F484837

General Info

Members Datasets Scaffolds Average Seq Length
890 419 841 291

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_001412|Ga0500643_001412_7571_8398
Length 275
Sequence MSLKDRTLFITGASRGIGKAIALRAARDGANIVVAAKTAEENAKLEGTIHSAAREIEAAGGRALAIQLDIRDDAAIAVAMKQAAERFGGIDVLVNNASAISLTGTLATPMKRFDLMLGVNARGTFACSQAAIPYLRKSANPHVLTLSPPLNLKPAWLKDHVAYTYSKYGMSFCTMGMAEEFRAEGIAFNSLWPRTIIDTAALRMIPGIDVKKARRPEILSDAAYAILNRPSRECTGNFFIDDQVLASAGIRDLAAYSVQPGAQDLHLDLFVDPVT

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
15 2791355199
16 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
17 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
18 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
19 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
20 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
21 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
24 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
25 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
26 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
27 2904699407
28 2906610324
29 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
30 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
31 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
32 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
33 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
34 2922425934
35 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
36 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
37 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
38 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
39 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
133 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
221 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
246 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
333 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
389 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
390 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
391 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
392 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
393 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
396 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
404 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
407 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
408 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
409 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
412 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
413 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
414 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
415 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
416 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
417 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
418 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
419 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0.11
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 4.38
Rhizoplane 7.3
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000570 3300001979 Bacteria 15869
2 JGI24737J22298_10004785 3300001990 Bacteria 4702
3 JGI25406J46586_10000241 3300003203 Bacteria 24433
4 JGI25406J46586_10013397 3300003203 Bacteria 3524
5 JGI25404J52841_10004528 3300003659 Bacteria 2824
6 JGI25404J52841_10007061 3300003659 Bacteria 2366
7 JGI25404J52841_10007351 3300003659 Bacteria 2328
8 JGI25404J52841_10007389 3300003659 Bacteria 2322
9 Ga0070658_10001807 3300005327 Bacteria 17987
10 Ga0070683_100037797 3300005329 Bacteria 4420
11 Ga0070683_100225403 3300005329 Bacteria 1781
12 Ga0070690_100000228 3300005330 Bacteria 29057
13 Ga0068869_100000350 3300005334 Bacteria 24670
14 Ga0068869_100072897 3300005334 Bacteria 2545
15 Ga0070680_100000306 3300005336 Bacteria 32712
16 Ga0070680_100061102 3300005336 Bacteria 3084
17 Ga0070680_100596326 3300005336 Bacteria 948
18 Ga0070682_100252250 3300005337 Bacteria 1273
19 Ga0070682_100309236 3300005337 Bacteria 1163
20 Ga0068868_100000207 3300005338 Bacteria 39850
21 Ga0070660_100166384 3300005339 Bacteria 1779
22 Ga0070660_100357109 3300005339 Bacteria 1204
23 Ga0070689_100018355 3300005340 Bacteria 5152
24 Ga0070691_10001525 3300005341 Bacteria 9955
25 Ga0070687_100000055 3300005343 Bacteria 36871
26 Ga0070661_100096527 3300005344 Bacteria 2193
27 Ga0070661_100117627 3300005344 Bacteria 1988
28 Ga0070692_10000296 3300005345 Bacteria 14110
29 Ga0070668_100046241 3300005347 Bacteria 3341
30 Ga0070668_100120400 3300005347 Bacteria 2097
31 Ga0070668_100297631 3300005347 Bacteria 1352
32 Ga0070668_100305617 3300005347 Bacteria 1335
33 Ga0070675_100340193 3300005354 Bacteria 1329
34 Ga0070671_100035152 3300005355 Bacteria 4151
35 Ga0070671_100067099 3300005355 Bacteria 2991
36 Ga0070671_100218788 3300005355 Bacteria 1616
37 Ga0070671_100314254 3300005355 Bacteria 1335
38 Ga0070674_100042324 3300005356 Bacteria 3093
39 Ga0070674_100056310 3300005356 Bacteria 2726
40 Ga0070674_100424577 3300005356 Bacteria 1091
41 Ga0070673_100367322 3300005364 Bacteria 1280
42 Ga0070659_100016139 3300005366 Bacteria 5604
43 Ga0070659_100105951 3300005366 Bacteria 2266
44 Ga0070659_100307266 3300005366 Bacteria 1324
45 Ga0070703_10011767 3300005406 Bacteria 2475
46 Ga0070709_10000409 3300005434 Bacteria 26244
47 Ga0070709_10031279 3300005434 Bacteria 3201
48 Ga0070709_10064221 3300005434 Bacteria 2347
49 Ga0070709_10240437 3300005434 Bacteria 1300
50 Ga0070714_100000597 3300005435 Bacteria 25798
51 Ga0070714_100092250 3300005435 Bacteria 2654
52 Ga0070713_100095939 3300005436 Bacteria 2559
53 Ga0070710_10000191 3300005437 Bacteria 28564
54 Ga0070710_10000880 3300005437 Bacteria 14380
55 Ga0070710_10103186 3300005437 Bacteria 1702
56 Ga0070701_10001180 3300005438 Bacteria 9582
57 Ga0070711_100000851 3300005439 Bacteria 16059
58 Ga0070711_100007845 3300005439 Bacteria 6506
59 Ga0070705_100000161 3300005440 Bacteria 39283
60 Ga0070705_100002001 3300005440 Bacteria 10418
61 Ga0070700_100000137 3300005441 Bacteria 43712
62 Ga0070700_100000998 3300005441 Bacteria 13957
63 Ga0070694_100000106 3300005444 Bacteria 40466
64 Ga0070694_100007725 3300005444 Bacteria 6561
65 Ga0070694_100026302 3300005444 Bacteria 3770
66 Ga0070694_100124203 3300005444 Bacteria 1856
67 Ga0070663_100004604 3300005455 Bacteria 8122
68 Ga0070663_100076375 3300005455 Bacteria 2450
69 Ga0070663_100229337 3300005455 Bacteria 1462
70 Ga0070663_100307637 3300005455 Bacteria 1271
71 Ga0070678_100027488 3300005456 Bacteria 3863
72 Ga0070662_100038283 3300005457 Bacteria 3406
73 Ga0070681_10019890 3300005458 Bacteria 6727
74 Ga0070681_10139496 3300005458 Bacteria 2354
75 Ga0070681_10189290 3300005458 Bacteria 1978
76 Ga0070681_10255009 3300005458 Bacteria 1666
77 Ga0068867_100000230 3300005459 Bacteria 36554
78 Ga0070685_10098273 3300005466 Bacteria 1783
79 Ga0070707_100125368 3300005468 Bacteria 2494
80 Ga0070707_100178214 3300005468 Bacteria 2072
81 Ga0070698_100025240 3300005471 Bacteria 6192
82 Ga0070698_100410792 3300005471 Bacteria 1287
83 Ga0070699_100000836 3300005518 Bacteria 28545
84 Ga0070679_100008011 3300005530 Bacteria 9922
85 Ga0070679_100034506 3300005530 Bacteria 5014
86 Ga0070679_100054833 3300005530 Bacteria 3969
87 Ga0070679_100070822 3300005530 Bacteria 3478
88 Ga0070679_100316216 3300005530 Bacteria 1511
89 Ga0070697_100029852 3300005536 Bacteria 4376
90 Ga0070697_100080131 3300005536 Bacteria 2689
91 Ga0068853_100021754 3300005539 Bacteria 5350
92 Ga0068853_100022948 3300005539 Bacteria 5218
93 Ga0068853_100028465 3300005539 Bacteria 4700
94 Ga0068853_100097555 3300005539 Bacteria 2595
95 Ga0068853_100240107 3300005539 Bacteria 1660
96 Ga0068853_100302820 3300005539 Bacteria 1478
97 Ga0068853_100650114 3300005539 Bacteria 1003
98 Ga0070672_100253068 3300005543 Bacteria 1484
99 Ga0070672_100412787 3300005543 Bacteria 1158
100 Ga0070686_100000546 3300005544 Bacteria 22497
101 Ga0070695_100000200 3300005545 Bacteria 29051
102 Ga0070695_100043789 3300005545 Bacteria 2848
103 Ga0070696_100000189 3300005546 Bacteria 36155
104 Ga0070696_100001033 3300005546 Bacteria 17993
105 Ga0070693_100000170 3300005547 Bacteria 30410
106 Ga0070665_100014247 3300005548 Bacteria 7985
107 Ga0070665_100022311 3300005548 Bacteria 6370
108 Ga0070665_100024863 3300005548 Bacteria 6035
109 Ga0070665_100057086 3300005548 Bacteria 3914
110 Ga0070665_100160327 3300005548 Bacteria 2251
111 Ga0070665_100227451 3300005548 Bacteria 1865
112 Ga0070704_100000028 3300005549 Bacteria 47635
113 Ga0068855_100002784 3300005563 Bacteria 21521
114 Ga0068855_100033709 3300005563 Bacteria 6109
115 Ga0068855_100136247 3300005563 Bacteria 2801
116 Ga0070664_100189368 3300005564 Bacteria 1833
117 Ga0068857_100009318 3300005577 Bacteria 8523
118 Ga0068857_100016536 3300005577 Bacteria 6463
119 Ga0068857_100017840 3300005577 Bacteria 6224
120 Ga0068857_100090238 3300005577 Bacteria 2742
121 Ga0068857_100095293 3300005577 Bacteria 2666
122 Ga0068857_100224233 3300005577 Bacteria 1718
123 Ga0068854_100003786 3300005578 Bacteria 9459
124 Ga0068854_100012220 3300005578 Bacteria 5618
125 Ga0068854_100022987 3300005578 Bacteria 4254
126 Ga0068854_100043384 3300005578 Bacteria 3188
127 Ga0068854_100112458 3300005578 Bacteria 2056
128 Ga0068854_100244220 3300005578 Bacteria 1431
129 Ga0068856_100002838 3300005614 Bacteria 17741
130 Ga0068856_100038677 3300005614 Bacteria 4683
131 Ga0068856_100074451 3300005614 Bacteria 3362
132 Ga0068856_100245193 3300005614 Bacteria 1807
133 Ga0070702_100000089 3300005615 Bacteria 26944
134 Ga0070702_100010659 3300005615 Bacteria 4539
135 Ga0068852_100034244 3300005616 Bacteria 4223
136 Ga0068852_100034788 3300005616 Bacteria 4196
137 Ga0068852_100231241 3300005616 Bacteria 1762
138 Ga0068859_100001708 3300005617 Bacteria 22385
139 Ga0068859_100102722 3300005617 Bacteria 2916
140 Ga0068864_100044923 3300005618 Bacteria 3788
141 Ga0068864_100209235 3300005618 Bacteria 1795
142 Ga0068864_100322955 3300005618 Bacteria 1450
143 Ga0068866_10003103 3300005718 Bacteria 6846
144 Ga0068866_10133392 3300005718 Bacteria 1416
145 Ga0068861_100001248 3300005719 Bacteria 15859
146 Ga0068851_10000402 3300005834 Bacteria 19592
147 Ga0068870_10034857 3300005840 Bacteria 2578
148 Ga0068863_100421635 3300005841 Bacteria 1307
149 Ga0068858_100001236 3300005842 Bacteria 26391
150 Ga0068858_100171384 3300005842 Bacteria 2046
151 Ga0068858_100222799 3300005842 Bacteria 1787
152 Ga0068860_100000433 3300005843 Bacteria 53218
153 Ga0068860_100000926 3300005843 Bacteria 32568
154 Ga0068860_100004410 3300005843 Bacteria 14375
155 Ga0068860_100031878 3300005843 Bacteria 5067
156 Ga0068860_100537803 3300005843 Bacteria 1169
157 Ga0068862_100000934 3300005844 Bacteria 28188
158 Ga0068862_100003737 3300005844 Bacteria 12990
159 Ga0068862_100195807 3300005844 Bacteria 1820
160 Ga0068862_100338283 3300005844 Bacteria 1393
161 Ga0081455_10000230 3300005937 Bacteria 72112
162 Ga0081455_10005195 3300005937 Bacteria 14318
163 Ga0081455_10014288 3300005937 Bacteria 7791
164 Ga0081455_10105341 3300005937 Bacteria 2254
165 Ga0081540_1002478 3300005983 Bacteria 15036
166 Ga0081540_1003002 3300005983 Bacteria 13529
167 Ga0081540_1003538 3300005983 Bacteria 12308
168 Ga0081540_1010331 3300005983 Bacteria 6331
169 Ga0081540_1016558 3300005983 Bacteria 4606
170 Ga0081540_1021616 3300005983 Bacteria 3824
171 Ga0081540_1028192 3300005983 Bacteria 3160
172 Ga0081540_1034870 3300005983 Bacteria 2706
173 Ga0081540_1036882 3300005983 Bacteria 2600
174 Ga0081540_1037256 3300005983 Bacteria 2581
175 Ga0081539_10000064 3300005985 Bacteria 247020
176 Ga0081539_10004421 3300005985 Bacteria 15548
177 Ga0081539_10046439 3300005985 Bacteria 2489
178 Ga0081539_10131132 3300005985 Bacteria 1231
179 Ga0070717_10002236 3300006028 Bacteria 13563
180 Ga0070717_10110826 3300006028 Bacteria 2341
181 Ga0075365_10020178 3300006038 Bacteria 4127
182 Ga0075368_10019963 3300006042 Bacteria 2533
183 Ga0075368_10049264 3300006042 Bacteria 1671
184 Ga0075363_100045503 3300006048 Bacteria 2327
185 Ga0075363_100134716 3300006048 Bacteria 1387
186 Ga0075432_10109043 3300006058 Bacteria 1030
187 Ga0070715_10002923 3300006163 Bacteria 5335
188 Ga0070716_100009934 3300006173 Bacteria 4759
189 Ga0070716_100051286 3300006173 Bacteria 2345
190 Ga0070716_100081810 3300006173 Bacteria 1929
191 Ga0070712_100261001 3300006175 Bacteria 1388
192 Ga0075362_10058990 3300006177 Bacteria 1732
193 Ga0075367_10008366 3300006178 Bacteria 5359
194 Ga0097621_100007162 3300006237 Bacteria 7952
195 Ga0097621_100046443 3300006237 Bacteria 3514
196 Ga0068871_100000322 3300006358 Bacteria 33363
197 Ga0075428_100007574 3300006844 Bacteria 12030
198 Ga0075428_100108955 3300006844 Bacteria 3018
199 Ga0075428_100447024 3300006844 Bacteria 1384
200 Ga0075430_100043772 3300006846 Bacteria 3785
201 Ga0075431_100043785 3300006847 Bacteria 4617
202 Ga0075433_10001174 3300006852 Bacteria 19047
203 Ga0075433_10169168 3300006852 Bacteria 1945
204 Ga0075434_100011494 3300006871 Bacteria 8353
205 Ga0075434_100039303 3300006871 Bacteria 4688
206 Ga0075434_100146177 3300006871 Bacteria 2385
207 Ga0075429_100119058 3300006880 Bacteria 2307
208 Ga0068865_100000108 3300006881 Bacteria 42603
209 Ga0097620_100001708 3300006931 Bacteria 22385
210 Ga0097620_100102716 3300006931 Bacteria 2916
211 Ga0099824_1004053 3300006942 Bacteria 21200
212 Ga0099822_1000007 3300006943 Bacteria 77453
213 Ga0075435_100160360 3300007076 Bacteria 1894
214 Ga0099794_10014507 3300007265 Bacteria 3454
215 Ga0099795_10007946 3300007788 Bacteria 2993
216 Ga0099795_10032687 3300007788 Bacteria 1801
217 Ga0099795_10079999 3300007788 Bacteria 1249
218 Ga0099795_10112859 3300007788 Bacteria 1079
219 Ga0105250_10024567 3300009092 Bacteria 2428
220 Ga0105240_10001597 3300009093 Bacteria 38497
221 Ga0105240_10004430 3300009093 Bacteria 21410
222 Ga0105240_10008378 3300009093 Bacteria 14796
223 Ga0105240_10021247 3300009093 Bacteria 8638
224 Ga0105240_10104006 3300009093 Bacteria 3449
225 Ga0105240_10187454 3300009093 Bacteria 2435
226 Ga0105240_10748804 3300009093 Bacteria 1062
227 Ga0111539_10488979 3300009094 Bacteria 1433
228 Ga0105245_10000481 3300009098 Bacteria 36561
229 Ga0105245_10044805 3300009098 Bacteria 3949
230 Ga0105245_10271604 3300009098 Bacteria 1654
231 Ga0105247_10120819 3300009101 Bacteria 1697
232 Ga0114129_10028708 3300009147 Bacteria 7883
233 Ga0114129_10455552 3300009147 Bacteria 1677
234 Ga0105243_10000575 3300009148 Bacteria 36969
235 Ga0105243_10197565 3300009148 Bacteria 1762
