F484953

General Info

Members Datasets Scaffolds Average Seq Length
894 414 673 208

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0421199|Ga0501043_0421199_234_872
Length 204
Sequence MEKQMSKPYVRLDKNNAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALADLAAYFKLPTILTTSFEDGPNGPLVPELKQIVPGQINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIAEGFDVFVVTDASGTFNAITRDAAWERMTAAGAQLMSWFGVACELHRDWRNDVEGLGALFSNHIPDYRNLITAYTTVSSKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231017 Pseudomonas sp. GM55 Isolate Nodule
8 2511231023 Pseudomonas sp. GM80 Isolate Nodule
9 2511231024 Pseudomonas sp. GM84 Isolate Nodule
10 2511231031 Pseudomonas sp. GM16 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
13 2547132181 Kosakonia sacchari SP1 Isolate Stem
14 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
15 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
16 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
17 2561511199 Enterobacter sp. R4-368 Isolate Nodule
18 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
19 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
20 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
21 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
22 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
23 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
24 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
25 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
26 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
27 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
28 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
29 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
30 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
31 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
32 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
33 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
34 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
35 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
36 2643221557 Ensifer sp. Root558 Isolate Unclassified
37 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
38 2643221569 Achromobacter sp. Root565 Isolate Unclassified
39 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
40 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
41 2643221594 Achromobacter sp. Root170 Isolate Unclassified
42 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
43 2643221610 Ensifer sp. Root74 Isolate Unclassified
44 2643221618 Ensifer sp. Root231 Isolate Unclassified
45 2643221621 Achromobacter sp. Root83 Isolate Unclassified
46 2643221626 Ensifer sp. Root31 Isolate Unclassified
47 2643221655 Ensifer sp. Root1252 Isolate Unclassified
48 2643221659 Ensifer sp. Root127 Isolate Unclassified
49 2643221668 Ensifer sp. Root423 Isolate Unclassified
50 2643221675 Ensifer sp. Root1298 Isolate Unclassified
51 2643221680 Ensifer sp. Root1312 Isolate Unclassified
52 2643221683 Variovorax sp. Root473 Isolate Unclassified
53 2643221698 Ensifer sp. Root142 Isolate Unclassified
54 2643221712 Ensifer sp. Root258 Isolate Unclassified
55 2643221726 Ensifer sp. Root954 Isolate Unclassified
56 2643221736 Bosea sp. Root483D1 Isolate Unclassified
57 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
58 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
59 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
60 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
61 2721755523 Delftia sp. HK171 Isolate Unclassified
62 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
63 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
64 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
65 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
66 2738541300 Massilia sp. GV016 Isolate Unclassified
67 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
68 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
69 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
70 2738543018 Massilia sp. GV045 Isolate Unclassified
71 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
72 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
73 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
74 2738543030 Massilia sp. GV097 Isolate Unclassified
75 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
76 2765235841 Pseudomonas putida AA7 Isolate Unclassified
77 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
78 2773857673 Pseudomonas sp. 443 Isolate Unclassified
79 2784132063 Pseudomonas sp. 424 Isolate Unclassified
80 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
81 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
82 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
83 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
84 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
85 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
86 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
87 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
88 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
89 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
90 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
91 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
92 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
93 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
94 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
95 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
96 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
97 2844163670 Ensifer sp. 1H6 Isolate Unclassified
98 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
99 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
100 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
101 2854911287 Brucella lupini LUP21 Isolate Unclassified
102 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
103 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
104 2858950400 Achromobacter sp. K91 Isolate Unclassified
105 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
106 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
107 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
108 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
109 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
110 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
111 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
112 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
113 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
114 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
115 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
116 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
117 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
118 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
119 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
120 2932406140 Serratia sp. 2723 Isolate Rhizosphere
121 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
122 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
123 2937967321 Serratia sp. YC16 Isolate Unclassified
124 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
125 2939577877 Serratia sp. 509 Isolate Rhizosphere
126 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
127 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
128 2941479691
129 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
130 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
131 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
132 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
133 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
134 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
135 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
136 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
137 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
138 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
139 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
140 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
141 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
142 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
143 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
144 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
145 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
146 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
147 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
148 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
149 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
150 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
151 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
152 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
153 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
154 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
155 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
156 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
157 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
158 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
159 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
160 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
161 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
165 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
166 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
167 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
168 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
171 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
172 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
173 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
174 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
175 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
176 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
179 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
180 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
183 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
184 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
185 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
186 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
187 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
188 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
189 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
202 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
203 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
204 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
205 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
208 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
212 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
213 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
234 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
235 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
242 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
263 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
264 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
265 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
274 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
288 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
289 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
336 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
378 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
382 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 640753048 Serratia proteamaculans 568 Isolate Endosphere
395 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
396 8004592986 Serratia sp. S119 Isolate Unclassified
397 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
398 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
399 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
400 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
401 8052494512 Pseudomonas putida LD6 Isolate Unclassified
402 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
403 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
404 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
405 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
406 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
407 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
408 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
