289 | Ga0065704_10004276 | Ga0065704_100042762 | 206 |
| 284 | 3300005289 | Ga0065704_10079174 | Ga0065704_100791744 | 206 |
| 285 | 3300005353 | Ga0070669_100584433 | Ga0070669_1005844331 | 206 |
| 286 | 3300006944 | Ga0099823_1000275 | Ga0099823_100027515 | 206 |
| 287 | 3300006944 | Ga0099823_1032813 | Ga0099823_10328132 | 206 |
| 288 | 3300009011 | Ga0105251_10000391 | Ga0105251_1000039115 | 206 |
| 289 | 3300009011 | Ga0105251_10000666 | Ga0105251_1000066610 | 206 |
| 290 | 3300009011 | Ga0105251_10113377 | Ga0105251_101133772 | 206 |
| 291 | 3300009036 | Ga0105244_10000799 | Ga0105244_1000079915 | 206 |
| 292 | 3300009036 | Ga0105244_10009450 | Ga0105244_100094501 | 206 |
| 293 | 3300009036 | Ga0105244_10014292 | Ga0105244_100142925 | 206 |
| 294 | 3300009036 | Ga0105244_10106183 | Ga0105244_101061832 | 206 |
| 295 | 3300009036 | Ga0105244_10109731 | Ga0105244_101097312 | 206 |
| 296 | 3300009092 | Ga0105250_10013843 | Ga0105250_100138434 | 206 |
| 297 | 3300009092 | Ga0105250_10033127 | Ga0105250_100331273 | 206 |
| 298 | 3300009092 | Ga0105250_10035365 | Ga0105250_100353654 | 206 |
| 299 | 3300009148 | Ga0105243_10001783 | Ga0105243_1000178310 | 206 |
| 300 | 3300013104 | Ga0157370_10031541 | Ga0157370_100315415 | 206 |
| 301 | 3300025292 | Ga0209676_1002285 | Ga0209676_10022853 | 206 |
| 302 | 3300025711 | Ga0207696_1000172 | Ga0207696_100017294 | 206 |
| 303 | 3300025711 | Ga0207696_1009804 | Ga0207696_10098042 | 206 |
| 304 | 3300025711 | Ga0207696_1011818 | Ga0207696_10118182 | 206 |
| 305 | 3300025711 | Ga0207696_1029204 | Ga0207696_10292042 | 206 |
| 306 | 3300025728 | Ga0207655_1000445 | Ga0207655_100044527 | 206 |
| 307 | 3300025728 | Ga0207655_1000523 | Ga0207655_100052329 | 206 |
| 308 | 3300025728 | Ga0207655_1004927 | Ga0207655_10049279 | 206 |
| 309 | 3300025728 | Ga0207655_1010084 | Ga0207655_10100841 | 206 |
| 310 | 3300025735 | Ga0207713_1000003 | Ga0207713_1000003670 | 206 |
| 311 | 3300025735 | Ga0207713_1012399 | Ga0207713_10123995 | 206 |
| 312 | 3300025735 | Ga0207713_1024772 | Ga0207713_10247722 | 206 |
| 313 | 3300025735 | Ga0207713_1031802 | Ga0207713_10318024 | 206 |
| 314 | 3300025735 | Ga0207713_1104403 | Ga0207713_11044031 | 206 |
| 315 | 3300025935 | Ga0207709_10002073 | Ga0207709_100020737 | 206 |
| 316 | 3300025935 | Ga0207709_10452497 | Ga0207709_104524971 | 206 |
| 317 | 3300027296 | Ga0209389_1000125 | Ga0209389_100012549 | 206 |
| 318 | 3300027312 | Ga0209371_1019651 | Ga0209371_10196511 | 206 |
| 319 | 3300042006 | Ga0439432_000442 | Ga0439432_000442_627_1247 | 206 |
| 320 | 3300042142 | Ga0450905_004491 | Ga0450905_004491_140_760 | 206 |
| 321 | 3300042142 | Ga0450905_012351 | Ga0450905_012351_425_1045 | 206 |
| 322 | 3300042439 | Ga0439464_0011602 | Ga0439464_0011602_749_1369 | 206 |
| 323 | 3300046515 | Ga0495620_0000124 | Ga0495620_0000124_14296_14916 | 206 |
| 324 | 3300046519 | Ga0495632_0000466 | Ga0495632_0000466_23700_24320 | 206 |
| 325 | 3300046520 | Ga0495637_0011326 | Ga0495637_0011326_300_1064 | 206 |
| 326 | 3300046522 | Ga0495643_0000810 | Ga0495643_0000810_16944_17564 | 206 |
| 327 | 3300046522 | Ga0495643_0002462 | Ga0495643_0002462_9181_9801 | 206 |
| 328 | 3300046524 | Ga0495648_0000606 | Ga0495648_0000606_14108_14728 | 206 |
| 329 | 3300046694 | Ga0495649_0043143 | Ga0495649_0043143_300_1064 | 206 |
| 330 | 3300048913 | Ga0496110_0080476 | Ga0496110_0080476_1812_2432 | 206 |
| 331 | 3300048917 | Ga0496114_0064744 | Ga0496114_0064744_37_657 | 206 |
| 332 | 3300048919 | Ga0496116_0018151 | Ga0496116_0018151_4673_5293 | 206 |
| 333 | 3300048920 | Ga0496117_0002101 | Ga0496117_0002101_4501_5121 | 206 |
| 334 | 3300048920 | Ga0496117_0033569 | Ga0496117_0033569_74_694 | 206 |
| 335 | 3300048921 | Ga0496118_0000752 | Ga0496118_0000752_24029_24649 | 206 |
| 336 | 3300048921 | Ga0496118_0003476 | Ga0496118_0003476_19075_19695 | 206 |
| 337 | 3300048925 | Ga0496122_0001471 | Ga0496122_0001471_30228_30848 | 206 |
| 338 | 3300048925 | Ga0496122_0064436 | Ga0496122_0064436_1818_2438 | 206 |
| 339 | 3300048926 | Ga0496123_0000567 | Ga0496123_0000567_35037_35657 | 206 |
| 340 | 3300048926 | Ga0496123_0205864 | Ga0496123_0205864_227_847 | 206 |
| 341 | 3300048927 | Ga0496124_0005761 | Ga0496124_0005761_7991_8611 | 206 |
| 342 | 3300048927 | Ga0496124_0006362 | Ga0496124_0006362_10130_10750 | 206 |
| 343 | 3300048927 | Ga0496124_0047518 | Ga0496124_0047518_2970_3590 | 206 |
| 344 | 3300048928 | Ga0496125_0002428 | Ga0496125_0002428_23517_24137 | 206 |
| 345 | 3300048928 | Ga0496125_0010853 | Ga0496125_0010853_1272_1892 | 206 |
| 346 | 3300048929 | Ga0496126_0247596 | Ga0496126_0247596_247_867 | 206 |
| 347 | 3300048929 | Ga0496126_0334349 | Ga0496126_0334349_607_1227 | 206 |
| 348 | 3300049571 | Ga0501034_0000131 | Ga0501034_0000131_129551_130171 | 206 |
| 349 | 3300049572 | Ga0501036_0453174 | Ga0501036_0453174_11_640 | 206 |
| 350 | 3300049574 | Ga0501038_0002404 | Ga0501038_0002404_7979_8608 | 206 |
| 351 | 3300049575 | Ga0501039_0033404 | Ga0501039_0033404_204_833 | 206 |
| 352 | 3300049822 | Ga0501035_0149620 | Ga0501035_0149620_982_1611 | 206 |
| 353 | 3300053135 | Ga0500659_0000087 | Ga0500659_0000087_32107_32727 | 206 |
| 354 | 3300002773 | JGI25152J39213_1000856 | JGI25152J39213_10008565 | 207 |
| 355 | 3300003187 | JGI25151J46595_10003449 | JGI25151J46595_100034493 | 207 |
| 356 | 3300003320 | rootH2_10069019 | rootH2_100690192 | 207 |
| 357 | 3300003771 | Ga0055526_1001559 | Ga0055526_10015592 | 207 |
| 358 | 3300003771 | Ga0055526_1005545 | Ga0055526_10055452 | 207 |
| 359 | 3300003781 | Ga0055536_1000058 | Ga0055536_10000586 | 207 |
| 360 | 3300003784 | Ga0055534_1000751 | Ga0055534_10007519 | 207 |
| 361 | 3300003856 | Ga0058692_1002490 | Ga0058692_10024904 | 207 |
| 362 | 3300009011 | Ga0105251_10000042 | Ga0105251_100000428 | 207 |
| 363 | 3300009036 | Ga0105244_10013896 | Ga0105244_100138962 | 207 |