236 Ga0105241_10017805 3300009174 Bacteria 5225
237 Ga0105241_10026741 3300009174 Bacteria 4295
238 Ga0105241_10028964 3300009174 Bacteria 4128
239 Ga0105241_10156616 3300009174 Bacteria 1869
240 Ga0105241_10226545 3300009174 Bacteria 1574
241 Ga0105241_10293797 3300009174 Bacteria 1392
242 Ga0105242_10000342 3300009176 Bacteria 37655
243 Ga0105248_10065189 3300009177 Bacteria 4090
244 Ga0105248_10170084 3300009177 Bacteria 2456
245 Ga0105237_10059559 3300009545 Bacteria 3820
246 Ga0105237_10081851 3300009545 Bacteria 3219
247 Ga0105237_10267871 3300009545 Bacteria 1711
248 Ga0105237_10331659 3300009545 Bacteria 1526
249 Ga0105237_10489285 3300009545 Bacteria 1237
250 Ga0105238_10006342 3300009551 Bacteria 11762
251 Ga0105238_10007309 3300009551 Bacteria 11059
252 Ga0105238_10009143 3300009551 Bacteria 9918
253 Ga0105238_10014918 3300009551 Bacteria 7865
254 Ga0105238_10028317 3300009551 Bacteria 5710
255 Ga0105238_10077621 3300009551 Bacteria 3312
256 Ga0105238_10676724 3300009551 Bacteria 1043
257 Ga0105249_10003783 3300009553 Bacteria 13067
258 Ga0105249_10029065 3300009553 Bacteria 4991
259 Ga0099796_10000761 3300010159 Bacteria 5776
260 Ga0105239_10020173 3300010375 Bacteria 7353
261 Ga0105239_10029909 3300010375 Bacteria 5991
262 Ga0105239_10032328 3300010375 Bacteria 5750
263 Ga0105239_10081518 3300010375 Bacteria 3561
264 Ga0105239_10083019 3300010375 Bacteria 3528
265 Ga0105239_10116920 3300010375 Bacteria 2959
266 Ga0105239_10123837 3300010375 Bacteria 2872
267 Ga0105239_10324481 3300010375 Bacteria 1736
268 Ga0105239_10563582 3300010375 Bacteria 1298
269 Ga0105239_10819389 3300010375 Bacteria 1067
270 Ga0105246_10114144 3300011119 Bacteria 1990
271 Ga0157370_10354215 3300013104 Bacteria 1353
272 Ga0157369_10038612 3300013105 Bacteria 5220
273 Ga0157369_10109012 3300013105 Bacteria 2945
274 Ga0157374_10006943 3300013296 Bacteria 9631
275 Ga0157378_10000365 3300013297 Bacteria 44708
276 Ga0157378_10085942 3300013297 Bacteria 2851
277 Ga0157378_10139529 3300013297 Bacteria 2250
278 Ga0163162_10013288 3300013306 Bacteria 8042
279 Ga0163162_10093948 3300013306 Bacteria 3085
280 Ga0157375_10120330 3300013308 Bacteria 2734
281 Ga0163163_10045070 3300014325 Bacteria 4328
282 Ga0163163_10075450 3300014325 Bacteria 3365
283 Ga0163163_10764770 3300014325 Bacteria 1029
284 Ga0157380_10065341 3300014326 Bacteria 2924
285 Ga0157379_10383884 3300014968 Bacteria 1289
286 Ga0157379_10388965 3300014968 Bacteria 1281
287 Ga0157376_10002020 3300014969 Bacteria 13604
288 Ga0157376_10053794 3300014969 Bacteria 3354
289 Ga0157376_10079948 3300014969 Bacteria 2803
290 Ga0157376_10348463 3300014969 Bacteria 1416
291 Ga0163161_10080958 3300017792 Bacteria 2391
292 Ga0213876_10002040 3300021384 Bacteria 11998
293 Ga0209758_1017728 3300025297 Bacteria 3526
294 Ga0209758_1020717 3300025297 Bacteria 3096
295 Ga0207656_10003907 3300025321 Bacteria 5163
296 Ga0207653_10011526 3300025885 Bacteria 2758
297 Ga0207692_10000493 3300025898 Bacteria 13965
298 Ga0207692_10002127 3300025898 Bacteria 7560
299 Ga0207642_10001661 3300025899 Bacteria 6866
300 Ga0207642_10151408 3300025899 Bacteria 1235
301 Ga0207688_10079684 3300025901 Bacteria 1868
302 Ga0207647_10004518 3300025904 Bacteria 10306
303 Ga0207647_10010711 3300025904 Bacteria 6458
304 Ga0207699_10000145 3300025906 Bacteria 46647
305 Ga0207699_10003326 3300025906 Bacteria 7664
306 Ga0207699_10124561 3300025906 Bacteria 1672
307 Ga0207699_10125180 3300025906 Bacteria 1668
308 Ga0207645_10036807 3300025907 Bacteria 3142
309 Ga0207643_10029932 3300025908 Bacteria 3029
310 Ga0207684_10353589 3300025910 Bacteria 1264
311 Ga0207654_10000058 3300025911 Bacteria 75628
312 Ga0207654_10036015 3300025911 Bacteria 2762
313 Ga0207654_10061904 3300025911 Bacteria 2191
314 Ga0207707_10000818 3300025912 Bacteria 30499
315 Ga0207707_10001462 3300025912 Bacteria 21837
316 Ga0207707_10039291 3300025912 Bacteria 4137
317 Ga0207707_10051302 3300025912 Bacteria 3592
318 Ga0207707_10178818 3300025912 Bacteria 1852
319 Ga0207707_10248631 3300025912 Bacteria 1545
320 Ga0207707_10295727 3300025912 Bacteria 1401
321 Ga0207695_10000453 3300025913 Bacteria 89314
322 Ga0207695_10024634 3300025913 Bacteria 6761
323 Ga0207695_10272735 3300025913 Bacteria 1587
324 Ga0207695_10285615 3300025913 Bacteria 1543
325 Ga0207671_10013631 3300025914 Bacteria 6464
326 Ga0207671_10065046 3300025914 Bacteria 2712
327 Ga0207671_10075209 3300025914 Bacteria 2525
328 Ga0207671_10151806 3300025914 Bacteria 1790
329 Ga0207693_10001606 3300025915 Bacteria 20003
330 Ga0207693_10016445 3300025915 Bacteria 5910
331 Ga0207693_10022371 3300025915 Bacteria 5024
332 Ga0207693_10242097 3300025915 Bacteria 1416
333 Ga0207663_10000390 3300025916 Bacteria 19024
334 Ga0207663_10243466 3300025916 Bacteria 1320
335 Ga0207660_10001409 3300025917 Bacteria 16130
336 Ga0207660_10001663 3300025917 Bacteria 14898
337 Ga0207660_10160795 3300025917 Bacteria 1732
338 Ga0207662_10000122 3300025918 Bacteria 37342
339 Ga0207662_10306421 3300025918 Bacteria 1057
340 Ga0207657_10001095 3300025919 Bacteria 28754
341 Ga0207657_10008750 3300025919 Bacteria 10246
342 Ga0207652_10003169 3300025921 Bacteria 13699
343 Ga0207652_10006226 3300025921 Bacteria 9635
344 Ga0207652_10028827 3300025921 Bacteria 4634
345 Ga0207652_10041550 3300025921 Bacteria 3909
346 Ga0207652_10066553 3300025921 Bacteria 3123
347 Ga0207652_10301643 3300025921 Bacteria 1446
348 Ga0207646_10154033 3300025922 Bacteria 2073
349 Ga0207646_10326769 3300025922 Bacteria 1386
350 Ga0207694_10000564 3300025924 Bacteria 33580
351 Ga0207694_10023140 3300025924 Bacteria 4717
352 Ga0207694_10084582 3300025924 Bacteria 2495
353 Ga0207694_10165683 3300025924 Bacteria 1787
354 Ga0207687_10000178 3300025927 Bacteria 41733
355 Ga0207687_10415182 3300025927 Bacteria 1110
356 Ga0207664_10000131 3300025929 Bacteria 65529
357 Ga0207664_10025264 3300025929 Bacteria 4472
358 Ga0207664_10415313 3300025929 Bacteria 1198
359 Ga0207644_10077473 3300025931 Bacteria 2448
360 Ga0207690_10000308 3300025932 Bacteria 33627
361 Ga0207690_10005794 3300025932 Bacteria 7307
362 Ga0207690_10101022 3300025932 Bacteria 2060
363 Ga0207690_10428836 3300025932 Bacteria 1059
364 Ga0207706_10067990 3300025933 Bacteria 3136
365 Ga0207706_10117341 3300025933 Bacteria 2341
366 Ga0207686_10000838 3300025934 Bacteria 18676
367 Ga0207686_10046294 3300025934 Bacteria 2682
368 Ga0207709_10002153 3300025935 Bacteria 12611
369 Ga0207709_10364651 3300025935 Bacteria 1095
370 Ga0207670_10008018 3300025936 Bacteria 5936
371 Ga0207669_10017701 3300025937 Bacteria 3662
372 Ga0207669_10309509 3300025937 Bacteria 1204
373 Ga0207704_10010347 3300025938 Bacteria 4547
374 Ga0207665_10000444 3300025939 Bacteria 28370
375 Ga0207665_10026200 3300025939 Bacteria 3848
376 Ga0207665_10037525 3300025939 Bacteria 3225
377 Ga0207665_10165683 3300025939 Bacteria 1593
378 Ga0207691_10033936 3300025940 Bacteria 4750
379 Ga0207691_10408155 3300025940 Bacteria 1158
380 Ga0207711_10128429 3300025941 Bacteria 2270
381 Ga0207689_10000535 3300025942 Bacteria 36056
382 Ga0207689_10082533 3300025942 Bacteria 2643
383 Ga0207661_10037684 3300025944 Bacteria 3784
384 Ga0207661_10228839 3300025944 Bacteria 1646
385 Ga0207679_10036408 3300025945 Bacteria 3490
386 Ga0207667_10009339 3300025949 Bacteria 11566
387 Ga0207667_10014006 3300025949 Bacteria 9157
388 Ga0207667_10018267 3300025949 Bacteria 7870
389 Ga0207667_10037421 3300025949 Bacteria 5186
390 Ga0207667_10201536 3300025949 Bacteria 2041
391 Ga0207667_10437837 3300025949 Bacteria 1329
392 Ga0207712_10004784 3300025961 Bacteria 8552
393 Ga0207712_10015222 3300025961 Bacteria 4958
394 Ga0207668_10014433 3300025972 Bacteria 4889
395 Ga0207668_10339612 3300025972 Bacteria 1252
396 Ga0207668_10394418 3300025972 Bacteria 1168
397 Ga0207640_10015461 3300025981 Bacteria 4418
398 Ga0207640_10021908 3300025981 Bacteria 3816
399 Ga0207640_10034634 3300025981 Bacteria 3153
400 Ga0207640_10139644 3300025981 Bacteria 1764
401 Ga0207640_10175336 3300025981 Bacteria 1602
402 Ga0207677_10001104 3300026023 Bacteria 14730
403 Ga0207703_10009082 3300026035 Bacteria 7827
404 Ga0207703_10177174 3300026035 Bacteria 1879
405 Ga0207703_10392333 3300026035 Bacteria 1286
406 Ga0207639_10001424 3300026041 Bacteria 16178
407 Ga0207639_10008949 3300026041 Bacteria 6891
408 Ga0207639_10016555 3300026041 Bacteria 5219
409 Ga0207639_10134168 3300026041 Bacteria 2054
410 Ga0207639_10210909 3300026041 Bacteria 1672
411 Ga0207639_10224901 3300026041 Bacteria 1623
412 Ga0207678_10002319 3300026067 Bacteria 17246
413 Ga0207678_10010067 3300026067 Bacteria 8296
414 Ga0207678_10015000 3300026067 Bacteria 6817
415 Ga0207678_10027531 3300026067 Bacteria 4960
416 Ga0207678_10587648 3300026067 Bacteria 976
417 Ga0207708_10000179 3300026075 Bacteria 50377
418 Ga0207708_10001547 3300026075 Bacteria 17170
419 Ga0207702_10000004 3300026078 Bacteria 422182
420 Ga0207702_10008145 3300026078 Bacteria 8866
421 Ga0207702_10028205 3300026078 Bacteria 4665
422 Ga0207702_10071595 3300026078 Bacteria 2986
423 Ga0207702_10092844 3300026078 Bacteria 2646
424 Ga0207648_10000772 3300026089 Bacteria 36056
425 Ga0207676_10059148 3300026095 Bacteria 3025
426 Ga0207676_10121668 3300026095 Bacteria 2202
427 Ga0207674_10005590 3300026116 Bacteria 14903
428 Ga0207674_10006172 3300026116 Bacteria 14146
429 Ga0207674_10006707 3300026116 Bacteria 13521
430 Ga0207674_10014421 3300026116 Bacteria 8730
431 Ga0207674_10037609 3300026116 Bacteria 5031
432 Ga0207675_100000127 3300026118 Bacteria 63431
433 Ga0207675_100015080 3300026118 Bacteria 7210
434 Ga0207675_100281703 3300026118 Bacteria 1615
435 Ga0207683_10048552 3300026121 Bacteria 3716
436 Ga0207683_10266370 3300026121 Bacteria 1565
437 Ga0207683_10467270 3300026121 Bacteria 1164
438 Ga0207698_10014462 3300026142 Bacteria 5248
439 Ga0207698_10048403 3300026142 Bacteria 3227
440 Ga0209589_1000021 3300027357 Bacteria 186431
441 Ga0209489_100028 3300027361 Bacteria 186431
442 Ga0209700_100037 3300027363 Bacteria 186431
443 Ga0209179_1001223 3300027512 Bacteria 3063
444 Ga0209179_1004630 3300027512 Bacteria 2091
445 Ga0209588_1006984 3300027671 Bacteria 3308
446 Ga0207428_10032301 3300027907 Bacteria 4306
447 Ga0207428_10350367 3300027907 Bacteria 1086
448 Ga0268266_10000680 3300028379 Bacteria 45937
449 Ga0268266_10012906 3300028379 Bacteria 7208
450 Ga0268266_10080249 3300028379 Bacteria 2842
451 Ga0268265_10001274 3300028380 Bacteria 21743
452 Ga0268265_10002376 3300028380 Bacteria 14227
453 Ga0268265_10020055 3300028380 Bacteria 4659
454 Ga0268264_10000062 3300028381 Bacteria 302110
455 Ga0268264_10002253 3300028381 Bacteria 17080
456 Ga0268264_10002417 3300028381 Bacteria 16431
457 Ga0268264_10179065 3300028381 Bacteria 1924
458 Ga0307517_10000942 3300028786 Bacteria 49547
459 Ga0307517_10137157 3300028786 Bacteria 1735
460 Ga0307515_10068562 3300028794 Bacteria 4870
461 Ga0265330_10006512 3300031235 Bacteria 5774
462 Ga0265330_10040805 3300031235 Bacteria 2060
463 Ga0265330_10076510 3300031235 Bacteria 1444
464 Ga0265330_10116335 3300031235 Bacteria 1140
465 Ga0265340_10002209 3300031247 Bacteria 11138
466 Ga0265339_10001277 3300031249 Bacteria 18834
467 Ga0265339_10117511 3300031249 Bacteria 1370
468 Ga0265331_10031034 3300031250 Bacteria 2658
469 Ga0265316_10157310 3300031344 Bacteria 1700
470 Ga0265316_10333189 3300031344 Bacteria 1101
471 Ga0307509_10006490 3300031507 Bacteria 15715
472 Ga0307509_10107620 3300031507 Bacteria 2803
473 Ga0307408_100210005 3300031548 Bacteria 1581
474 Ga0307408_100603308 3300031548 Bacteria 976
475 Ga0307508_10000108 3300031616 Bacteria 97443
476 Ga0307508_10012397 3300031616 Bacteria 7796
477 Ga0307508_10037820 3300031616 Bacteria 4339
478 Ga0307508_10083297 3300031616 Bacteria 2780
479 Ga0265314_10002048 3300031711 Bacteria 21322
480 Ga0265314_10045576 3300031711 Bacteria 3099
481 Ga0265314_10066862 3300031711 Bacteria 2423
482 Ga0265342_10189225 3300031712 Bacteria 1124
483 Ga0307516_10000908 3300031730 Bacteria 40669
484 Ga0307516_10044620 3300031730 Bacteria 4384
485 Ga0307516_10062483 3300031730 Bacteria 3609
486 Ga0307516_10068912 3300031730 Bacteria 3404
487 Ga0307516_10206850 3300031730 Bacteria 1679
488 Ga0307413_10179716 3300031824 Bacteria 1507
489 Ga0307415_100023277 3300032126 Bacteria 3842
490 Ga0307510_10003483 3300033180 Bacteria 18332
491 Ga0307510_10297932 3300033180 Bacteria 1076
492 Ga0315911_1000008 3300033442 Bacteria 381285
493 Ga0373930_0020576 3300034816 Bacteria 1287
494 Ga0373958_0011429 3300034819 Bacteria 1501
495 Ga0373934_0005625 3300035086 Bacteria 4642
496 Ga0373934_0013237 3300035086 Bacteria 3118
497 Ga0373934_0028140 3300035086 Bacteria 2188
498 Ga0373949_0028848 3300035090 Bacteria 1312
499 Ga0373923_0024780 3300035111 Bacteria 2371
500 Ga0373923_0054009 3300035111 Bacteria 1690
501 Ga0373923_0081850 3300035111 Bacteria 1401
502 Ga0373932_0029061 3300035112 Bacteria 1524
503 Ga0373936_0010488 3300035113 Bacteria 3496
504 Ga0373936_0062179 3300035113 Bacteria 1526
505 Ga0373939_0041433 3300035114 Bacteria 1388
506 Ga0373939_0054530 3300035114 Bacteria 1252
507 Ga0373945_0019064 3300035116 Bacteria 2339
508 Ga0373945_0025780 3300035116 Bacteria 2045
509 Ga0373953_0000037 3300035117 Bacteria 34731
510 Ga0373954_0000242 3300035118 Bacteria 20003
511 Ga0373954_0004339 3300035118 Bacteria 6098
512 Ga0373954_0033727 3300035118 Bacteria 2369
513 Ga0373956_0000631 3300035119 Bacteria 14442
514 Ga0373957_0000417 3300035120 Bacteria 10760
515 Ga0373957_0071680 3300035120 Bacteria 1356
516 Ga0373943_0002237 3300035170 Bacteria 8797
517 Ga0373946_0006294 3300035171 Bacteria 4302
518 Ga0373946_0061766 3300035171 Bacteria 1596
519 Ga0373955_0001044 3300035172 Bacteria 11768
520 Ga0373955_0005369 3300035172 Bacteria 5754
521 Ga0373955_0048879 3300035172 Bacteria 2295
522 Ga0373955_0247208 3300035172 Bacteria 1069
523 Ga0373942_0007848 3300035207 Bacteria 2481
524 Ga0373961_0018293 3300035241 Bacteria 1828
525 Ga0373962_0019495 3300035242 Bacteria 1775
526 Ga0373924_0023154 3300035410 Bacteria 2433
527 Ga0373924_0042213 3300035410 Bacteria 1870
528 Ga0373924_0045195 3300035410 Bacteria 1811
529 Ga0373931_0027612 3300035691 Bacteria 2899
530 Ga0373931_0080472 3300035691 Bacteria 1796
531 Ga0373931_0269970 3300035691 Bacteria 1041
532 Ga0373935_0000500 3300035692 Bacteria 20245
533 Ga0373935_0031449 3300035692 Bacteria 3294
534 Ga0373927_0000337 3300035695 Bacteria 36861
535 Ga0373927_0006763 3300035695 Bacteria 7801
536 Ga0373927_0022849 3300035695 Bacteria 4096