409 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
410 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
411 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
412 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
413 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
414 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.17
Metatranscriptomes 0.56
Isolates 23.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 3.13
Rhizoplane 2.46
Rhizosphere 63.53
Stem 0.11
Stem Tuber 0
Unclassified 22.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1285905 2162886007 Bacteria 1774
2 SwRhRL2b_contig_150973 2162886007 Bacteria 882
3 SwRhRL2b_contig_2968351 2162886007 Bacteria 3334
4 SwRhRL2b_contig_3730156 2162886007 Bacteria 1552
5 JGI25158J39367_1000331 3300002739 Bacteria 10490
6 JGI25152J39213_1000856 3300002773 Bacteria 15060
7 JGI25159J45721_1002851 3300002987 Bacteria 6344
8 JGI25151J46595_10003449 3300003187 Bacteria 8735
9 rootH2_10069019 3300003320 Bacteria 6274
10 rootH1_10142104 3300003323 Bacteria 1685
11 JGI25161J50226_1000500 3300003374 Bacteria 17353
12 Ga0006562J51391_1139573 3300003578 Bacteria 2046
13 Ga0055538_1001219 3300003751 Bacteria 5363
14 Ga0055526_1001559 3300003771 Bacteria 16179
15 Ga0055526_1001572 3300003771 Bacteria 16064
16 Ga0055526_1005545 3300003771 Bacteria 7215
17 Ga0055526_1007392 3300003771 Bacteria 5720
18 Ga0055537_1002144 3300003773 Bacteria 6892
19 Ga0055524_1000731 3300003775 Bacteria 22525
20 Ga0055524_1004607 3300003775 Bacteria 6337
21 Ga0055536_1000058 3300003781 Bacteria 104496
22 Ga0055536_1000458 3300003781 Bacteria 28710
23 Ga0055534_1000751 3300003784 Bacteria 15491
24 Ga0055534_1010125 3300003784 Bacteria 1998
25 Ga0055530_10001636 3300003791 Bacteria 16017
26 Ga0055540_1000344 3300003792 Bacteria 39592
27 Ga0055541_1001161 3300003841 Bacteria 5904
28 Ga0058692_1002490 3300003856 Bacteria 6142
29 Ga0055543_1001678 3300004625 Bacteria 8401
30 Ga0065165_1003101 3300005262 Bacteria 12363
31 Ga0065165_1034065 3300005262 Bacteria 1579
32 Ga0065703_1000561 3300005272 Bacteria 6166
33 Ga0065714_10002206 3300005288 Bacteria 60276
34 Ga0065714_10070299 3300005288 Bacteria 3906
35 Ga0065704_10004276 3300005289 Bacteria 6405
36 Ga0065704_10079174 3300005289 Bacteria 4220
37 Ga0065704_10096582 3300005289 Bacteria 2426
38 Ga0065704_10098658 3300005289 Bacteria 2344
39 Ga0065704_10124566 3300005289 Bacteria 1702
40 Ga0065704_10163538 3300005289 Bacteria 1338
41 Ga0070669_100584433 3300005353 Bacteria 934
42 Ga0070662_100865934 3300005457 Bacteria 770
43 Ga0070665_100151506 3300005548 Bacteria 2322
44 Ga0068859_100190329 3300005617 Bacteria 2136
45 Ga0081455_10017544 3300005937 Bacteria 6858
46 Ga0081455_10092321 3300005937 Bacteria 2449
47 Ga0070717_10667348 3300006028 Bacteria 944
48 Ga0075363_100009224 3300006048 Bacteria 4635
49 Ga0075364_10077656 3300006051 Bacteria 2192
50 Ga0075364_10169985 3300006051 Bacteria 1473
51 Ga0075364_10219983 3300006051 Bacteria 1289
52 Ga0075364_10393324 3300006051 Bacteria 946
53 Ga0075432_10033565 3300006058 Bacteria 1781
54 Ga0075432_10076629 3300006058 Bacteria 1207
55 Ga0075432_10089266 3300006058 Bacteria 1127
56 Ga0075362_10058435 3300006177 Bacteria 1739
57 Ga0075362_10174184 3300006177 Bacteria 1040
58 Ga0075370_10347356 3300006353 Bacteria 886
59 Ga0075430_100310557 3300006846 Bacteria 1304
60 Ga0075431_100599436 3300006847 Bacteria 1086
61 Ga0075436_100240524 3300006914 Bacteria 1287
62 Ga0075436_100366636 3300006914 Bacteria 1040
63 Ga0097620_100190318 3300006931 Bacteria 2136
64 Ga0099823_1000275 3300006944 Bacteria 30639
65 Ga0099823_1032813 3300006944 Bacteria 4205
66 Ga0079104_1000004 3300006946 Bacteria 444549
67 Ga0079104_1000176 3300006946 Bacteria 91230
68 Ga0079104_1000700 3300006946 Bacteria 30527
69 Ga0099826_10000013 3300006948 Bacteria 265459
70 Ga0075435_100802479 3300007076 Bacteria 819
71 Ga0105251_10000042 3300009011 Bacteria 114031
72 Ga0105251_10000073 3300009011 Bacteria 97270
73 Ga0105251_10000391 3300009011 Bacteria 42881
74 Ga0105251_10000582 3300009011 Bacteria 33639
75 Ga0105251_10000666 3300009011 Bacteria 31657
76 Ga0105251_10015013 3300009011 Bacteria 4250
77 Ga0105251_10113377 3300009011 Bacteria 1234
78 Ga0105244_10000026 3300009036 Bacteria 216056
79 Ga0105244_10000071 3300009036 Bacteria 117110
80 Ga0105244_10000799 3300009036 Bacteria 26810
81 Ga0105244_10009450 3300009036 Bacteria 5992
82 Ga0105244_10013896 3300009036 Bacteria 4678
83 Ga0105244_10014292 3300009036 Bacteria 4597
84 Ga0105244_10040086 3300009036 Bacteria 2434
85 Ga0105244_10106183 3300009036 Bacteria 1370
86 Ga0105244_10109731 3300009036 Bacteria 1343
87 Ga0105244_10225347 3300009036 Bacteria 878
88 Ga0105250_10000059 3300009092 Bacteria 109549
89 Ga0105250_10000310 3300009092 Bacteria 38190
90 Ga0105250_10011998 3300009092 Bacteria 3587
91 Ga0105250_10013843 3300009092 Bacteria 3322
92 Ga0105250_10033127 3300009092 Bacteria 2074
93 Ga0105250_10035365 3300009092 Bacteria 2004
94 Ga0105250_10037558 3300009092 Bacteria 1944
95 Ga0105250_10130841 3300009092 Bacteria 1036
96 Ga0111539_10015990 3300009094 Bacteria 9321
97 Ga0111539_10089953 3300009094 Bacteria 3608
98 Ga0105247_10000187 3300009101 Bacteria 60332
99 Ga0114129_10026761 3300009147 Bacteria 8169
100 Ga0114129_11236404 3300009147 Bacteria 929
101 Ga0105243_10000547 3300009148 Bacteria 37977
102 Ga0105243_10000736 3300009148 Bacteria 31344
103 Ga0105243_10001371 3300009148 Bacteria 21570
104 Ga0105243_10001783 3300009148 Bacteria 18473
105 Ga0105243_10039987 3300009148 Bacteria 3659
106 Ga0105243_10048163 3300009148 Bacteria 3359
107 Ga0105241_10000004 3300009174 Bacteria 803007
108 Ga0105248_10971349 3300009177 Bacteria 959
109 Ga0105249_10000138 3300009553 Bacteria 95736
110 Ga0157345_1000004 3300012498 Bacteria 80365
111 Ga0157373_10000039 3300013100 Bacteria 117160
112 Ga0157373_10062091 3300013100 Bacteria 2646
113 Ga0157373_10260503 3300013100 Bacteria 1227
114 Ga0157371_10026820 3300013102 Bacteria 4184
115 Ga0157371_10431531 3300013102 Bacteria 967
116 Ga0157370_10001493 3300013104 Bacteria 28957
117 Ga0157370_10001741 3300013104 Bacteria 26789
118 Ga0157370_10031541 3300013104 Bacteria 5182
119 Ga0157369_10007171 3300013105 Bacteria 12844
120 Ga0157374_10201811 3300013296 Bacteria 1947
121 Ga0163162_10000067 3300013306 Bacteria 99435
122 Ga0157372_10000672 3300013307 Bacteria 37619
123 Ga0182008_10013747 3300014497 Bacteria 4252
124 Ga0182008_10033799 3300014497 Bacteria 2565
125 Ga0182008_10034689 3300014497 Bacteria 2529
126 Ga0182006_1023968 3300015261 Bacteria 2522
127 Ga0182006_1080183 3300015261 Bacteria 1192
128 Ga0163161_10000004 3300017792 Bacteria 333149
129 Ga0163161_10000066 3300017792 Bacteria 107442
130 Ga0209436_100445 3300025208 Bacteria 18569
131 Ga0209784_100360 3300025224 Bacteria 21994
132 Ga0209566_100666 3300025225 Bacteria 20564
133 Ga0209674_102378 3300025226 Bacteria 4083
134 Ga0207425_1010707 3300025245 Bacteria 2220
135 Ga0209129_1000008 3300025258 Bacteria 640959
136 Ga0209565_1000053 3300025263 Bacteria 210249
137 Ga0209565_1000176 3300025263 Bacteria 81062
138 Ga0209565_1002293 3300025263 Bacteria 7026
139 Ga0209673_1020634 3300025273 Bacteria 2328
140 Ga0209130_1001179 3300025284 Bacteria 18686
141 Ga0209675_1000091 3300025291 Bacteria 146390
142 Ga0209675_1000167 3300025291 Bacteria 79477
143 Ga0209675_1000328 3300025291 Bacteria 41805
144 Ga0209675_1015036 3300025291 Bacteria 2321
145 Ga0209676_1000098 3300025292 Bacteria 234305
146 Ga0209676_1000210 3300025292 Bacteria 130159
147 Ga0209676_1001409 3300025292 Bacteria 23191
148 Ga0209676_1002285 3300025292 Bacteria 14011
149 Ga0209676_1003474 3300025292 Bacteria 9667
150 Ga0209676_1035086 3300025292 Bacteria 1475
151 Ga0209025_1000051 3300025294 Bacteria 330080
152 Ga0209025_1000085 3300025294 Bacteria 263782
153 Ga0209025_1000098 3300025294 Bacteria 233886
154 Ga0209564_1000084 3300025295 Bacteria 252729
155 Ga0209564_1000376 3300025295 Bacteria 82120
156 Ga0209564_1000421 3300025295 Bacteria 74558
157 Ga0209564_1000666 3300025295 Bacteria 50795
158 Ga0209564_1001130 3300025295 Bacteria 31388
159 Ga0209564_1016648 3300025295 Bacteria 2910
160 Ga0209050_1000754 3300025298 Bacteria 46538
161 Ga0209050_1002114 3300025298 Bacteria 18120
162 Ga0209050_1008876 3300025298 Bacteria 5263
163 Ga0209256_1000073 3300025299 Bacteria 237553
164 Ga0209256_1000517 3300025299 Bacteria 56494
165 Ga0209256_1001071 3300025299 Bacteria 31723
166 Ga0209256_1001352 3300025299 Bacteria 25972
167 Ga0207426_1034175 3300025302 Bacteria 1633
168 Ga0209051_1000098 3300025303 Bacteria 165284
169 Ga0209051_1019117 3300025303 Bacteria 3002
170 Ga0209257_1021335 3300025304 Bacteria 2356
171 Ga0207696_1000003 3300025711 Bacteria 860639
172 Ga0207696_1000005 3300025711 Bacteria 642078
173 Ga0207696_1000033 3300025711 Bacteria 360689
174 Ga0207696_1000172 3300025711 Bacteria 102404
175 Ga0207696_1003553 3300025711 Bacteria 7044
176 Ga0207696_1009804 3300025711 Bacteria 3553
177 Ga0207696_1011818 3300025711 Bacteria 3122
178 Ga0207696_1029204 3300025711 Bacteria 1686
179 Ga0207655_1000027 3300025728 Bacteria 444552
180 Ga0207655_1000057 3300025728 Bacteria 273598
181 Ga0207655_1000445 3300025728 Bacteria 54522
182 Ga0207655_1000523 3300025728 Bacteria 48957
183 Ga0207655_1004927 3300025728 Bacteria 9261
184 Ga0207655_1010084 3300025728 Bacteria 5775
185 Ga0207655_1011659 3300025728 Bacteria 5210
186 Ga0207655_1015132 3300025728 Bacteria 4310
187 Ga0207655_1045291 3300025728 Bacteria 1838
188 Ga0207655_1122658 3300025728 Bacteria 858
189 Ga0207713_1000002 3300025735 Bacteria 1061749
190 Ga0207713_1000003 3300025735 Bacteria 860698
191 Ga0207713_1000065 3300025735 Bacteria 196128
192 Ga0207713_1000108 3300025735 Bacteria 137268
193 Ga0207713_1004928 3300025735 Bacteria 8533
194 Ga0207713_1012399 3300025735 Bacteria 4563
195 Ga0207713_1024772 3300025735 Bacteria 2787
196 Ga0207713_1031802 3300025735 Bacteria 2327
197 Ga0207713_1078765 3300025735 Bacteria 1192
198 Ga0207713_1104403 3300025735 Bacteria 973
199 Ga0207710_10000016 3300025900 Bacteria 388568
200 Ga0207654_10000006 3300025911 Bacteria 815027
201 Ga0207709_10000019 3300025935 Bacteria 402225
202 Ga0207709_10000130 3300025935 Bacteria 110843
203 Ga0207709_10000565 3300025935 Bacteria 31347
204 Ga0207709_10002073 3300025935 Bacteria 12946
205 Ga0207709_10363427 3300025935 Bacteria 1096
206 Ga0207709_10452497 3300025935 Bacteria 993
207 Ga0207712_10000103 3300025961 Bacteria 95707
208 Ga0207668_10959223 3300025972 Bacteria 763
209 Ga0209281_1000005 3300027111 Bacteria 1242284
210 Ga0209281_1000008 3300027111 Bacteria 867470
211 Ga0209281_1000294 3300027111 Bacteria 91244
212 Ga0209281_1007658 3300027111 Bacteria 2692
213 Ga0209389_1000125 3300027296 Bacteria 68494
214 Ga0209371_1000046 3300027312 Bacteria 306549
215 Ga0209371_1000959 3300027312 Bacteria 22434
216 Ga0209371_1008116 3300027312 Bacteria 3538
217 Ga0209371_1011506 3300027312 Bacteria 2625
218 Ga0209371_1012687 3300027312 Bacteria 2419
219 Ga0209371_1019651 3300027312 Bacteria 1680
220 Ga0209282_1000043 3300027666 Bacteria 119260
221 Ga0209974_10009818 3300027876 Bacteria 3240
222 Ga0207428_10171731 3300027907 Bacteria 1642
223 Ga0207428_10172086 3300027907 Bacteria 1640
224 Ga0207428_10179370 3300027907 Bacteria 1601
225 Ga0207428_10217958 3300027907 Bacteria 1432
226 Ga0268266_10083946 3300028379 Bacteria 2781
227 Ga0307517_10030228 3300028786 Bacteria 6360
228 Ga0268256_1000012 3300030500 Bacteria 794553
229 Ga0268256_1005632 3300030500 Bacteria 4864
230 Ga0268256_1012555 3300030500 Bacteria 2614
231 Ga0268256_1013855 3300030500 Bacteria 2419
232 Ga0316176_1013952 3300030732 Bacteria 1047
233 Ga0307509_10149488 3300031507 Bacteria 2254
234 Ga0307408_100000103 3300031548 Bacteria 93203
235 Ga0307408_100011698 3300031548 Bacteria 5802
236 Ga0307508_10239705 3300031616 Bacteria 1411
237 Ga0307405_10048028 3300031731 Bacteria 2630
238 Ga0307406_10002676 3300031901 Bacteria 9700
239 Ga0307406_10548543 3300031901 Bacteria 945
240 Ga0307412_10010689 3300031911 Bacteria 5290
241 Ga0307412_10247750 3300031911 Bacteria 1382
242 Ga0307412_10338074 3300031911 Bacteria 1204
243 Ga0307409_100041740 3300031995 Bacteria 3429
244 Ga0307416_100631951 3300032002 Bacteria 1154
245 Ga0307411_10073542 3300032005 Bacteria 2326