| 364 | 3300009092 | Ga0105250_10000059 | Ga0105250_1000005984 | 207 |
| 365 | 3300009148 | Ga0105243_10039987 | Ga0105243_100399874 | 207 |
| 366 | 3300013102 | Ga0157371_10431531 | Ga0157371_104315311 | 207 |
| 367 | 3300013105 | Ga0157369_10007171 | Ga0157369_100071715 | 207 |
| 368 | 3300013307 | Ga0157372_10000672 | Ga0157372_1000067214 | 207 |
| 369 | 3300025245 | Ga0207425_1010707 | Ga0207425_10107072 | 207 |
| 370 | 3300025258 | Ga0209129_1000008 | Ga0209129_100000850 | 207 |
| 371 | 3300025291 | Ga0209675_1000167 | Ga0209675_10001677 | 207 |
| 372 | 3300025292 | Ga0209676_1000210 | Ga0209676_100021011 | 207 |
| 373 | 3300025294 | Ga0209025_1000051 | Ga0209025_1000051197 | 207 |
| 374 | 3300025295 | Ga0209564_1000084 | Ga0209564_1000084204 | 207 |
| 375 | 3300025295 | Ga0209564_1001130 | Ga0209564_10011307 | 207 |
| 376 | 3300025711 | Ga0207696_1000005 | Ga0207696_1000005121 | 207 |
| 377 | 3300025728 | Ga0207655_1045291 | Ga0207655_10452912 | 207 |
| 378 | 3300025735 | Ga0207713_1000002 | Ga0207713_1000002364 | 207 |
| 379 | 3300025935 | Ga0207709_10363427 | Ga0207709_103634271 | 207 |
| 380 | 3300027312 | Ga0209371_1000046 | Ga0209371_100004621 | 207 |
| 381 | 3300027312 | Ga0209371_1000959 | Ga0209371_10009596 | 207 |
| 382 | 3300027312 | Ga0209371_1008116 | Ga0209371_10081162 | 207 |
| 383 | 3300027312 | Ga0209371_1011506 | Ga0209371_10115063 | 207 |
| 384 | 3300027312 | Ga0209371_1012687 | Ga0209371_10126872 | 207 |
| 385 | 3300030500 | Ga0268256_1000012 | Ga0268256_100001241 | 207 |
| 386 | 3300030500 | Ga0268256_1005632 | Ga0268256_10056322 | 207 |
| 387 | 3300030500 | Ga0268256_1012555 | Ga0268256_10125552 | 207 |
| 388 | 3300030500 | Ga0268256_1013855 | Ga0268256_10138552 | 207 |
| 389 | 3300042010 | Ga0439452_000005 | Ga0439452_000005_595200_595823 | 207 |
| 390 | 3300042010 | Ga0439452_006872 | Ga0439452_006872_1681_2304 | 207 |
| 391 | 3300042115 | Ga0450911_000820 | Ga0450911_000820_7074_7697 | 207 |
| 392 | 3300042439 | Ga0439464_0033500 | Ga0439464_0033500_301_924 | 207 |
| 393 | 3300044669 | Ga0466981_0000007 | Ga0466981_0000007_122631_123254 | 207 |
| 394 | 3300046471 | Ga0495650_0005106 | Ga0495650_0005106_5578_6201 | 207 |
| 395 | 3300046471 | Ga0495650_0119151 | Ga0495650_0119151_112_735 | 207 |
| 396 | 3300047446 | Ga0495679_007973 | Ga0495679_007973_2168_2791 | 207 |
| 397 | 3300048907 | Ga0496104_0022954 | Ga0496104_0022954_2336_2959 | 207 |
| 398 | 3300048908 | Ga0496105_0064629 | Ga0496105_0064629_321_944 | 207 |
| 399 | 3300048919 | Ga0496116_0001738 | Ga0496116_0001738_3730_4353 | 207 |
| 400 | 3300048919 | Ga0496116_0185320 | Ga0496116_0185320_426_1049 | 207 |
| 401 | 3300048919 | Ga0496116_0185561 | Ga0496116_0185561_60_683 | 207 |
| 402 | 3300048920 | Ga0496117_0009911 | Ga0496117_0009911_4516_5139 | 207 |
| 403 | 3300048920 | Ga0496117_0318653 | Ga0496117_0318653_85_708 | 207 |
| 404 | 3300048921 | Ga0496118_0006939 | Ga0496118_0006939_8828_9451 | 207 |
| 405 | 3300048921 | Ga0496118_0011847 | Ga0496118_0011847_4414_5037 | 207 |
| 406 | 3300048921 | Ga0496118_0039084 | Ga0496118_0039084_2090_2713 | 207 |
| 407 | 3300048922 | Ga0496119_0000032 | Ga0496119_0000032_51947_52570 | 207 |
| 408 | 3300048922 | Ga0496119_0000230 | Ga0496119_0000230_19293_19916 | 207 |
| 409 | 3300048922 | Ga0496119_0088545 | Ga0496119_0088545_903_1526 | 207 |
| 410 | 3300048923 | Ga0496120_0000324 | Ga0496120_0000324_22460_23083 | 207 |
| 411 | 3300048923 | Ga0496120_0009427 | Ga0496120_0009427_2110_2733 | 207 |
| 412 | 3300048923 | Ga0496120_0069875 | Ga0496120_0069875_1068_1691 | 207 |
| 413 | 3300048924 | Ga0496121_0056192 | Ga0496121_0056192_1146_1769 | 207 |
| 414 | 3300048925 | Ga0496122_0000582 | Ga0496122_0000582_27598_28221 | 207 |
| 415 | 3300048925 | Ga0496122_0012075 | Ga0496122_0012075_2685_3308 | 207 |
| 416 | 3300048925 | Ga0496122_0082195 | Ga0496122_0082195_1584_2207 | 207 |
| 417 | 3300048926 | Ga0496123_0000479 | Ga0496123_0000479_46124_46747 | 207 |
| 418 | 3300048926 | Ga0496123_0011868 | Ga0496123_0011868_1767_2390 | 207 |
| 419 | 3300048926 | Ga0496123_0099822 | Ga0496123_0099822_293_916 | 207 |
| 420 | 3300048927 | Ga0496124_0000332 | Ga0496124_0000332_34749_35372 | 207 |
| 421 | 3300048927 | Ga0496124_0052871 | Ga0496124_0052871_510_1133 | 207 |
| 422 | 3300048927 | Ga0496124_0212040 | Ga0496124_0212040_604_1227 | 207 |
| 423 | 3300048928 | Ga0496125_0018504 | Ga0496125_0018504_4066_4689 | 207 |
| 424 | 3300048928 | Ga0496125_0066411 | Ga0496125_0066411_341_964 | 207 |
| 425 | 3300048928 | Ga0496125_0080299 | Ga0496125_0080299_97_720 | 207 |
| 426 | 3300048928 | Ga0496125_0190764 | Ga0496125_0190764_234_857 | 207 |
| 427 | 3300048929 | Ga0496126_0010848 | Ga0496126_0010848_5280_5903 | 207 |
| 428 | 3300048929 | Ga0496126_0019975 | Ga0496126_0019975_1097_1720 | 207 |
| 429 | 3300048929 | Ga0496126_0050226 | Ga0496126_0050226_663_1286 | 207 |
| 430 | 3300049569 | Ga0501032_0373673 | Ga0501032_0373673_171_812 | 207 |
| 431 | 3300049576 | Ga0501040_0358361 | Ga0501040_0358361_198_839 | 207 |
| 432 | 3300049576 | Ga0501040_0656410 | Ga0501040_0656410_114_746 | 207 |
| 433 | 3300049577 | Ga0501041_0243440 | Ga0501041_0243440_237_878 | 207 |
| 434 | 3300049578 | Ga0501042_0098375 | Ga0501042_0098375_254_895 | 207 |
| 435 | 3300049587 | Ga0501071_0786166 | Ga0501071_0786166_38_679 | 207 |
| 436 | 3300049588 | Ga0501072_0112231 | Ga0501072_0112231_1070_1711 | 207 |
| 437 | 3300049588 | Ga0501072_0330996 | Ga0501072_0330996_35_667 | 207 |
| 438 | 3300049591 | Ga0501075_0019354 | Ga0501075_0019354_698_1339 | 207 |
| 439 | 3300049591 | Ga0501075_0045078 | Ga0501075_0045078_385_1017 | 207 |
| 440 | 3300049592 | Ga0501076_0016082 | Ga0501076_0016082_1265_1906 | 207 |
| 441 | 3300049593 | Ga0501077_0040832 | Ga0501077_0040832_1429_2070 | 207 |
| 442 | 3300049742 | Ga0501080_0298737 | Ga0501080_0298737_808_1449 | 207 |
| 443 | 3300049822 | Ga0501035_0350285 | Ga0501035_0350285_66_707 | 207 |