537 Ga0373927_0029973 3300035695 Bacteria 3549
538 Ga0373927_0034171 3300035695 Bacteria 3308
539 Ga0373933_0000487 3300035724 Bacteria 24768
540 Ga0373933_0044281 3300035724 Bacteria 2636
541 Ga0373947_0002043 3300035725 Bacteria 12316
542 Ga0373947_0005807 3300035725 Bacteria 7195
543 Ga0373947_0111496 3300035725 Bacteria 1729
544 Ga0373947_0147476 3300035725 Bacteria 1513
545 Ga0373937_0038100 3300036401 Bacteria 4382
546 Ga0373937_0125555 3300036401 Bacteria 2393
547 Ga0373937_0147029 3300036401 Bacteria 2206
548 Ga0373937_0187235 3300036401 Bacteria 1944
549 Ga0372808_006158 3300036459 Bacteria 1608
550 Ga0373925_0003157 3300037068 Bacteria 12909
551 Ga0373925_0013825 3300037068 Bacteria 5843
552 Ga0373925_0042071 3300037068 Bacteria 3389
553 Ga0373925_0153495 3300037068 Bacteria 1810
554 Ga0395905_0151758 3300037471 Bacteria 2180
555 Ga0395905_0327503 3300037471 Bacteria 1422
556 Ga0436364_0336598 3300037853 Bacteria 4233
557 Ga0436365_0116257 3300039437 Bacteria 988
558 Ga0436365_0173083 3300039437 Bacteria 16286
559 Ga0436365_0398617 3300039437 Bacteria 4806
560 Ga0436365_0675687 3300039437 Bacteria 1242
561 Ga0451853_3231558 3300041512 Bacteria 1189
562 Ga0439448_0055361 3300042005 Bacteria 1304
563 Ga0466967_0271578 3300045976 Bacteria 1625
564 Ga0495592_0052315 3300046454 Bacteria 3033
565 Ga0495592_0066449 3300046454 Bacteria 2638
566 Ga0495603_0001388 3300046455 Bacteria 14063
567 Ga0495603_0002436 3300046455 Bacteria 10943
568 Ga0495603_0005675 3300046455 Bacteria 7457
569 Ga0495591_041077 3300046458 Bacteria 1315
570 Ga0495629_0000124 3300046459 Bacteria 68796
571 Ga0495629_0000727 3300046459 Bacteria 26728
572 Ga0495641_0007117 3300046461 Bacteria 7073
573 Ga0495641_0079497 3300046461 Bacteria 1469
574 Ga0495651_0039024 3300046462 Bacteria 3697
575 Ga0495651_0041061 3300046462 Bacteria 3595
576 Ga0495651_0280975 3300046462 Bacteria 1124
577 Ga0495653_0000465 3300046463 Bacteria 31535
578 Ga0495653_0041812 3300046463 Bacteria 3575
579 Ga0495653_0251108 3300046463 Bacteria 1174
580 Ga0495580_0002297 3300046472 Bacteria 16691
581 Ga0495580_0031584 3300046472 Bacteria 3826
582 Ga0495580_0034287 3300046472 Bacteria 3655
583 Ga0495582_0000494 3300046473 Bacteria 21572
584 Ga0495582_0020335 3300046473 Bacteria 3633
585 Ga0495639_0000119 3300046475 Bacteria 39930
586 Ga0495639_0091485 3300046475 Bacteria 1428
587 Ga0495639_0105842 3300046475 Bacteria 1332
588 Ga0495662_0001142 3300046476 Bacteria 13095
589 Ga0495662_0074939 3300046476 Bacteria 1642
590 Ga0495664_0001550 3300046477 Bacteria 12165
591 Ga0495664_0007218 3300046477 Bacteria 6161
592 Ga0495664_0012516 3300046477 Bacteria 4806
593 Ga0495664_0055229 3300046477 Bacteria 2363
594 Ga0495585_0010815 3300046492 Bacteria 5422
595 Ga0495585_0017878 3300046492 Bacteria 4091
596 Ga0495594_0031156 3300046499 Bacteria 2890
597 Ga0495596_0042640 3300046500 Bacteria 1788
598 Ga0495596_0052406 3300046500 Bacteria 1597
599 Ga0495608_0001489 3300046511 Bacteria 16666
600 Ga0495608_0068946 3300046511 Bacteria 2311
601 Ga0495608_0087706 3300046511 Bacteria 2015
602 Ga0495618_0010417 3300046514 Bacteria 5621
603 Ga0495618_0136834 3300046514 Bacteria 1567
604 Ga0495620_0030968 3300046515 Bacteria 2456
605 Ga0495628_0006943 3300046516 Bacteria 9831
606 Ga0495628_0017483 3300046516 Bacteria 5971
607 Ga0495628_0023788 3300046516 Bacteria 5023
608 Ga0495630_0140250 3300046517 Bacteria 1838
609 Ga0495630_0257369 3300046517 Bacteria 1333
610 Ga0495631_0008583 3300046518 Bacteria 5145
611 Ga0495631_0123369 3300046518 Bacteria 1114
612 Ga0495666_0030645 3300046526 Bacteria 2638
613 Ga0495652_0001377 3300046529 Bacteria 27009
614 Ga0495652_0069696 3300046529 Bacteria 2942
615 Ga0495652_0170570 3300046529 Bacteria 1680
616 Ga0495665_0000251 3300046531 Bacteria 26959
617 Ga0495665_0015050 3300046531 Bacteria 4169
618 Ga0495640_0026258 3300046533 Bacteria 4211
619 Ga0495640_0036134 3300046533 Bacteria 3491
620 Ga0495640_0205877 3300046533 Bacteria 1245
621 Ga0495587_0033400 3300046536 Bacteria 3106
622 Ga0495587_0048659 3300046536 Bacteria 2510
623 Ga0495598_0026992 3300046537 Bacteria 1580
624 Ga0495645_0017210 3300046543 Bacteria 5177
625 Ga0495645_0258808 3300046543 Bacteria 1153
626 Ga0495622_0024919 3300046557 Bacteria 2794
627 Ga0495622_0038571 3300046557 Bacteria 2224
628 Ga0495667_0001146 3300046559 Bacteria 17281
629 Ga0495667_0027511 3300046559 Bacteria 3831
630 Ga0495667_0036446 3300046559 Bacteria 3284
631 Ga0495634_0000886 3300046642 Bacteria 28754
632 Ga0495634_0014430 3300046642 Bacteria 5696
633 Ga0495634_0053801 3300046642 Bacteria 2695
634 Ga0495635_0000786 3300046663 Bacteria 20681
635 Ga0495635_0001208 3300046663 Bacteria 17261
636 Ga0495635_0019516 3300046663 Bacteria 4724
637 Ga0495635_0060747 3300046663 Bacteria 2597
638 Ga0495659_0011408 3300046664 Bacteria 2863
639 Ga0495659_0041774 3300046664 Bacteria 1639
640 Ga0495588_0017578 3300046674 Bacteria 3476
641 Ga0495588_0019036 3300046674 Bacteria 3358
642 Ga0495588_0204762 3300046674 Bacteria 1042
643 Ga0495657_0001030 3300046675 Bacteria 24459
644 Ga0495599_0031137 3300046678 Bacteria 3349
645 Ga0495599_0092967 3300046678 Bacteria 1881
646 Ga0495623_0014400 3300046679 Bacteria 5118
647 Ga0495623_0172304 3300046679 Bacteria 1263
648 Ga0495646_0023325 3300046680 Bacteria 3897
649 Ga0495646_0033655 3300046680 Bacteria 3186
650 Ga0495647_0000085 3300046681 Bacteria 22908
651 Ga0495658_0000135 3300046683 Bacteria 40991
652 Ga0495658_0012816 3300046683 Bacteria 4257
653 Ga0495658_0272621 3300046683 Bacteria 1067
654 Ga0495669_0000707 3300046684 Bacteria 14557
655 Ga0495613_0001617 3300046689 Bacteria 17148
656 Ga0495613_0073692 3300046689 Bacteria 2487
657 Ga0495613_0148177 3300046689 Bacteria 1675
658 Ga0495624_0000144 3300046690 Bacteria 51509
659 Ga0495624_0032598 3300046690 Bacteria 3378
660 Ga0495600_0000768 3300046809 Bacteria 16897
661 Ga0495600_0046877 3300046809 Bacteria 2819
662 Ga0495581_0000421 3300047315 Bacteria 21445
663 Ga0495581_0016438 3300047315 Bacteria 4301
664 Ga0495581_0079139 3300047315 Bacteria 1902
665 Ga0495581_0253921 3300047315 Bacteria 1028
666 Ga0495604_0009371 3300047317 Bacteria 7744
667 Ga0495636_0031056 3300047318 Bacteria 2188
668 Ga0495674_0001274 3300047319 Bacteria 24483
669 Ga0495674_0035560 3300047319 Bacteria 4492
670 Ga0495674_0067280 3300047319 Bacteria 3104
671 Ga0495674_0082014 3300047319 Bacteria 2765
672 Ga0495672_0011591 3300047320 Bacteria 6211
673 Ga0495672_0077427 3300047320 Bacteria 1864
674 Ga0495676_0012854 3300047321 Bacteria 7528
675 Ga0495676_0020657 3300047321 Bacteria 5771
676 Ga0495676_0096406 3300047321 Bacteria 2199
677 Ga0495676_0169786 3300047321 Bacteria 1536
678 Ga0495680_0001556 3300047322 Bacteria 24553
679 Ga0495680_0050712 3300047322 Bacteria 3243
680 Ga0495680_0292552 3300047322 Bacteria 1145
681 Ga0495675_0003063 3300047444 Bacteria 10046
682 Ga0495675_0019876 3300047444 Bacteria 4268
683 Ga0495679_044115 3300047446 Bacteria 1367
684 Ga0495673_0056264 3300047469 Bacteria 1703
685 Ga0495681_0105548 3300047470 Bacteria 1226
686 Ga0495684_0000169 3300047471 Bacteria 49164
687 Ga0495684_0033825 3300047471 Bacteria 3921
688 Ga0495684_0084824 3300047471 Bacteria 2402
689 Ga0495686_0037943 3300047472 Bacteria 3085
690 Ga0495593_0000007 3300047673 Bacteria 87657
691 Ga0495593_0004906 3300047673 Bacteria 7935
692 Ga0495602_0018573 3300048088 Bacteria 6936
693 Ga0495614_0009706 3300048089 Bacteria 4253
694 Ga0495614_0061335 3300048089 Bacteria 1616
695 Ga0495626_0102882 3300048091 Bacteria 1244
696 Ga0496100_0012929 3300048903 Bacteria 4799
697 Ga0496100_0108105 3300048903 Bacteria 1928
698 Ga0496100_0116295 3300048903 Bacteria 1866
699 Ga0496101_0006277 3300048904 Bacteria 7650
700 Ga0496101_0030669 3300048904 Bacteria 3773
701 Ga0496101_0064590 3300048904 Bacteria 2666
702 Ga0496101_0067239 3300048904 Bacteria 2616
703 Ga0496101_0172043 3300048904 Bacteria 1665
704 Ga0496101_0425268 3300048904 Bacteria 1047
705 Ga0496102_0002951 3300048905 Bacteria 14413
706 Ga0496102_0008119 3300048905 Bacteria 8984
707 Ga0496102_0009172 3300048905 Bacteria 8488
708 Ga0496103_0042331 3300048906 Bacteria 2802
709 Ga0496104_0080044 3300048907 Bacteria 3114
710 Ga0496105_0032942 3300048908 Bacteria 4254
711 Ga0496106_0000929 3300048909 Bacteria 21332
712 Ga0496106_0002286 3300048909 Bacteria 14292
713 Ga0496106_0010158 3300048909 Bacteria 6954
714 Ga0496106_0014006 3300048909 Bacteria 5929
715 Ga0496106_0025052 3300048909 Bacteria 4438
716 Ga0496106_0037948 3300048909 Bacteria 3605
717 Ga0496106_0067541 3300048909 Bacteria 2726
718 Ga0496106_0074110 3300048909 Bacteria 2605
719 Ga0496106_0093924 3300048909 Bacteria 2318
720 Ga0496107_0005366 3300048910 Bacteria 8769
721 Ga0496107_0007292 3300048910 Bacteria 7621
722 Ga0496107_0131841 3300048910 Bacteria 1845
723 Ga0496107_0165943 3300048910 Bacteria 1637
724 Ga0496107_0289447 3300048910 Bacteria 1219
725 Ga0496108_0007489 3300048911 Bacteria 8847
726 Ga0496108_0013286 3300048911 Bacteria 6713
727 Ga0496108_0026806 3300048911 Bacteria 4756
728 Ga0496108_0029893 3300048911 Bacteria 4515
729 Ga0496108_0034630 3300048911 Bacteria 4196
730 Ga0496108_0045808 3300048911 Bacteria 3653
731 Ga0496108_0300339 3300048911 Bacteria 1399
732 Ga0496109_0003252 3300048912 Bacteria 13541
733 Ga0496109_0155032 3300048912 Bacteria 2145
734 Ga0496109_0158178 3300048912 Bacteria 2122
735 Ga0496109_0191817 3300048912 Bacteria 1920
736 Ga0496109_0293130 3300048912 Bacteria 1534
737 Ga0496110_0020307 3300048913 Bacteria 5608
738 Ga0496110_0079965 3300048913 Bacteria 2911
739 Ga0496110_0127679 3300048913 Bacteria 2295
740 Ga0496111_0198527 3300048914 Bacteria 1491
741 Ga0496112_0000035 3300048915 Bacteria 106983
742 Ga0496112_0003673 3300048915 Bacteria 12791
743 Ga0496112_0074304 3300048915 Bacteria 3361
744 Ga0496112_0087087 3300048915 Bacteria 3090
745 Ga0496112_0098794 3300048915 Bacteria 2888
746 Ga0496112_0150319 3300048915 Bacteria 2296
747 Ga0496112_0270112 3300048915 Bacteria 1649
748 Ga0496113_0012420 3300048916 Bacteria 5723
749 Ga0496113_0063988 3300048916 Bacteria 2780
750 Ga0496113_0079843 3300048916 Bacteria 2505
751 Ga0496113_0216991 3300048916 Bacteria 1524
752 Ga0496114_0061781 3300048917 Bacteria 3134
753 Ga0496114_0205974 3300048917 Bacteria 1724
754 Ga0496115_0002653 3300048918 Bacteria 12842
755 Ga0496115_0012788 3300048918 Bacteria 6328
756 Ga0496115_0025586 3300048918 Bacteria 4597
757 Ga0496115_0047885 3300048918 Bacteria 3419
758 Ga0496115_0049186 3300048918 Bacteria 3374
759 Ga0496115_0419216 3300048918 Bacteria 1085
760 Ga0496117_0010324 3300048920 Bacteria 8535
761 Ga0496118_0007916 3300048921 Bacteria 11123
762 Ga0496120_0098961 3300048923 Bacteria 1545
763 Ga0496121_0000203 3300048924 Bacteria 130984
764 Ga0496121_0000893 3300048924 Bacteria 53847
765 Ga0496121_0007942 3300048924 Bacteria 12680
766 Ga0496121_0106495 3300048924 Bacteria 2149
767 Ga0496124_0001303 3300048927 Bacteria 37721
768 Ga0496124_0068930 3300048927 Bacteria 2938
769 Ga0496125_0064007 3300048928 Bacteria 2927
770 Ga0496125_0090937 3300048928 Bacteria 2288
771 Ga0496126_0014074 3300048929 Bacteria 8104
772 Ga0496126_0021709 3300048929 Bacteria 6265
773 Ga0496126_0072585 3300048929 Bacteria 3061
774 Ga0496126_0148674 3300048929 Bacteria 2009
775 Ga0496126_0165177 3300048929 Bacteria 1889
776 Ga0496126_0283371 3300048929 Bacteria 1372
777 Ga0501034_0022273 3300049571 Bacteria 6458
778 Ga0501039_0390387 3300049575 Bacteria 1093
779 Ga0501047_0036672 3300049581 Bacteria 4739
780 Ga0501077_0070402 3300049593 Bacteria 2217
781 Ga0501077_0248659 3300049593 Bacteria 1130
782 Ga0501079_0248447 3300049741 Bacteria 1390
783 Ga0501081_0025778 3300049743 Bacteria 3959
784 Ga0501044_0016453 3300049823 Bacteria 7938
785 nmdc:mga03n38_100_c1 3300050490 Bacteria 19063
786 nmdc:mga06z11_13204_c1 3300050494 Bacteria 3618
787 nmdc:mga07m45_52329_c1 3300050496 Bacteria 2305
788 nmdc:mga05p37_172909_c1 3300050507 Bacteria 2633
789 nmdc:mga05p37_462464_c1 3300050507 Bacteria 1466
790 nmdc:mga09592_165572_c1 3300050508 Bacteria 1911
791 nmdc:mga09592_64113_c1 3300050508 Bacteria 3111
792 nmdc:mga0qj67_32117_c1 3300050509 Bacteria 4094
793 nmdc:mga06r32_7402_c1 3300050510 Bacteria 9875
794 nmdc:mga08y16_77109_c1 3300050511 Bacteria 3475
795 nmdc:mga0n895_24405_c1 3300050512 Bacteria 5699
796 nmdc:mga0n895_53433_c1 3300050512 Bacteria 3969
797 nmdc:mga0rr50_41840_c1 3300050513 Bacteria 3342
798 nmdc:mga0a205_11623_c2 3300050515 Bacteria 7704
799 nmdc:mga0a205_506851_c1 3300050515 Bacteria 1063
800 Ga0495601_0015001 3300053077 Bacteria 4680
801 Ga0495601_0030171 3300053077 Bacteria 3366
802 Ga0495601_0093245 3300053077 Bacteria 1940
803 Ga0495612_0014984 3300053078 Bacteria 3109
804 Ga0495612_0044248 3300053078 Bacteria 1821
805 Ga0495655_0050413 3300053083 Bacteria 1100
806 Ga0495595_0000329 3300053084 Bacteria 18457
807 Ga0495619_0025638 3300053085 Bacteria 3788
808 Ga0500643_001412 3300053087 Bacteria 13874
809 Ga0500647_0004754 3300053091 Bacteria 5526
810 Ga0500651_0001809 3300053093 Bacteria 10947
811 Ga0500566_0000150 3300053094 Bacteria 35703
812 Ga0500566_0001277 3300053094 Bacteria 14669
813 Ga0500640_011476 3300053095 Bacteria 3612
814 Ga0500641_0003982 3300053096 Bacteria 5222
815 Ga0500641_0006532 3300053096 Bacteria 4135
816 Ga0500554_002467 3300053102 Bacteria 3647
817 Ga0500562_017692 3300053108 Bacteria 1839
818 Ga0500572_009836 3300053111 Bacteria 2271
819 Ga0500595_000258 3300053119 Bacteria 35116
820 Ga0500595_002380 3300053119 Bacteria 9400
821 Ga0500595_002973 3300053119 Bacteria 8073
822 Ga0500595_003042 3300053119 Bacteria 7968
823 Ga0500595_014145 3300053119 Bacteria 3034
824 Ga0500642_0001001 3300053130 Bacteria 8113
825 Ga0500655_006652 3300053133 Bacteria 2080
826 Ga0500559_0000244 3300053136 Bacteria 42994
827 Ga0500559_0134507 3300053136 Bacteria 1155
828 Ga0500603_000762 3300053150 Bacteria 7755
829 Ga0500603_008823 3300053150 Bacteria 2247
830 Ga0500616_0000127 3300053153 Bacteria 134777
831 Ga0500622_0033972 3300053156 Bacteria 2673
832 Ga0500627_0131810 3300053158 Bacteria 1129
833 Ga0500639_110654 3300053163 Bacteria 1336
834 Ga0500637_0000140 3300053178 Bacteria 26532
835 Ga0500637_0000147 3300053178 Bacteria 25930
836 Ga0500637_0055835 3300053178 Bacteria 2256
837 Ga0500657_132507 3300053728 Bacteria 963
838 Ga0500552_005755 3300053733 Bacteria 1364
839 Ga0500596_003380 3300053735 Bacteria 3042
840 Ga0500661_003026 3300055283 Bacteria 3159
841 Ga0501082_0123288 3300060353 Bacteria 2247