246 Ga0307411_10222313 3300032005 Bacteria 1466
247 Ga0307510_10000324 3300033180 Bacteria 44451
248 Ga0307510_10056331 3300033180 Bacteria 4095
249 Ga0436365_1873831 3300039437 Bacteria 1657
250 Ga0439438_000894 3300041405 Bacteria 13245
251 Ga0439438_008226 3300041405 Bacteria 3482
252 Ga0439447_000588 3300041407 Bacteria 13574
253 Ga0439466_0024049 3300041411 Bacteria 2139
254 Ga0451837_1686659 3300041494 Bacteria 1467
255 Ga0439432_000442 3300042006 Bacteria 15354
256 Ga0439432_006057 3300042006 Bacteria 4338
257 Ga0439452_000005 3300042010 Bacteria 646919
258 Ga0439452_001772 3300042010 Bacteria 8413
259 Ga0439452_006872 3300042010 Bacteria 3528
260 Ga0450911_000820 3300042115 Bacteria 8549
261 Ga0450920_008740 3300042122 Bacteria 1855
262 Ga0450922_000031 3300042124 Bacteria 12294
263 Ga0450900_003341 3300042136 Bacteria 1776
264 Ga0450902_000234 3300042137 Bacteria 6554
265 Ga0450905_000549 3300042142 Bacteria 4622
266 Ga0450905_004491 3300042142 Bacteria 1852
267 Ga0450905_012351 3300042142 Bacteria 1202
268 Ga0450907_029959 3300042146 Bacteria 924
269 Ga0450910_001840 3300042147 Bacteria 2737
270 Ga0450908_007926 3300042184 Bacteria 1992
271 Ga0439464_0011602 3300042439 Bacteria 2336
272 Ga0439464_0033500 3300042439 Bacteria 1446
273 Ga0439460_0006245 3300042461 Bacteria 2949
274 Ga0451577_0004339 3300042876 Bacteria 15036
275 Ga0466969_0031452 3300044656 Bacteria 2701
276 Ga0466977_0356395 3300044666 Bacteria 862
277 Ga0466981_0000007 3300044669 Bacteria 155983
278 Ga0453683_0085262 3300044673 Bacteria 1979
279 Ga0466965_0017394 3300044683 Bacteria 3436
280 Ga0466961_0000028 3300044693 Bacteria 86793
281 Ga0466964_0027344 3300044706 Bacteria 2239
282 Ga0453684_0027406 3300044712 Bacteria 8173
283 Ga0453684_0042921 3300044712 Bacteria 6087
284 Ga0453684_0157005 3300044712 Bacteria 2696
285 Ga0453684_0234536 3300044712 Bacteria 2116
286 Ga0453684_0395903 3300044712 Bacteria 1548
287 Ga0453684_0536361 3300044712 Bacteria 1291
288 Ga0466971_0013057 3300044719 Bacteria 3643
289 Ga0466968_0009173 3300044735 Bacteria 3803
290 Ga0466970_0017001 3300044765 Bacteria 3755
291 Ga0466960_0062595 3300044901 Bacteria 1829
292 Ga0466959_0107157 3300045049 Bacteria 1997
293 Ga0451576_0000034 3300045051 Bacteria 390778
294 Ga0451576_0661975 3300045051 Bacteria 1097
295 Ga0495617_002042 3300046452 Bacteria 8382
296 Ga0495627_000101 3300046453 Bacteria 105414
297 Ga0495627_000133 3300046453 Bacteria 89977
298 Ga0495627_000141 3300046453 Bacteria 85993
299 Ga0495627_000624 3300046453 Bacteria 28116
300 Ga0495590_0001183 3300046457 Bacteria 11416
301 Ga0495590_0011347 3300046457 Bacteria 3334
302 Ga0495590_0014819 3300046457 Bacteria 2841
303 Ga0495590_0109123 3300046457 Bacteria 987
304 Ga0495591_000082 3300046458 Bacteria 107579
305 Ga0495591_000120 3300046458 Bacteria 86214
306 Ga0495591_000618 3300046458 Bacteria 26645
307 Ga0495591_003774 3300046458 Bacteria 7661
308 Ga0495591_005827 3300046458 Bacteria 5600
309 Ga0495591_006921 3300046458 Bacteria 4907
310 Ga0495591_023707 3300046458 Bacteria 1960
311 Ga0495638_0005031 3300046460 Bacteria 9919
312 Ga0495638_0005146 3300046460 Bacteria 9779
313 Ga0495638_0015269 3300046460 Bacteria 5159
314 Ga0495650_0005106 3300046471 Bacteria 8679
315 Ga0495650_0009781 3300046471 Bacteria 5420
316 Ga0495650_0119151 3300046471 Bacteria 973
317 Ga0495605_0001069 3300046474 Bacteria 18288
318 Ga0495605_0002868 3300046474 Bacteria 10479
319 Ga0495605_0003306 3300046474 Bacteria 9652
320 Ga0495605_0120567 3300046474 Bacteria 1189
321 Ga0495584_0000739 3300046491 Bacteria 21572
322 Ga0495584_0007072 3300046491 Bacteria 5864
323 Ga0495584_0011219 3300046491 Bacteria 4589
324 Ga0495584_0028404 3300046491 Bacteria 2834
325 Ga0495584_0039536 3300046491 Bacteria 2383
326 Ga0495584_0044068 3300046491 Bacteria 2251
327 Ga0495585_0001688 3300046492 Bacteria 16875
328 Ga0495585_0075423 3300046492 Bacteria 1833
329 Ga0495596_0000058 3300046500 Bacteria 80763
330 Ga0495596_0003510 3300046500 Bacteria 7905
331 Ga0495596_0004956 3300046500 Bacteria 6382
332 Ga0495596_0009510 3300046500 Bacteria 4272
333 Ga0495596_0009749 3300046500 Bacteria 4214
334 Ga0495596_0020487 3300046500 Bacteria 2706
335 Ga0495607_0000209 3300046501 Bacteria 62350
336 Ga0495607_0000517 3300046501 Bacteria 38004
337 Ga0495607_0003558 3300046501 Bacteria 11864
338 Ga0495607_0009070 3300046501 Bacteria 6761
339 Ga0495607_0014501 3300046501 Bacteria 5124
340 Ga0495607_0076480 3300046501 Bacteria 1851
341 Ga0495607_0111875 3300046501 Bacteria 1447
342 Ga0495607_0284551 3300046501 Bacteria 783
343 Ga0495607_0297737 3300046501 Bacteria 760
344 Ga0495583_0000852 3300046506 Bacteria 37144
345 Ga0495583_0005886 3300046506 Bacteria 8166
346 Ga0495583_0023359 3300046506 Bacteria 3129
347 Ga0495606_0000634 3300046507 Bacteria 55249
348 Ga0495606_0000656 3300046507 Bacteria 54383
349 Ga0495606_0000861 3300046507 Bacteria 45459
350 Ga0495606_0000965 3300046507 Bacteria 42060
351 Ga0495606_0003705 3300046507 Bacteria 15962
352 Ga0495606_0009752 3300046507 Bacteria 8076
353 Ga0495606_0032404 3300046507 Bacteria 3620
354 Ga0495606_0034716 3300046507 Bacteria 3458
355 Ga0495610_0000173 3300046512 Bacteria 72402
356 Ga0495610_0000563 3300046512 Bacteria 37173
357 Ga0495610_0001764 3300046512 Bacteria 18932
358 Ga0495610_0002756 3300046512 Bacteria 14409
359 Ga0495610_0005706 3300046512 Bacteria 8771
360 Ga0495610_0006280 3300046512 Bacteria 8226
361 Ga0495610_0024812 3300046512 Bacteria 3229
362 Ga0495610_0073590 3300046512 Bacteria 1587
363 Ga0495616_0000041 3300046513 Bacteria 122413
364 Ga0495616_0000166 3300046513 Bacteria 57340
365 Ga0495616_0004221 3300046513 Bacteria 9092
366 Ga0495616_0011508 3300046513 Bacteria 5064
367 Ga0495620_0000124 3300046515 Bacteria 62374
368 Ga0495620_0003915 3300046515 Bacteria 8484
369 Ga0495620_0050319 3300046515 Bacteria 1778
370 Ga0495631_0000013 3300046518 Bacteria 109794
371 Ga0495631_0032002 3300046518 Bacteria 2373
372 Ga0495631_0084525 3300046518 Bacteria 1367
373 Ga0495632_0000097 3300046519 Bacteria 88746
374 Ga0495632_0000466 3300046519 Bacteria 38410
375 Ga0495632_0000475 3300046519 Bacteria 38064
376 Ga0495632_0012301 3300046519 Bacteria 4939
377 Ga0495632_0014299 3300046519 Bacteria 4493
378 Ga0495632_0098094 3300046519 Bacteria 1382
379 Ga0495632_0254226 3300046519 Bacteria 787
380 Ga0495637_0001309 3300046520 Bacteria 14938
381 Ga0495637_0011326 3300046520 Bacteria 4288
382 Ga0495637_0017909 3300046520 Bacteria 3292
383 Ga0495637_0030284 3300046520 Bacteria 2401
384 Ga0495637_0038309 3300046520 Bacteria 2076
385 Ga0495637_0048735 3300046520 Bacteria 1783
386 Ga0495637_0070329 3300046520 Bacteria 1414
387 Ga0495643_0000625 3300046522 Bacteria 42011
388 Ga0495643_0000810 3300046522 Bacteria 34361
389 Ga0495643_0001821 3300046522 Bacteria 18154
390 Ga0495643_0001848 3300046522 Bacteria 17969
391 Ga0495643_0002462 3300046522 Bacteria 14658
392 Ga0495643_0113234 3300046522 Bacteria 1377
393 Ga0495643_0153739 3300046522 Bacteria 1137
394 Ga0495644_0003352 3300046523 Bacteria 6331
395 Ga0495648_0000172 3300046524 Bacteria 74485
396 Ga0495648_0000606 3300046524 Bacteria 38334
397 Ga0495648_0001295 3300046524 Bacteria 24874
398 Ga0495648_0001927 3300046524 Bacteria 19765
399 Ga0495648_0004144 3300046524 Bacteria 12465
400 Ga0495648_0004767 3300046524 Bacteria 11480
401 Ga0495648_0006760 3300046524 Bacteria 9273
402 Ga0495648_0042903 3300046524 Bacteria 2841
403 Ga0495648_0075551 3300046524 Bacteria 1937
404 Ga0495642_0000670 3300046528 Bacteria 17084
405 Ga0495642_0009438 3300046528 Bacteria 3735
406 Ga0495654_0000104 3300046530 Bacteria 95266
407 Ga0495654_0000353 3300046530 Bacteria 39769
408 Ga0495654_0003209 3300046530 Bacteria 10123
409 Ga0495654_0003366 3300046530 Bacteria 9850
410 Ga0495654_0007391 3300046530 Bacteria 6138
411 Ga0495654_0008186 3300046530 Bacteria 5789
412 Ga0495654_0016695 3300046530 Bacteria 3872
413 Ga0495654_0034197 3300046530 Bacteria 2566
414 Ga0495654_0092845 3300046530 Bacteria 1398
415 Ga0495654_0104707 3300046530 Bacteria 1297
416 Ga0495654_0161252 3300046530 Bacteria 984
417 Ga0495609_0000286 3300046538 Bacteria 46726
418 Ga0495609_0001705 3300046538 Bacteria 14247
419 Ga0495609_0002472 3300046538 Bacteria 11352
420 Ga0495609_0049806 3300046538 Bacteria 1868
421 Ga0495597_0000117 3300046542 Bacteria 71911
422 Ga0495597_0000560 3300046542 Bacteria 30875
423 Ga0495597_0006351 3300046542 Bacteria 6119
424 Ga0495597_0020676 3300046542 Bacteria 3063
425 Ga0495597_0031569 3300046542 Bacteria 2409
426 Ga0495597_0066529 3300046542 Bacteria 1561
427 Ga0495597_0144141 3300046542 Bacteria 981
428 Ga0495597_0190612 3300046542 Bacteria 825
429 Ga0495622_0000047 3300046557 Bacteria 109638
430 Ga0495622_0135966 3300046557 Bacteria 1117
431 Ga0495622_0257586 3300046557 Bacteria 766
432 Ga0495633_0000564 3300046558 Bacteria 36203
433 Ga0495656_0058820 3300046615 Bacteria 1670
434 Ga0495668_0010707 3300046616 Bacteria 5538
435 Ga0495668_0010888 3300046616 Bacteria 5476
436 Ga0495668_0015087 3300046616 Bacteria 4518
437 Ga0495611_0000024 3300046648 Bacteria 118898
438 Ga0495625_0000103 3300046660 Bacteria 136109
439 Ga0495625_0000861 3300046660 Bacteria 41279
440 Ga0495625_0003017 3300046660 Bacteria 17334
441 Ga0495625_0006238 3300046660 Bacteria 10678
442 Ga0495625_0007003 3300046660 Bacteria 9935
443 Ga0495625_0007929 3300046660 Bacteria 9128
444 Ga0495625_0023549 3300046660 Bacteria 4702
445 Ga0495659_0003039 3300046664 Bacteria 5380
446 Ga0495661_0005184 3300046665 Bacteria 9286
447 Ga0495661_0038532 3300046665 Bacteria 2976
448 Ga0495661_0095793 3300046665 Bacteria 1679
449 Ga0495588_0026797 3300046674 Bacteria 2878
450 Ga0495669_0012970 3300046684 Bacteria 3549
451 Ga0495669_0100189 3300046684 Bacteria 1345
452 Ga0495669_0148916 3300046684 Bacteria 1107
453 Ga0495613_0000001 3300046689 Eukaryota 436313
454 Ga0495624_0037776 3300046690 Bacteria 3105
455 Ga0495670_0000020 3300046691 Bacteria 110171
456 Ga0495671_0004837 3300046692 Bacteria 7962
457 Ga0495671_0005338 3300046692 Bacteria 7541
458 Ga0495671_0179470 3300046692 Bacteria 1028
459 Ga0495671_0202893 3300046692 Bacteria 961
460 Ga0495649_0000108 3300046694 Bacteria 73708
461 Ga0495649_0000894 3300046694 Bacteria 23680
462 Ga0495649_0001346 3300046694 Bacteria 18674
463 Ga0495649_0002635 3300046694 Bacteria 12511
464 Ga0495649_0007422 3300046694 Bacteria 6683
465 Ga0495649_0021658 3300046694 Bacteria 3600
466 Ga0495649_0028631 3300046694 Bacteria 3087
467 Ga0495649_0043143 3300046694 Bacteria 2462
468 Ga0495649_0051256 3300046694 Bacteria 2238
469 Ga0495649_0239909 3300046694 Bacteria 933
470 Ga0495649_0293715 3300046694 Bacteria 828
471 Ga0495589_0000006 3300046794 Bacteria 303635
472 Ga0495589_0009008 3300046794 Bacteria 5191
473 Ga0495589_0011171 3300046794 Bacteria 4658
474 Ga0495589_0013308 3300046794 Bacteria 4246
475 Ga0495589_0163821 3300046794 Bacteria 1058
476 Ga0495660_0001349 3300046810 Bacteria 16870
477 Ga0495660_0002399 3300046810 Bacteria 11962
478 Ga0495660_0004217 3300046810 Bacteria 8735
479 Ga0495660_0004243 3300046810 Bacteria 8700
480 Ga0495660_0013192 3300046810 Bacteria 4787
481 Ga0495660_0025582 3300046810 Bacteria 3351
482 Ga0495660_0040326 3300046810 Bacteria 2588
483 Ga0495660_0112541 3300046810 Bacteria 1387
484 Ga0495636_0008837 3300047318 Bacteria 3968
485 Ga0495672_0003616 3300047320 Bacteria 13109
486 Ga0495672_0003859 3300047320 Bacteria 12600
487 Ga0495672_0012420 3300047320 Bacteria 5942
488 Ga0495672_0024227 3300047320 Bacteria 3914
489 Ga0495672_0029375 3300047320 Bacteria 3462
490 Ga0495672_0043623 3300047320 Bacteria 2695
491 Ga0495672_0051954 3300047320 Bacteria 2410
492 Ga0495676_0000058 3300047321 Bacteria 86045
493 Ga0495683_0000199 3300047323 Bacteria 56834
494 Ga0495683_0002985 3300047323 Bacteria 9985
495 Ga0495677_0003548 3300047445 Bacteria 6051
496 Ga0495679_000945 3300047446 Bacteria 18048
497 Ga0495679_005691 3300047446 Bacteria 5494
498 Ga0495679_006942 3300047446 Bacteria 4798
499 Ga0495679_007151 3300047446 Bacteria 4693
500 Ga0495679_007973 3300047446 Bacteria 4355
501 Ga0495685_016605 3300047447 Bacteria 2516
502 Ga0495685_029585 3300047447 Bacteria 1883
503 Ga0495673_0005992 3300047469 Bacteria 7230
504 Ga0495673_0006535 3300047469 Bacteria 6837
505 Ga0495673_0007428 3300047469 Bacteria 6301