| 444 | iso_pu_bacteria | 2739367655 | 2739610590 | 207 |
| 445 | 2162886007 | SwRhRL2b_contig_1285905 | SwRhRL2b_0387.00001970 | 208 |
| 446 | 3300003578 | Ga0006562J51391_1139573 | Ga0006562J51391_11395732 | 208 |
| 447 | 3300003751 | Ga0055538_1001219 | Ga0055538_10012198 | 208 |
| 448 | 3300003771 | Ga0055526_1007392 | Ga0055526_10073922 | 208 |
| 449 | 3300003775 | Ga0055524_1000731 | Ga0055524_100073116 | 208 |
| 450 | 3300003781 | Ga0055536_1000458 | Ga0055536_100045823 | 208 |
| 451 | 3300003792 | Ga0055540_1000344 | Ga0055540_100034422 | 208 |
| 452 | 3300003841 | Ga0055541_1001161 | Ga0055541_10011616 | 208 |
| 453 | 3300005272 | Ga0065703_1000561 | Ga0065703_10005614 | 208 |
| 454 | 3300005288 | Ga0065714_10002206 | Ga0065714_1000220635 | 208 |
| 455 | 3300005288 | Ga0065714_10070299 | Ga0065714_100702992 | 208 |
| 456 | 3300005289 | Ga0065704_10096582 | Ga0065704_100965821 | 208 |
| 457 | 3300005289 | Ga0065704_10124566 | Ga0065704_101245662 | 208 |
| 458 | 3300005289 | Ga0065704_10163538 | Ga0065704_101635381 | 208 |
| 459 | 3300005548 | Ga0070665_100151506 | Ga0070665_1001515062 | 208 |
| 460 | 3300005617 | Ga0068859_100190329 | Ga0068859_1001903292 | 208 |
| 461 | 3300005937 | Ga0081455_10017544 | Ga0081455_100175449 | 208 |
| 462 | 3300005937 | Ga0081455_10092321 | Ga0081455_100923213 | 208 |
| 463 | 3300006028 | Ga0070717_10667348 | Ga0070717_106673481 | 208 |
| 464 | 3300006051 | Ga0075364_10077656 | Ga0075364_100776563 | 208 |
| 465 | 3300006051 | Ga0075364_10169985 | Ga0075364_101699852 | 208 |
| 466 | 3300006051 | Ga0075364_10219983 | Ga0075364_102199832 | 208 |
| 467 | 3300006051 | Ga0075364_10393324 | Ga0075364_103933241 | 208 |
| 468 | 3300006058 | Ga0075432_10033565 | Ga0075432_100335653 | 208 |
| 469 | 3300006058 | Ga0075432_10076629 | Ga0075432_100766291 | 208 |
| 470 | 3300006058 | Ga0075432_10089266 | Ga0075432_100892662 | 208 |
| 471 | 3300006177 | Ga0075362_10058435 | Ga0075362_100584352 | 208 |
| 472 | 3300006177 | Ga0075362_10174184 | Ga0075362_101741842 | 208 |
| 473 | 3300006353 | Ga0075370_10347356 | Ga0075370_103473561 | 208 |
| 474 | 3300006914 | Ga0075436_100240524 | Ga0075436_1002405242 | 208 |
| 475 | 3300006914 | Ga0075436_100366636 | Ga0075436_1003666361 | 208 |
| 476 | 3300006931 | Ga0097620_100190318 | Ga0097620_1001903182 | 208 |
| 477 | 3300006946 | Ga0079104_1000004 | Ga0079104_100000488 | 208 |
| 478 | 3300006946 | Ga0079104_1000176 | Ga0079104_100017655 | 208 |
| 479 | 3300006946 | Ga0079104_1000700 | Ga0079104_100070026 | 208 |
| 480 | 3300006948 | Ga0099826_10000013 | Ga0099826_10000013189 | 208 |
| 481 | 3300007076 | Ga0075435_100802479 | Ga0075435_1008024791 | 208 |
| 482 | 3300009011 | Ga0105251_10000073 | Ga0105251_1000007350 | 208 |
| 483 | 3300009011 | Ga0105251_10000582 | Ga0105251_100005823 | 208 |
| 484 | 3300009011 | Ga0105251_10015013 | Ga0105251_100150132 | 208 |
| 485 | 3300009036 | Ga0105244_10000026 | Ga0105244_10000026186 | 208 |
| 486 | 3300009036 | Ga0105244_10000071 | Ga0105244_1000007120 | 208 |
| 487 | 3300009036 | Ga0105244_10040086 | Ga0105244_100400862 | 208 |
| 488 | 3300009036 | Ga0105244_10225347 | Ga0105244_102253472 | 208 |
| 489 | 3300009092 | Ga0105250_10000310 | Ga0105250_1000031010 | 208 |
| 490 | 3300009092 | Ga0105250_10037558 | Ga0105250_100375582 | 208 |
| 491 | 3300009092 | Ga0105250_10130841 | Ga0105250_101308412 | 208 |
| 492 | 3300009094 | Ga0111539_10015990 | Ga0111539_100159905 | 208 |
| 493 | 3300009101 | Ga0105247_10000187 | Ga0105247_1000018747 | 208 |
| 494 | 3300009147 | Ga0114129_10026761 | Ga0114129_100267614 | 208 |
| 495 | 3300009148 | Ga0105243_10000547 | Ga0105243_1000054720 | 208 |
| 496 | 3300009148 | Ga0105243_10000736 | Ga0105243_1000073628 | 208 |
| 497 | 3300009148 | Ga0105243_10001371 | Ga0105243_1000137110 | 208 |
| 498 | 3300009148 | Ga0105243_10048163 | Ga0105243_100481632 | 208 |
| 499 | 3300009174 | Ga0105241_10000004 | Ga0105241_10000004100 | 208 |
| 500 | 3300009177 | Ga0105248_10971349 | Ga0105248_109713491 | 208 |
| 501 | 3300009553 | Ga0105249_10000138 | Ga0105249_1000013891 | 208 |
| 502 | 3300012498 | Ga0157345_1000004 | Ga0157345_100000423 | 208 |
| 503 | 3300013100 | Ga0157373_10000039 | Ga0157373_1000003954 | 208 |
| 504 | 3300013100 | Ga0157373_10062091 | Ga0157373_100620913 | 208 |
| 505 | 3300013100 | Ga0157373_10260503 | Ga0157373_102605032 | 208 |
| 506 | 3300013104 | Ga0157370_10001493 | Ga0157370_100014932 | 208 |
| 507 | 3300013296 | Ga0157374_10201811 | Ga0157374_102018113 | 208 |
| 508 | 3300013306 | Ga0163162_10000067 | Ga0163162_1000006743 | 208 |
| 509 | 3300014497 | Ga0182008_10013747 | Ga0182008_100137476 | 208 |
| 510 | 3300014497 | Ga0182008_10033799 | Ga0182008_100337992 | 208 |
| 511 | 3300014497 | Ga0182008_10034689 | Ga0182008_100346892 | 208 |
| 512 | 3300015261 | Ga0182006_1023968 | Ga0182006_10239682 | 208 |
| 513 | 3300017792 | Ga0163161_10000004 | Ga0163161_10000004290 | 208 |
| 514 | 3300017792 | Ga0163161_10000066 | Ga0163161_10000066107 | 208 |
| 515 | 3300025224 | Ga0209784_100360 | Ga0209784_10036017 | 208 |
| 516 | 3300025225 | Ga0209566_100666 | Ga0209566_10066622 | 208 |
| 517 | 3300025226 | Ga0209674_102378 | Ga0209674_1023782 | 208 |
| 518 | 3300025263 | Ga0209565_1000053 | Ga0209565_1000053120 | 208 |
| 519 | 3300025263 | Ga0209565_1000176 | Ga0209565_100017667 | 208 |
| 520 | 3300025273 | Ga0209673_1020634 | Ga0209673_10206342 | 208 |
| 521 | 3300025291 | Ga0209675_1000091 | Ga0209675_1000091120 | 208 |
| 522 | 3300025291 | Ga0209675_1000328 | Ga0209675_100032811 | 208 |
| 523 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098128 | 208 |
| 524 | 3300025292 | Ga0209676_1001409 | Ga0209676_10014097 | 208 |
| 525 | 3300025292 | Ga0209676_1003474 | Ga0209676_10034748 | 208 |
| 526 | 3300025292 | Ga0209676_1035086 | Ga0209676_10350862 | 208 |