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10748804 Ga0105240_107488042 262
2 3300025913 Ga0207695_10024634 Ga0207695_100246342 262
3 3300025914 Ga0207671_10151806 Ga0207671_101518062 262
4 3300025921 Ga0207652_10028827 Ga0207652_100288274 262
5 3300005327 Ga0070658_10001807 Ga0070658_100018079 263
6 3300005330 Ga0070690_100000228 Ga0070690_1000002284 263
7 3300005334 Ga0068869_100000350 Ga0068869_10000035011 263
8 3300005336 Ga0070680_100000306 Ga0070680_10000030619 263
9 3300005336 Ga0070680_100596326 Ga0070680_1005963261 263
10 3300005338 Ga0068868_100000207 Ga0068868_10000020711 263
11 3300005340 Ga0070689_100018355 Ga0070689_1000183554 263
12 3300005341 Ga0070691_10001525 Ga0070691_100015256 263
13 3300005343 Ga0070687_100000055 Ga0070687_10000005511 263
14 3300005344 Ga0070661_100096527 Ga0070661_1000965272 263
15 3300005345 Ga0070692_10000296 Ga0070692_100002964 263
16 3300005355 Ga0070671_100067099 Ga0070671_1000670992 263
17 3300005406 Ga0070703_10011767 Ga0070703_100117672 263
18 3300005435 Ga0070714_100000597 Ga0070714_1000005979 263
19 3300005438 Ga0070701_10001180 Ga0070701_100011806 263
20 3300005440 Ga0070705_100000161 Ga0070705_10000016124 263
21 3300005441 Ga0070700_100000137 Ga0070700_10000013713 263
22 3300005444 Ga0070694_100000106 Ga0070694_10000010611 263
23 3300005444 Ga0070694_100124203 Ga0070694_1001242032 263
24 3300005457 Ga0070662_100038283 Ga0070662_1000382834 263
25 3300005458 Ga0070681_10189290 Ga0070681_101892903 263
26 3300005459 Ga0068867_100000230 Ga0068867_10000023011 263
27 3300005530 Ga0070679_100008011 Ga0070679_1000080113 263
28 3300005539 Ga0068853_100022948 Ga0068853_1000229483 263
29 3300005539 Ga0068853_100650114 Ga0068853_1006501141 263
30 3300005544 Ga0070686_100000546 Ga0070686_1000005464 263
31 3300005545 Ga0070695_100000200 Ga0070695_10000020023 263
32 3300005546 Ga0070696_100000189 Ga0070696_10000018915 263
33 3300005547 Ga0070693_100000170 Ga0070693_1000001705 263
34 3300005549 Ga0070704_100000028 Ga0070704_10000002811 263
35 3300005563 Ga0068855_100002784 Ga0068855_10000278413 263
36 3300005577 Ga0068857_100224233 Ga0068857_1002242332 263
37 3300005578 Ga0068854_100012220 Ga0068854_1000122204 263
38 3300005615 Ga0070702_100000089 Ga0070702_10000008913 263
39 3300005617 Ga0068859_100001708 Ga0068859_10000170819 263
40 3300005718 Ga0068866_10003103 Ga0068866_100031035 263
41 3300005719 Ga0068861_100001248 Ga0068861_10000124811 263
42 3300005840 Ga0068870_10034857 Ga0068870_100348573 263
43 3300005842 Ga0068858_100001236 Ga0068858_1000012365 263
44 3300005843 Ga0068860_100004410 Ga0068860_1000044103 263
45 3300005844 Ga0068862_100003737 Ga0068862_1000037372 263
46 3300006358 Ga0068871_100000322 Ga0068871_10000032210 263
47 3300006881 Ga0068865_100000108 Ga0068865_10000010811 263
48 3300006931 Ga0097620_100001708 Ga0097620_10000170819 263
49 3300009093 Ga0105240_10001597 Ga0105240_1000159715 263
50 3300009098 Ga0105245_10000481 Ga0105245_1000048111 263
51 3300009148 Ga0105243_10000575 Ga0105243_1000057511 263
52 3300009174 Ga0105241_10017805 Ga0105241_100178052 263
53 3300009176 Ga0105242_10000342 Ga0105242_1000034225 263
54 3300009553 Ga0105249_10003783 Ga0105249_1000378313 263
55 3300010375 Ga0105239_10081518 Ga0105239_100815184 263
56 3300010375 Ga0105239_10563582 Ga0105239_105635821 263
57 3300013297 Ga0157378_10000365 Ga0157378_1000036511 263
58 3300013297 Ga0157378_10139529 Ga0157378_101395291 263
59 3300013306 Ga0163162_10093948 Ga0163162_100939482 263
60 3300014968 Ga0157379_10388965 Ga0157379_103889652 263
61 3300025885 Ga0207653_10011526 Ga0207653_100115263 263
62 3300025899 Ga0207642_10001661 Ga0207642_100016614 263
63 3300025904 Ga0207647_10010711 Ga0207647_100107115 263
64 3300025911 Ga0207654_10061904 Ga0207654_100619042 263
65 3300025912 Ga0207707_10039291 Ga0207707_100392914 263
66 3300025912 Ga0207707_10295727 Ga0207707_102957272 263
67 3300025917 Ga0207660_10001409 Ga0207660_100014095 263
68 3300025917 Ga0207660_10160795 Ga0207660_101607953 263
69 3300025918 Ga0207662_10000122 Ga0207662_1000012211 263
70 3300025919 Ga0207657_10008750 Ga0207657_100087509 263
71 3300025921 Ga0207652_10041550 Ga0207652_100415504 263
72 3300025927 Ga0207687_10000178 Ga0207687_1000017827 263
73 3300025929 Ga0207664_10000131 Ga0207664_100001319 263
74 3300025932 Ga0207690_10000308 Ga0207690_1000030819 263
75 3300025932 Ga0207690_10005794 Ga0207690_100057944 263
76 3300025934 Ga0207686_10000838 Ga0207686_1000083812 263
77 3300025935 Ga0207709_10002153 Ga0207709_100021532 263
78 3300025936 Ga0207670_10008018 Ga0207670_100080185 263
79 3300025938 Ga0207704_10010347 Ga0207704_100103472 263
80 3300025942 Ga0207689_10000535 Ga0207689_1000053511 263
81 3300025949 Ga0207667_10014006 Ga0207667_100140068 263
82 3300025949 Ga0207667_10201536 Ga0207667_102015361 263
83 3300025949 Ga0207667_10437837 Ga0207667_104378371 263
84 3300025961 Ga0207712_10004784 Ga0207712_100047846 263
85 3300025981 Ga0207640_10015461 Ga0207640_100154612 263
86 3300026023 Ga0207677_10001104 Ga0207677_1000110412 263
87 3300026035 Ga0207703_10009082 Ga0207703_100090828 263
88 3300026041 Ga0207639_10016555 Ga0207639_100165553 263
89 3300026075 Ga0207708_10000179 Ga0207708_1000017933 263
90 3300026078 Ga0207702_10008145 Ga0207702_100081454 263
91 3300026089 Ga0207648_10000772 Ga0207648_1000077224 263
92 3300026118 Ga0207675_100000127 Ga0207675_10000012715 263
93 3300028380 Ga0268265_10002376 Ga0268265_1000237611 263
94 3300028381 Ga0268264_10002417 Ga0268264_1000241715 263
95 3300035207 Ga0373942_0007848 Ga0373942_0007848_649_1467 263
96 3300035691 Ga0373931_0080472 Ga0373931_0080472_945_1763 263
97 3300042005 Ga0439448_0055361 Ga0439448_0055361_304_1122 263
98 3300048909 Ga0496106_0067541 Ga0496106_0067541_570_1388 263
99 3300048916 Ga0496113_0216991 Ga0496113_0216991_46_864 263
100 3300049581 Ga0501047_0036672 Ga0501047_0036672_3881_4699 263
101 3300049823 Ga0501044_0016453 Ga0501044_0016453_2816_3634 263
102 3300006237 Ga0097621_100007162 Ga0097621_1000071623 264
103 3300009093 Ga0105240_10104006 Ga0105240_101040063 264
104 3300009174 Ga0105241_10028964 Ga0105241_100289644 264
105 3300009545 Ga0105237_10267871 Ga0105237_102678713 264
106 3300009551 Ga0105238_10028317 Ga0105238_100283174 264
107 3300013297 Ga0157378_10085942 Ga0157378_100859424 264
108 3300014968 Ga0157379_10383884 Ga0157379_103838842 264
109 3300014969 Ga0157376_10079948 Ga0157376_100799484 264
110 3300025911 Ga0207654_10036015 Ga0207654_100360154 264
111 3300025913 Ga0207695_10272735 Ga0207695_102727353 264
112 3300025924 Ga0207694_10084582 Ga0207694_100845823 264
113 3300025927 Ga0207687_10415182 Ga0207687_104151821 264
114 3300026078 Ga0207702_10092844 Ga0207702_100928444 264
115 3300031548 Ga0307408_100210005 Ga0307408_1002100052 264
116 3300048904 Ga0496101_0067239 Ga0496101_0067239_234_1070 264
117 3300048915 Ga0496112_0074304 Ga0496112_0074304_389_1225 264
118 3300048918 Ga0496115_0025586 Ga0496115_0025586_1714_2550 264
119 3300006844 Ga0075428_100007574 Ga0075428_10000757411 265
120 3300009147 Ga0114129_10028708 Ga0114129_100287088 265
121 3300053087 Ga0500643_001412 Ga0500643_001412_7571_8398 265
122 3300049593 Ga0501077_0070402 Ga0501077_0070402_397_1314 266
123 3300046463 Ga0495653_0251108 Ga0495653_0251108_295_1149 269
124 3300048911 Ga0496108_0034630 Ga0496108_0034630_910_1782 270
125 3300049571 Ga0501034_0022273 Ga0501034_0022273_2502_3359 270
126 3300053108 Ga0500562_017692 Ga0500562_017692_561_1430 270
127 3300053156 Ga0500622_0033972 Ga0500622_0033972_171_1040 270
128 iso_pu_bacteria 2513237104 2513721303 270
129 iso_pu_bacteria 2513237104 2513724155 270
130 iso_pu_bacteria 2744054633 2745082556 270
131 iso_pu_bacteria 2847930680 2847935430 270
132 iso_pu_bacteria 2876761206 2876769200 270
133 3300005339 Ga0070660_100166384 Ga0070660_1001663842 271
134 3300006042 Ga0075368_10019963 Ga0075368_100199632 271
135 3300006178 Ga0075367_10008366 Ga0075367_100083662 271
136 3300010375 Ga0105239_10083019 Ga0105239_100830192 271
137 3300014325 Ga0163163_10075450 Ga0163163_100754502 271
138 3300025914 Ga0207671_10013631 Ga0207671_100136318 271
139 3300026067 Ga0207678_10587648 Ga0207678_105876481 271
140 3300035691 Ga0373931_0027612 Ga0373931_0027612_1210_2106 271
141 3300048904 Ga0496101_0425268 Ga0496101_0425268_39_935 271
142 3300048905 Ga0496102_0009172 Ga0496102_0009172_5460_6356 271
143 3300048908 Ga0496105_0032942 Ga0496105_0032942_1072_1968 271
144 3300048909 Ga0496106_0037948 Ga0496106_0037948_1346_2242 271
145 3300048910 Ga0496107_0131841 Ga0496107_0131841_931_1827 271
146 3300048911 Ga0496108_0026806 Ga0496108_0026806_2049_2945 271
147 3300048913 Ga0496110_0020307 Ga0496110_0020307_1787_2683 271
148 3300048914 Ga0496111_0198527 Ga0496111_0198527_264_1160 271
149 3300048915 Ga0496112_0003673 Ga0496112_0003673_9175_10071 271
150 3300048916 Ga0496113_0079843 Ga0496113_0079843_525_1421 271
151 3300048917 Ga0496114_0205974 Ga0496114_0205974_815_1711 271
152 3300048918 Ga0496115_0419216 Ga0496115_0419216_115_1011 271
153 3300025937 Ga0207669_10309509 Ga0207669_103095092 272
154 3300031235 Ga0265330_10076510 Ga0265330_100765101 272
155 3300031250 Ga0265331_10031034 Ga0265331_100310343 272
156 3300031711 Ga0265314_10045576 Ga0265314_100455763 272
157 3300035118 Ga0373954_0004339 Ga0373954_0004339_5148_6011 272
158 3300037853 Ga0436364_0336598 Ga0436364_0336598_245_1153 272
159 3300048923 Ga0496120_0098961 Ga0496120_0098961_536_1432 272
160 3300048924 Ga0496121_0007942 Ga0496121_0007942_8388_9284 272
161 3300053119 Ga0500595_002973 Ga0500595_002973_456_1352 272
162 3300053119 Ga0500595_003042 Ga0500595_003042_1634_2530 272
163 3300053158 Ga0500627_0131810 Ga0500627_0131810_35_931 272
164 iso_pu_bacteria 2513237096 2513658867 272
165 iso_pu_bacteria 2513237137 2513860873 272
166 iso_pu_bacteria 2513237145 2513921131 272
167 iso_pu_bacteria 2728368998 2728755041 272
168 iso_pu_bacteria 2791355197 2793072985 272
169 iso_pu_bacteria 2885374607 2885377505 272
170 iso_pu_bacteria 2903748898 2903752079 272
171 iso_pu_bacteria 2904690495 2904691147 272
172 iso_pu_bacteria 2904699407 2904708628 272
173 iso_pu_bacteria 2906635258 2906642277 272
174 iso_pu_bacteria 2906660503 2906667305 272
175 iso_pu_bacteria 2908739725 2908747498 272
176 iso_pu_bacteria 2908756301 2908756541 272
177 3300005530 Ga0070679_100054833 Ga0070679_1000548333 273
178 3300025921 Ga0207652_10066553 Ga0207652_100665533 273
179 3300005434 Ga0070709_10000409 Ga0070709_1000040910 274
180 3300005437 Ga0070710_10000191 Ga0070710_100001918 274
181 3300005439 Ga0070711_100000851 Ga0070711_1000008512 274
182 3300005468 Ga0070707_100125368 Ga0070707_1001253682 274
183 3300005471 Ga0070698_100410792 Ga0070698_1004107921 274
184 3300005536 Ga0070697_100080131 Ga0070697_1000801311 274
185 3300005539 Ga0068853_100302820 Ga0068853_1003028201 274
186 3300006028 Ga0070717_10110826 Ga0070717_101108262 274
187 3300006173 Ga0070716_100051286 Ga0070716_1000512863 274
188 3300007788 Ga0099795_10032687 Ga0099795_100326873 274
189 3300009545 Ga0105237_10331659 Ga0105237_103316592 274
190 3300010159 Ga0099796_10000761 Ga0099796_100007617 274