506 Ga0495673_0019474 3300047469 Bacteria 3399
507 Ga0495681_0001171 3300047470 Bacteria 19926
508 Ga0495681_0001795 3300047470 Bacteria 15813
509 Ga0495681_0005497 3300047470 Bacteria 8472
510 Ga0495681_0010489 3300047470 Bacteria 5605
511 Ga0495681_0153462 3300047470 Bacteria 964
512 Ga0495686_0000266 3300047472 Bacteria 93781
513 Ga0495686_0002608 3300047472 Bacteria 16715
514 Ga0495686_0008113 3300047472 Bacteria 7765
515 Ga0495686_0011409 3300047472 Bacteria 6262
516 Ga0495686_0020167 3300047472 Bacteria 4447
517 Ga0495626_0000074 3300048091 Bacteria 132552
518 Ga0495626_0000366 3300048091 Bacteria 47327
519 Ga0495626_0001013 3300048091 Bacteria 24145
520 Ga0495626_0002162 3300048091 Bacteria 14153
521 Ga0495626_0002404 3300048091 Bacteria 13042
522 Ga0495626_0031832 3300048091 Bacteria 2535
523 Ga0495626_0064485 3300048091 Bacteria 1659
524 Ga0496104_0000368 3300048907 Bacteria 39833
525 Ga0496104_0022954 3300048907 Bacteria 5734
526 Ga0496105_0064629 3300048908 Bacteria 3019
527 Ga0496110_0080476 3300048913 Bacteria 2903
528 Ga0496114_0064744 3300048917 Bacteria 3062
529 Ga0496114_0136116 3300048917 Bacteria 2124
530 Ga0496116_0000031 3300048919 Bacteria 420043
531 Ga0496116_0000255 3300048919 Bacteria 94048
532 Ga0496116_0001333 3300048919 Bacteria 28080
533 Ga0496116_0001738 3300048919 Bacteria 23730
534 Ga0496116_0004739 3300048919 Bacteria 12843
535 Ga0496116_0018151 3300048919 Bacteria 5433
536 Ga0496116_0043455 3300048919 Eukaryota 3061
537 Ga0496116_0061807 3300048919 Bacteria 2422
538 Ga0496116_0185320 3300048919 Bacteria 1108
539 Ga0496116_0185561 3300048919 Bacteria 1107
540 Ga0496117_0001129 3300048920 Bacteria 40277
541 Ga0496117_0002101 3300048920 Bacteria 26223
542 Ga0496117_0006088 3300048920 Bacteria 12358
543 Ga0496117_0007023 3300048920 Bacteria 11146
544 Ga0496117_0009911 3300048920 Bacteria 8767
545 Ga0496117_0033569 3300048920 Bacteria 3878
546 Ga0496117_0045706 3300048920 Bacteria 3158
547 Ga0496117_0318653 3300048920 Bacteria 816
548 Ga0496118_0000752 3300048921 Bacteria 52469
549 Ga0496118_0003476 3300048921 Bacteria 19765
550 Ga0496118_0006939 3300048921 Bacteria 12245
551 Ga0496118_0011847 3300048921 Bacteria 8453
552 Ga0496118_0039084 3300048921 Bacteria 3791
553 Ga0496118_0041857 3300048921 Bacteria 3621
554 Ga0496119_0000032 3300048922 Bacteria 222289
555 Ga0496119_0000230 3300048922 Bacteria 78527
556 Ga0496119_0000258 3300048922 Bacteria 75132
557 Ga0496119_0015888 3300048922 Bacteria 5764
558 Ga0496119_0088545 3300048922 Bacteria 1764
559 Ga0496120_0000228 3300048923 Bacteria 96403
560 Ga0496120_0000255 3300048923 Bacteria 89200
561 Ga0496120_0000324 3300048923 Bacteria 79261
562 Ga0496120_0009427 3300048923 Bacteria 6925
563 Ga0496120_0014871 3300048923 Bacteria 5160
564 Ga0496120_0069875 3300048923 Bacteria 1932
565 Ga0496121_0000140 3300048924 Bacteria 162689
566 Ga0496121_0009355 3300048924 Bacteria 11285
567 Ga0496121_0056192 3300048924 Bacteria 3271
568 Ga0496121_0315061 3300048924 Bacteria 1055
569 Ga0496122_0000582 3300048925 Bacteria 74845
570 Ga0496122_0000908 3300048925 Bacteria 54441
571 Ga0496122_0001471 3300048925 Bacteria 37928
572 Ga0496122_0011350 3300048925 Bacteria 9035
573 Ga0496122_0012075 3300048925 Bacteria 8657
574 Ga0496122_0018888 3300048925 Bacteria 6333
575 Ga0496122_0064436 3300048925 Bacteria 2666
576 Ga0496122_0082195 3300048925 Bacteria 2238
577 Ga0496122_0143043 3300048925 Bacteria 1492
578 Ga0496122_0190743 3300048925 Bacteria 1210
579 Ga0496123_0000412 3300048926 Bacteria 78170
580 Ga0496123_0000479 3300048926 Bacteria 69250
581 Ga0496123_0000567 3300048926 Bacteria 63083
582 Ga0496123_0007217 3300048926 Bacteria 10544
583 Ga0496123_0011868 3300048926 Bacteria 7493
584 Ga0496123_0022316 3300048926 Bacteria 4883
585 Ga0496123_0069202 3300048926 Bacteria 2218
586 Ga0496123_0099822 3300048926 Bacteria 1693
587 Ga0496123_0205864 3300048926 Bacteria 1004
588 Ga0496124_0000013 3300048927 Bacteria 484884
589 Ga0496124_0000122 3300048927 Bacteria 161741
590 Ga0496124_0000332 3300048927 Bacteria 87485
591 Ga0496124_0005761 3300048927 Bacteria 13791
592 Ga0496124_0006362 3300048927 Bacteria 12884
593 Ga0496124_0015667 3300048927 Bacteria 7252
594 Ga0496124_0025233 3300048927 Bacteria 5387
595 Ga0496124_0032726 3300048927 Bacteria 4585
596 Ga0496124_0047518 3300048927 Bacteria 3671
597 Ga0496124_0052871 3300048927 Bacteria 3448
598 Ga0496124_0053134 3300048927 Bacteria 3437
599 Ga0496124_0212040 3300048927 Bacteria 1464
600 Ga0496125_0000016 3300048928 Bacteria 512512
601 Ga0496125_0000190 3300048928 Bacteria 132540
602 Ga0496125_0002428 3300048928 Bacteria 24231
603 Ga0496125_0005878 3300048928 Bacteria 13466
604 Ga0496125_0009349 3300048928 Bacteria 10098
605 Ga0496125_0010853 3300048928 Bacteria 9170
606 Ga0496125_0018504 3300048928 Bacteria 6616
607 Ga0496125_0026879 3300048928 Bacteria 5227
608 Ga0496125_0066411 3300048928 Bacteria 2850
609 Ga0496125_0070390 3300048928 Eukaryota 2739
610 Ga0496125_0080299 3300048928 Bacteria 2497
611 Ga0496125_0190764 3300048928 Bacteria 1353
612 Ga0496126_0007121 3300048929 Bacteria 12321
613 Ga0496126_0010848 3300048929 Bacteria 9499
614 Ga0496126_0011107 3300048929 Eukaryota 9356
615 Ga0496126_0019975 3300048929 Bacteria 6582
616 Ga0496126_0050226 3300048929 Bacteria 3802
617 Ga0496126_0116878 3300048929 Bacteria 2318
618 Ga0496126_0247596 3300048929 Bacteria 1486
619 Ga0496126_0334349 3300048929 Bacteria 1242
620 Ga0501309_003594 3300049129 Bacteria 1763
621 Ga0501304_017235 3300049160 Bacteria 690
622 Ga0501305_004359 3300049161 Bacteria 1660
623 Ga0495678_000222 3300049459 Bacteria 65798
624 Ga0495678_000359 3300049459 Bacteria 46686
625 Ga0495678_000500 3300049459 Bacteria 38668
626 Ga0495678_029021 3300049459 Bacteria 2327
627 Ga0495678_059444 3300049459 Bacteria 1441
628 Ga0495682_0001555 3300049460 Bacteria 12042
629 Ga0501312_002565 3300049528 Bacteria 1972
630 Ga0501032_0373673 3300049569 Bacteria 917
631 Ga0501032_0402812 3300049569 Bacteria 879
632 Ga0501033_0083798 3300049570 Bacteria 2337
633 Ga0501034_0000131 3300049571 Bacteria 139479
634 Ga0501034_0003332 3300049571 Bacteria 18336
635 Ga0501036_0453174 3300049572 Bacteria 1069
636 Ga0501038_0002404 3300049574 Bacteria 17444
637 Ga0501039_0033404 3300049575 Bacteria 3967
638 Ga0501040_0340552 3300049576 Bacteria 1074
639 Ga0501040_0358361 3300049576 Bacteria 1045
640 Ga0501040_0656410 3300049576 Bacteria 758
641 Ga0501041_0069703 3300049577 Bacteria 2158
642 Ga0501041_0243440 3300049577 Bacteria 1130
643 Ga0501042_0098375 3300049578 Bacteria 2104
644 Ga0501042_0344445 3300049578 Bacteria 1078
645 Ga0501043_0421199 3300049579 Bacteria 1007
646 Ga0501048_0231662 3300049582 Bacteria 1311
647 Ga0501071_0786166 3300049587 Bacteria 733
648 Ga0501072_0112231 3300049588 Bacteria 2170
649 Ga0501072_0330996 3300049588 Bacteria 1210
650 Ga0501075_0019354 3300049591 Bacteria 4938
651 Ga0501075_0045078 3300049591 Bacteria 3310
652 Ga0501075_0315845 3300049591 Bacteria 1191
653 Ga0501076_0016082 3300049592 Bacteria 5665
654 Ga0501077_0040832 3300049593 Bacteria 2954
655 Ga0501198_005122 3300049649 Bacteria 1837
656 Ga0501227_000545 3300049665 Bacteria 8167
657 Ga0501080_0298737 3300049742 Bacteria 1461
658 Ga0501083_0421295 3300049744 Bacteria 869
659 Ga0501241_000247 3300049758 Bacteria 12110
660 Ga0501269_001191 3300049766 Bacteria 3556
661 Ga0501035_0149620 3300049822 Bacteria 2027
662 Ga0501035_0310409 3300049822 Bacteria 1327
663 Ga0501035_0350285 3300049822 Bacteria 1236
664 Ga0501044_0458963 3300049823 Bacteria 1180
665 nmdc:mga03683_251448_c1 3300050489 Bacteria 821
666 nmdc:mga00v17_527_c1 3300050491 Bacteria 21481
667 nmdc:mga05p37_533047_c1 3300050507 Bacteria 1340
668 nmdc:mga0qj67_282046_c1 3300050509 Bacteria 1346
669 nmdc:mga06r32_231069_c1 3300050510 Bacteria 1837
670 nmdc:mga08y16_176298_c1 3300050511 Bacteria 2220
671 nmdc:mga0sz30_18806_c1 3300050516 Bacteria 2768
672 Ga0500659_0000087 3300053135 Bacteria 46315
673 Ga0501084_0972787 3300054114 Bacteria 713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10011998 Ga0105250_100119984 196
2 3300049579 Ga0501043_0421199 Ga0501043_0421199_234_872 200
3 3300002739 JGI25158J39367_1000331 JGI25158J39367_10003313 201
4 3300002987 JGI25159J45721_1002851 JGI25159J45721_10028513 201
5 3300003374 JGI25161J50226_1000500 JGI25161J50226_100050018 201
6 3300003771 Ga0055526_1001572 Ga0055526_100157217 201
7 3300003773 Ga0055537_1002144 Ga0055537_10021448 201
8 3300003775 Ga0055524_1004607 Ga0055524_10046073 201
9 3300003784 Ga0055534_1010125 Ga0055534_10101253 201
10 3300003791 Ga0055530_10001636 Ga0055530_1000163617 201
11 3300004625 Ga0055543_1001678 Ga0055543_10016782 201
12 3300005262 Ga0065165_1003101 Ga0065165_10031013 201
13 3300005262 Ga0065165_1034065 Ga0065165_10340652 201
14 3300025208 Ga0209436_100445 Ga0209436_10044519 201
15 3300025263 Ga0209565_1002293 Ga0209565_10022937 201
16 3300025284 Ga0209130_1001179 Ga0209130_100117919 201
17 3300025291 Ga0209675_1015036 Ga0209675_10150362 201
18 3300025295 Ga0209564_1000376 Ga0209564_100037665 201
19 3300025295 Ga0209564_1016648 Ga0209564_10166482 201
20 3300025298 Ga0209050_1002114 Ga0209050_100211418 201
21 3300025299 Ga0209256_1001352 Ga0209256_100135219 201
22 3300025302 Ga0207426_1034175 Ga0207426_10341752 201
23 3300031548 Ga0307408_100000103 Ga0307408_10000010318 201
24 3300048927 Ga0496124_0015667 Ga0496124_0015667_1800_2405 201
25 iso_pu_bacteria 2554235132 2554816530 201
26 iso_pu_bacteria 2606217733 2608380157 201
27 iso_pu_bacteria 2738543020 2739290057 201
28 iso_pu_bacteria 2738543021 2739295369 201
29 iso_pu_bacteria 2786546517 2787438038 201
30 iso_pu_bacteria 2808606385 2808978660 201
31 iso_pu_bacteria 2808606388 2808994392 201
32 iso_pu_bacteria 2852612431 2852614048 201
33 iso_pu_bacteria 2852667396 2852668215 201
34 iso_pu_bacteria 2920107658 2920110847 201
35 iso_pu_bacteria 8056131705 8056134348 201
36 iso_pu_bacteria 2554235231 2555248905 202
37 iso_pu_bacteria 2765235841 2765581915 202
38 iso_pu_bacteria 2806310737 2807406571 202
39 iso_pu_bacteria 2806310745 2807454903 202
40 iso_pu_bacteria 2842805378 2842806892 202
41 iso_pu_bacteria 8052494512 8052499233 202
42 iso_pu_bacteria 8054929484 8054930928 202
43 iso_pu_bacteria 8056115690 8056120578 202
44 iso_pu_bacteria 8056120720 8056121599 202
45 3300046522 Ga0495643_0001848 Ga0495643_0001848_2167_2784 203
46 3300046660 Ga0495625_0023549 Ga0495625_0023549_592_1209 203
47 3300046692 Ga0495671_0005338 Ga0495671_0005338_5714_6331 203
48 3300046694 Ga0495649_0239909 Ga0495649_0239909_268_885 203
49 iso_pu_bacteria 2547132181 2547698207 203
50 iso_pu_bacteria 2554235234 2555258045 203
51 iso_pu_bacteria 2561511199 2562465501 203
52 iso_pu_bacteria 2600255256 2601536180 203
53 iso_pu_bacteria 2600255257 2601541214 203
54 iso_pu_bacteria 2600255310 2601759838 203
55 iso_pu_bacteria 2600255311 2601765270 203
56 iso_pu_bacteria 2602042046 2603640828 203
57 iso_pu_bacteria 2602042109 2603867041 203
58 iso_pu_bacteria 2791355010 2792314099 203
59 iso_pu_bacteria 2811995292 2813731099 203
60 iso_pu_bacteria 2814123068 2814698757 203
61 iso_pu_bacteria 2888373701 2888378525 203
62 iso_pu_bacteria 2919108558 2919109287 203
63 iso_pu_bacteria 2935625433 2935628935 203
64 iso_pu_bacteria 2939617950 2939620056 203
65 iso_pu_bacteria 2971820967 2971823846 203
66 iso_pu_bacteria 2974435778 2974436552 203
67 iso_pu_bacteria 3003665799 3003669552 203
68 iso_pu_bacteria 8015394850 8015397589 203
69 iso_pu_bacteria 8019504834 8019506422 203
70 2162886007 SwRhRL2b_contig_150973 SwRhRL2b_0750.00003370 204
71 3300005289 Ga0065704_10098658 Ga0065704_100986582 204
72 3300005457 Ga0070662_100865934 Ga0070662_1008659341 204
73 3300006846 Ga0075430_100310557 Ga0075430_1003105572 204
74 3300006847 Ga0075431_100599436 Ga0075431_1005994362 204
75 3300009094 Ga0111539_10089953 Ga0111539_100899533 204
76 3300009147 Ga0114129_11236404 Ga0114129_112364042 204
77 3300013102 Ga0157371_10026820 Ga0157371_100268202 204
78 3300013104 Ga0157370_10001741 Ga0157370_1000174117 204
79 3300015261 Ga0182006_1080183 Ga0182006_10801832 204
80 3300025972 Ga0207668_10959223 Ga0207668_109592231 204
81 3300030732 Ga0316176_1013952 Ga0316176_10139522 204
82 3300031548 Ga0307408_100011698 Ga0307408_1000116983 204
83 3300031901 Ga0307406_10002676 Ga0307406_100026764 204