| 527 | 3300025294 | Ga0209025_1000085 | Ga0209025_100008571 | 208 |
| 528 | 3300025294 | Ga0209025_1000098 | Ga0209025_100009894 | 208 |
| 529 | 3300025295 | Ga0209564_1000421 | Ga0209564_100042167 | 208 |
| 530 | 3300025295 | Ga0209564_1000666 | Ga0209564_10006661 | 208 |
| 531 | 3300025298 | Ga0209050_1000754 | Ga0209050_100075420 | 208 |
| 532 | 3300025298 | Ga0209050_1008876 | Ga0209050_10088765 | 208 |
| 533 | 3300025299 | Ga0209256_1000073 | Ga0209256_1000073106 | 208 |
| 534 | 3300025299 | Ga0209256_1000517 | Ga0209256_100051737 | 208 |
| 535 | 3300025299 | Ga0209256_1001071 | Ga0209256_100107112 | 208 |
| 536 | 3300025303 | Ga0209051_1000098 | Ga0209051_1000098128 | 208 |
| 537 | 3300025303 | Ga0209051_1019117 | Ga0209051_10191172 | 208 |
| 538 | 3300025304 | Ga0209257_1021335 | Ga0209257_10213352 | 208 |
| 539 | 3300025711 | Ga0207696_1000003 | Ga0207696_1000003782 | 208 |
| 540 | 3300025711 | Ga0207696_1000033 | Ga0207696_1000033248 | 208 |
| 541 | 3300025711 | Ga0207696_1003553 | Ga0207696_10035534 | 208 |
| 542 | 3300025728 | Ga0207655_1000027 | Ga0207655_1000027343 | 208 |
| 543 | 3300025728 | Ga0207655_1000057 | Ga0207655_1000057215 | 208 |
| 544 | 3300025728 | Ga0207655_1011659 | Ga0207655_10116595 | 208 |
| 545 | 3300025728 | Ga0207655_1015132 | Ga0207655_10151322 | 208 |
| 546 | 3300025728 | Ga0207655_1122658 | Ga0207655_11226581 | 208 |
| 547 | 3300025735 | Ga0207713_1000065 | Ga0207713_1000065115 | 208 |
| 548 | 3300025735 | Ga0207713_1000108 | Ga0207713_100010879 | 208 |
| 549 | 3300025735 | Ga0207713_1004928 | Ga0207713_10049281 | 208 |
| 550 | 3300025735 | Ga0207713_1078765 | Ga0207713_10787651 | 208 |
| 551 | 3300025900 | Ga0207710_10000016 | Ga0207710_10000016122 | 208 |
| 552 | 3300025911 | Ga0207654_10000006 | Ga0207654_10000006116 | 208 |
| 553 | 3300025935 | Ga0207709_10000019 | Ga0207709_10000019200 | 208 |
| 554 | 3300025935 | Ga0207709_10000130 | Ga0207709_1000013061 | 208 |
| 555 | 3300025935 | Ga0207709_10000565 | Ga0207709_1000056528 | 208 |
| 556 | 3300025961 | Ga0207712_10000103 | Ga0207712_1000010392 | 208 |
| 557 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005289 | 208 |
| 558 | 3300027111 | Ga0209281_1000008 | Ga0209281_1000008754 | 208 |
| 559 | 3300027111 | Ga0209281_1000294 | Ga0209281_10002946 | 208 |
| 560 | 3300027111 | Ga0209281_1007658 | Ga0209281_10076583 | 208 |
| 561 | 3300027666 | Ga0209282_1000043 | Ga0209282_100004396 | 208 |
| 562 | 3300027876 | Ga0209974_10009818 | Ga0209974_100098181 | 208 |
| 563 | 3300027907 | Ga0207428_10171731 | Ga0207428_101717311 | 208 |
| 564 | 3300027907 | Ga0207428_10172086 | Ga0207428_101720862 | 208 |
| 565 | 3300027907 | Ga0207428_10179370 | Ga0207428_101793702 | 208 |
| 566 | 3300027907 | Ga0207428_10217958 | Ga0207428_102179582 | 208 |
| 567 | 3300028379 | Ga0268266_10083946 | Ga0268266_100839462 | 208 |
| 568 | 3300028786 | Ga0307517_10030228 | Ga0307517_100302285 | 208 |
| 569 | 3300031507 | Ga0307509_10149488 | Ga0307509_101494883 | 208 |
| 570 | 3300031616 | Ga0307508_10239705 | Ga0307508_102397052 | 208 |
| 571 | 3300031731 | Ga0307405_10048028 | Ga0307405_100480282 | 208 |
| 572 | 3300031911 | Ga0307412_10010689 | Ga0307412_100106892 | 208 |
| 573 | 3300031911 | Ga0307412_10247750 | Ga0307412_102477501 | 208 |
| 574 | 3300031911 | Ga0307412_10338074 | Ga0307412_103380742 | 208 |
| 575 | 3300032002 | Ga0307416_100631951 | Ga0307416_1006319512 | 208 |
| 576 | 3300032005 | Ga0307411_10073542 | Ga0307411_100735423 | 208 |
| 577 | 3300032005 | Ga0307411_10222313 | Ga0307411_102223132 | 208 |
| 578 | 3300033180 | Ga0307510_10000324 | Ga0307510_1000032425 | 208 |
| 579 | 3300033180 | Ga0307510_10000324 | Ga0307510_100003245 | 208 |
| 580 | 3300033180 | Ga0307510_10056331 | Ga0307510_100563311 | 208 |
| 581 | 3300039437 | Ga0436365_1873831 | Ga0436365_1873831_701_1333 | 208 |
| 582 | 3300041405 | Ga0439438_000894 | Ga0439438_000894_3203_3829 | 208 |
| 583 | 3300041405 | Ga0439438_008226 | Ga0439438_008226_1710_2336 | 208 |
| 584 | 3300041407 | Ga0439447_000588 | Ga0439447_000588_3675_4301 | 208 |
| 585 | 3300041411 | Ga0439466_0024049 | Ga0439466_0024049_941_1567 | 208 |
| 586 | 3300041494 | Ga0451837_1686659 | Ga0451837_1686659_782_1450 | 208 |
| 587 | 3300042006 | Ga0439432_006057 | Ga0439432_006057_3528_4154 | 208 |
| 588 | 3300042010 | Ga0439452_001772 | Ga0439452_001772_7082_7708 | 208 |
| 589 | 3300042122 | Ga0450920_008740 | Ga0450920_008740_264_890 | 208 |
| 590 | 3300042124 | Ga0450922_000031 | Ga0450922_000031_2466_3092 | 208 |
| 591 | 3300042136 | Ga0450900_003341 | Ga0450900_003341_1028_1654 | 208 |
| 592 | 3300042137 | Ga0450902_000234 | Ga0450902_000234_5031_5657 | 208 |
| 593 | 3300042142 | Ga0450905_000549 | Ga0450905_000549_1493_2119 | 208 |
| 594 | 3300042146 | Ga0450907_029959 | Ga0450907_029959_174_800 | 208 |
| 595 | 3300042147 | Ga0450910_001840 | Ga0450910_001840_1848_2474 | 208 |
| 596 | 3300042184 | Ga0450908_007926 | Ga0450908_007926_1103_1729 | 208 |
| 597 | 3300042461 | Ga0439460_0006245 | Ga0439460_0006245_2290_2916 | 208 |
| 598 | 3300044656 | Ga0466969_0031452 | Ga0466969_0031452_1187_1864 | 208 |
| 599 | 3300044666 | Ga0466977_0356395 | Ga0466977_0356395_156_782 | 208 |
| 600 | 3300044683 | Ga0466965_0017394 | Ga0466965_0017394_601_1227 | 208 |
| 601 | 3300044693 | Ga0466961_0000028 | Ga0466961_0000028_31729_32355 | 208 |
| 602 | 3300044706 | Ga0466964_0027344 | Ga0466964_0027344_1431_2057 | 208 |
| 603 | 3300044712 | Ga0453684_0042921 | Ga0453684_0042921_1373_2020 | 208 |
| 604 | 3300044712 | Ga0453684_0536361 | Ga0453684_0536361_176_823 | 208 |
| 605 | 3300044719 | Ga0466971_0013057 | Ga0466971_0013057_2034_2660 | 208 |
| 606 | 3300044735 | Ga0466968_0009173 | Ga0466968_0009173_1997_2623 | 208 |
| 607 | 3300044765 | Ga0466970_0017001 | Ga0466970_0017001_2214_2840 | 208 |
| 608 | 3300044901 | Ga0466960_0062595 | Ga0466960_0062595_548_1174 | 208 |