191 3300013105 Ga0157369_10109012 Ga0157369_101090122 274
192 3300021384 Ga0213876_10002040 Ga0213876_100020405 274
193 3300025898 Ga0207692_10000493 Ga0207692_100004933 274
194 3300025906 Ga0207699_10000145 Ga0207699_1000014525 274
195 3300025910 Ga0207684_10353589 Ga0207684_103535892 274
196 3300025929 Ga0207664_10025264 Ga0207664_100252644 274
197 3300025939 Ga0207665_10037525 Ga0207665_100375252 274
198 3300026041 Ga0207639_10210909 Ga0207639_102109091 274
199 3300034819 Ga0373958_0011429 Ga0373958_0011429_35_904 274
200 3300039437 Ga0436365_0173083 Ga0436365_0173083_8000_8869 274
201 3300047320 Ga0495672_0077427 Ga0495672_0077427_116_994 274
202 3300048929 Ga0496126_0283371 Ga0496126_0283371_393_1262 274
203 3300049593 Ga0501077_0248659 Ga0501077_0248659_42_923 274
204 3300049741 Ga0501079_0248447 Ga0501079_0248447_271_1152 274
205 3300049743 Ga0501081_0025778 Ga0501081_0025778_253_1134 274
206 3300060353 Ga0501082_0123288 Ga0501082_0123288_419_1300 274
207 3300005336 Ga0070680_100061102 Ga0070680_1000611022 275
208 3300005347 Ga0070668_100305617 Ga0070668_1003056172 275
209 3300005440 Ga0070705_100002001 Ga0070705_10000200111 275
210 3300005441 Ga0070700_100000998 Ga0070700_10000099810 275
211 3300005444 Ga0070694_100007725 Ga0070694_1000077252 275
212 3300005444 Ga0070694_100026302 Ga0070694_1000263021 275
213 3300005518 Ga0070699_100000836 Ga0070699_10000083622 275
214 3300005530 Ga0070679_100316216 Ga0070679_1003162162 275
215 3300005536 Ga0070697_100029852 Ga0070697_1000298523 275
216 3300005545 Ga0070695_100043789 Ga0070695_1000437892 275
217 3300005546 Ga0070696_100001033 Ga0070696_10000103313 275
218 3300005577 Ga0068857_100009318 Ga0068857_1000093187 275
219 3300005615 Ga0070702_100010659 Ga0070702_1000106592 275
220 3300005618 Ga0068864_100322955 Ga0068864_1003229552 275
221 3300005843 Ga0068860_100000926 Ga0068860_10000092612 275
222 3300005844 Ga0068862_100000934 Ga0068862_10000093417 275
223 3300005937 Ga0081455_10000230 Ga0081455_1000023018 275
224 3300006058 Ga0075432_10109043 Ga0075432_101090431 275
225 3300006844 Ga0075428_100447024 Ga0075428_1004470241 275
226 3300006846 Ga0075430_100043772 Ga0075430_1000437722 275
227 3300006847 Ga0075431_100043785 Ga0075431_1000437853 275
228 3300006852 Ga0075433_10001174 Ga0075433_1000117418 275
229 3300006871 Ga0075434_100011494 Ga0075434_10001149410 275
230 3300006880 Ga0075429_100119058 Ga0075429_1001190582 275
231 3300007076 Ga0075435_100160360 Ga0075435_1001603601 275
232 3300009553 Ga0105249_10029065 Ga0105249_100290652 275
233 3300025917 Ga0207660_10001663 Ga0207660_1000166316 275
234 3300025921 Ga0207652_10301643 Ga0207652_103016432 275
235 3300025942 Ga0207689_10082533 Ga0207689_100825334 275
236 3300025972 Ga0207668_10339612 Ga0207668_103396122 275
237 3300026067 Ga0207678_10002319 Ga0207678_100023197 275
238 3300026075 Ga0207708_10001547 Ga0207708_100015479 275
239 3300026095 Ga0207676_10121668 Ga0207676_101216682 275
240 3300026116 Ga0207674_10006172 Ga0207674_1000617216 275
241 3300027907 Ga0207428_10032301 Ga0207428_100323013 275
242 3300027907 Ga0207428_10350367 Ga0207428_103503671 275
243 3300028380 Ga0268265_10001274 Ga0268265_100012744 275
244 3300028381 Ga0268264_10002253 Ga0268264_100022533 275
245 3300035114 Ga0373939_0054530 Ga0373939_0054530_113_1012 275
246 3300035241 Ga0373961_0018293 Ga0373961_0018293_883_1782 275
247 3300035242 Ga0373962_0019495 Ga0373962_0019495_640_1539 275
248 3300048905 Ga0496102_0002951 Ga0496102_0002951_417_1289 275
249 3300048909 Ga0496106_0000929 Ga0496106_0000929_19303_20175 275
250 3300048910 Ga0496107_0007292 Ga0496107_0007292_4748_5620 275
251 3300048911 Ga0496108_0045808 Ga0496108_0045808_118_990 275
252 3300050507 nmdc:mga05p37_462464_c1 nmdc:mga05p37_462464_c1_581_1453 275
253 3300050508 nmdc:mga09592_165572_c1 nmdc:mga09592_165572_c1_638_1510 275
254 3300050508 nmdc:mga09592_64113_c1 nmdc:mga09592_64113_c1_2198_3070 275
255 3300050509 nmdc:mga0qj67_32117_c1 nmdc:mga0qj67_32117_c1_2741_3613 275
256 3300050510 nmdc:mga06r32_7402_c1 nmdc:mga06r32_7402_c1_7933_8805 275
257 3300050511 nmdc:mga08y16_77109_c1 nmdc:mga08y16_77109_c1_172_1071 275
258 3300050512 nmdc:mga0n895_24405_c1 nmdc:mga0n895_24405_c1_1987_2886 275
259 3300050513 nmdc:mga0rr50_41840_c1 nmdc:mga0rr50_41840_c1_113_1012 275
260 3300050515 nmdc:mga0a205_11623_c2 nmdc:mga0a205_11623_c2_1312_2211 275
261 iso_pu_bacteria 2667528175 2671122501 275
262 3300005434 Ga0070709_10064221 Ga0070709_100642212 276
263 3300005435 Ga0070714_100092250 Ga0070714_1000922502 276
264 3300005437 Ga0070710_10000880 Ga0070710_100008806 276
265 3300005439 Ga0070711_100007845 Ga0070711_1000078454 276
266 3300005842 Ga0068858_100222799 Ga0068858_1002227992 276
267 3300005843 Ga0068860_100000433 Ga0068860_10000043316 276
268 3300006028 Ga0070717_10002236 Ga0070717_100022363 276
269 3300006163 Ga0070715_10002923 Ga0070715_100029234 276
270 3300006173 Ga0070716_100009934 Ga0070716_1000099343 276
271 3300009148 Ga0105243_10197565 Ga0105243_101975652 276
272 3300009551 Ga0105238_10676724 Ga0105238_106767241 276
273 3300010375 Ga0105239_10324481 Ga0105239_103244812 276
274 3300010375 Ga0105239_10819389 Ga0105239_108193891 276
275 3300025898 Ga0207692_10002127 Ga0207692_100021279 276
276 3300025906 Ga0207699_10003326 Ga0207699_100033262 276
277 3300025915 Ga0207693_10001606 Ga0207693_100016066 276
278 3300025916 Ga0207663_10000390 Ga0207663_1000039011 276
279 3300025924 Ga0207694_10165683 Ga0207694_101656832 276
280 3300025929 Ga0207664_10415313 Ga0207664_104153131 276
281 3300025939 Ga0207665_10000444 Ga0207665_1000044418 276
282 3300028381 Ga0268264_10000062 Ga0268264_1000006271 276
283 3300031507 Ga0307509_10006490 Ga0307509_1000649014 276
284 3300031616 Ga0307508_10083297 Ga0307508_100832972 276
285 3300031730 Ga0307516_10000908 Ga0307516_1000090825 276
286 3300031730 Ga0307516_10062483 Ga0307516_100624831 276
287 3300031730 Ga0307516_10068912 Ga0307516_100689122 276
288 3300033442 Ga0315911_1000008 Ga0315911_1000008255 276
289 3300035692 Ga0373935_0031449 Ga0373935_0031449_2105_2980 276
290 3300035695 Ga0373927_0034171 Ga0373927_0034171_1570_2445 276
291 3300036459 Ga0372808_006158 Ga0372808_006158_429_1304 276
292 3300037068 Ga0373925_0042071 Ga0373925_0042071_1025_1900 276
293 3300039437 Ga0436365_0116257 Ga0436365_0116257_31_912 276
294 3300046475 Ga0495639_0105842 Ga0495639_0105842_295_1170 276
295 3300046557 Ga0495622_0024919 Ga0495622_0024919_416_1291 276
296 3300048909 Ga0496106_0002286 Ga0496106_0002286_13211_14086 276
297 3300048910 Ga0496107_0165943 Ga0496107_0165943_134_1009 276
298 3300048920 Ga0496117_0010324 Ga0496117_0010324_1818_2693 276
299 3300048921 Ga0496118_0007916 Ga0496118_0007916_1972_2847 276
300 3300048924 Ga0496121_0000203 Ga0496121_0000203_77242_78117 276
301 3300048927 Ga0496124_0001303 Ga0496124_0001303_36459_37334 276
302 3300048928 Ga0496125_0064007 Ga0496125_0064007_1812_2687 276
303 3300053178 Ga0500637_0055835 Ga0500637_0055835_148_1023 276
304 3300053728 Ga0500657_132507 Ga0500657_132507_68_943 276
305 3300053733 Ga0500552_005755 Ga0500552_005755_413_1288 276
306 3300005548 Ga0070665_100024863 Ga0070665_1000248632 277
307 iso_pu_bacteria 2513237098 2513675092 277
308 iso_pu_bacteria 2513237101 2513695148 277
309 iso_pu_bacteria 2517572143 2517888895 277
310 iso_pu_bacteria 2524023210 2524469504 277
311 iso_pu_bacteria 2524023228 2524536993 277
312 iso_pu_bacteria 2721755755 2723841678 277
313 iso_pu_bacteria 2791355199 2793083619 277
314 iso_pu_bacteria 2874604998 2874608027 277
315 iso_pu_bacteria 2876808645 2876816140 277
316 iso_pu_bacteria 2879110137 2879112213 277
317 iso_pu_bacteria 2885383462 2885392604 277
318 iso_pu_bacteria 2889033259 2889035448 277
319 iso_pu_bacteria 2903768456 2903771821 277
320 iso_pu_bacteria 2906610324 2906613923 277
321 iso_pu_bacteria 2922361189 2922363961 277
322 iso_pu_bacteria 2922425934 2922434169 277
323 iso_pu_bacteria 2935630451 2935637086 277
324 iso_pu_bacteria 2941507105 2941513647 277
325 iso_pu_bacteria 2941515067 2941521610 277
326 iso_pu_bacteria 2941523033 2941529441 277
327 iso_pu_bacteria 3005474847 3005475121 277
328 iso_pu_bacteria 8006933436 8006936170 277
329 iso_pu_bacteria 8006964411 8006967495 277
330 iso_pu_bacteria 8006973647 8006976116 277
331 iso_pu_bacteria 8006984368 8006990961 277
332 iso_pu_bacteria 8006994254 8006996472 277
333 iso_pu_bacteria 8019555841 8019562461 277
334 iso_pu_bacteria 8019565922 8019572536 277
335 iso_pu_bacteria 8056673599 8056675774 277
336 iso_pu_bacteria 8056681323 8056686570 277
337 3300005468 Ga0070707_100178214 Ga0070707_1001782142 278
338 3300005471 Ga0070698_100025240 Ga0070698_1000252403 278
339 3300005937 Ga0081455_10014288 Ga0081455_100142883 278
340 3300025922 Ga0207646_10154033 Ga0207646_101540332 278
341 3300035113 Ga0373936_0010488 Ga0373936_0010488_1746_2642 278
342 3300053091 Ga0500647_0004754 Ga0500647_0004754_3155_4051 278
343 3300053093 Ga0500651_0001809 Ga0500651_0001809_6971_7867 278
344 3300053094 Ga0500566_0000150 Ga0500566_0000150_15673_16569 278
345 3300053095 Ga0500640_011476 Ga0500640_011476_1938_2834 278
346 3300053111 Ga0500572_009836 Ga0500572_009836_641_1537 278
347 3300053130 Ga0500642_0001001 Ga0500642_0001001_1388_2284 278
348 3300053136 Ga0500559_0134507 Ga0500559_0134507_222_1118 278
349 3300053150 Ga0500603_008823 Ga0500603_008823_722_1618 278
350 3300053163 Ga0500639_110654 Ga0500639_110654_113_1009 278
351 3300005355 Ga0070671_100218788 Ga0070671_1002187882 279
352 3300005844 Ga0068862_100338283 Ga0068862_1003382832 279
353 3300006042 Ga0075368_10049264 Ga0075368_100492642 279
354 3300009177 Ga0105248_10170084 Ga0105248_101700842 279
355 3300025941 Ga0207711_10128429 Ga0207711_101284292 279
356 3300047320 Ga0495672_0011591 Ga0495672_0011591_1873_2763 279
357 3300048913 Ga0496110_0127679 Ga0496110_0127679_808_1704 279
358 3300053153 Ga0500616_0000127 Ga0500616_0000127_109539_110429 279
359 3300003203 JGI25406J46586_10000241 JGI25406J46586_1000024125 280
360 3300005434 Ga0070709_10031279 Ga0070709_100312793 280
361 3300005436 Ga0070713_100095939 Ga0070713_1000959392 280
362 3300005437 Ga0070710_10103186 Ga0070710_101031862 280
363 3300005983 Ga0081540_1016558 Ga0081540_10165585 280
364 3300005985 Ga0081539_10000064 Ga0081539_100000642 280
365 3300025906 Ga0207699_10124561 Ga0207699_101245612 280
366 3300025915 Ga0207693_10016445 Ga0207693_100164457 280
367 3300031235 Ga0265330_10116335 Ga0265330_101163351 280
368 3300048915 Ga0496112_0000035 Ga0496112_0000035_98938_99831 280
369 3300001979 JGI24740J21852_10000570 JGI24740J21852_100005705 281
370 3300001990 JGI24737J22298_10004785 JGI24737J22298_100047853 281
371 3300003203 JGI25406J46586_10013397 JGI25406J46586_100133972 281
372 3300003659 JGI25404J52841_10004528 JGI25404J52841_100045281 281
373 3300003659 JGI25404J52841_10007061 JGI25404J52841_100070611 281
374 3300003659 JGI25404J52841_10007351 JGI25404J52841_100073512 281
375 3300003659 JGI25404J52841_10007389 JGI25404J52841_100073892 281
376 3300005329 Ga0070683_100037797 Ga0070683_1000377975 281
377 3300005329 Ga0070683_100225403 Ga0070683_1002254032 281