84 3300031901 Ga0307406_10548543 Ga0307406_105485432 204
85 3300031995 Ga0307409_100041740 Ga0307409_1000417403 204
86 3300042876 Ga0451577_0004339 Ga0451577_0004339_6572_7195 204
87 3300044673 Ga0453683_0085262 Ga0453683_0085262_243_866 204
88 3300044712 Ga0453684_0027406 Ga0453684_0027406_5306_5929 204
89 3300044712 Ga0453684_0157005 Ga0453684_0157005_1772_2395 204
90 3300044712 Ga0453684_0234536 Ga0453684_0234536_1058_1750 204
91 3300045051 Ga0451576_0000034 Ga0451576_0000034_322531_323154 204
92 3300046507 Ga0495606_0000861 Ga0495606_0000861_14689_15309 204
93 3300046522 Ga0495643_0113234 Ga0495643_0113234_198_818 204
94 3300046694 Ga0495649_0002635 Ga0495649_0002635_2637_3257 204
95 3300048920 Ga0496117_0045706 Ga0496117_0045706_2436_3053 204
96 3300049459 Ga0495678_059444 Ga0495678_059444_607_1227 204
97 3300049649 Ga0501198_005122 Ga0501198_005122_170_805 204
98 3300049822 Ga0501035_0310409 Ga0501035_0310409_422_1045 204
99 3300050507 nmdc:mga05p37_533047_c1 nmdc:mga05p37_533047_c1_194_817 204
100 3300050509 nmdc:mga0qj67_282046_c1 nmdc:mga0qj67_282046_c1_94_717 204
101 3300050510 nmdc:mga06r32_231069_c1 nmdc:mga06r32_231069_c1_1049_1672 204
102 iso_pu_bacteria 2506520007 2506576971 204
103 iso_pu_bacteria 2506520008 2506582109 204
104 iso_pu_bacteria 2508501071 2508850934 204
105 iso_pu_bacteria 2511231011 2511296864 204
106 iso_pu_bacteria 2511231012 2511303586 204
107 iso_pu_bacteria 2511231017 2511331451 204
108 iso_pu_bacteria 2511231023 2511368980 204
109 iso_pu_bacteria 2511231031 2511414473 204
110 iso_pu_bacteria 2511231031 2511414487 204
111 iso_pu_bacteria 2511231031 2511414492 204
112 iso_pu_bacteria 2513237150 2513953306 204
113 iso_pu_bacteria 2513237150 2513955373 204
114 iso_pu_bacteria 2513237165 2514040704 204
115 iso_pu_bacteria 2597489888 2597866213 204
116 iso_pu_bacteria 2597489889 2597872051 204
117 iso_pu_bacteria 2599185167 2599401299 204
118 iso_pu_bacteria 2599185189 2599509778 204
119 iso_pu_bacteria 2599185191 2599520190 204
120 iso_pu_bacteria 2599185288 2599881622 204
121 iso_pu_bacteria 2599185292 2599904095 204
122 iso_pu_bacteria 2599185303 2599949247 204
123 iso_pu_bacteria 2599185352 2600192668 204
124 iso_pu_bacteria 2600255296 2601693851 204
125 iso_pu_bacteria 2619619299 2621297243 204
126 iso_pu_bacteria 2643221557 2643804680 204
127 iso_pu_bacteria 2643221571 2643870838 204
128 iso_pu_bacteria 2643221571 2643870849 204
129 iso_pu_bacteria 2643221589 2643953199 204
130 iso_pu_bacteria 2643221594 2643982739 204
131 iso_pu_bacteria 2643221602 2644025197 204
132 iso_pu_bacteria 2643221610 2644064043 204
133 iso_pu_bacteria 2643221618 2644104836 204
134 iso_pu_bacteria 2643221621 2644120799 204
135 iso_pu_bacteria 2643221626 2644151267 204
136 iso_pu_bacteria 2643221655 2644313255 204
137 iso_pu_bacteria 2643221659 2644336341 204
138 iso_pu_bacteria 2643221668 2644375649 204
139 iso_pu_bacteria 2643221675 2644415875 204
140 iso_pu_bacteria 2643221680 2644448916 204
141 iso_pu_bacteria 2643221683 2644464771 204
142 iso_pu_bacteria 2643221698 2644547177 204
143 iso_pu_bacteria 2643221712 2644612878 204
144 iso_pu_bacteria 2643221726 2644686560 204
145 iso_pu_bacteria 2643221736 2644745288 204
146 iso_pu_bacteria 2654587920 2656279341 204
147 iso_pu_bacteria 2687453601 2689443370 204
148 iso_pu_bacteria 2713897148 2715753493 204
149 iso_pu_bacteria 2713897148 2715753504 204
150 iso_pu_bacteria 2718217725 2718634506 204
151 iso_pu_bacteria 2718217725 2718634527 204
152 iso_pu_bacteria 2721755523 2722884471 204
153 iso_pu_bacteria 2721755607 2723250947 204
154 iso_pu_bacteria 2738541265 2738673013 204
155 iso_pu_bacteria 2738541282 2738751406 204
156 iso_pu_bacteria 2738541294 2738810174 204
157 iso_pu_bacteria 2738541303 2738860447 204
158 iso_pu_bacteria 2738541309 2738897534 204
159 iso_pu_bacteria 2738543015 2739261928 204
160 iso_pu_bacteria 2738543025 2739313190 204
161 iso_pu_bacteria 2738543025 2739313207 204
162 iso_pu_bacteria 2739367655 2739610493 204
163 iso_pu_bacteria 2772190666 2772437502 204
164 iso_pu_bacteria 2773857673 2774138333 204
165 iso_pu_bacteria 2784132063 2784264915 204
166 iso_pu_bacteria 2806310673 2807178360 204
167 iso_pu_bacteria 2808606385 2808977499 204
168 iso_pu_bacteria 2808606388 2808992843 204
169 iso_pu_bacteria 2808606395 2809034848 204
170 iso_pu_bacteria 2816332298 2817493639 204
171 iso_pu_bacteria 2839138175 2839143067 204
172 iso_pu_bacteria 2842826826 2842829062 204
173 iso_pu_bacteria 2842832357 2842835296 204
174 iso_pu_bacteria 2842832357 2842835307 204
175 iso_pu_bacteria 2842837860 2842840499 204
176 iso_pu_bacteria 2842843487 2842843613 204
177 iso_pu_bacteria 2842843487 2842844115 204
178 iso_pu_bacteria 2842843487 2842844126 204
179 iso_pu_bacteria 2844163670 2844169611 204
180 iso_pu_bacteria 2852612431 2852618061 204
181 iso_pu_bacteria 2852657418 2852662162 204
182 iso_pu_bacteria 2852667396 2852673119 204
183 iso_pu_bacteria 2854911287 2854916185 204
184 iso_pu_bacteria 2857537821 2857542021 204
185 iso_pu_bacteria 2857542790 2857543307 204
186 iso_pu_bacteria 2858950400 2858956753 204
187 iso_pu_bacteria 2860867994 2860872619 204
188 iso_pu_bacteria 2861691609 2861696025 204
189 iso_pu_bacteria 2869551831 2869552780 204
190 iso_pu_bacteria 2880230671 2880233052 204
191 iso_pu_bacteria 2888366609 2888367517 204
192 iso_pu_bacteria 2888366609 2888370691 204
193 iso_pu_bacteria 2904518522 2904523433 204
194 iso_pu_bacteria 2919385768 2919386928 204
195 iso_pu_bacteria 2919385768 2919391029 204
196 iso_pu_bacteria 2919487758 2919492212 204
197 iso_pu_bacteria 2919487758 2919492921 204
198 iso_pu_bacteria 2920822456 2920827004 204
199 iso_pu_bacteria 2929189879 2929194731 204
200 iso_pu_bacteria 2932406140 2932407490 204
201 iso_pu_bacteria 2937967321 2937969192 204
202 iso_pu_bacteria 2939573065 2939574432 204
203 iso_pu_bacteria 2939577877 2939579400 204
204 iso_pu_bacteria 2939636861 2939642409 204
205 iso_pu_bacteria 2941479691 2941480649 204
206 iso_pu_bacteria 2941499720 2941504472 204
207 iso_pu_bacteria 2945928738 2945931324 204
208 iso_pu_bacteria 2946027586 2946033223 204
209 iso_pu_bacteria 2947233263 2947233995 204
210 iso_pu_bacteria 2947233263 2947234006 204
211 iso_pu_bacteria 2969304461 2969307041 204
212 iso_pu_bacteria 2969304461 2969307065 204
213 iso_pu_bacteria 2974289157 2974291542 204
214 iso_pu_bacteria 2974289157 2974291552 204
215 iso_pu_bacteria 2998139840 2998142226 204
216 iso_pu_bacteria 2998139840 2998142236 204
217 iso_pu_bacteria 3007614139 3007619258 204
218 iso_pu_bacteria 3007614139 3007619272 204
219 iso_pu_bacteria 3007855910 3007856431 204
220 iso_pu_bacteria 3007861166 3007862473 204
221 iso_pu_bacteria 640753048 640936520 204
222 iso_pu_bacteria 644736347 644747007 204
223 iso_pu_bacteria 644736347 644751647 204
224 iso_pu_bacteria 8004592986 8004594200 204
225 iso_pu_bacteria 8011350971 8011351962 204
226 iso_pu_bacteria 8011350971 8011353698 204
227 iso_pu_bacteria 8015394850 8015396723 204
228 iso_pu_bacteria 8015394850 8015396776 204
229 iso_pu_bacteria 8029995093 8029998474 204
230 iso_pu_bacteria 8029995093 8029998484 204
231 iso_pu_bacteria 8054347763 8054352938 204
232 iso_pu_bacteria 8054503363 8054508506 204
233 iso_pu_bacteria 8055817908 8055823473 204
234 iso_pu_bacteria 8055878733 8055878776 204
235 iso_pu_bacteria 8056125926 8056129979 204
236 iso_pu_bacteria 8056131705 8056136910 204
237 iso_pu_bacteria 8056148874 8056150140 204
238 iso_pu_bacteria 8056166840 8056168836 204
239 iso_pu_bacteria 8056166840 8056168846 204
240 iso_pu_bacteria 8056177738 8056181397 204
241 3300003323 rootH1_10142104 rootH1_101421043 205
242 3300006048 Ga0075363_100009224 Ga0075363_1000092244 205
243 3300044712 Ga0453684_0395903 Ga0453684_0395903_778_1401 205
244 3300045051 Ga0451576_0661975 Ga0451576_0661975_131_787 205
245 3300046615 Ga0495656_0058820 Ga0495656_0058820_79_696 205
246 3300048920 Ga0496117_0001129 Ga0496117_0001129_9718_10335 205
247 3300049576 Ga0501040_0340552 Ga0501040_0340552_356_979 205
248 3300049577 Ga0501041_0069703 Ga0501041_0069703_618_1241 205
249 3300049578 Ga0501042_0344445 Ga0501042_0344445_86_709 205
250 3300049582 Ga0501048_0231662 Ga0501048_0231662_628_1251 205
251 3300049591 Ga0501075_0315845 Ga0501075_0315845_472_1095 205
252 3300049665 Ga0501227_000545 Ga0501227_000545_4613_5341 205
253 3300049744 Ga0501083_0421295 Ga0501083_0421295_217_840 205
254 3300054114 Ga0501084_0972787 Ga0501084_0972787_68_691 205
255 iso_pu_bacteria 2511231024 2511373348 205
256 iso_pu_bacteria 2511231024 2511373352 205
257 iso_pu_bacteria 2554235231 2555248209 205
258 iso_pu_bacteria 2643221565 2643841125 205
259 iso_pu_bacteria 2738541300 2738846718 205
260 iso_pu_bacteria 2738543018 2739277624 205
261 iso_pu_bacteria 2738543030 2739346691 205
262 iso_pu_bacteria 2765235841 2765586650 205
263 iso_pu_bacteria 2765235841 2765586657 205
264 iso_pu_bacteria 2806310737 2807405908 205
265 iso_pu_bacteria 2806310745 2807454243 205
266 iso_pu_bacteria 2894023352 2894024940 205
267 iso_pu_bacteria 2919155634 2919155969 205
268 iso_pu_bacteria 2932422444 2932422480 205
269 iso_pu_bacteria 3007803356 3007807637 205
270 iso_pu_bacteria 3007803356 3007807644 205
271 iso_pu_bacteria 3007872151 3007873260 205
272 iso_pu_bacteria 8052494512 8052494765 205
273 iso_pu_bacteria 8052494512 8052494772 205
274 iso_pu_bacteria 8054929484 8054931244 205
275 iso_pu_bacteria 8054929484 8054931252 205
276 iso_pu_bacteria 8056115690 8056116208 205
277 iso_pu_bacteria 8056120720 8056120837 205
278 iso_pu_bacteria 8056137416 8056142873 205
279 iso_pu_bacteria 8056137416 8056142874 205
280 iso_pu_bacteria 8056137416 8056142881 205
281 2162886007 SwRhRL2b_contig_2968351 SwRhRL2b_0145.00002800 206
282 2162886007 SwRhRL2b_contig_3730156 SwRhRL2b_0310.00006310 206
283 3300005289 Ga0065704_10004276 Ga0065704_100042762 206
284 3300005289 Ga0065704_10079174 Ga0065704_100791744 206
285 3300005353 Ga0070669_100584433 Ga0070669_1005844331 206
286 3300006944 Ga0099823_1000275 Ga0099823_100027515 206
287 3300006944 Ga0099823_1032813 Ga0099823_10328132 206
288 3300009011 Ga0105251_10000391 Ga0105251_1000039115 206
289 3300009011 Ga0105251_10000666 Ga0105251_1000066610 206
290 3300009011 Ga0105251_10113377 Ga0105251_101133772 206
291 3300009036 Ga0105244_10000799 Ga0105244_1000079915 206
292 3300009036 Ga0105244_10009450 Ga0105244_100094501 206
293 3300009036 Ga0105244_10014292 Ga0105244_100142925 206
294 3300009036 Ga0105244_10106183 Ga0105244_101061832 206
295 3300009036 Ga0105244_10109731 Ga0105244_101097312 206
296 3300009092 Ga0105250_10013843 Ga0105250_100138434 206
297 3300009092 Ga0105250_10033127 Ga0105250_100331273 206
298 3300009092 Ga0105250_10035365 Ga0105250_100353654 206
299 3300009148 Ga0105243_10001783 Ga0105243_1000178310 206
300 3300013104 Ga0157370_10031541 Ga0157370_100315415 206
301 3300025292 Ga0209676_1002285 Ga0209676_10022853 206
302 3300025711 Ga0207696_1000172 Ga0207696_100017294 206
303 3300025711 Ga0207696_1009804 Ga0207696_10098042 206
304 3300025711 Ga0207696_1011818 Ga0207696_10118182 206
305 3300025711 Ga0207696_1029204 Ga0207696_10292042 206
306 3300025728 Ga0207655_1000445 Ga0207655_100044527 206
307 3300025728 Ga0207655_1000523 Ga0207655_100052329 206
308 3300025728 Ga0207655_1004927 Ga0207655_10049279 206
309 3300025728 Ga0207655_1010084 Ga0207655_10100841 206
310 3300025735 Ga0207713_1000003 Ga0207713_1000003670 206
311 3300025735 Ga0207713_1012399 Ga0207713_10123995 206
312 3300025735 Ga0207713_1024772 Ga0207713_10247722 206
313 3300025735 Ga0207713_1031802 Ga0207713_10318024 206
314 3300025735 Ga0207713_1104403 Ga0207713_11044031 206
315 3300025935 Ga0207709_10002073 Ga0207709_100020737 206
316 3300025935 Ga0207709_10452497 Ga0207709_104524971 206
317 3300027296 Ga0209389_1000125 Ga0209389_100012549 206
318 3300027312 Ga0209371_1019651 Ga0209371_10196511 206
319 3300042006 Ga0439432_000442 Ga0439432_000442_627_1247 206
320 3300042142 Ga0450905_004491 Ga0450905_004491_140_760 206
321 3300042142 Ga0450905_012351 Ga0450905_012351_425_1045 206
322 3300042439 Ga0439464_0011602 Ga0439464_0011602_749_1369 206
323 3300046515 Ga0495620_0000124 Ga0495620_0000124_14296_14916 206
324 3300046519 Ga0495632_0000466 Ga0495632_0000466_23700_24320 206
325 3300046520 Ga0495637_0011326 Ga0495637_0011326_300_1064 206