| 609 | 3300045049 | Ga0466959_0107157 | Ga0466959_0107157_613_1239 | 208 |
| 610 | 3300046452 | Ga0495617_002042 | Ga0495617_002042_5713_6345 | 208 |
| 611 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_17508_18140 | 208 |
| 612 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_46122_46754 | 208 |
| 613 | 3300046453 | Ga0495627_000133 | Ga0495627_000133_30786_31418 | 208 |
| 614 | 3300046453 | Ga0495627_000133 | Ga0495627_000133_55908_56540 | 208 |
| 615 | 3300046453 | Ga0495627_000141 | Ga0495627_000141_24536_25162 | 208 |
| 616 | 3300046453 | Ga0495627_000624 | Ga0495627_000624_21488_22120 | 208 |
| 617 | 3300046457 | Ga0495590_0001183 | Ga0495590_0001183_8622_9248 | 208 |
| 618 | 3300046457 | Ga0495590_0011347 | Ga0495590_0011347_1583_2212 | 208 |
| 619 | 3300046457 | Ga0495590_0014819 | Ga0495590_0014819_620_1252 | 208 |
| 620 | 3300046457 | Ga0495590_0109123 | Ga0495590_0109123_269_901 | 208 |
| 621 | 3300046458 | Ga0495591_000082 | Ga0495591_000082_40101_40733 | 208 |
| 622 | 3300046458 | Ga0495591_000120 | Ga0495591_000120_63565_64197 | 208 |
| 623 | 3300046458 | Ga0495591_000618 | Ga0495591_000618_192_818 | 208 |
| 624 | 3300046458 | Ga0495591_003774 | Ga0495591_003774_4661_5293 | 208 |
| 625 | 3300046458 | Ga0495591_005827 | Ga0495591_005827_3589_4215 | 208 |
| 626 | 3300046458 | Ga0495591_006921 | Ga0495591_006921_3198_3830 | 208 |
| 627 | 3300046458 | Ga0495591_023707 | Ga0495591_023707_495_1127 | 208 |
| 628 | 3300046460 | Ga0495638_0005031 | Ga0495638_0005031_4523_5152 | 208 |
| 629 | 3300046460 | Ga0495638_0005146 | Ga0495638_0005146_7794_8420 | 208 |
| 630 | 3300046460 | Ga0495638_0015269 | Ga0495638_0015269_2576_3208 | 208 |
| 631 | 3300046471 | Ga0495650_0009781 | Ga0495650_0009781_1863_2495 | 208 |
| 632 | 3300046474 | Ga0495605_0001069 | Ga0495605_0001069_9327_9953 | 208 |
| 633 | 3300046474 | Ga0495605_0002868 | Ga0495605_0002868_9813_10439 | 208 |
| 634 | 3300046474 | Ga0495605_0003306 | Ga0495605_0003306_1824_2453 | 208 |
| 635 | 3300046474 | Ga0495605_0120567 | Ga0495605_0120567_130_756 | 208 |
| 636 | 3300046491 | Ga0495584_0000739 | Ga0495584_0000739_15049_15681 | 208 |
| 637 | 3300046491 | Ga0495584_0007072 | Ga0495584_0007072_4295_4921 | 208 |
| 638 | 3300046491 | Ga0495584_0011219 | Ga0495584_0011219_936_1562 | 208 |
| 639 | 3300046491 | Ga0495584_0028404 | Ga0495584_0028404_1372_2004 | 208 |
| 640 | 3300046491 | Ga0495584_0039536 | Ga0495584_0039536_25_654 | 208 |
| 641 | 3300046491 | Ga0495584_0044068 | Ga0495584_0044068_1077_1706 | 208 |
| 642 | 3300046492 | Ga0495585_0001688 | Ga0495585_0001688_6905_7531 | 208 |
| 643 | 3300046492 | Ga0495585_0075423 | Ga0495585_0075423_28_660 | 208 |
| 644 | 3300046500 | Ga0495596_0000058 | Ga0495596_0000058_61128_61757 | 208 |
| 645 | 3300046500 | Ga0495596_0003510 | Ga0495596_0003510_406_1038 | 208 |
| 646 | 3300046500 | Ga0495596_0004956 | Ga0495596_0004956_153_785 | 208 |
| 647 | 3300046500 | Ga0495596_0009510 | Ga0495596_0009510_257_889 | 208 |
| 648 | 3300046500 | Ga0495596_0009749 | Ga0495596_0009749_3426_4058 | 208 |
| 649 | 3300046500 | Ga0495596_0020487 | Ga0495596_0020487_1098_1730 | 208 |
| 650 | 3300046501 | Ga0495607_0000209 | Ga0495607_0000209_26327_26959 | 208 |
| 651 | 3300046501 | Ga0495607_0000517 | Ga0495607_0000517_13384_14016 | 208 |
| 652 | 3300046501 | Ga0495607_0003558 | Ga0495607_0003558_4536_5168 | 208 |
| 653 | 3300046501 | Ga0495607_0009070 | Ga0495607_0009070_4346_4975 | 208 |
| 654 | 3300046501 | Ga0495607_0014501 | Ga0495607_0014501_1799_2428 | 208 |
| 655 | 3300046501 | Ga0495607_0076480 | Ga0495607_0076480_130_762 | 208 |
| 656 | 3300046501 | Ga0495607_0111875 | Ga0495607_0111875_627_1253 | 208 |
| 657 | 3300046501 | Ga0495607_0284551 | Ga0495607_0284551_102_734 | 208 |
| 658 | 3300046501 | Ga0495607_0297737 | Ga0495607_0297737_79_711 | 208 |
| 659 | 3300046506 | Ga0495583_0000852 | Ga0495583_0000852_8710_9336 | 208 |
| 660 | 3300046506 | Ga0495583_0005886 | Ga0495583_0005886_5693_6325 | 208 |
| 661 | 3300046506 | Ga0495583_0005886 | Ga0495583_0005886_57_689 | 208 |
| 662 | 3300046506 | Ga0495583_0023359 | Ga0495583_0023359_582_1211 | 208 |
| 663 | 3300046507 | Ga0495606_0000634 | Ga0495606_0000634_50792_51424 | 208 |
| 664 | 3300046507 | Ga0495606_0000656 | Ga0495606_0000656_10196_10828 | 208 |
| 665 | 3300046507 | Ga0495606_0000965 | Ga0495606_0000965_8370_8996 | 208 |
| 666 | 3300046507 | Ga0495606_0003705 | Ga0495606_0003705_14127_14759 | 208 |
| 667 | 3300046507 | Ga0495606_0009752 | Ga0495606_0009752_849_1478 | 208 |
| 668 | 3300046507 | Ga0495606_0032404 | Ga0495606_0032404_124_783 | 208 |
| 669 | 3300046507 | Ga0495606_0034716 | Ga0495606_0034716_476_1108 | 208 |
| 670 | 3300046512 | Ga0495610_0000173 | Ga0495610_0000173_48874_49506 | 208 |
| 671 | 3300046512 | Ga0495610_0000563 | Ga0495610_0000563_29484_30113 | 208 |
| 672 | 3300046512 | Ga0495610_0001764 | Ga0495610_0001764_8896_9522 | 208 |
| 673 | 3300046512 | Ga0495610_0002756 | Ga0495610_0002756_7033_7659 | 208 |
| 674 | 3300046512 | Ga0495610_0005706 | Ga0495610_0005706_6298_6930 | 208 |
| 675 | 3300046512 | Ga0495610_0006280 | Ga0495610_0006280_6040_6672 | 208 |
| 676 | 3300046512 | Ga0495610_0024812 | Ga0495610_0024812_2111_2737 | 208 |
| 677 | 3300046512 | Ga0495610_0073590 | Ga0495610_0073590_632_1264 | 208 |
| 678 | 3300046513 | Ga0495616_0000041 | Ga0495616_0000041_53497_54129 | 208 |
| 679 | 3300046513 | Ga0495616_0000041 | Ga0495616_0000041_78619_79251 | 208 |
| 680 | 3300046513 | Ga0495616_0000166 | Ga0495616_0000166_18231_18863 | 208 |
| 681 | 3300046513 | Ga0495616_0004221 | Ga0495616_0004221_6472_7101 | 208 |
| 682 | 3300046513 | Ga0495616_0011508 | Ga0495616_0011508_3496_4125 | 208 |
| 683 | 3300046515 | Ga0495620_0003915 | Ga0495620_0003915_7396_8028 | 208 |
| 684 | 3300046515 | Ga0495620_0050319 | Ga0495620_0050319_1069_1701 | 208 |
| 685 | 3300046518 | Ga0495631_0000013 | Ga0495631_0000013_58969_59601 | 208 |