378 3300005334 Ga0068869_100072897 Ga0068869_1000728972 281
379 3300005337 Ga0070682_100252250 Ga0070682_1002522501 281
380 3300005337 Ga0070682_100309236 Ga0070682_1003092361 281
381 3300005339 Ga0070660_100357109 Ga0070660_1003571091 281
382 3300005344 Ga0070661_100117627 Ga0070661_1001176272 281
383 3300005347 Ga0070668_100046241 Ga0070668_1000462413 281
384 3300005347 Ga0070668_100120400 Ga0070668_1001204001 281
385 3300005347 Ga0070668_100297631 Ga0070668_1002976311 281
386 3300005354 Ga0070675_100340193 Ga0070675_1003401931 281
387 3300005355 Ga0070671_100035152 Ga0070671_1000351523 281
388 3300005355 Ga0070671_100314254 Ga0070671_1003142541 281
389 3300005356 Ga0070674_100042324 Ga0070674_1000423243 281
390 3300005356 Ga0070674_100056310 Ga0070674_1000563101 281
391 3300005356 Ga0070674_100424577 Ga0070674_1004245771 281
392 3300005364 Ga0070673_100367322 Ga0070673_1003673221 281
393 3300005366 Ga0070659_100016139 Ga0070659_1000161391 281
394 3300005366 Ga0070659_100105951 Ga0070659_1001059512 281
395 3300005366 Ga0070659_100307266 Ga0070659_1003072662 281
396 3300005434 Ga0070709_10240437 Ga0070709_102404371 281
397 3300005455 Ga0070663_100004604 Ga0070663_1000046042 281
398 3300005455 Ga0070663_100076375 Ga0070663_1000763752 281
399 3300005455 Ga0070663_100229337 Ga0070663_1002293372 281
400 3300005455 Ga0070663_100307637 Ga0070663_1003076371 281
401 3300005456 Ga0070678_100027488 Ga0070678_1000274882 281
402 3300005458 Ga0070681_10019890 Ga0070681_100198903 281
403 3300005458 Ga0070681_10139496 Ga0070681_101394962 281
404 3300005458 Ga0070681_10255009 Ga0070681_102550091 281
405 3300005466 Ga0070685_10098273 Ga0070685_100982732 281
406 3300005530 Ga0070679_100034506 Ga0070679_1000345061 281
407 3300005530 Ga0070679_100070822 Ga0070679_1000708222 281
408 3300005539 Ga0068853_100021754 Ga0068853_1000217543 281
409 3300005539 Ga0068853_100028465 Ga0068853_1000284653 281
410 3300005539 Ga0068853_100097555 Ga0068853_1000975552 281
411 3300005539 Ga0068853_100240107 Ga0068853_1002401072 281
412 3300005543 Ga0070672_100253068 Ga0070672_1002530682 281
413 3300005543 Ga0070672_100412787 Ga0070672_1004127871 281
414 3300005548 Ga0070665_100014247 Ga0070665_1000142472 281
415 3300005548 Ga0070665_100022311 Ga0070665_1000223113 281
416 3300005548 Ga0070665_100057086 Ga0070665_1000570863 281
417 3300005548 Ga0070665_100160327 Ga0070665_1001603272 281
418 3300005548 Ga0070665_100227451 Ga0070665_1002274511 281
419 3300005563 Ga0068855_100033709 Ga0068855_1000337092 281
420 3300005563 Ga0068855_100136247 Ga0068855_1001362472 281
421 3300005564 Ga0070664_100189368 Ga0070664_1001893681 281
422 3300005577 Ga0068857_100016536 Ga0068857_1000165364 281
423 3300005577 Ga0068857_100017840 Ga0068857_1000178405 281
424 3300005577 Ga0068857_100090238 Ga0068857_1000902382 281
425 3300005577 Ga0068857_100095293 Ga0068857_1000952932 281
426 3300005578 Ga0068854_100003786 Ga0068854_1000037863 281
427 3300005578 Ga0068854_100022987 Ga0068854_1000229873 281
428 3300005578 Ga0068854_100043384 Ga0068854_1000433843 281
429 3300005578 Ga0068854_100112458 Ga0068854_1001124582 281
430 3300005578 Ga0068854_100244220 Ga0068854_1002442202 281
431 3300005614 Ga0068856_100002838 Ga0068856_1000028382 281
432 3300005614 Ga0068856_100038677 Ga0068856_1000386771 281
433 3300005614 Ga0068856_100074451 Ga0068856_1000744512 281
434 3300005614 Ga0068856_100245193 Ga0068856_1002451932 281
435 3300005616 Ga0068852_100034244 Ga0068852_1000342442 281
436 3300005616 Ga0068852_100034788 Ga0068852_1000347882 281
437 3300005616 Ga0068852_100231241 Ga0068852_1002312412 281
438 3300005617 Ga0068859_100102722 Ga0068859_1001027222 281
439 3300005618 Ga0068864_100044923 Ga0068864_1000449232 281
440 3300005618 Ga0068864_100209235 Ga0068864_1002092352 281
441 3300005718 Ga0068866_10133392 Ga0068866_101333922 281
442 3300005834 Ga0068851_10000402 Ga0068851_1000040211 281
443 3300005841 Ga0068863_100421635 Ga0068863_1004216352 281
444 3300005842 Ga0068858_100171384 Ga0068858_1001713842 281
445 3300005843 Ga0068860_100031878 Ga0068860_1000318783 281
446 3300005843 Ga0068860_100537803 Ga0068860_1005378032 281
447 3300005844 Ga0068862_100195807 Ga0068862_1001958072 281
448 3300005937 Ga0081455_10005195 Ga0081455_1000519510 281
449 3300005937 Ga0081455_10105341 Ga0081455_101053412 281
450 3300005983 Ga0081540_1002478 Ga0081540_10024782 281
451 3300005983 Ga0081540_1003002 Ga0081540_10030029 281
452 3300005983 Ga0081540_1003538 Ga0081540_100353813 281
453 3300005983 Ga0081540_1010331 Ga0081540_10103313 281
454 3300005983 Ga0081540_1021616 Ga0081540_10216164 281
455 3300005983 Ga0081540_1028192 Ga0081540_10281922 281
456 3300005983 Ga0081540_1034870 Ga0081540_10348702 281
457 3300005983 Ga0081540_1036882 Ga0081540_10368822 281
458 3300005983 Ga0081540_1037256 Ga0081540_10372562 281
459 3300005985 Ga0081539_10004421 Ga0081539_100044215 281
460 3300005985 Ga0081539_10046439 Ga0081539_100464392 281
461 3300005985 Ga0081539_10131132 Ga0081539_101311321 281
462 3300006038 Ga0075365_10020178 Ga0075365_100201784 281
463 3300006048 Ga0075363_100045503 Ga0075363_1000455032 281
464 3300006048 Ga0075363_100134716 Ga0075363_1001347162 281
465 3300006173 Ga0070716_100081810 Ga0070716_1000818102 281
466 3300006175 Ga0070712_100261001 Ga0070712_1002610012 281
467 3300006177 Ga0075362_10058990 Ga0075362_100589902 281
468 3300006237 Ga0097621_100046443 Ga0097621_1000464433 281
469 3300006844 Ga0075428_100108955 Ga0075428_1001089552 281
470 3300006852 Ga0075433_10169168 Ga0075433_101691681 281
471 3300006871 Ga0075434_100039303 Ga0075434_1000393032 281
472 3300006871 Ga0075434_100146177 Ga0075434_1001461772 281
473 3300006931 Ga0097620_100102716 Ga0097620_1001027162 281
474 3300006942 Ga0099824_1004053 Ga0099824_10040533 281
475 3300006943 Ga0099822_1000007 Ga0099822_100000755 281
476 3300007265 Ga0099794_10014507 Ga0099794_100145072 281
477 3300007788 Ga0099795_10007946 Ga0099795_100079462 281
478 3300007788 Ga0099795_10079999 Ga0099795_100799992 281
479 3300007788 Ga0099795_10112859 Ga0099795_101128591 281
480 3300009092 Ga0105250_10024567 Ga0105250_100245672 281
481 3300009093 Ga0105240_10004430 Ga0105240_1000443014 281
482 3300009093 Ga0105240_10008378 Ga0105240_100083782 281
483 3300009093 Ga0105240_10021247 Ga0105240_100212476 281
484 3300009093 Ga0105240_10187454 Ga0105240_101874542 281
485 3300009094 Ga0111539_10488979 Ga0111539_104889792 281
486 3300009098 Ga0105245_10044805 Ga0105245_100448052 281
487 3300009098 Ga0105245_10271604 Ga0105245_102716042 281
488 3300009101 Ga0105247_10120819 Ga0105247_101208192 281
489 3300009147 Ga0114129_10455552 Ga0114129_104555522 281
490 3300009174 Ga0105241_10026741 Ga0105241_100267413 281
491 3300009174 Ga0105241_10156616 Ga0105241_101566162 281
492 3300009174 Ga0105241_10226545 Ga0105241_102265451 281
493 3300009174 Ga0105241_10293797 Ga0105241_102937972 281
494 3300009177 Ga0105248_10065189 Ga0105248_100651892 281
495 3300009545 Ga0105237_10059559 Ga0105237_100595592 281
496 3300009545 Ga0105237_10081851 Ga0105237_100818512 281
497 3300009545 Ga0105237_10489285 Ga0105237_104892852 281
498 3300009551 Ga0105238_10006342 Ga0105238_100063426 281
499 3300009551 Ga0105238_10007309 Ga0105238_100073094 281
500 3300009551 Ga0105238_10009143 Ga0105238_100091432 281
501 3300009551 Ga0105238_10014918 Ga0105238_100149183 281
502 3300009551 Ga0105238_10077621 Ga0105238_100776212 281
503 3300010375 Ga0105239_10020173 Ga0105239_100201736 281
504 3300010375 Ga0105239_10029909 Ga0105239_100299092 281
505 3300010375 Ga0105239_10032328 Ga0105239_100323283 281
506 3300010375 Ga0105239_10116920 Ga0105239_101169203 281
507 3300010375 Ga0105239_10123837 Ga0105239_101238372 281
508 3300011119 Ga0105246_10114144 Ga0105246_101141442 281
509 3300013104 Ga0157370_10354215 Ga0157370_103542151 281
510 3300013105 Ga0157369_10038612 Ga0157369_100386121 281
511 3300013296 Ga0157374_10006943 Ga0157374_100069433 281
512 3300013306 Ga0163162_10013288 Ga0163162_100132885 281
513 3300013308 Ga0157375_10120330 Ga0157375_101203302 281
514 3300014325 Ga0163163_10045070 Ga0163163_100450703 281
515 3300014325 Ga0163163_10764770 Ga0163163_107647701 281
516 3300014326 Ga0157380_10065341 Ga0157380_100653412 281
517 3300014969 Ga0157376_10002020 Ga0157376_100020207 281
518 3300014969 Ga0157376_10053794 Ga0157376_100537942 281
519 3300014969 Ga0157376_10348463 Ga0157376_103484632 281
520 3300017792 Ga0163161_10080958 Ga0163161_100809581 281
521 3300025297 Ga0209758_1017728 Ga0209758_10177283 281
522 3300025297 Ga0209758_1020717 Ga0209758_10207172 281
523 3300025321 Ga0207656_10003907 Ga0207656_100039076 281
524 3300025899 Ga0207642_10151408 Ga0207642_101514082 281
525 3300025901 Ga0207688_10079684 Ga0207688_100796842 281
526 3300025904 Ga0207647_10004518 Ga0207647_100045182 281
527 3300025906 Ga0207699_10125180 Ga0207699_101251802 281
528 3300025907 Ga0207645_10036807 Ga0207645_100368072 281
529 3300025908 Ga0207643_10029932 Ga0207643_100299322 281
530 3300025911 Ga0207654_10000058 Ga0207654_1000005822 281
531 3300025912 Ga0207707_10000818 Ga0207707_1000081828 281
532 3300025912 Ga0207707_10001462 Ga0207707_100014624 281
533 3300025912 Ga0207707_10051302 Ga0207707_100513021 281
534 3300025912 Ga0207707_10178818 Ga0207707_101788182 281
535 3300025912 Ga0207707_10248631 Ga0207707_102486312 281
536 3300025913 Ga0207695_10000453 Ga0207695_100004538 281
537 3300025913 Ga0207695_10285615 Ga0207695_102856152 281
538 3300025914 Ga0207671_10065046 Ga0207671_100650462 281
539 3300025914 Ga0207671_10075209 Ga0207671_100752092 281
540 3300025915 Ga0207693_10022371 Ga0207693_100223712 281
541 3300025915 Ga0207693_10242097 Ga0207693_102420972 281
542 3300025916 Ga0207663_10243466 Ga0207663_102434662 281
543 3300025918 Ga0207662_10306421 Ga0207662_103064211 281
544 3300025919 Ga0207657_10001095 Ga0207657_100010958 281
545 3300025921 Ga0207652_10003169 Ga0207652_100031694 281
546 3300025921 Ga0207652_10006226 Ga0207652_100062264 281
547 3300025922 Ga0207646_10326769 Ga0207646_103267692 281
548 3300025924 Ga0207694_10000564 Ga0207694_1000056419 281
549 3300025924 Ga0207694_10023140 Ga0207694_100231403 281
550 3300025931 Ga0207644_10077473 Ga0207644_100774732 281
551 3300025932 Ga0207690_10101022 Ga0207690_101010222 281
552 3300025932 Ga0207690_10428836 Ga0207690_104288361 281
553 3300025933 Ga0207706_10067990 Ga0207706_100679903 281
554 3300025933 Ga0207706_10117341 Ga0207706_101173412 281
555 3300025934 Ga0207686_10046294 Ga0207686_100462942 281
556 3300025935 Ga0207709_10364651 Ga0207709_103646511 281
557 3300025937 Ga0207669_10017701 Ga0207669_100177011 281
558 3300025939 Ga0207665_10026200 Ga0207665_100262004 281
559 3300025939 Ga0207665_10165683 Ga0207665_101656832 281
560 3300025940 Ga0207691_10033936 Ga0207691_100339363 281
561 3300025940 Ga0207691_10408155 Ga0207691_104081551 281
562 3300025944 Ga0207661_10037684 Ga0207661_100376844 281
563 3300025944 Ga0207661_10228839 Ga0207661_102288392 281
564 3300025945 Ga0207679_10036408 Ga0207679_100364082 281
565 3300025949 Ga0207667_10009339 Ga0207667_100093394 281
566 3300025949 Ga0207667_10018267 Ga0207667_100182673 281