326 3300046522 Ga0495643_0000810 Ga0495643_0000810_16944_17564 206
327 3300046522 Ga0495643_0002462 Ga0495643_0002462_9181_9801 206
328 3300046524 Ga0495648_0000606 Ga0495648_0000606_14108_14728 206
329 3300046694 Ga0495649_0043143 Ga0495649_0043143_300_1064 206
330 3300048913 Ga0496110_0080476 Ga0496110_0080476_1812_2432 206
331 3300048917 Ga0496114_0064744 Ga0496114_0064744_37_657 206
332 3300048919 Ga0496116_0018151 Ga0496116_0018151_4673_5293 206
333 3300048920 Ga0496117_0002101 Ga0496117_0002101_4501_5121 206
334 3300048920 Ga0496117_0033569 Ga0496117_0033569_74_694 206
335 3300048921 Ga0496118_0000752 Ga0496118_0000752_24029_24649 206
336 3300048921 Ga0496118_0003476 Ga0496118_0003476_19075_19695 206
337 3300048925 Ga0496122_0001471 Ga0496122_0001471_30228_30848 206
338 3300048925 Ga0496122_0064436 Ga0496122_0064436_1818_2438 206
339 3300048926 Ga0496123_0000567 Ga0496123_0000567_35037_35657 206
340 3300048926 Ga0496123_0205864 Ga0496123_0205864_227_847 206
341 3300048927 Ga0496124_0005761 Ga0496124_0005761_7991_8611 206
342 3300048927 Ga0496124_0006362 Ga0496124_0006362_10130_10750 206
343 3300048927 Ga0496124_0047518 Ga0496124_0047518_2970_3590 206
344 3300048928 Ga0496125_0002428 Ga0496125_0002428_23517_24137 206
345 3300048928 Ga0496125_0010853 Ga0496125_0010853_1272_1892 206
346 3300048929 Ga0496126_0247596 Ga0496126_0247596_247_867 206
347 3300048929 Ga0496126_0334349 Ga0496126_0334349_607_1227 206
348 3300049571 Ga0501034_0000131 Ga0501034_0000131_129551_130171 206
349 3300049572 Ga0501036_0453174 Ga0501036_0453174_11_640 206
350 3300049574 Ga0501038_0002404 Ga0501038_0002404_7979_8608 206
351 3300049575 Ga0501039_0033404 Ga0501039_0033404_204_833 206
352 3300049822 Ga0501035_0149620 Ga0501035_0149620_982_1611 206
353 3300053135 Ga0500659_0000087 Ga0500659_0000087_32107_32727 206
354 3300002773 JGI25152J39213_1000856 JGI25152J39213_10008565 207
355 3300003187 JGI25151J46595_10003449 JGI25151J46595_100034493 207
356 3300003320 rootH2_10069019 rootH2_100690192 207
357 3300003771 Ga0055526_1001559 Ga0055526_10015592 207
358 3300003771 Ga0055526_1005545 Ga0055526_10055452 207
359 3300003781 Ga0055536_1000058 Ga0055536_10000586 207
360 3300003784 Ga0055534_1000751 Ga0055534_10007519 207
361 3300003856 Ga0058692_1002490 Ga0058692_10024904 207
362 3300009011 Ga0105251_10000042 Ga0105251_100000428 207
363 3300009036 Ga0105244_10013896 Ga0105244_100138962 207
364 3300009092 Ga0105250_10000059 Ga0105250_1000005984 207
365 3300009148 Ga0105243_10039987 Ga0105243_100399874 207
366 3300013102 Ga0157371_10431531 Ga0157371_104315311 207
367 3300013105 Ga0157369_10007171 Ga0157369_100071715 207
368 3300013307 Ga0157372_10000672 Ga0157372_1000067214 207
369 3300025245 Ga0207425_1010707 Ga0207425_10107072 207
370 3300025258 Ga0209129_1000008 Ga0209129_100000850 207
371 3300025291 Ga0209675_1000167 Ga0209675_10001677 207
372 3300025292 Ga0209676_1000210 Ga0209676_100021011 207
373 3300025294 Ga0209025_1000051 Ga0209025_1000051197 207
374 3300025295 Ga0209564_1000084 Ga0209564_1000084204 207
375 3300025295 Ga0209564_1001130 Ga0209564_10011307 207
376 3300025711 Ga0207696_1000005 Ga0207696_1000005121 207
377 3300025728 Ga0207655_1045291 Ga0207655_10452912 207
378 3300025735 Ga0207713_1000002 Ga0207713_1000002364 207
379 3300025935 Ga0207709_10363427 Ga0207709_103634271 207
380 3300027312 Ga0209371_1000046 Ga0209371_100004621 207
381 3300027312 Ga0209371_1000959 Ga0209371_10009596 207
382 3300027312 Ga0209371_1008116 Ga0209371_10081162 207
383 3300027312 Ga0209371_1011506 Ga0209371_10115063 207
384 3300027312 Ga0209371_1012687 Ga0209371_10126872 207
385 3300030500 Ga0268256_1000012 Ga0268256_100001241 207
386 3300030500 Ga0268256_1005632 Ga0268256_10056322 207
387 3300030500 Ga0268256_1012555 Ga0268256_10125552 207
388 3300030500 Ga0268256_1013855 Ga0268256_10138552 207
389 3300042010 Ga0439452_000005 Ga0439452_000005_595200_595823 207
390 3300042010 Ga0439452_006872 Ga0439452_006872_1681_2304 207
391 3300042115 Ga0450911_000820 Ga0450911_000820_7074_7697 207
392 3300042439 Ga0439464_0033500 Ga0439464_0033500_301_924 207
393 3300044669 Ga0466981_0000007 Ga0466981_0000007_122631_123254 207
394 3300046471 Ga0495650_0005106 Ga0495650_0005106_5578_6201 207
395 3300046471 Ga0495650_0119151 Ga0495650_0119151_112_735 207
396 3300047446 Ga0495679_007973 Ga0495679_007973_2168_2791 207
397 3300048907 Ga0496104_0022954 Ga0496104_0022954_2336_2959 207
398 3300048908 Ga0496105_0064629 Ga0496105_0064629_321_944 207
399 3300048919 Ga0496116_0001738 Ga0496116_0001738_3730_4353 207
400 3300048919 Ga0496116_0185320 Ga0496116_0185320_426_1049 207
401 3300048919 Ga0496116_0185561 Ga0496116_0185561_60_683 207
402 3300048920 Ga0496117_0009911 Ga0496117_0009911_4516_5139 207
403 3300048920 Ga0496117_0318653 Ga0496117_0318653_85_708 207
404 3300048921 Ga0496118_0006939 Ga0496118_0006939_8828_9451 207
405 3300048921 Ga0496118_0011847 Ga0496118_0011847_4414_5037 207
406 3300048921 Ga0496118_0039084 Ga0496118_0039084_2090_2713 207
407 3300048922 Ga0496119_0000032 Ga0496119_0000032_51947_52570 207
408 3300048922 Ga0496119_0000230 Ga0496119_0000230_19293_19916 207
409 3300048922 Ga0496119_0088545 Ga0496119_0088545_903_1526 207
410 3300048923 Ga0496120_0000324 Ga0496120_0000324_22460_23083 207
411 3300048923 Ga0496120_0009427 Ga0496120_0009427_2110_2733 207
412 3300048923 Ga0496120_0069875 Ga0496120_0069875_1068_1691 207
413 3300048924 Ga0496121_0056192 Ga0496121_0056192_1146_1769 207
414 3300048925 Ga0496122_0000582 Ga0496122_0000582_27598_28221 207
415 3300048925 Ga0496122_0012075 Ga0496122_0012075_2685_3308 207
416 3300048925 Ga0496122_0082195 Ga0496122_0082195_1584_2207 207
417 3300048926 Ga0496123_0000479 Ga0496123_0000479_46124_46747 207
418 3300048926 Ga0496123_0011868 Ga0496123_0011868_1767_2390 207
419 3300048926 Ga0496123_0099822 Ga0496123_0099822_293_916 207
420 3300048927 Ga0496124_0000332 Ga0496124_0000332_34749_35372 207
421 3300048927 Ga0496124_0052871 Ga0496124_0052871_510_1133 207
422 3300048927 Ga0496124_0212040 Ga0496124_0212040_604_1227 207
423 3300048928 Ga0496125_0018504 Ga0496125_0018504_4066_4689 207
424 3300048928 Ga0496125_0066411 Ga0496125_0066411_341_964 207
425 3300048928 Ga0496125_0080299 Ga0496125_0080299_97_720 207
426 3300048928 Ga0496125_0190764 Ga0496125_0190764_234_857 207
427 3300048929 Ga0496126_0010848 Ga0496126_0010848_5280_5903 207
428 3300048929 Ga0496126_0019975 Ga0496126_0019975_1097_1720 207
429 3300048929 Ga0496126_0050226 Ga0496126_0050226_663_1286 207
430 3300049569 Ga0501032_0373673 Ga0501032_0373673_171_812 207
431 3300049576 Ga0501040_0358361 Ga0501040_0358361_198_839 207
432 3300049576 Ga0501040_0656410 Ga0501040_0656410_114_746 207
433 3300049577 Ga0501041_0243440 Ga0501041_0243440_237_878 207
434 3300049578 Ga0501042_0098375 Ga0501042_0098375_254_895 207
435 3300049587 Ga0501071_0786166 Ga0501071_0786166_38_679 207
436 3300049588 Ga0501072_0112231 Ga0501072_0112231_1070_1711 207
437 3300049588 Ga0501072_0330996 Ga0501072_0330996_35_667 207
438 3300049591 Ga0501075_0019354 Ga0501075_0019354_698_1339 207
439 3300049591 Ga0501075_0045078 Ga0501075_0045078_385_1017 207
440 3300049592 Ga0501076_0016082 Ga0501076_0016082_1265_1906 207
441 3300049593 Ga0501077_0040832 Ga0501077_0040832_1429_2070 207
442 3300049742 Ga0501080_0298737 Ga0501080_0298737_808_1449 207
443 3300049822 Ga0501035_0350285 Ga0501035_0350285_66_707 207
444 iso_pu_bacteria 2739367655 2739610590 207
445 2162886007 SwRhRL2b_contig_1285905 SwRhRL2b_0387.00001970 208
446 3300003578 Ga0006562J51391_1139573 Ga0006562J51391_11395732 208
447 3300003751 Ga0055538_1001219 Ga0055538_10012198 208
448 3300003771 Ga0055526_1007392 Ga0055526_10073922 208
449 3300003775 Ga0055524_1000731 Ga0055524_100073116 208
450 3300003781 Ga0055536_1000458 Ga0055536_100045823 208
451 3300003792 Ga0055540_1000344 Ga0055540_100034422 208
452 3300003841 Ga0055541_1001161 Ga0055541_10011616 208
453 3300005272 Ga0065703_1000561 Ga0065703_10005614 208
454 3300005288 Ga0065714_10002206 Ga0065714_1000220635 208
455 3300005288 Ga0065714_10070299 Ga0065714_100702992 208
456 3300005289 Ga0065704_10096582 Ga0065704_100965821 208
457 3300005289 Ga0065704_10124566 Ga0065704_101245662 208
458 3300005289 Ga0065704_10163538 Ga0065704_101635381 208
459 3300005548 Ga0070665_100151506 Ga0070665_1001515062 208
460 3300005617 Ga0068859_100190329 Ga0068859_1001903292 208
461 3300005937 Ga0081455_10017544 Ga0081455_100175449 208
462 3300005937 Ga0081455_10092321 Ga0081455_100923213 208
463 3300006028 Ga0070717_10667348 Ga0070717_106673481 208
464 3300006051 Ga0075364_10077656 Ga0075364_100776563 208
465 3300006051 Ga0075364_10169985 Ga0075364_101699852 208
466 3300006051 Ga0075364_10219983 Ga0075364_102199832 208
467 3300006051 Ga0075364_10393324 Ga0075364_103933241 208
468 3300006058 Ga0075432_10033565 Ga0075432_100335653 208
469 3300006058 Ga0075432_10076629 Ga0075432_100766291 208
470 3300006058 Ga0075432_10089266 Ga0075432_100892662 208
471 3300006177 Ga0075362_10058435 Ga0075362_100584352 208
472 3300006177 Ga0075362_10174184 Ga0075362_101741842 208
473 3300006353 Ga0075370_10347356 Ga0075370_103473561 208
474 3300006914 Ga0075436_100240524 Ga0075436_1002405242 208
475 3300006914 Ga0075436_100366636 Ga0075436_1003666361 208
476 3300006931 Ga0097620_100190318 Ga0097620_1001903182 208
477 3300006946 Ga0079104_1000004 Ga0079104_100000488 208
478 3300006946 Ga0079104_1000176 Ga0079104_100017655 208
479 3300006946 Ga0079104_1000700 Ga0079104_100070026 208
480 3300006948 Ga0099826_10000013 Ga0099826_10000013189 208
481 3300007076 Ga0075435_100802479 Ga0075435_1008024791 208
482 3300009011 Ga0105251_10000073 Ga0105251_1000007350 208
483 3300009011 Ga0105251_10000582 Ga0105251_100005823 208
484 3300009011 Ga0105251_10015013 Ga0105251_100150132 208
485 3300009036 Ga0105244_10000026 Ga0105244_10000026186 208
486 3300009036 Ga0105244_10000071 Ga0105244_1000007120 208
487 3300009036 Ga0105244_10040086 Ga0105244_100400862 208
488 3300009036 Ga0105244_10225347 Ga0105244_102253472 208
489 3300009092 Ga0105250_10000310 Ga0105250_1000031010 208
490 3300009092 Ga0105250_10037558 Ga0105250_100375582 208
491 3300009092 Ga0105250_10130841 Ga0105250_101308412 208
492 3300009094 Ga0111539_10015990 Ga0111539_100159905 208
493 3300009101 Ga0105247_10000187 Ga0105247_1000018747 208
494 3300009147 Ga0114129_10026761 Ga0114129_100267614 208
495 3300009148 Ga0105243_10000547 Ga0105243_1000054720 208
496 3300009148 Ga0105243_10000736 Ga0105243_1000073628 208
497 3300009148 Ga0105243_10001371 Ga0105243_1000137110 208
498 3300009148 Ga0105243_10048163 Ga0105243_100481632 208
499 3300009174 Ga0105241_10000004 Ga0105241_10000004100 208
500 3300009177 Ga0105248_10971349 Ga0105248_109713491 208
501 3300009553 Ga0105249_10000138 Ga0105249_1000013891 208
502 3300012498 Ga0157345_1000004 Ga0157345_100000423 208
503 3300013100 Ga0157373_10000039 Ga0157373_1000003954 208
504 3300013100 Ga0157373_10062091 Ga0157373_100620913 208
505 3300013100 Ga0157373_10260503 Ga0157373_102605032 208
506 3300013104 Ga0157370_10001493 Ga0157370_100014932 208
507 3300013296 Ga0157374_10201811 Ga0157374_102018113 208
508 3300013306 Ga0163162_10000067 Ga0163162_1000006743 208
509 3300014497 Ga0182008_10013747 Ga0182008_100137476 208
510 3300014497 Ga0182008_10033799 Ga0182008_100337992 208
511 3300014497 Ga0182008_10034689 Ga0182008_100346892 208
512 3300015261 Ga0182006_1023968 Ga0182006_10239682 208
513 3300017792 Ga0163161_10000004 Ga0163161_10000004290 208
514 3300017792 Ga0163161_10000066 Ga0163161_10000066107 208
515 3300025224 Ga0209784_100360 Ga0209784_10036017 208
516 3300025225 Ga0209566_100666 Ga0209566_10066622 208
517 3300025226 Ga0209674_102378 Ga0209674_1023782 208
518 3300025263 Ga0209565_1000053 Ga0209565_1000053120 208
519 3300025263 Ga0209565_1000176 Ga0209565_100017667 208
520 3300025273 Ga0209673_1020634 Ga0209673_10206342 208
521 3300025291 Ga0209675_1000091 Ga0209675_1000091120 208
522 3300025291 Ga0209675_1000328 Ga0209675_100032811 208
523 3300025292 Ga0209676_1000098 Ga0209676_1000098128 208
524 3300025292 Ga0209676_1001409 Ga0209676_10014097 208
525 3300025292 Ga0209676_1003474 Ga0209676_10034748 208
526 3300025292 Ga0209676_1035086 Ga0209676_10350862 208
527 3300025294 Ga0209025_1000085 Ga0209025_100008571 208