| 686 | 3300046518 | Ga0495631_0032002 | Ga0495631_0032002_1705_2337 | 208 |
| 687 | 3300046518 | Ga0495631_0084525 | Ga0495631_0084525_484_1110 | 208 |
| 688 | 3300046519 | Ga0495632_0000097 | Ga0495632_0000097_68672_69304 | 208 |
| 689 | 3300046519 | Ga0495632_0000475 | Ga0495632_0000475_26074_26706 | 208 |
| 690 | 3300046519 | Ga0495632_0000475 | Ga0495632_0000475_952_1584 | 208 |
| 691 | 3300046519 | Ga0495632_0012301 | Ga0495632_0012301_3511_4143 | 208 |
| 692 | 3300046519 | Ga0495632_0014299 | Ga0495632_0014299_1494_2126 | 208 |
| 693 | 3300046519 | Ga0495632_0098094 | Ga0495632_0098094_144_776 | 208 |
| 694 | 3300046519 | Ga0495632_0254226 | Ga0495632_0254226_26_652 | 208 |
| 695 | 3300046520 | Ga0495637_0001309 | Ga0495637_0001309_2814_3446 | 208 |
| 696 | 3300046520 | Ga0495637_0017909 | Ga0495637_0017909_1519_2151 | 208 |
| 697 | 3300046520 | Ga0495637_0030284 | Ga0495637_0030284_628_1260 | 208 |
| 698 | 3300046520 | Ga0495637_0038309 | Ga0495637_0038309_307_933 | 208 |
| 699 | 3300046520 | Ga0495637_0048735 | Ga0495637_0048735_781_1407 | 208 |
| 700 | 3300046520 | Ga0495637_0070329 | Ga0495637_0070329_391_1023 | 208 |
| 701 | 3300046522 | Ga0495643_0000625 | Ga0495643_0000625_12311_12943 | 208 |
| 702 | 3300046522 | Ga0495643_0000625 | Ga0495643_0000625_40928_41560 | 208 |
| 703 | 3300046522 | Ga0495643_0001821 | Ga0495643_0001821_6117_6749 | 208 |
| 704 | 3300046522 | Ga0495643_0153739 | Ga0495643_0153739_147_773 | 208 |
| 705 | 3300046523 | Ga0495644_0003352 | Ga0495644_0003352_856_1488 | 208 |
| 706 | 3300046524 | Ga0495648_0000172 | Ga0495648_0000172_42630_43262 | 208 |
| 707 | 3300046524 | Ga0495648_0001295 | Ga0495648_0001295_180_806 | 208 |
| 708 | 3300046524 | Ga0495648_0001927 | Ga0495648_0001927_8343_8969 | 208 |
| 709 | 3300046524 | Ga0495648_0004144 | Ga0495648_0004144_9579_10211 | 208 |
| 710 | 3300046524 | Ga0495648_0004767 | Ga0495648_0004767_4392_5024 | 208 |
| 711 | 3300046524 | Ga0495648_0006760 | Ga0495648_0006760_336_968 | 208 |
| 712 | 3300046524 | Ga0495648_0042903 | Ga0495648_0042903_1431_2063 | 208 |
| 713 | 3300046524 | Ga0495648_0075551 | Ga0495648_0075551_265_897 | 208 |
| 714 | 3300046528 | Ga0495642_0000670 | Ga0495642_0000670_9336_9962 | 208 |
| 715 | 3300046528 | Ga0495642_0009438 | Ga0495642_0009438_2035_2664 | 208 |
| 716 | 3300046530 | Ga0495654_0000104 | Ga0495654_0000104_68957_69589 | 208 |
| 717 | 3300046530 | Ga0495654_0000104 | Ga0495654_0000104_94079_94711 | 208 |
| 718 | 3300046530 | Ga0495654_0000353 | Ga0495654_0000353_10491_11117 | 208 |
| 719 | 3300046530 | Ga0495654_0003209 | Ga0495654_0003209_4809_5435 | 208 |
| 720 | 3300046530 | Ga0495654_0003366 | Ga0495654_0003366_884_1510 | 208 |
| 721 | 3300046530 | Ga0495654_0007391 | Ga0495654_0007391_3501_4127 | 208 |
| 722 | 3300046530 | Ga0495654_0008186 | Ga0495654_0008186_3963_4595 | 208 |
| 723 | 3300046530 | Ga0495654_0016695 | Ga0495654_0016695_1146_1778 | 208 |
| 724 | 3300046530 | Ga0495654_0034197 | Ga0495654_0034197_740_1372 | 208 |
| 725 | 3300046530 | Ga0495654_0092845 | Ga0495654_0092845_717_1349 | 208 |
| 726 | 3300046530 | Ga0495654_0104707 | Ga0495654_0104707_240_872 | 208 |
| 727 | 3300046530 | Ga0495654_0161252 | Ga0495654_0161252_122_748 | 208 |
| 728 | 3300046538 | Ga0495609_0000286 | Ga0495609_0000286_34376_35008 | 208 |
| 729 | 3300046538 | Ga0495609_0001705 | Ga0495609_0001705_2697_3326 | 208 |
| 730 | 3300046538 | Ga0495609_0002472 | Ga0495609_0002472_9900_10529 | 208 |
| 731 | 3300046538 | Ga0495609_0049806 | Ga0495609_0049806_708_1340 | 208 |
| 732 | 3300046542 | Ga0495597_0000117 | Ga0495597_0000117_42967_43599 | 208 |
| 733 | 3300046542 | Ga0495597_0000117 | Ga0495597_0000117_67874_68506 | 208 |
| 734 | 3300046542 | Ga0495597_0000560 | Ga0495597_0000560_20734_21360 | 208 |
| 735 | 3300046542 | Ga0495597_0006351 | Ga0495597_0006351_4829_5455 | 208 |
| 736 | 3300046542 | Ga0495597_0020676 | Ga0495597_0020676_353_985 | 208 |
| 737 | 3300046542 | Ga0495597_0031569 | Ga0495597_0031569_1364_1990 | 208 |
| 738 | 3300046542 | Ga0495597_0066529 | Ga0495597_0066529_268_897 | 208 |
| 739 | 3300046542 | Ga0495597_0144141 | Ga0495597_0144141_132_761 | 208 |
| 740 | 3300046542 | Ga0495597_0190612 | Ga0495597_0190612_58_684 | 208 |
| 741 | 3300046557 | Ga0495622_0000047 | Ga0495622_0000047_58802_59434 | 208 |
| 742 | 3300046557 | Ga0495622_0000047 | Ga0495622_0000047_83715_84347 | 208 |
| 743 | 3300046557 | Ga0495622_0135966 | Ga0495622_0135966_402_1034 | 208 |
| 744 | 3300046557 | Ga0495622_0257586 | Ga0495622_0257586_65_697 | 208 |
| 745 | 3300046558 | Ga0495633_0000564 | Ga0495633_0000564_4389_5021 | 208 |
| 746 | 3300046616 | Ga0495668_0010707 | Ga0495668_0010707_2116_2748 | 208 |
| 747 | 3300046616 | Ga0495668_0010888 | Ga0495668_0010888_1836_2465 | 208 |
| 748 | 3300046616 | Ga0495668_0015087 | Ga0495668_0015087_387_1013 | 208 |
| 749 | 3300046648 | Ga0495611_0000024 | Ga0495611_0000024_56640_57272 | 208 |
| 750 | 3300046660 | Ga0495625_0000103 | Ga0495625_0000103_42479_43111 | 208 |
| 751 | 3300046660 | Ga0495625_0000861 | Ga0495625_0000861_19535_20167 | 208 |
| 752 | 3300046660 | Ga0495625_0003017 | Ga0495625_0003017_7337_7966 | 208 |
| 753 | 3300046660 | Ga0495625_0006238 | Ga0495625_0006238_245_874 | 208 |
| 754 | 3300046660 | Ga0495625_0007003 | Ga0495625_0007003_2745_3371 | 208 |
| 755 | 3300046660 | Ga0495625_0007929 | Ga0495625_0007929_7702_8334 | 208 |
| 756 | 3300046664 | Ga0495659_0003039 | Ga0495659_0003039_1051_1680 | 208 |
| 757 | 3300046665 | Ga0495661_0005184 | Ga0495661_0005184_3941_4570 | 208 |
| 758 | 3300046665 | Ga0495661_0038532 | Ga0495661_0038532_1918_2547 | 208 |
| 759 | 3300046665 | Ga0495661_0095793 | Ga0495661_0095793_23_655 | 208 |
| 760 | 3300046674 | Ga0495588_0026797 | Ga0495588_0026797_1528_2154 | 208 |
| 761 | 3300046684 | Ga0495669_0012970 | Ga0495669_0012970_2506_3135 | 208 |
| 762 | 3300046684 | Ga0495669_0100189 | Ga0495669_0100189_250_876 | 208 |