567 3300025949 Ga0207667_10037421 Ga0207667_100374214 281
568 3300025961 Ga0207712_10015222 Ga0207712_100152223 281
569 3300025972 Ga0207668_10014433 Ga0207668_100144332 281
570 3300025972 Ga0207668_10394418 Ga0207668_103944182 281
571 3300025981 Ga0207640_10021908 Ga0207640_100219082 281
572 3300025981 Ga0207640_10034634 Ga0207640_100346343 281
573 3300025981 Ga0207640_10139644 Ga0207640_101396442 281
574 3300025981 Ga0207640_10175336 Ga0207640_101753361 281
575 3300026035 Ga0207703_10177174 Ga0207703_101771741 281
576 3300026035 Ga0207703_10392333 Ga0207703_103923331 281
577 3300026041 Ga0207639_10001424 Ga0207639_100014247 281
578 3300026041 Ga0207639_10008949 Ga0207639_100089494 281
579 3300026041 Ga0207639_10134168 Ga0207639_101341682 281
580 3300026041 Ga0207639_10224901 Ga0207639_102249012 281
581 3300026067 Ga0207678_10010067 Ga0207678_100100679 281
582 3300026067 Ga0207678_10015000 Ga0207678_100150002 281
583 3300026067 Ga0207678_10027531 Ga0207678_100275312 281
584 3300026078 Ga0207702_10000004 Ga0207702_10000004205 281
585 3300026078 Ga0207702_10028205 Ga0207702_100282053 281
586 3300026078 Ga0207702_10071595 Ga0207702_100715953 281
587 3300026095 Ga0207676_10059148 Ga0207676_100591482 281
588 3300026116 Ga0207674_10005590 Ga0207674_100055908 281
589 3300026116 Ga0207674_10006707 Ga0207674_1000670714 281
590 3300026116 Ga0207674_10014421 Ga0207674_100144214 281
591 3300026116 Ga0207674_10037609 Ga0207674_100376095 281
592 3300026118 Ga0207675_100015080 Ga0207675_1000150805 281
593 3300026118 Ga0207675_100281703 Ga0207675_1002817032 281
594 3300026121 Ga0207683_10048552 Ga0207683_100485522 281
595 3300026121 Ga0207683_10266370 Ga0207683_102663701 281
596 3300026121 Ga0207683_10467270 Ga0207683_104672702 281
597 3300026142 Ga0207698_10014462 Ga0207698_100144626 281
598 3300026142 Ga0207698_10048403 Ga0207698_100484032 281
599 3300027357 Ga0209589_1000021 Ga0209589_100002165 281
600 3300027361 Ga0209489_100028 Ga0209489_10002865 281
601 3300027363 Ga0209700_100037 Ga0209700_10003765 281
602 3300027512 Ga0209179_1001223 Ga0209179_10012232 281
603 3300027512 Ga0209179_1004630 Ga0209179_10046302 281
604 3300027671 Ga0209588_1006984 Ga0209588_10069843 281
605 3300028379 Ga0268266_10000680 Ga0268266_1000068039 281
606 3300028379 Ga0268266_10012906 Ga0268266_100129064 281
607 3300028379 Ga0268266_10080249 Ga0268266_100802492 281
608 3300028380 Ga0268265_10020055 Ga0268265_100200553 281
609 3300028381 Ga0268264_10179065 Ga0268264_101790651 281
610 3300028786 Ga0307517_10000942 Ga0307517_100009425 281
611 3300028786 Ga0307517_10137157 Ga0307517_101371572 281
612 3300028794 Ga0307515_10068562 Ga0307515_100685624 281
613 3300031235 Ga0265330_10006512 Ga0265330_100065123 281
614 3300031235 Ga0265330_10040805 Ga0265330_100408052 281
615 3300031247 Ga0265340_10002209 Ga0265340_100022094 281
616 3300031249 Ga0265339_10001277 Ga0265339_100012777 281
617 3300031249 Ga0265339_10117511 Ga0265339_101175111 281
618 3300031344 Ga0265316_10157310 Ga0265316_101573101 281
619 3300031344 Ga0265316_10333189 Ga0265316_103331891 281
620 3300031507 Ga0307509_10107620 Ga0307509_101076202 281
621 3300031548 Ga0307408_100603308 Ga0307408_1006033081 281
622 3300031616 Ga0307508_10000108 Ga0307508_100001085 281
623 3300031616 Ga0307508_10012397 Ga0307508_100123972 281
624 3300031616 Ga0307508_10037820 Ga0307508_100378203 281
625 3300031711 Ga0265314_10002048 Ga0265314_1000204816 281
626 3300031711 Ga0265314_10066862 Ga0265314_100668621 281
627 3300031712 Ga0265342_10189225 Ga0265342_101892252 281
628 3300031730 Ga0307516_10044620 Ga0307516_100446203 281
629 3300031730 Ga0307516_10206850 Ga0307516_102068502 281
630 3300031824 Ga0307413_10179716 Ga0307413_101797162 281
631 3300032126 Ga0307415_100023277 Ga0307415_1000232774 281
632 3300033180 Ga0307510_10003483 Ga0307510_100034831 281
633 3300033180 Ga0307510_10297932 Ga0307510_102979322 281
634 3300034816 Ga0373930_0020576 Ga0373930_0020576_352_1248 281
635 3300035086 Ga0373934_0005625 Ga0373934_0005625_1913_2812 281
636 3300035086 Ga0373934_0013237 Ga0373934_0013237_1835_2731 281
637 3300035086 Ga0373934_0028140 Ga0373934_0028140_698_1594 281
638 3300035090 Ga0373949_0028848 Ga0373949_0028848_64_960 281
639 3300035111 Ga0373923_0024780 Ga0373923_0024780_844_1740 281
640 3300035111 Ga0373923_0054009 Ga0373923_0054009_699_1595 281
641 3300035111 Ga0373923_0081850 Ga0373923_0081850_204_1100 281
642 3300035112 Ga0373932_0029061 Ga0373932_0029061_25_921 281
643 3300035113 Ga0373936_0062179 Ga0373936_0062179_19_915 281
644 3300035114 Ga0373939_0041433 Ga0373939_0041433_364_1260 281
645 3300035116 Ga0373945_0019064 Ga0373945_0019064_1038_1934 281
646 3300035116 Ga0373945_0025780 Ga0373945_0025780_1010_1906 281
647 3300035117 Ga0373953_0000037 Ga0373953_0000037_14823_15722 281
648 3300035118 Ga0373954_0000242 Ga0373954_0000242_18421_19320 281
649 3300035118 Ga0373954_0033727 Ga0373954_0033727_425_1321 281
650 3300035119 Ga0373956_0000631 Ga0373956_0000631_8932_9831 281
651 3300035120 Ga0373957_0000417 Ga0373957_0000417_5864_6760 281
652 3300035120 Ga0373957_0071680 Ga0373957_0071680_17_913 281
653 3300035170 Ga0373943_0002237 Ga0373943_0002237_990_1886 281
654 3300035171 Ga0373946_0006294 Ga0373946_0006294_3131_4027 281
655 3300035171 Ga0373946_0061766 Ga0373946_0061766_21_917 281
656 3300035172 Ga0373955_0001044 Ga0373955_0001044_10328_11227 281
657 3300035172 Ga0373955_0005369 Ga0373955_0005369_3968_4864 281
658 3300035172 Ga0373955_0048879 Ga0373955_0048879_479_1375 281
659 3300035172 Ga0373955_0247208 Ga0373955_0247208_120_1016 281
660 3300035410 Ga0373924_0023154 Ga0373924_0023154_340_1236 281
661 3300035410 Ga0373924_0042213 Ga0373924_0042213_316_1212 281
662 3300035410 Ga0373924_0045195 Ga0373924_0045195_883_1782 281
663 3300035691 Ga0373931_0269970 Ga0373931_0269970_35_931 281
664 3300035692 Ga0373935_0000500 Ga0373935_0000500_13534_14430 281
665 3300035695 Ga0373927_0000337 Ga0373927_0000337_11381_12277 281
666 3300035695 Ga0373927_0006763 Ga0373927_0006763_4732_5628 281
667 3300035695 Ga0373927_0022849 Ga0373927_0022849_2858_3757 281
668 3300035695 Ga0373927_0029973 Ga0373927_0029973_2517_3413 281
669 3300035724 Ga0373933_0000487 Ga0373933_0000487_2952_3851 281
670 3300035724 Ga0373933_0044281 Ga0373933_0044281_388_1284 281
671 3300035725 Ga0373947_0002043 Ga0373947_0002043_6818_7714 281
672 3300035725 Ga0373947_0005807 Ga0373947_0005807_5881_6777 281
673 3300035725 Ga0373947_0111496 Ga0373947_0111496_570_1469 281
674 3300035725 Ga0373947_0147476 Ga0373947_0147476_310_1206 281
675 3300036401 Ga0373937_0038100 Ga0373937_0038100_976_1875 281
676 3300036401 Ga0373937_0125555 Ga0373937_0125555_540_1436 281
677 3300036401 Ga0373937_0147029 Ga0373937_0147029_881_1777 281
678 3300036401 Ga0373937_0187235 Ga0373937_0187235_596_1492 281
679 3300037068 Ga0373925_0003157 Ga0373925_0003157_5960_6856 281
680 3300037068 Ga0373925_0013825 Ga0373925_0013825_1307_2203 281
681 3300037068 Ga0373925_0153495 Ga0373925_0153495_519_1415 281
682 3300037471 Ga0395905_0151758 Ga0395905_0151758_340_1236 281
683 3300037471 Ga0395905_0327503 Ga0395905_0327503_419_1315 281
684 3300039437 Ga0436365_0398617 Ga0436365_0398617_1046_1942 281
685 3300039437 Ga0436365_0675687 Ga0436365_0675687_166_1062 281
686 3300041512 Ga0451853_3231558 Ga0451853_3231558_257_1153 281
687 3300045976 Ga0466967_0271578 Ga0466967_0271578_121_1017 281
688 3300046454 Ga0495592_0052315 Ga0495592_0052315_398_1294 281
689 3300046454 Ga0495592_0066449 Ga0495592_0066449_1087_1986 281
690 3300046455 Ga0495603_0001388 Ga0495603_0001388_10302_11198 281
691 3300046455 Ga0495603_0002436 Ga0495603_0002436_2355_3251 281
692 3300046455 Ga0495603_0005675 Ga0495603_0005675_4179_5075 281
693 3300046458 Ga0495591_041077 Ga0495591_041077_273_1169 281
694 3300046459 Ga0495629_0000124 Ga0495629_0000124_23015_23914 281
695 3300046459 Ga0495629_0000727 Ga0495629_0000727_15184_16080 281
696 3300046461 Ga0495641_0007117 Ga0495641_0007117_4474_5370 281
697 3300046461 Ga0495641_0079497 Ga0495641_0079497_79_975 281
698 3300046462 Ga0495651_0039024 Ga0495651_0039024_1712_2611 281
699 3300046462 Ga0495651_0041061 Ga0495651_0041061_366_1262 281
700 3300046462 Ga0495651_0280975 Ga0495651_0280975_199_1095 281
701 3300046463 Ga0495653_0000465 Ga0495653_0000465_4226_5125 281
702 3300046463 Ga0495653_0041812 Ga0495653_0041812_1567_2463 281
703 3300046472 Ga0495580_0002297 Ga0495580_0002297_5072_5968 281
704 3300046472 Ga0495580_0031584 Ga0495580_0031584_2322_3218 281
705 3300046472 Ga0495580_0034287 Ga0495580_0034287_1914_2810 281
706 3300046473 Ga0495582_0000494 Ga0495582_0000494_2878_3774 281
707 3300046473 Ga0495582_0020335 Ga0495582_0020335_1650_2546 281
708 3300046475 Ga0495639_0000119 Ga0495639_0000119_28156_29052 281
709 3300046475 Ga0495639_0091485 Ga0495639_0091485_67_963 281
710 3300046476 Ga0495662_0001142 Ga0495662_0001142_12154_13050 281
711 3300046476 Ga0495662_0074939 Ga0495662_0074939_471_1367 281
712 3300046477 Ga0495664_0001550 Ga0495664_0001550_9167_10063 281
713 3300046477 Ga0495664_0007218 Ga0495664_0007218_11_907 281
714 3300046477 Ga0495664_0012516 Ga0495664_0012516_2066_2962 281
715 3300046477 Ga0495664_0055229 Ga0495664_0055229_518_1414 281
716 3300046492 Ga0495585_0010815 Ga0495585_0010815_2087_2983 281
717 3300046492 Ga0495585_0017878 Ga0495585_0017878_1157_2053 281
718 3300046499 Ga0495594_0031156 Ga0495594_0031156_353_1249 281
719 3300046500 Ga0495596_0042640 Ga0495596_0042640_244_1140 281
720 3300046500 Ga0495596_0052406 Ga0495596_0052406_508_1404 281
721 3300046511 Ga0495608_0001489 Ga0495608_0001489_5567_6466 281
722 3300046511 Ga0495608_0068946 Ga0495608_0068946_880_1776 281
723 3300046511 Ga0495608_0087706 Ga0495608_0087706_397_1293 281
724 3300046514 Ga0495618_0010417 Ga0495618_0010417_1294_2190 281
725 3300046514 Ga0495618_0136834 Ga0495618_0136834_109_1005 281
726 3300046515 Ga0495620_0030968 Ga0495620_0030968_497_1393 281
727 3300046516 Ga0495628_0006943 Ga0495628_0006943_1070_1966 281
728 3300046516 Ga0495628_0017483 Ga0495628_0017483_3605_4501 281
729 3300046516 Ga0495628_0023788 Ga0495628_0023788_2502_3401 281
730 3300046517 Ga0495630_0140250 Ga0495630_0140250_601_1497 281
731 3300046517 Ga0495630_0257369 Ga0495630_0257369_22_918 281
732 3300046518 Ga0495631_0008583 Ga0495631_0008583_1826_2722 281
733 3300046518 Ga0495631_0123369 Ga0495631_0123369_153_1049 281
734 3300046526 Ga0495666_0030645 Ga0495666_0030645_1582_2478 281
735 3300046529 Ga0495652_0001377 Ga0495652_0001377_7493_8392 281
736 3300046529 Ga0495652_0069696 Ga0495652_0069696_618_1514 281
737 3300046529 Ga0495652_0170570 Ga0495652_0170570_361_1257 281
738 3300046531 Ga0495665_0000251 Ga0495665_0000251_15186_16082 281
739 3300046531 Ga0495665_0015050 Ga0495665_0015050_2993_3889 281
740 3300046533 Ga0495640_0026258 Ga0495640_0026258_2377_3273 281
741 3300046533 Ga0495640_0036134 Ga0495640_0036134_830_1726 281
742 3300046533 Ga0495640_0205877 Ga0495640_0205877_168_1064 281
743 3300046536 Ga0495587_0033400 Ga0495587_0033400_1671_2567 281
744 3300046536 Ga0495587_0048659 Ga0495587_0048659_525_1424 281
745 3300046537 Ga0495598_0026992 Ga0495598_0026992_315_1211 281
746 3300046543 Ga0495645_0017210 Ga0495645_0017210_3695_4594 281
747 3300046543 Ga0495645_0258808 Ga0495645_0258808_206_1102 281
748 3300046557 Ga0495622_0038571 Ga0495622_0038571_78_974 281
749 3300046559 Ga0495667_0001146 Ga0495667_0001146_525_1424 281
750 3300046559 Ga0495667_0027511 Ga0495667_0027511_445_1341 281
751 3300046559 Ga0495667_0036446 Ga0495667_0036446_922_1818 281
752 3300046642 Ga0495634_0000886 Ga0495634_0000886_1730_2626 281
753 3300046642 Ga0495634_0014430 Ga0495634_0014430_4603_5502 281
754 3300046642 Ga0495634_0053801 Ga0495634_0053801_585_1481 281
755 3300046663 Ga0495635_0000786 Ga0495635_0000786_18824_19723 281
756 3300046663 Ga0495635_0001208 Ga0495635_0001208_1359_2255 281
757 3300046663 Ga0495635_0019516 Ga0495635_0019516_1809_2705 281
758 3300046663 Ga0495635_0060747 Ga0495635_0060747_425_1321 281
759 3300046664 Ga0495659_0011408 Ga0495659_0011408_84_980 281
760 3300046664 Ga0495659_0041774 Ga0495659_0041774_663_1559 281
761 3300046674 Ga0495588_0017578 Ga0495588_0017578_2413_3309 281
762 3300046674 Ga0495588_0019036 Ga0495588_0019036_1199_2095 281
763 3300046674 Ga0495588_0204762 Ga0495588_0204762_28_924 281
764 3300046675 Ga0495657_0001030 Ga0495657_0001030_6716_7615 281
765 3300046678 Ga0495599_0031137 Ga0495599_0031137_1256_2152 281
766 3300046678 Ga0495599_0092967 Ga0495599_0092967_458_1357 281
767 3300046679 Ga0495623_0014400 Ga0495623_0014400_1584_2483 281
768 3300046679 Ga0495623_0172304 Ga0495623_0172304_42_938 281
769 3300046680 Ga0495646_0023325 Ga0495646_0023325_1011_1910 281
770 3300046680 Ga0495646_0033655 Ga0495646_0033655_822_1718 281
771 3300046681 Ga0495647_0000085 Ga0495647_0000085_16078_16974 281
772 3300046683 Ga0495658_0000135 Ga0495658_0000135_29349_30245 281
773 3300046683 Ga0495658_0012816 Ga0495658_0012816_2901_3797 281
774 3300046683 Ga0495658_0272621 Ga0495658_0272621_143_1039 281
775 3300046684 Ga0495669_0000707 Ga0495669_0000707_8006_8902 281
776 3300046689 Ga0495613_0001617 Ga0495613_0001617_5569_6465 281
777 3300046689 Ga0495613_0073692 Ga0495613_0073692_1103_2002 281
778 3300046689 Ga0495613_0148177 Ga0495613_0148177_623_1519 281
779 3300046690 Ga0495624_0000144 Ga0495624_0000144_41042_41938 281
780 3300046690 Ga0495624_0032598 Ga0495624_0032598_351_1247 281
781 3300046809 Ga0495600_0000768 Ga0495600_0000768_15346_16245 281
782 3300046809 Ga0495600_0046877 Ga0495600_0046877_1010_1906 281
783 3300047315 Ga0495581_0000421 Ga0495581_0000421_2751_3647 281
784 3300047315 Ga0495581_0016438 Ga0495581_0016438_148_1044 281
785 3300047315 Ga0495581_0079139 Ga0495581_0079139_101_997 281
786 3300047315 Ga0495581_0253921 Ga0495581_0253921_49_945 281
787 3300047317 Ga0495604_0009371 Ga0495604_0009371_1814_2713 281
788 3300047318 Ga0495636_0031056 Ga0495636_0031056_316_1212 281
789 3300047319 Ga0495674_0001274 Ga0495674_0001274_10724_11620 281
790 3300047319 Ga0495674_0035560 Ga0495674_0035560_1364_2263 281
791 3300047319 Ga0495674_0067280 Ga0495674_0067280_932_1828 281
792 3300047319 Ga0495674_0082014 Ga0495674_0082014_684_1580 281
793 3300047321 Ga0495676_0012854 Ga0495676_0012854_4984_5880 281
794 3300047321 Ga0495676_0020657 Ga0495676_0020657_2566_3462 281
795 3300047321 Ga0495676_0096406 Ga0495676_0096406_1009_1908 281
796 3300047321 Ga0495676_0169786 Ga0495676_0169786_76_972 281
797 3300047322 Ga0495680_0001556 Ga0495680_0001556_21659_22558 281
798 3300047322 Ga0495680_0050712 Ga0495680_0050712_1594_2490 281
799 3300047322 Ga0495680_0292552 Ga0495680_0292552_49_945 281
800 3300047444 Ga0495675_0003063 Ga0495675_0003063_6588_7487 281
801 3300047444 Ga0495675_0019876 Ga0495675_0019876_1188_2084 281
802 3300047446 Ga0495679_044115 Ga0495679_044115_111_1007 281
803 3300047469 Ga0495673_0056264 Ga0495673_0056264_227_1123 281
804 3300047470 Ga0495681_0105548 Ga0495681_0105548_112_1008 281
805 3300047471 Ga0495684_0000169 Ga0495684_0000169_27345_28244 281
806 3300047471 Ga0495684_0033825 Ga0495684_0033825_646_1542 281
807 3300047471 Ga0495684_0084824 Ga0495684_0084824_794_1690 281
808 3300047472 Ga0495686_0037943 Ga0495686_0037943_1473_2369 281
809 3300047673 Ga0495593_0000007 Ga0495593_0000007_9868_10764 281
810 3300047673 Ga0495593_0004906 Ga0495593_0004906_4978_5877 281
811 3300048088 Ga0495602_0018573 Ga0495602_0018573_3909_4808 281
812 3300048089 Ga0495614_0009706 Ga0495614_0009706_2458_3354 281
813 3300048089 Ga0495614_0061335 Ga0495614_0061335_440_1336 281
814 3300048091 Ga0495626_0102882 Ga0495626_0102882_17_913 281
815 3300048903 Ga0496100_0012929 Ga0496100_0012929_2248_3144 281
816 3300048903 Ga0496100_0108105 Ga0496100_0108105_823_1731 281
817 3300048903 Ga0496100_0116295 Ga0496100_0116295_529_1425 281
818 3300048904 Ga0496101_0006277 Ga0496101_0006277_6183_7079 281
819 3300048904 Ga0496101_0030669 Ga0496101_0030669_2796_3692 281
820 3300048904 Ga0496101_0064590 Ga0496101_0064590_1541_2437 281
821 3300048904 Ga0496101_0172043 Ga0496101_0172043_578_1474 281
822 3300048905 Ga0496102_0008119 Ga0496102_0008119_1333_2229 281
823 3300048906 Ga0496103_0042331 Ga0496103_0042331_1321_2217 281
824 3300048907 Ga0496104_0080044 Ga0496104_0080044_2097_2993 281
825 3300048909 Ga0496106_0010158 Ga0496106_0010158_5997_6905 281
826 3300048909 Ga0496106_0014006 Ga0496106_0014006_2988_3884 281
827 3300048909 Ga0496106_0025052 Ga0496106_0025052_1308_2204 281
828 3300048909 Ga0496106_0074110 Ga0496106_0074110_824_1720 281
829 3300048909 Ga0496106_0093924 Ga0496106_0093924_292_1188 281
830 3300048910 Ga0496107_0005366 Ga0496107_0005366_4103_4999 281
831 3300048910 Ga0496107_0289447 Ga0496107_0289447_74_970 281
832 3300048911 Ga0496108_0007489 Ga0496108_0007489_1031_1939 281
833 3300048911 Ga0496108_0013286 Ga0496108_0013286_4041_4937 281
834 3300048911 Ga0496108_0029893 Ga0496108_0029893_823_1719 281
835 3300048911 Ga0496108_0300339 Ga0496108_0300339_205_1101 281
836 3300048912 Ga0496109_0003252 Ga0496109_0003252_417_1325 281
837 3300048912 Ga0496109_0155032 Ga0496109_0155032_903_1799 281
838 3300048912 Ga0496109_0158178 Ga0496109_0158178_1093_1989 281
839 3300048912 Ga0496109_0191817 Ga0496109_0191817_438_1334 281
840 3300048912 Ga0496109_0293130 Ga0496109_0293130_578_1474 281
841 3300048913 Ga0496110_0079965 Ga0496110_0079965_1309_2205 281
842 3300048915 Ga0496112_0087087 Ga0496112_0087087_666_1562 281
843 3300048915 Ga0496112_0098794 Ga0496112_0098794_30_926 281
844 3300048915 Ga0496112_0150319 Ga0496112_0150319_476_1372 281
845 3300048915 Ga0496112_0270112 Ga0496112_0270112_340_1236 281
846 3300048916 Ga0496113_0012420 Ga0496113_0012420_4241_5137 281
847 3300048916 Ga0496113_0063988 Ga0496113_0063988_727_1623 281
848 3300048917 Ga0496114_0061781 Ga0496114_0061781_722_1618 281
849 3300048918 Ga0496115_0002653 Ga0496115_0002653_2620_3516 281
850 3300048918 Ga0496115_0012788 Ga0496115_0012788_5020_5916 281
851 3300048918 Ga0496115_0047885 Ga0496115_0047885_684_1580 281
852 3300048918 Ga0496115_0049186 Ga0496115_0049186_1480_2376 281
853 3300048924 Ga0496121_0000893 Ga0496121_0000893_37283_38179 281
854 3300048924 Ga0496121_0106495 Ga0496121_0106495_1093_1989 281
855 3300048927 Ga0496124_0068930 Ga0496124_0068930_434_1444 281
856 3300048928 Ga0496125_0090937 Ga0496125_0090937_620_1618 281
857 3300048929 Ga0496126_0014074 Ga0496126_0014074_6182_7078 281
858 3300048929 Ga0496126_0021709 Ga0496126_0021709_4741_5637 281
859 3300048929 Ga0496126_0072585 Ga0496126_0072585_1109_2005 281
860 3300048929 Ga0496126_0148674 Ga0496126_0148674_835_1731 281
861 3300048929 Ga0496126_0165177 Ga0496126_0165177_946_1842 281
862 3300049575 Ga0501039_0390387 Ga0501039_0390387_53_949 281
863 3300050490 nmdc:mga03n38_100_c1 nmdc:mga03n38_100_c1_5263_6159 281
864 3300050494 nmdc:mga06z11_13204_c1 nmdc:mga06z11_13204_c1_2142_3038 281
865 3300050496 nmdc:mga07m45_52329_c1 nmdc:mga07m45_52329_c1_464_1360 281
866 3300050507 nmdc:mga05p37_172909_c1 nmdc:mga05p37_172909_c1_222_1118 281
867 3300050512 nmdc:mga0n895_53433_c1 nmdc:mga0n895_53433_c1_305_1201 281
868 3300050515 nmdc:mga0a205_506851_c1 nmdc:mga0a205_506851_c1_129_1025 281
869 3300053077 Ga0495601_0015001 Ga0495601_0015001_2128_3024 281
870 3300053077 Ga0495601_0030171 Ga0495601_0030171_943_1842 281
871 3300053077 Ga0495601_0093245 Ga0495601_0093245_343_1239 281
872 3300053078 Ga0495612_0014984 Ga0495612_0014984_301_1197 281
873 3300053078 Ga0495612_0044248 Ga0495612_0044248_791_1687 281
874 3300053083 Ga0495655_0050413 Ga0495655_0050413_192_1088 281
875 3300053084 Ga0495595_0000329 Ga0495595_0000329_16973_17872 281
876 3300053085 Ga0495619_0025638 Ga0495619_0025638_2282_3178 281
877 3300053094 Ga0500566_0001277 Ga0500566_0001277_4462_5385 281
878 3300053096 Ga0500641_0003982 Ga0500641_0003982_1334_2230 281
879 3300053096 Ga0500641_0006532 Ga0500641_0006532_822_1718 281
880 3300053102 Ga0500554_002467 Ga0500554_002467_682_1578 281
881 3300053119 Ga0500595_000258 Ga0500595_000258_10941_11864 281
882 3300053119 Ga0500595_002380 Ga0500595_002380_3775_4671 281
883 3300053119 Ga0500595_014145 Ga0500595_014145_1891_2787 281
884 3300053133 Ga0500655_006652 Ga0500655_006652_345_1241 281
885 3300053136 Ga0500559_0000244 Ga0500559_0000244_20704_21600 281
886 3300053150 Ga0500603_000762 Ga0500603_000762_2239_3135 281
887 3300053178 Ga0500637_0000140 Ga0500637_0000140_4731_5627 281
888 3300053178 Ga0500637_0000147 Ga0500637_0000147_13472_14395 281
889 3300053735 Ga0500596_003380 Ga0500596_003380_1093_1989 281
890 3300055283 Ga0500661_003026 Ga0500661_003026_1890_2813 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

206

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

223

0.84

PF08659

KR

KR domain

6

133

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvo-assembly3.cif.gz_B crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) 0.9418 1 266
3e03-assembly1.cif.gz_C-2 crystal structure of a putative dehydrogenase from xanthomonas campestris 0.9414 3 266
3kvo-assembly3.cif.gz_A crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) 0.9351 1 265
3sc4-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile 0.922 3 265
3e03-assembly3.cif.gz_A-4 crystal structure of a putative dehydrogenase from xanthomonas campestris 0.914 3 267
ID Description Score Start End Superfamily
af_Q6P5L8_1_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 1 265 3.40.50.720
af_Q6P5L8_1_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9093 1 265 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8727 54 188 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8702 91 185 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8561 1 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0D8XLV9-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family protein 0.9934 75 187 GO:0005739
AF-A0A0D8XLV9-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family protein 0.9762 75 187 GO:0005739
AF-A0A1A9NGH1-F1-model_v4 Short chain dehydrogenase 0.966 3 264
AF-A0A433A4X0-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9641 1 269
AF-A0A5C8B4H1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9486 7 266 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.62 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map