528 3300025294 Ga0209025_1000098 Ga0209025_100009894 208
529 3300025295 Ga0209564_1000421 Ga0209564_100042167 208
530 3300025295 Ga0209564_1000666 Ga0209564_10006661 208
531 3300025298 Ga0209050_1000754 Ga0209050_100075420 208
532 3300025298 Ga0209050_1008876 Ga0209050_10088765 208
533 3300025299 Ga0209256_1000073 Ga0209256_1000073106 208
534 3300025299 Ga0209256_1000517 Ga0209256_100051737 208
535 3300025299 Ga0209256_1001071 Ga0209256_100107112 208
536 3300025303 Ga0209051_1000098 Ga0209051_1000098128 208
537 3300025303 Ga0209051_1019117 Ga0209051_10191172 208
538 3300025304 Ga0209257_1021335 Ga0209257_10213352 208
539 3300025711 Ga0207696_1000003 Ga0207696_1000003782 208
540 3300025711 Ga0207696_1000033 Ga0207696_1000033248 208
541 3300025711 Ga0207696_1003553 Ga0207696_10035534 208
542 3300025728 Ga0207655_1000027 Ga0207655_1000027343 208
543 3300025728 Ga0207655_1000057 Ga0207655_1000057215 208
544 3300025728 Ga0207655_1011659 Ga0207655_10116595 208
545 3300025728 Ga0207655_1015132 Ga0207655_10151322 208
546 3300025728 Ga0207655_1122658 Ga0207655_11226581 208
547 3300025735 Ga0207713_1000065 Ga0207713_1000065115 208
548 3300025735 Ga0207713_1000108 Ga0207713_100010879 208
549 3300025735 Ga0207713_1004928 Ga0207713_10049281 208
550 3300025735 Ga0207713_1078765 Ga0207713_10787651 208
551 3300025900 Ga0207710_10000016 Ga0207710_10000016122 208
552 3300025911 Ga0207654_10000006 Ga0207654_10000006116 208
553 3300025935 Ga0207709_10000019 Ga0207709_10000019200 208
554 3300025935 Ga0207709_10000130 Ga0207709_1000013061 208
555 3300025935 Ga0207709_10000565 Ga0207709_1000056528 208
556 3300025961 Ga0207712_10000103 Ga0207712_1000010392 208
557 3300027111 Ga0209281_1000005 Ga0209281_1000005289 208
558 3300027111 Ga0209281_1000008 Ga0209281_1000008754 208
559 3300027111 Ga0209281_1000294 Ga0209281_10002946 208
560 3300027111 Ga0209281_1007658 Ga0209281_10076583 208
561 3300027666 Ga0209282_1000043 Ga0209282_100004396 208
562 3300027876 Ga0209974_10009818 Ga0209974_100098181 208
563 3300027907 Ga0207428_10171731 Ga0207428_101717311 208
564 3300027907 Ga0207428_10172086 Ga0207428_101720862 208
565 3300027907 Ga0207428_10179370 Ga0207428_101793702 208
566 3300027907 Ga0207428_10217958 Ga0207428_102179582 208
567 3300028379 Ga0268266_10083946 Ga0268266_100839462 208
568 3300028786 Ga0307517_10030228 Ga0307517_100302285 208
569 3300031507 Ga0307509_10149488 Ga0307509_101494883 208
570 3300031616 Ga0307508_10239705 Ga0307508_102397052 208
571 3300031731 Ga0307405_10048028 Ga0307405_100480282 208
572 3300031911 Ga0307412_10010689 Ga0307412_100106892 208
573 3300031911 Ga0307412_10247750 Ga0307412_102477501 208
574 3300031911 Ga0307412_10338074 Ga0307412_103380742 208
575 3300032002 Ga0307416_100631951 Ga0307416_1006319512 208
576 3300032005 Ga0307411_10073542 Ga0307411_100735423 208
577 3300032005 Ga0307411_10222313 Ga0307411_102223132 208
578 3300033180 Ga0307510_10000324 Ga0307510_1000032425 208
579 3300033180 Ga0307510_10000324 Ga0307510_100003245 208
580 3300033180 Ga0307510_10056331 Ga0307510_100563311 208
581 3300039437 Ga0436365_1873831 Ga0436365_1873831_701_1333 208
582 3300041405 Ga0439438_000894 Ga0439438_000894_3203_3829 208
583 3300041405 Ga0439438_008226 Ga0439438_008226_1710_2336 208
584 3300041407 Ga0439447_000588 Ga0439447_000588_3675_4301 208
585 3300041411 Ga0439466_0024049 Ga0439466_0024049_941_1567 208
586 3300041494 Ga0451837_1686659 Ga0451837_1686659_782_1450 208
587 3300042006 Ga0439432_006057 Ga0439432_006057_3528_4154 208
588 3300042010 Ga0439452_001772 Ga0439452_001772_7082_7708 208
589 3300042122 Ga0450920_008740 Ga0450920_008740_264_890 208
590 3300042124 Ga0450922_000031 Ga0450922_000031_2466_3092 208
591 3300042136 Ga0450900_003341 Ga0450900_003341_1028_1654 208
592 3300042137 Ga0450902_000234 Ga0450902_000234_5031_5657 208
593 3300042142 Ga0450905_000549 Ga0450905_000549_1493_2119 208
594 3300042146 Ga0450907_029959 Ga0450907_029959_174_800 208
595 3300042147 Ga0450910_001840 Ga0450910_001840_1848_2474 208
596 3300042184 Ga0450908_007926 Ga0450908_007926_1103_1729 208
597 3300042461 Ga0439460_0006245 Ga0439460_0006245_2290_2916 208
598 3300044656 Ga0466969_0031452 Ga0466969_0031452_1187_1864 208
599 3300044666 Ga0466977_0356395 Ga0466977_0356395_156_782 208
600 3300044683 Ga0466965_0017394 Ga0466965_0017394_601_1227 208
601 3300044693 Ga0466961_0000028 Ga0466961_0000028_31729_32355 208
602 3300044706 Ga0466964_0027344 Ga0466964_0027344_1431_2057 208
603 3300044712 Ga0453684_0042921 Ga0453684_0042921_1373_2020 208
604 3300044712 Ga0453684_0536361 Ga0453684_0536361_176_823 208
605 3300044719 Ga0466971_0013057 Ga0466971_0013057_2034_2660 208
606 3300044735 Ga0466968_0009173 Ga0466968_0009173_1997_2623 208
607 3300044765 Ga0466970_0017001 Ga0466970_0017001_2214_2840 208
608 3300044901 Ga0466960_0062595 Ga0466960_0062595_548_1174 208
609 3300045049 Ga0466959_0107157 Ga0466959_0107157_613_1239 208
610 3300046452 Ga0495617_002042 Ga0495617_002042_5713_6345 208
611 3300046453 Ga0495627_000101 Ga0495627_000101_17508_18140 208
612 3300046453 Ga0495627_000101 Ga0495627_000101_46122_46754 208
613 3300046453 Ga0495627_000133 Ga0495627_000133_30786_31418 208
614 3300046453 Ga0495627_000133 Ga0495627_000133_55908_56540 208
615 3300046453 Ga0495627_000141 Ga0495627_000141_24536_25162 208
616 3300046453 Ga0495627_000624 Ga0495627_000624_21488_22120 208
617 3300046457 Ga0495590_0001183 Ga0495590_0001183_8622_9248 208
618 3300046457 Ga0495590_0011347 Ga0495590_0011347_1583_2212 208
619 3300046457 Ga0495590_0014819 Ga0495590_0014819_620_1252 208
620 3300046457 Ga0495590_0109123 Ga0495590_0109123_269_901 208
621 3300046458 Ga0495591_000082 Ga0495591_000082_40101_40733 208
622 3300046458 Ga0495591_000120 Ga0495591_000120_63565_64197 208
623 3300046458 Ga0495591_000618 Ga0495591_000618_192_818 208
624 3300046458 Ga0495591_003774 Ga0495591_003774_4661_5293 208
625 3300046458 Ga0495591_005827 Ga0495591_005827_3589_4215 208
626 3300046458 Ga0495591_006921 Ga0495591_006921_3198_3830 208
627 3300046458 Ga0495591_023707 Ga0495591_023707_495_1127 208
628 3300046460 Ga0495638_0005031 Ga0495638_0005031_4523_5152 208
629 3300046460 Ga0495638_0005146 Ga0495638_0005146_7794_8420 208
630 3300046460 Ga0495638_0015269 Ga0495638_0015269_2576_3208 208
631 3300046471 Ga0495650_0009781 Ga0495650_0009781_1863_2495 208
632 3300046474 Ga0495605_0001069 Ga0495605_0001069_9327_9953 208
633 3300046474 Ga0495605_0002868 Ga0495605_0002868_9813_10439 208
634 3300046474 Ga0495605_0003306 Ga0495605_0003306_1824_2453 208
635 3300046474 Ga0495605_0120567 Ga0495605_0120567_130_756 208
636 3300046491 Ga0495584_0000739 Ga0495584_0000739_15049_15681 208
637 3300046491 Ga0495584_0007072 Ga0495584_0007072_4295_4921 208
638 3300046491 Ga0495584_0011219 Ga0495584_0011219_936_1562 208
639 3300046491 Ga0495584_0028404 Ga0495584_0028404_1372_2004 208
640 3300046491 Ga0495584_0039536 Ga0495584_0039536_25_654 208
641 3300046491 Ga0495584_0044068 Ga0495584_0044068_1077_1706 208
642 3300046492 Ga0495585_0001688 Ga0495585_0001688_6905_7531 208
643 3300046492 Ga0495585_0075423 Ga0495585_0075423_28_660 208
644 3300046500 Ga0495596_0000058 Ga0495596_0000058_61128_61757 208
645 3300046500 Ga0495596_0003510 Ga0495596_0003510_406_1038 208
646 3300046500 Ga0495596_0004956 Ga0495596_0004956_153_785 208
647 3300046500 Ga0495596_0009510 Ga0495596_0009510_257_889 208
648 3300046500 Ga0495596_0009749 Ga0495596_0009749_3426_4058 208
649 3300046500 Ga0495596_0020487 Ga0495596_0020487_1098_1730 208
650 3300046501 Ga0495607_0000209 Ga0495607_0000209_26327_26959 208
651 3300046501 Ga0495607_0000517 Ga0495607_0000517_13384_14016 208
652 3300046501 Ga0495607_0003558 Ga0495607_0003558_4536_5168 208
653 3300046501 Ga0495607_0009070 Ga0495607_0009070_4346_4975 208
654 3300046501 Ga0495607_0014501 Ga0495607_0014501_1799_2428 208
655 3300046501 Ga0495607_0076480 Ga0495607_0076480_130_762 208
656 3300046501 Ga0495607_0111875 Ga0495607_0111875_627_1253 208
657 3300046501 Ga0495607_0284551 Ga0495607_0284551_102_734 208
658 3300046501 Ga0495607_0297737 Ga0495607_0297737_79_711 208
659 3300046506 Ga0495583_0000852 Ga0495583_0000852_8710_9336 208
660 3300046506 Ga0495583_0005886 Ga0495583_0005886_5693_6325 208
661 3300046506 Ga0495583_0005886 Ga0495583_0005886_57_689 208
662 3300046506 Ga0495583_0023359 Ga0495583_0023359_582_1211 208
663 3300046507 Ga0495606_0000634 Ga0495606_0000634_50792_51424 208
664 3300046507 Ga0495606_0000656 Ga0495606_0000656_10196_10828 208
665 3300046507 Ga0495606_0000965 Ga0495606_0000965_8370_8996 208
666 3300046507 Ga0495606_0003705 Ga0495606_0003705_14127_14759 208
667 3300046507 Ga0495606_0009752 Ga0495606_0009752_849_1478 208
668 3300046507 Ga0495606_0032404 Ga0495606_0032404_124_783 208
669 3300046507 Ga0495606_0034716 Ga0495606_0034716_476_1108 208
670 3300046512 Ga0495610_0000173 Ga0495610_0000173_48874_49506 208
671 3300046512 Ga0495610_0000563 Ga0495610_0000563_29484_30113 208
672 3300046512 Ga0495610_0001764 Ga0495610_0001764_8896_9522 208
673 3300046512 Ga0495610_0002756 Ga0495610_0002756_7033_7659 208
674 3300046512 Ga0495610_0005706 Ga0495610_0005706_6298_6930 208
675 3300046512 Ga0495610_0006280 Ga0495610_0006280_6040_6672 208
676 3300046512 Ga0495610_0024812 Ga0495610_0024812_2111_2737 208
677 3300046512 Ga0495610_0073590 Ga0495610_0073590_632_1264 208
678 3300046513 Ga0495616_0000041 Ga0495616_0000041_53497_54129 208
679 3300046513 Ga0495616_0000041 Ga0495616_0000041_78619_79251 208
680 3300046513 Ga0495616_0000166 Ga0495616_0000166_18231_18863 208
681 3300046513 Ga0495616_0004221 Ga0495616_0004221_6472_7101 208
682 3300046513 Ga0495616_0011508 Ga0495616_0011508_3496_4125 208
683 3300046515 Ga0495620_0003915 Ga0495620_0003915_7396_8028 208
684 3300046515 Ga0495620_0050319 Ga0495620_0050319_1069_1701 208
685 3300046518 Ga0495631_0000013 Ga0495631_0000013_58969_59601 208
686 3300046518 Ga0495631_0032002 Ga0495631_0032002_1705_2337 208
687 3300046518 Ga0495631_0084525 Ga0495631_0084525_484_1110 208
688 3300046519 Ga0495632_0000097 Ga0495632_0000097_68672_69304 208
689 3300046519 Ga0495632_0000475 Ga0495632_0000475_26074_26706 208
690 3300046519 Ga0495632_0000475 Ga0495632_0000475_952_1584 208
691 3300046519 Ga0495632_0012301 Ga0495632_0012301_3511_4143 208
692 3300046519 Ga0495632_0014299 Ga0495632_0014299_1494_2126 208
693 3300046519 Ga0495632_0098094 Ga0495632_0098094_144_776 208
694 3300046519 Ga0495632_0254226 Ga0495632_0254226_26_652 208
695 3300046520 Ga0495637_0001309 Ga0495637_0001309_2814_3446 208
696 3300046520 Ga0495637_0017909 Ga0495637_0017909_1519_2151 208
697 3300046520 Ga0495637_0030284 Ga0495637_0030284_628_1260 208
698 3300046520 Ga0495637_0038309 Ga0495637_0038309_307_933 208
699 3300046520 Ga0495637_0048735 Ga0495637_0048735_781_1407 208
700 3300046520 Ga0495637_0070329 Ga0495637_0070329_391_1023 208
701 3300046522 Ga0495643_0000625 Ga0495643_0000625_12311_12943 208
702 3300046522 Ga0495643_0000625 Ga0495643_0000625_40928_41560 208
703 3300046522 Ga0495643_0001821 Ga0495643_0001821_6117_6749 208
704 3300046522 Ga0495643_0153739 Ga0495643_0153739_147_773 208
705 3300046523 Ga0495644_0003352 Ga0495644_0003352_856_1488 208
706 3300046524 Ga0495648_0000172 Ga0495648_0000172_42630_43262 208
707 3300046524 Ga0495648_0001295 Ga0495648_0001295_180_806 208
708 3300046524 Ga0495648_0001927 Ga0495648_0001927_8343_8969 208
709 3300046524 Ga0495648_0004144 Ga0495648_0004144_9579_10211 208
710 3300046524 Ga0495648_0004767 Ga0495648_0004767_4392_5024 208
711 3300046524 Ga0495648_0006760 Ga0495648_0006760_336_968 208
712 3300046524 Ga0495648_0042903 Ga0495648_0042903_1431_2063 208
713 3300046524 Ga0495648_0075551 Ga0495648_0075551_265_897 208
714 3300046528 Ga0495642_0000670 Ga0495642_0000670_9336_9962 208
715 3300046528 Ga0495642_0009438 Ga0495642_0009438_2035_2664 208
716 3300046530 Ga0495654_0000104 Ga0495654_0000104_68957_69589 208
717 3300046530 Ga0495654_0000104 Ga0495654_0000104_94079_94711 208
718 3300046530 Ga0495654_0000353 Ga0495654_0000353_10491_11117 208
719 3300046530 Ga0495654_0003209 Ga0495654_0003209_4809_5435 208
720 3300046530 Ga0495654_0003366 Ga0495654_0003366_884_1510 208
721 3300046530 Ga0495654_0007391 Ga0495654_0007391_3501_4127 208
722 3300046530 Ga0495654_0008186 Ga0495654_0008186_3963_4595 208
723 3300046530 Ga0495654_0016695 Ga0495654_0016695_1146_1778 208