| 763 | 3300046684 | Ga0495669_0148916 | Ga0495669_0148916_153_782 | 208 |
| 764 | 3300046689 | Ga0495613_0000001 | Ga0495613_0000001_1171_1863 | 208 |
| 765 | 3300046690 | Ga0495624_0037776 | Ga0495624_0037776_894_1526 | 208 |
| 766 | 3300046691 | Ga0495670_0000020 | Ga0495670_0000020_59372_60004 | 208 |
| 767 | 3300046692 | Ga0495671_0004837 | Ga0495671_0004837_773_1402 | 208 |
| 768 | 3300046692 | Ga0495671_0179470 | Ga0495671_0179470_18_644 | 208 |
| 769 | 3300046692 | Ga0495671_0202893 | Ga0495671_0202893_79_711 | 208 |
| 770 | 3300046694 | Ga0495649_0000108 | Ga0495649_0000108_21250_21882 | 208 |
| 771 | 3300046694 | Ga0495649_0000894 | Ga0495649_0000894_3690_4322 | 208 |
| 772 | 3300046694 | Ga0495649_0001346 | Ga0495649_0001346_17869_18495 | 208 |
| 773 | 3300046694 | Ga0495649_0007422 | Ga0495649_0007422_3817_4446 | 208 |
| 774 | 3300046694 | Ga0495649_0021658 | Ga0495649_0021658_1130_1756 | 208 |
| 775 | 3300046694 | Ga0495649_0028631 | Ga0495649_0028631_2319_2945 | 208 |
| 776 | 3300046694 | Ga0495649_0051256 | Ga0495649_0051256_931_1560 | 208 |
| 777 | 3300046694 | Ga0495649_0293715 | Ga0495649_0293715_164_796 | 208 |
| 778 | 3300046794 | Ga0495589_0000006 | Ga0495589_0000006_120156_120782 | 208 |
| 779 | 3300046794 | Ga0495589_0009008 | Ga0495589_0009008_2849_3475 | 208 |
| 780 | 3300046794 | Ga0495589_0011171 | Ga0495589_0011171_418_1044 | 208 |
| 781 | 3300046794 | Ga0495589_0013308 | Ga0495589_0013308_2500_3126 | 208 |
| 782 | 3300046794 | Ga0495589_0163821 | Ga0495589_0163821_333_965 | 208 |
| 783 | 3300046810 | Ga0495660_0001349 | Ga0495660_0001349_10258_10890 | 208 |
| 784 | 3300046810 | Ga0495660_0002399 | Ga0495660_0002399_4299_4931 | 208 |
| 785 | 3300046810 | Ga0495660_0004217 | Ga0495660_0004217_1157_1789 | 208 |
| 786 | 3300046810 | Ga0495660_0004243 | Ga0495660_0004243_7967_8599 | 208 |
| 787 | 3300046810 | Ga0495660_0013192 | Ga0495660_0013192_2065_2697 | 208 |
| 788 | 3300046810 | Ga0495660_0025582 | Ga0495660_0025582_104_733 | 208 |
| 789 | 3300046810 | Ga0495660_0040326 | Ga0495660_0040326_403_1035 | 208 |
| 790 | 3300046810 | Ga0495660_0112541 | Ga0495660_0112541_310_939 | 208 |
| 791 | 3300047318 | Ga0495636_0008837 | Ga0495636_0008837_1584_2213 | 208 |
| 792 | 3300047320 | Ga0495672_0003616 | Ga0495672_0003616_9684_10316 | 208 |
| 793 | 3300047320 | Ga0495672_0003859 | Ga0495672_0003859_9183_9809 | 208 |
| 794 | 3300047320 | Ga0495672_0012420 | Ga0495672_0012420_5234_5860 | 208 |
| 795 | 3300047320 | Ga0495672_0024227 | Ga0495672_0024227_284_913 | 208 |
| 796 | 3300047320 | Ga0495672_0029375 | Ga0495672_0029375_812_1438 | 208 |
| 797 | 3300047320 | Ga0495672_0043623 | Ga0495672_0043623_1748_2374 | 208 |
| 798 | 3300047320 | Ga0495672_0051954 | Ga0495672_0051954_1093_1734 | 208 |
| 799 | 3300047321 | Ga0495676_0000058 | Ga0495676_0000058_15107_15739 | 208 |
| 800 | 3300047321 | Ga0495676_0000058 | Ga0495676_0000058_30586_31218 | 208 |
| 801 | 3300047323 | Ga0495683_0000199 | Ga0495683_0000199_8366_8992 | 208 |
| 802 | 3300047323 | Ga0495683_0002985 | Ga0495683_0002985_9265_9897 | 208 |
| 803 | 3300047445 | Ga0495677_0003548 | Ga0495677_0003548_1284_1913 | 208 |
| 804 | 3300047446 | Ga0495679_000945 | Ga0495679_000945_14600_15232 | 208 |
| 805 | 3300047446 | Ga0495679_005691 | Ga0495679_005691_3353_3979 | 208 |
| 806 | 3300047446 | Ga0495679_006942 | Ga0495679_006942_3957_4586 | 208 |
| 807 | 3300047446 | Ga0495679_007151 | Ga0495679_007151_1594_2226 | 208 |
| 808 | 3300047447 | Ga0495685_016605 | Ga0495685_016605_1270_1899 | 208 |
| 809 | 3300047447 | Ga0495685_029585 | Ga0495685_029585_1028_1657 | 208 |
| 810 | 3300047469 | Ga0495673_0005992 | Ga0495673_0005992_3424_4056 | 208 |
| 811 | 3300047469 | Ga0495673_0006535 | Ga0495673_0006535_446_1072 | 208 |
| 812 | 3300047469 | Ga0495673_0007428 | Ga0495673_0007428_2389_3021 | 208 |
| 813 | 3300047469 | Ga0495673_0019474 | Ga0495673_0019474_612_1244 | 208 |
| 814 | 3300047470 | Ga0495681_0001171 | Ga0495681_0001171_123_755 | 208 |
| 815 | 3300047470 | Ga0495681_0001795 | Ga0495681_0001795_8570_9196 | 208 |
| 816 | 3300047470 | Ga0495681_0005497 | Ga0495681_0005497_5280_5912 | 208 |
| 817 | 3300047470 | Ga0495681_0010489 | Ga0495681_0010489_3950_4579 | 208 |
| 818 | 3300047470 | Ga0495681_0153462 | Ga0495681_0153462_18_644 | 208 |
| 819 | 3300047472 | Ga0495686_0000266 | Ga0495686_0000266_14623_15255 | 208 |
| 820 | 3300047472 | Ga0495686_0000266 | Ga0495686_0000266_35430_36062 | 208 |
| 821 | 3300047472 | Ga0495686_0002608 | Ga0495686_0002608_9376_10002 | 208 |
| 822 | 3300047472 | Ga0495686_0008113 | Ga0495686_0008113_3580_4212 | 208 |
| 823 | 3300047472 | Ga0495686_0011409 | Ga0495686_0011409_3037_3663 | 208 |
| 824 | 3300047472 | Ga0495686_0020167 | Ga0495686_0020167_1109_1741 | 208 |
| 825 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_64322_64954 | 208 |
| 826 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_89444_90076 | 208 |
| 827 | 3300048091 | Ga0495626_0000366 | Ga0495626_0000366_46484_47116 | 208 |
| 828 | 3300048091 | Ga0495626_0001013 | Ga0495626_0001013_15388_16014 | 208 |
| 829 | 3300048091 | Ga0495626_0002162 | Ga0495626_0002162_6368_7000 | 208 |
| 830 | 3300048091 | Ga0495626_0002404 | Ga0495626_0002404_3012_3638 | 208 |
| 831 | 3300048091 | Ga0495626_0031832 | Ga0495626_0031832_914_1546 | 208 |
| 832 | 3300048091 | Ga0495626_0064485 | Ga0495626_0064485_984_1616 | 208 |
| 833 | 3300048907 | Ga0496104_0000368 | Ga0496104_0000368_1277_1903 | 208 |
| 834 | 3300048917 | Ga0496114_0136116 | Ga0496114_0136116_814_1440 | 208 |
| 835 | 3300048919 | Ga0496116_0000031 | Ga0496116_0000031_117336_117962 | 208 |
| 836 | 3300048919 | Ga0496116_0000255 | Ga0496116_0000255_14274_14906 | 208 |
| 837 | 3300048919 | Ga0496116_0001333 | Ga0496116_0001333_6125_6757 | 208 |
| 838 | 3300048919 | Ga0496116_0004739 | Ga0496116_0004739_11890_12519 | 208 |