724 3300046530 Ga0495654_0034197 Ga0495654_0034197_740_1372 208
725 3300046530 Ga0495654_0092845 Ga0495654_0092845_717_1349 208
726 3300046530 Ga0495654_0104707 Ga0495654_0104707_240_872 208
727 3300046530 Ga0495654_0161252 Ga0495654_0161252_122_748 208
728 3300046538 Ga0495609_0000286 Ga0495609_0000286_34376_35008 208
729 3300046538 Ga0495609_0001705 Ga0495609_0001705_2697_3326 208
730 3300046538 Ga0495609_0002472 Ga0495609_0002472_9900_10529 208
731 3300046538 Ga0495609_0049806 Ga0495609_0049806_708_1340 208
732 3300046542 Ga0495597_0000117 Ga0495597_0000117_42967_43599 208
733 3300046542 Ga0495597_0000117 Ga0495597_0000117_67874_68506 208
734 3300046542 Ga0495597_0000560 Ga0495597_0000560_20734_21360 208
735 3300046542 Ga0495597_0006351 Ga0495597_0006351_4829_5455 208
736 3300046542 Ga0495597_0020676 Ga0495597_0020676_353_985 208
737 3300046542 Ga0495597_0031569 Ga0495597_0031569_1364_1990 208
738 3300046542 Ga0495597_0066529 Ga0495597_0066529_268_897 208
739 3300046542 Ga0495597_0144141 Ga0495597_0144141_132_761 208
740 3300046542 Ga0495597_0190612 Ga0495597_0190612_58_684 208
741 3300046557 Ga0495622_0000047 Ga0495622_0000047_58802_59434 208
742 3300046557 Ga0495622_0000047 Ga0495622_0000047_83715_84347 208
743 3300046557 Ga0495622_0135966 Ga0495622_0135966_402_1034 208
744 3300046557 Ga0495622_0257586 Ga0495622_0257586_65_697 208
745 3300046558 Ga0495633_0000564 Ga0495633_0000564_4389_5021 208
746 3300046616 Ga0495668_0010707 Ga0495668_0010707_2116_2748 208
747 3300046616 Ga0495668_0010888 Ga0495668_0010888_1836_2465 208
748 3300046616 Ga0495668_0015087 Ga0495668_0015087_387_1013 208
749 3300046648 Ga0495611_0000024 Ga0495611_0000024_56640_57272 208
750 3300046660 Ga0495625_0000103 Ga0495625_0000103_42479_43111 208
751 3300046660 Ga0495625_0000861 Ga0495625_0000861_19535_20167 208
752 3300046660 Ga0495625_0003017 Ga0495625_0003017_7337_7966 208
753 3300046660 Ga0495625_0006238 Ga0495625_0006238_245_874 208
754 3300046660 Ga0495625_0007003 Ga0495625_0007003_2745_3371 208
755 3300046660 Ga0495625_0007929 Ga0495625_0007929_7702_8334 208
756 3300046664 Ga0495659_0003039 Ga0495659_0003039_1051_1680 208
757 3300046665 Ga0495661_0005184 Ga0495661_0005184_3941_4570 208
758 3300046665 Ga0495661_0038532 Ga0495661_0038532_1918_2547 208
759 3300046665 Ga0495661_0095793 Ga0495661_0095793_23_655 208
760 3300046674 Ga0495588_0026797 Ga0495588_0026797_1528_2154 208
761 3300046684 Ga0495669_0012970 Ga0495669_0012970_2506_3135 208
762 3300046684 Ga0495669_0100189 Ga0495669_0100189_250_876 208
763 3300046684 Ga0495669_0148916 Ga0495669_0148916_153_782 208
764 3300046689 Ga0495613_0000001 Ga0495613_0000001_1171_1863 208
765 3300046690 Ga0495624_0037776 Ga0495624_0037776_894_1526 208
766 3300046691 Ga0495670_0000020 Ga0495670_0000020_59372_60004 208
767 3300046692 Ga0495671_0004837 Ga0495671_0004837_773_1402 208
768 3300046692 Ga0495671_0179470 Ga0495671_0179470_18_644 208
769 3300046692 Ga0495671_0202893 Ga0495671_0202893_79_711 208
770 3300046694 Ga0495649_0000108 Ga0495649_0000108_21250_21882 208
771 3300046694 Ga0495649_0000894 Ga0495649_0000894_3690_4322 208
772 3300046694 Ga0495649_0001346 Ga0495649_0001346_17869_18495 208
773 3300046694 Ga0495649_0007422 Ga0495649_0007422_3817_4446 208
774 3300046694 Ga0495649_0021658 Ga0495649_0021658_1130_1756 208
775 3300046694 Ga0495649_0028631 Ga0495649_0028631_2319_2945 208
776 3300046694 Ga0495649_0051256 Ga0495649_0051256_931_1560 208
777 3300046694 Ga0495649_0293715 Ga0495649_0293715_164_796 208
778 3300046794 Ga0495589_0000006 Ga0495589_0000006_120156_120782 208
779 3300046794 Ga0495589_0009008 Ga0495589_0009008_2849_3475 208
780 3300046794 Ga0495589_0011171 Ga0495589_0011171_418_1044 208
781 3300046794 Ga0495589_0013308 Ga0495589_0013308_2500_3126 208
782 3300046794 Ga0495589_0163821 Ga0495589_0163821_333_965 208
783 3300046810 Ga0495660_0001349 Ga0495660_0001349_10258_10890 208
784 3300046810 Ga0495660_0002399 Ga0495660_0002399_4299_4931 208
785 3300046810 Ga0495660_0004217 Ga0495660_0004217_1157_1789 208
786 3300046810 Ga0495660_0004243 Ga0495660_0004243_7967_8599 208
787 3300046810 Ga0495660_0013192 Ga0495660_0013192_2065_2697 208
788 3300046810 Ga0495660_0025582 Ga0495660_0025582_104_733 208
789 3300046810 Ga0495660_0040326 Ga0495660_0040326_403_1035 208
790 3300046810 Ga0495660_0112541 Ga0495660_0112541_310_939 208
791 3300047318 Ga0495636_0008837 Ga0495636_0008837_1584_2213 208
792 3300047320 Ga0495672_0003616 Ga0495672_0003616_9684_10316 208
793 3300047320 Ga0495672_0003859 Ga0495672_0003859_9183_9809 208
794 3300047320 Ga0495672_0012420 Ga0495672_0012420_5234_5860 208
795 3300047320 Ga0495672_0024227 Ga0495672_0024227_284_913 208
796 3300047320 Ga0495672_0029375 Ga0495672_0029375_812_1438 208
797 3300047320 Ga0495672_0043623 Ga0495672_0043623_1748_2374 208
798 3300047320 Ga0495672_0051954 Ga0495672_0051954_1093_1734 208
799 3300047321 Ga0495676_0000058 Ga0495676_0000058_15107_15739 208
800 3300047321 Ga0495676_0000058 Ga0495676_0000058_30586_31218 208
801 3300047323 Ga0495683_0000199 Ga0495683_0000199_8366_8992 208
802 3300047323 Ga0495683_0002985 Ga0495683_0002985_9265_9897 208
803 3300047445 Ga0495677_0003548 Ga0495677_0003548_1284_1913 208
804 3300047446 Ga0495679_000945 Ga0495679_000945_14600_15232 208
805 3300047446 Ga0495679_005691 Ga0495679_005691_3353_3979 208
806 3300047446 Ga0495679_006942 Ga0495679_006942_3957_4586 208
807 3300047446 Ga0495679_007151 Ga0495679_007151_1594_2226 208
808 3300047447 Ga0495685_016605 Ga0495685_016605_1270_1899 208
809 3300047447 Ga0495685_029585 Ga0495685_029585_1028_1657 208
810 3300047469 Ga0495673_0005992 Ga0495673_0005992_3424_4056 208
811 3300047469 Ga0495673_0006535 Ga0495673_0006535_446_1072 208
812 3300047469 Ga0495673_0007428 Ga0495673_0007428_2389_3021 208
813 3300047469 Ga0495673_0019474 Ga0495673_0019474_612_1244 208
814 3300047470 Ga0495681_0001171 Ga0495681_0001171_123_755 208
815 3300047470 Ga0495681_0001795 Ga0495681_0001795_8570_9196 208
816 3300047470 Ga0495681_0005497 Ga0495681_0005497_5280_5912 208
817 3300047470 Ga0495681_0010489 Ga0495681_0010489_3950_4579 208
818 3300047470 Ga0495681_0153462 Ga0495681_0153462_18_644 208
819 3300047472 Ga0495686_0000266 Ga0495686_0000266_14623_15255 208
820 3300047472 Ga0495686_0000266 Ga0495686_0000266_35430_36062 208
821 3300047472 Ga0495686_0002608 Ga0495686_0002608_9376_10002 208
822 3300047472 Ga0495686_0008113 Ga0495686_0008113_3580_4212 208
823 3300047472 Ga0495686_0011409 Ga0495686_0011409_3037_3663 208
824 3300047472 Ga0495686_0020167 Ga0495686_0020167_1109_1741 208
825 3300048091 Ga0495626_0000074 Ga0495626_0000074_64322_64954 208
826 3300048091 Ga0495626_0000074 Ga0495626_0000074_89444_90076 208
827 3300048091 Ga0495626_0000366 Ga0495626_0000366_46484_47116 208
828 3300048091 Ga0495626_0001013 Ga0495626_0001013_15388_16014 208
829 3300048091 Ga0495626_0002162 Ga0495626_0002162_6368_7000 208
830 3300048091 Ga0495626_0002404 Ga0495626_0002404_3012_3638 208
831 3300048091 Ga0495626_0031832 Ga0495626_0031832_914_1546 208
832 3300048091 Ga0495626_0064485 Ga0495626_0064485_984_1616 208
833 3300048907 Ga0496104_0000368 Ga0496104_0000368_1277_1903 208
834 3300048917 Ga0496114_0136116 Ga0496114_0136116_814_1440 208
835 3300048919 Ga0496116_0000031 Ga0496116_0000031_117336_117962 208
836 3300048919 Ga0496116_0000255 Ga0496116_0000255_14274_14906 208
837 3300048919 Ga0496116_0001333 Ga0496116_0001333_6125_6757 208
838 3300048919 Ga0496116_0004739 Ga0496116_0004739_11890_12519 208
839 3300048919 Ga0496116_0043455 Ga0496116_0043455_2341_2979 208
840 3300048919 Ga0496116_0061807 Ga0496116_0061807_598_1224 208
841 3300048920 Ga0496117_0006088 Ga0496117_0006088_8141_8776 208
842 3300048920 Ga0496117_0007023 Ga0496117_0007023_2389_3015 208
843 3300048921 Ga0496118_0041857 Ga0496118_0041857_2244_2870 208
844 3300048922 Ga0496119_0000258 Ga0496119_0000258_33677_34303 208
845 3300048922 Ga0496119_0015888 Ga0496119_0015888_2882_3508 208
846 3300048923 Ga0496120_0000228 Ga0496120_0000228_46269_46895 208
847 3300048923 Ga0496120_0000255 Ga0496120_0000255_47280_48002 208
848 3300048923 Ga0496120_0014871 Ga0496120_0014871_2416_3042 208
849 3300048924 Ga0496121_0000140 Ga0496121_0000140_45112_45738 208
850 3300048924 Ga0496121_0009355 Ga0496121_0009355_3300_3929 208
851 3300048924 Ga0496121_0315061 Ga0496121_0315061_196_822 208
852 3300048925 Ga0496122_0000908 Ga0496122_0000908_31680_32309 208
853 3300048925 Ga0496122_0011350 Ga0496122_0011350_4738_5370 208
854 3300048925 Ga0496122_0018888 Ga0496122_0018888_5661_6299 208
855 3300048925 Ga0496122_0143043 Ga0496122_0143043_809_1456 208
856 3300048925 Ga0496122_0190743 Ga0496122_0190743_130_756 208
857 3300048926 Ga0496123_0000412 Ga0496123_0000412_58509_59138 208
858 3300048926 Ga0496123_0007217 Ga0496123_0007217_6826_7452 208
859 3300048926 Ga0496123_0022316 Ga0496123_0022316_3647_4279 208
860 3300048926 Ga0496123_0069202 Ga0496123_0069202_1549_2187 208
861 3300048927 Ga0496124_0000013 Ga0496124_0000013_380204_380830 208
862 3300048927 Ga0496124_0000122 Ga0496124_0000122_83533_84159 208
863 3300048927 Ga0496124_0025233 Ga0496124_0025233_1418_2053 208
864 3300048927 Ga0496124_0032726 Ga0496124_0032726_1412_2038 208
865 3300048927 Ga0496124_0053134 Ga0496124_0053134_1505_2152 208
866 3300048928 Ga0496125_0000016 Ga0496125_0000016_8089_8736 208
867 3300048928 Ga0496125_0000190 Ga0496125_0000190_92924_93550 208
868 3300048928 Ga0496125_0005878 Ga0496125_0005878_9160_9792 208
869 3300048928 Ga0496125_0009349 Ga0496125_0009349_6532_7158 208
870 3300048928 Ga0496125_0026879 Ga0496125_0026879_1977_2603 208
871 3300048928 Ga0496125_0070390 Ga0496125_0070390_29_667 208
872 3300048929 Ga0496126_0007121 Ga0496126_0007121_9738_10364 208
873 3300048929 Ga0496126_0011107 Ga0496126_0011107_6439_7077 208
874 3300048929 Ga0496126_0116878 Ga0496126_0116878_1536_2162 208
875 3300049129 Ga0501309_003594 Ga0501309_003594_865_1491 208
876 3300049160 Ga0501304_017235 Ga0501304_017235_23_670 208
877 3300049161 Ga0501305_004359 Ga0501305_004359_837_1463 208
878 3300049459 Ga0495678_000222 Ga0495678_000222_3623_4255 208
879 3300049459 Ga0495678_000359 Ga0495678_000359_25286_25918 208
880 3300049459 Ga0495678_000500 Ga0495678_000500_24951_25583 208
881 3300049459 Ga0495678_029021 Ga0495678_029021_389_1015 208
882 3300049460 Ga0495682_0001555 Ga0495682_0001555_2768_3394 208
883 3300049528 Ga0501312_002565 Ga0501312_002565_1110_1736 208
884 3300049569 Ga0501032_0402812 Ga0501032_0402812_164_790 208
885 3300049570 Ga0501033_0083798 Ga0501033_0083798_1194_1826 208
886 3300049571 Ga0501034_0003332 Ga0501034_0003332_6338_6964 208
887 3300049758 Ga0501241_000247 Ga0501241_000247_8629_9261 208
888 3300049766 Ga0501269_001191 Ga0501269_001191_1951_2583 208
889 3300049823 Ga0501044_0458963 Ga0501044_0458963_22_654 208
890 3300050489 nmdc:mga03683_251448_c1 nmdc:mga03683_251448_c1_140_766 208
891 3300050491 nmdc:mga00v17_527_c1 nmdc:mga00v17_527_c1_18841_19470 208
892 3300050511 nmdc:mga08y16_176298_c1 nmdc:mga08y16_176298_c1_461_1093 208
893 3300050516 nmdc:mga0sz30_18806_c1 nmdc:mga0sz30_18806_c1_301_927 208
894 iso_pu_bacteria 2643221569 2643863425 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

17

162

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9435 3 201
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9411 2 204
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9403 3 201
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9323 2 204
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9255 3 201
ID Description Score Start End Superfamily
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.939 3 201 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9208 3 201 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9033 7 186 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8761 6 186 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8625 6 190 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A1C7N270-F1-model_v4 Uncharacterized protein YcaC 0.9596 4 150
AF-A0A6N6RNM2-F1-model_v4 Isochorismatase family protein 0.9581 6 179
AF-G9MWN6-F1-model_v4 Isochorismatase-like domain-containing protein 0.9581 3 178
AF-A0A4U3AM91-F1-model_v4 deleted 0.9568 19 154
AF-A0A1E4EGZ0-F1-model_v4 Hydrolase 0.9561 1 178 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map