| 839 | 3300048919 | Ga0496116_0043455 | Ga0496116_0043455_2341_2979 | 208 |
| 840 | 3300048919 | Ga0496116_0061807 | Ga0496116_0061807_598_1224 | 208 |
| 841 | 3300048920 | Ga0496117_0006088 | Ga0496117_0006088_8141_8776 | 208 |
| 842 | 3300048920 | Ga0496117_0007023 | Ga0496117_0007023_2389_3015 | 208 |
| 843 | 3300048921 | Ga0496118_0041857 | Ga0496118_0041857_2244_2870 | 208 |
| 844 | 3300048922 | Ga0496119_0000258 | Ga0496119_0000258_33677_34303 | 208 |
| 845 | 3300048922 | Ga0496119_0015888 | Ga0496119_0015888_2882_3508 | 208 |
| 846 | 3300048923 | Ga0496120_0000228 | Ga0496120_0000228_46269_46895 | 208 |
| 847 | 3300048923 | Ga0496120_0000255 | Ga0496120_0000255_47280_48002 | 208 |
| 848 | 3300048923 | Ga0496120_0014871 | Ga0496120_0014871_2416_3042 | 208 |
| 849 | 3300048924 | Ga0496121_0000140 | Ga0496121_0000140_45112_45738 | 208 |
| 850 | 3300048924 | Ga0496121_0009355 | Ga0496121_0009355_3300_3929 | 208 |
| 851 | 3300048924 | Ga0496121_0315061 | Ga0496121_0315061_196_822 | 208 |
| 852 | 3300048925 | Ga0496122_0000908 | Ga0496122_0000908_31680_32309 | 208 |
| 853 | 3300048925 | Ga0496122_0011350 | Ga0496122_0011350_4738_5370 | 208 |
| 854 | 3300048925 | Ga0496122_0018888 | Ga0496122_0018888_5661_6299 | 208 |
| 855 | 3300048925 | Ga0496122_0143043 | Ga0496122_0143043_809_1456 | 208 |
| 856 | 3300048925 | Ga0496122_0190743 | Ga0496122_0190743_130_756 | 208 |
| 857 | 3300048926 | Ga0496123_0000412 | Ga0496123_0000412_58509_59138 | 208 |
| 858 | 3300048926 | Ga0496123_0007217 | Ga0496123_0007217_6826_7452 | 208 |
| 859 | 3300048926 | Ga0496123_0022316 | Ga0496123_0022316_3647_4279 | 208 |
| 860 | 3300048926 | Ga0496123_0069202 | Ga0496123_0069202_1549_2187 | 208 |
| 861 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_380204_380830 | 208 |
| 862 | 3300048927 | Ga0496124_0000122 | Ga0496124_0000122_83533_84159 | 208 |
| 863 | 3300048927 | Ga0496124_0025233 | Ga0496124_0025233_1418_2053 | 208 |
| 864 | 3300048927 | Ga0496124_0032726 | Ga0496124_0032726_1412_2038 | 208 |
| 865 | 3300048927 | Ga0496124_0053134 | Ga0496124_0053134_1505_2152 | 208 |
| 866 | 3300048928 | Ga0496125_0000016 | Ga0496125_0000016_8089_8736 | 208 |
| 867 | 3300048928 | Ga0496125_0000190 | Ga0496125_0000190_92924_93550 | 208 |
| 868 | 3300048928 | Ga0496125_0005878 | Ga0496125_0005878_9160_9792 | 208 |
| 869 | 3300048928 | Ga0496125_0009349 | Ga0496125_0009349_6532_7158 | 208 |
| 870 | 3300048928 | Ga0496125_0026879 | Ga0496125_0026879_1977_2603 | 208 |
| 871 | 3300048928 | Ga0496125_0070390 | Ga0496125_0070390_29_667 | 208 |
| 872 | 3300048929 | Ga0496126_0007121 | Ga0496126_0007121_9738_10364 | 208 |
| 873 | 3300048929 | Ga0496126_0011107 | Ga0496126_0011107_6439_7077 | 208 |
| 874 | 3300048929 | Ga0496126_0116878 | Ga0496126_0116878_1536_2162 | 208 |
| 875 | 3300049129 | Ga0501309_003594 | Ga0501309_003594_865_1491 | 208 |
| 876 | 3300049160 | Ga0501304_017235 | Ga0501304_017235_23_670 | 208 |
| 877 | 3300049161 | Ga0501305_004359 | Ga0501305_004359_837_1463 | 208 |
| 878 | 3300049459 | Ga0495678_000222 | Ga0495678_000222_3623_4255 | 208 |
| 879 | 3300049459 | Ga0495678_000359 | Ga0495678_000359_25286_25918 | 208 |
| 880 | 3300049459 | Ga0495678_000500 | Ga0495678_000500_24951_25583 | 208 |
| 881 | 3300049459 | Ga0495678_029021 | Ga0495678_029021_389_1015 | 208 |
| 882 | 3300049460 | Ga0495682_0001555 | Ga0495682_0001555_2768_3394 | 208 |
| 883 | 3300049528 | Ga0501312_002565 | Ga0501312_002565_1110_1736 | 208 |
| 884 | 3300049569 | Ga0501032_0402812 | Ga0501032_0402812_164_790 | 208 |
| 885 | 3300049570 | Ga0501033_0083798 | Ga0501033_0083798_1194_1826 | 208 |
| 886 | 3300049571 | Ga0501034_0003332 | Ga0501034_0003332_6338_6964 | 208 |
| 887 | 3300049758 | Ga0501241_000247 | Ga0501241_000247_8629_9261 | 208 |
| 888 | 3300049766 | Ga0501269_001191 | Ga0501269_001191_1951_2583 | 208 |
| 889 | 3300049823 | Ga0501044_0458963 | Ga0501044_0458963_22_654 | 208 |
| 890 | 3300050489 | nmdc:mga03683_251448_c1 | nmdc:mga03683_251448_c1_140_766 | 208 |
| 891 | 3300050491 | nmdc:mga00v17_527_c1 | nmdc:mga00v17_527_c1_18841_19470 | 208 |
| 892 | 3300050511 | nmdc:mga08y16_176298_c1 | nmdc:mga08y16_176298_c1_461_1093 | 208 |
| 893 | 3300050516 | nmdc:mga0sz30_18806_c1 | nmdc:mga0sz30_18806_c1_301_927 | 208 |
| 894 | iso_pu_bacteria | 2643221569 | 2643863425 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wgf-assembly1.cif.gz_C | ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide | 0.9435 | 3 | 201 |
| 1yac-assembly1.cif.gz_A | the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity | 0.9411 | 2 | 204 |
| 4wh0-assembly1.cif.gz_A | ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine | 0.9403 | 3 | 201 |
| 1yac-assembly1.cif.gz_A | the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity | 0.9323 | 2 | 204 |
| 4wgf-assembly1.cif.gz_C | ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide | 0.9255 | 3 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wh0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.939 | 3 | 201 | 3.40.50.850 |
| 4wh0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9208 | 3 | 201 | 3.40.50.850 |
| af_A0JME6_2_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9033 | 7 | 186 | 3.40.50.850 |
| af_Q9W127_4_199_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8761 | 6 | 186 | 3.40.50.850 |
| af_Q54RC7_3_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8625 | 6 | 190 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C7N270-F1-model_v4 | Uncharacterized protein YcaC | 0.9596 | 4 | 150 |
|
| AF-A0A6N6RNM2-F1-model_v4 | Isochorismatase family protein | 0.9581 | 6 | 179 |
|
| AF-G9MWN6-F1-model_v4 | Isochorismatase-like domain-containing protein | 0.9581 | 3 | 178 |
|
| AF-A0A4U3AM91-F1-model_v4 | deleted | 0.9568 | 19 | 154 |
|
| AF-A0A1E4EGZ0-F1-model_v4 | Hydrolase | 0.9561 | 1 | 178 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar