F484837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 890 | 419 | 841 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_001412|Ga0500643_001412_7571_8398 |
| Length | 275 |
| Sequence | MSLKDRTLFITGASRGIGKAIALRAARDGANIVVAAKTAEENAKLEGTIHSAAREIEAAGGRALAIQLDIRDDAAIAVAMKQAAERFGGIDVLVNNASAISLTGTLATPMKRFDLMLGVNARGTFACSQAAIPYLRKSANPHVLTLSPPLNLKPAWLKDHVAYTYSKYGMSFCTMGMAEEFRAEGIAFNSLWPRTIIDTAALRMIPGIDVKKARRPEILSDAAYAILNRPSRECTGNFFIDDQVLASAGIRDLAAYSVQPGAQDLHLDLFVDPVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 14 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 15 | 2791355199 | |||
| 16 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 17 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 18 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 19 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 20 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 21 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 22 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 23 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 24 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 25 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 26 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 27 | 2904699407 | |||
| 28 | 2906610324 | |||
| 29 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 30 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 31 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 32 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 33 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 34 | 2922425934 | |||
| 35 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 36 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 37 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 38 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 39 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 128 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 129 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 130 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 133 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 389 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 390 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 392 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 397 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 398 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 403 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 408 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 409 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 412 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 413 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 414 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 415 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 416 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 417 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 418 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 419 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.81 |
| Metatranscriptomes | 0.11 |
| Isolates | 5.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.06 |
| Nodule | 4.38 |
| Rhizoplane | 7.3 |
| Rhizosphere | 76.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000570 | 3300001979 | Bacteria | 15869 |
| 2 | JGI24737J22298_10004785 | 3300001990 | Bacteria | 4702 |
| 3 | JGI25406J46586_10000241 | 3300003203 | Bacteria | 24433 |
| 4 | JGI25406J46586_10013397 | 3300003203 | Bacteria | 3524 |
| 5 | JGI25404J52841_10004528 | 3300003659 | Bacteria | 2824 |
| 6 | JGI25404J52841_10007061 | 3300003659 | Bacteria | 2366 |
| 7 | JGI25404J52841_10007351 | 3300003659 | Bacteria | 2328 |
| 8 | JGI25404J52841_10007389 | 3300003659 | Bacteria | 2322 |
| 9 | Ga0070658_10001807 | 3300005327 | Bacteria | 17987 |
| 10 | Ga0070683_100037797 | 3300005329 | Bacteria | 4420 |
| 11 | Ga0070683_100225403 | 3300005329 | Bacteria | 1781 |
| 12 | Ga0070690_100000228 | 3300005330 | Bacteria | 29057 |
| 13 | Ga0068869_100000350 | 3300005334 | Bacteria | 24670 |
| 14 | Ga0068869_100072897 | 3300005334 | Bacteria | 2545 |
| 15 | Ga0070680_100000306 | 3300005336 | Bacteria | 32712 |
| 16 | Ga0070680_100061102 | 3300005336 | Bacteria | 3084 |
| 17 | Ga0070680_100596326 | 3300005336 | Bacteria | 948 |
| 18 | Ga0070682_100252250 | 3300005337 | Bacteria | 1273 |
| 19 | Ga0070682_100309236 | 3300005337 | Bacteria | 1163 |
| 20 | Ga0068868_100000207 | 3300005338 | Bacteria | 39850 |
| 21 | Ga0070660_100166384 | 3300005339 | Bacteria | 1779 |
| 22 | Ga0070660_100357109 | 3300005339 | Bacteria | 1204 |
| 23 | Ga0070689_100018355 | 3300005340 | Bacteria | 5152 |
| 24 | Ga0070691_10001525 | 3300005341 | Bacteria | 9955 |
| 25 | Ga0070687_100000055 | 3300005343 | Bacteria | 36871 |
| 26 | Ga0070661_100096527 | 3300005344 | Bacteria | 2193 |
| 27 | Ga0070661_100117627 | 3300005344 | Bacteria | 1988 |
| 28 | Ga0070692_10000296 | 3300005345 | Bacteria | 14110 |
| 29 | Ga0070668_100046241 | 3300005347 | Bacteria | 3341 |
| 30 | Ga0070668_100120400 | 3300005347 | Bacteria | 2097 |
| 31 | Ga0070668_100297631 | 3300005347 | Bacteria | 1352 |
| 32 | Ga0070668_100305617 | 3300005347 | Bacteria | 1335 |
| 33 | Ga0070675_100340193 | 3300005354 | Bacteria | 1329 |
| 34 | Ga0070671_100035152 | 3300005355 | Bacteria | 4151 |
| 35 | Ga0070671_100067099 | 3300005355 | Bacteria | 2991 |
| 36 | Ga0070671_100218788 | 3300005355 | Bacteria | 1616 |
| 37 | Ga0070671_100314254 | 3300005355 | Bacteria | 1335 |
| 38 | Ga0070674_100042324 | 3300005356 | Bacteria | 3093 |
| 39 | Ga0070674_100056310 | 3300005356 | Bacteria | 2726 |
| 40 | Ga0070674_100424577 | 3300005356 | Bacteria | 1091 |
| 41 | Ga0070673_100367322 | 3300005364 | Bacteria | 1280 |
| 42 | Ga0070659_100016139 | 3300005366 | Bacteria | 5604 |
| 43 | Ga0070659_100105951 | 3300005366 | Bacteria | 2266 |
| 44 | Ga0070659_100307266 | 3300005366 | Bacteria | 1324 |
| 45 | Ga0070703_10011767 | 3300005406 | Bacteria | 2475 |
| 46 | Ga0070709_10000409 | 3300005434 | Bacteria | 26244 |
| 47 | Ga0070709_10031279 | 3300005434 | Bacteria | 3201 |
| 48 | Ga0070709_10064221 | 3300005434 | Bacteria | 2347 |
| 49 | Ga0070709_10240437 | 3300005434 | Bacteria | 1300 |
| 50 | Ga0070714_100000597 | 3300005435 | Bacteria | 25798 |
| 51 | Ga0070714_100092250 | 3300005435 | Bacteria | 2654 |
| 52 | Ga0070713_100095939 | 3300005436 | Bacteria | 2559 |
| 53 | Ga0070710_10000191 | 3300005437 | Bacteria | 28564 |
| 54 | Ga0070710_10000880 | 3300005437 | Bacteria | 14380 |
| 55 | Ga0070710_10103186 | 3300005437 | Bacteria | 1702 |
| 56 | Ga0070701_10001180 | 3300005438 | Bacteria | 9582 |
| 57 | Ga0070711_100000851 | 3300005439 | Bacteria | 16059 |
| 58 | Ga0070711_100007845 | 3300005439 | Bacteria | 6506 |
| 59 | Ga0070705_100000161 | 3300005440 | Bacteria | 39283 |
| 60 | Ga0070705_100002001 | 3300005440 | Bacteria | 10418 |
| 61 | Ga0070700_100000137 | 3300005441 | Bacteria | 43712 |
| 62 | Ga0070700_100000998 | 3300005441 | Bacteria | 13957 |
| 63 | Ga0070694_100000106 | 3300005444 | Bacteria | 40466 |
| 64 | Ga0070694_100007725 | 3300005444 | Bacteria | 6561 |
| 65 | Ga0070694_100026302 | 3300005444 | Bacteria | 3770 |
| 66 | Ga0070694_100124203 | 3300005444 | Bacteria | 1856 |
| 67 | Ga0070663_100004604 | 3300005455 | Bacteria | 8122 |
| 68 | Ga0070663_100076375 | 3300005455 | Bacteria | 2450 |
| 69 | Ga0070663_100229337 | 3300005455 | Bacteria | 1462 |
| 70 | Ga0070663_100307637 | 3300005455 | Bacteria | 1271 |
| 71 | Ga0070678_100027488 | 3300005456 | Bacteria | 3863 |
| 72 | Ga0070662_100038283 | 3300005457 | Bacteria | 3406 |
| 73 | Ga0070681_10019890 | 3300005458 | Bacteria | 6727 |
| 74 | Ga0070681_10139496 | 3300005458 | Bacteria | 2354 |
| 75 | Ga0070681_10189290 | 3300005458 | Bacteria | 1978 |
| 76 | Ga0070681_10255009 | 3300005458 | Bacteria | 1666 |
| 77 | Ga0068867_100000230 | 3300005459 | Bacteria | 36554 |
| 78 | Ga0070685_10098273 | 3300005466 | Bacteria | 1783 |
| 79 | Ga0070707_100125368 | 3300005468 | Bacteria | 2494 |
| 80 | Ga0070707_100178214 | 3300005468 | Bacteria | 2072 |
| 81 | Ga0070698_100025240 | 3300005471 | Bacteria | 6192 |
| 82 | Ga0070698_100410792 | 3300005471 | Bacteria | 1287 |
| 83 | Ga0070699_100000836 | 3300005518 | Bacteria | 28545 |
| 84 | Ga0070679_100008011 | 3300005530 | Bacteria | 9922 |
| 85 | Ga0070679_100034506 | 3300005530 | Bacteria | 5014 |
| 86 | Ga0070679_100054833 | 3300005530 | Bacteria | 3969 |
| 87 | Ga0070679_100070822 | 3300005530 | Bacteria | 3478 |
| 88 | Ga0070679_100316216 | 3300005530 | Bacteria | 1511 |
| 89 | Ga0070697_100029852 | 3300005536 | Bacteria | 4376 |
| 90 | Ga0070697_100080131 | 3300005536 | Bacteria | 2689 |
| 91 | Ga0068853_100021754 | 3300005539 | Bacteria | 5350 |
| 92 | Ga0068853_100022948 | 3300005539 | Bacteria | 5218 |
| 93 | Ga0068853_100028465 | 3300005539 | Bacteria | 4700 |
| 94 | Ga0068853_100097555 | 3300005539 | Bacteria | 2595 |
| 95 | Ga0068853_100240107 | 3300005539 | Bacteria | 1660 |
| 96 | Ga0068853_100302820 | 3300005539 | Bacteria | 1478 |
| 97 | Ga0068853_100650114 | 3300005539 | Bacteria | 1003 |
| 98 | Ga0070672_100253068 | 3300005543 | Bacteria | 1484 |
| 99 | Ga0070672_100412787 | 3300005543 | Bacteria | 1158 |
| 100 | Ga0070686_100000546 | 3300005544 | Bacteria | 22497 |
| 101 | Ga0070695_100000200 | 3300005545 | Bacteria | 29051 |
| 102 | Ga0070695_100043789 | 3300005545 | Bacteria | 2848 |
| 103 | Ga0070696_100000189 | 3300005546 | Bacteria | 36155 |
| 104 | Ga0070696_100001033 | 3300005546 | Bacteria | 17993 |
| 105 | Ga0070693_100000170 | 3300005547 | Bacteria | 30410 |
| 106 | Ga0070665_100014247 | 3300005548 | Bacteria | 7985 |
| 107 | Ga0070665_100022311 | 3300005548 | Bacteria | 6370 |
| 108 | Ga0070665_100024863 | 3300005548 | Bacteria | 6035 |
| 109 | Ga0070665_100057086 | 3300005548 | Bacteria | 3914 |
| 110 | Ga0070665_100160327 | 3300005548 | Bacteria | 2251 |
| 111 | Ga0070665_100227451 | 3300005548 | Bacteria | 1865 |
| 112 | Ga0070704_100000028 | 3300005549 | Bacteria | 47635 |
| 113 | Ga0068855_100002784 | 3300005563 | Bacteria | 21521 |
| 114 | Ga0068855_100033709 | 3300005563 | Bacteria | 6109 |
| 115 | Ga0068855_100136247 | 3300005563 | Bacteria | 2801 |
| 116 | Ga0070664_100189368 | 3300005564 | Bacteria | 1833 |
| 117 | Ga0068857_100009318 | 3300005577 | Bacteria | 8523 |
| 118 | Ga0068857_100016536 | 3300005577 | Bacteria | 6463 |
| 119 | Ga0068857_100017840 | 3300005577 | Bacteria | 6224 |
| 120 | Ga0068857_100090238 | 3300005577 | Bacteria | 2742 |
| 121 | Ga0068857_100095293 | 3300005577 | Bacteria | 2666 |
| 122 | Ga0068857_100224233 | 3300005577 | Bacteria | 1718 |
| 123 | Ga0068854_100003786 | 3300005578 | Bacteria | 9459 |
| 124 | Ga0068854_100012220 | 3300005578 | Bacteria | 5618 |
| 125 | Ga0068854_100022987 | 3300005578 | Bacteria | 4254 |
| 126 | Ga0068854_100043384 | 3300005578 | Bacteria | 3188 |
| 127 | Ga0068854_100112458 | 3300005578 | Bacteria | 2056 |
| 128 | Ga0068854_100244220 | 3300005578 | Bacteria | 1431 |
| 129 | Ga0068856_100002838 | 3300005614 | Bacteria | 17741 |
| 130 | Ga0068856_100038677 | 3300005614 | Bacteria | 4683 |
| 131 | Ga0068856_100074451 | 3300005614 | Bacteria | 3362 |
| 132 | Ga0068856_100245193 | 3300005614 | Bacteria | 1807 |
| 133 | Ga0070702_100000089 | 3300005615 | Bacteria | 26944 |
| 134 | Ga0070702_100010659 | 3300005615 | Bacteria | 4539 |
| 135 | Ga0068852_100034244 | 3300005616 | Bacteria | 4223 |
| 136 | Ga0068852_100034788 | 3300005616 | Bacteria | 4196 |
| 137 | Ga0068852_100231241 | 3300005616 | Bacteria | 1762 |
| 138 | Ga0068859_100001708 | 3300005617 | Bacteria | 22385 |
| 139 | Ga0068859_100102722 | 3300005617 | Bacteria | 2916 |
| 140 | Ga0068864_100044923 | 3300005618 | Bacteria | 3788 |
| 141 | Ga0068864_100209235 | 3300005618 | Bacteria | 1795 |
| 142 | Ga0068864_100322955 | 3300005618 | Bacteria | 1450 |
| 143 | Ga0068866_10003103 | 3300005718 | Bacteria | 6846 |
| 144 | Ga0068866_10133392 | 3300005718 | Bacteria | 1416 |
| 145 | Ga0068861_100001248 | 3300005719 | Bacteria | 15859 |
| 146 | Ga0068851_10000402 | 3300005834 | Bacteria | 19592 |
| 147 | Ga0068870_10034857 | 3300005840 | Bacteria | 2578 |
| 148 | Ga0068863_100421635 | 3300005841 | Bacteria | 1307 |
| 149 | Ga0068858_100001236 | 3300005842 | Bacteria | 26391 |
| 150 | Ga0068858_100171384 | 3300005842 | Bacteria | 2046 |
| 151 | Ga0068858_100222799 | 3300005842 | Bacteria | 1787 |
| 152 | Ga0068860_100000433 | 3300005843 | Bacteria | 53218 |
| 153 | Ga0068860_100000926 | 3300005843 | Bacteria | 32568 |
| 154 | Ga0068860_100004410 | 3300005843 | Bacteria | 14375 |
| 155 | Ga0068860_100031878 | 3300005843 | Bacteria | 5067 |
| 156 | Ga0068860_100537803 | 3300005843 | Bacteria | 1169 |
| 157 | Ga0068862_100000934 | 3300005844 | Bacteria | 28188 |
| 158 | Ga0068862_100003737 | 3300005844 | Bacteria | 12990 |
| 159 | Ga0068862_100195807 | 3300005844 | Bacteria | 1820 |
| 160 | Ga0068862_100338283 | 3300005844 | Bacteria | 1393 |
| 161 | Ga0081455_10000230 | 3300005937 | Bacteria | 72112 |
| 162 | Ga0081455_10005195 | 3300005937 | Bacteria | 14318 |
| 163 | Ga0081455_10014288 | 3300005937 | Bacteria | 7791 |
| 164 | Ga0081455_10105341 | 3300005937 | Bacteria | 2254 |
| 165 | Ga0081540_1002478 | 3300005983 | Bacteria | 15036 |
| 166 | Ga0081540_1003002 | 3300005983 | Bacteria | 13529 |
| 167 | Ga0081540_1003538 | 3300005983 | Bacteria | 12308 |
| 168 | Ga0081540_1010331 | 3300005983 | Bacteria | 6331 |
| 169 | Ga0081540_1016558 | 3300005983 | Bacteria | 4606 |
| 170 | Ga0081540_1021616 | 3300005983 | Bacteria | 3824 |
| 171 | Ga0081540_1028192 | 3300005983 | Bacteria | 3160 |
| 172 | Ga0081540_1034870 | 3300005983 | Bacteria | 2706 |
| 173 | Ga0081540_1036882 | 3300005983 | Bacteria | 2600 |
| 174 | Ga0081540_1037256 | 3300005983 | Bacteria | 2581 |
| 175 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 176 | Ga0081539_10004421 | 3300005985 | Bacteria | 15548 |
| 177 | Ga0081539_10046439 | 3300005985 | Bacteria | 2489 |
| 178 | Ga0081539_10131132 | 3300005985 | Bacteria | 1231 |
| 179 | Ga0070717_10002236 | 3300006028 | Bacteria | 13563 |
| 180 | Ga0070717_10110826 | 3300006028 | Bacteria | 2341 |
| 181 | Ga0075365_10020178 | 3300006038 | Bacteria | 4127 |
| 182 | Ga0075368_10019963 | 3300006042 | Bacteria | 2533 |
| 183 | Ga0075368_10049264 | 3300006042 | Bacteria | 1671 |
| 184 | Ga0075363_100045503 | 3300006048 | Bacteria | 2327 |
| 185 | Ga0075363_100134716 | 3300006048 | Bacteria | 1387 |
| 186 | Ga0075432_10109043 | 3300006058 | Bacteria | 1030 |
| 187 | Ga0070715_10002923 | 3300006163 | Bacteria | 5335 |
| 188 | Ga0070716_100009934 | 3300006173 | Bacteria | 4759 |
| 189 | Ga0070716_100051286 | 3300006173 | Bacteria | 2345 |
| 190 | Ga0070716_100081810 | 3300006173 | Bacteria | 1929 |
| 191 | Ga0070712_100261001 | 3300006175 | Bacteria | 1388 |
| 192 | Ga0075362_10058990 | 3300006177 | Bacteria | 1732 |
| 193 | Ga0075367_10008366 | 3300006178 | Bacteria | 5359 |
| 194 | Ga0097621_100007162 | 3300006237 | Bacteria | 7952 |
| 195 | Ga0097621_100046443 | 3300006237 | Bacteria | 3514 |
| 196 | Ga0068871_100000322 | 3300006358 | Bacteria | 33363 |
| 197 | Ga0075428_100007574 | 3300006844 | Bacteria | 12030 |
| 198 | Ga0075428_100108955 | 3300006844 | Bacteria | 3018 |
| 199 | Ga0075428_100447024 | 3300006844 | Bacteria | 1384 |
| 200 | Ga0075430_100043772 | 3300006846 | Bacteria | 3785 |
| 201 | Ga0075431_100043785 | 3300006847 | Bacteria | 4617 |
| 202 | Ga0075433_10001174 | 3300006852 | Bacteria | 19047 |
| 203 | Ga0075433_10169168 | 3300006852 | Bacteria | 1945 |
| 204 | Ga0075434_100011494 | 3300006871 | Bacteria | 8353 |
| 205 | Ga0075434_100039303 | 3300006871 | Bacteria | 4688 |
| 206 | Ga0075434_100146177 | 3300006871 | Bacteria | 2385 |
| 207 | Ga0075429_100119058 | 3300006880 | Bacteria | 2307 |
| 208 | Ga0068865_100000108 | 3300006881 | Bacteria | 42603 |
| 209 | Ga0097620_100001708 | 3300006931 | Bacteria | 22385 |
| 210 | Ga0097620_100102716 | 3300006931 | Bacteria | 2916 |
| 211 | Ga0099824_1004053 | 3300006942 | Bacteria | 21200 |
| 212 | Ga0099822_1000007 | 3300006943 | Bacteria | 77453 |
| 213 | Ga0075435_100160360 | 3300007076 | Bacteria | 1894 |
| 214 | Ga0099794_10014507 | 3300007265 | Bacteria | 3454 |
| 215 | Ga0099795_10007946 | 3300007788 | Bacteria | 2993 |
| 216 | Ga0099795_10032687 | 3300007788 | Bacteria | 1801 |
| 217 | Ga0099795_10079999 | 3300007788 | Bacteria | 1249 |
| 218 | Ga0099795_10112859 | 3300007788 | Bacteria | 1079 |
| 219 | Ga0105250_10024567 | 3300009092 | Bacteria | 2428 |
| 220 | Ga0105240_10001597 | 3300009093 | Bacteria | 38497 |
| 221 | Ga0105240_10004430 | 3300009093 | Bacteria | 21410 |
| 222 | Ga0105240_10008378 | 3300009093 | Bacteria | 14796 |
| 223 | Ga0105240_10021247 | 3300009093 | Bacteria | 8638 |
| 224 | Ga0105240_10104006 | 3300009093 | Bacteria | 3449 |
| 225 | Ga0105240_10187454 | 3300009093 | Bacteria | 2435 |
| 226 | Ga0105240_10748804 | 3300009093 | Bacteria | 1062 |
| 227 | Ga0111539_10488979 | 3300009094 | Bacteria | 1433 |
| 228 | Ga0105245_10000481 | 3300009098 | Bacteria | 36561 |
| 229 | Ga0105245_10044805 | 3300009098 | Bacteria | 3949 |
| 230 | Ga0105245_10271604 | 3300009098 | Bacteria | 1654 |
| 231 | Ga0105247_10120819 | 3300009101 | Bacteria | 1697 |
| 232 | Ga0114129_10028708 | 3300009147 | Bacteria | 7883 |
| 233 | Ga0114129_10455552 | 3300009147 | Bacteria | 1677 |
| 234 | Ga0105243_10000575 | 3300009148 | Bacteria | 36969 |
| 235 | Ga0105243_10197565 | 3300009148 | Bacteria | 1762 |
| 236 | Ga0105241_10017805 | 3300009174 | Bacteria | 5225 |
| 237 | Ga0105241_10026741 | 3300009174 | Bacteria | 4295 |
| 238 | Ga0105241_10028964 | 3300009174 | Bacteria | 4128 |
| 239 | Ga0105241_10156616 | 3300009174 | Bacteria | 1869 |
| 240 | Ga0105241_10226545 | 3300009174 | Bacteria | 1574 |
| 241 | Ga0105241_10293797 | 3300009174 | Bacteria | 1392 |
| 242 | Ga0105242_10000342 | 3300009176 | Bacteria | 37655 |
| 243 | Ga0105248_10065189 | 3300009177 | Bacteria | 4090 |
| 244 | Ga0105248_10170084 | 3300009177 | Bacteria | 2456 |
| 245 | Ga0105237_10059559 | 3300009545 | Bacteria | 3820 |
| 246 | Ga0105237_10081851 | 3300009545 | Bacteria | 3219 |
| 247 | Ga0105237_10267871 | 3300009545 | Bacteria | 1711 |
| 248 | Ga0105237_10331659 | 3300009545 | Bacteria | 1526 |
| 249 | Ga0105237_10489285 | 3300009545 | Bacteria | 1237 |
| 250 | Ga0105238_10006342 | 3300009551 | Bacteria | 11762 |
| 251 | Ga0105238_10007309 | 3300009551 | Bacteria | 11059 |
| 252 | Ga0105238_10009143 | 3300009551 | Bacteria | 9918 |
| 253 | Ga0105238_10014918 | 3300009551 | Bacteria | 7865 |
| 254 | Ga0105238_10028317 | 3300009551 | Bacteria | 5710 |
| 255 | Ga0105238_10077621 | 3300009551 | Bacteria | 3312 |
| 256 | Ga0105238_10676724 | 3300009551 | Bacteria | 1043 |
| 257 | Ga0105249_10003783 | 3300009553 | Bacteria | 13067 |
| 258 | Ga0105249_10029065 | 3300009553 | Bacteria | 4991 |
| 259 | Ga0099796_10000761 | 3300010159 | Bacteria | 5776 |
| 260 | Ga0105239_10020173 | 3300010375 | Bacteria | 7353 |
| 261 | Ga0105239_10029909 | 3300010375 | Bacteria | 5991 |
| 262 | Ga0105239_10032328 | 3300010375 | Bacteria | 5750 |
| 263 | Ga0105239_10081518 | 3300010375 | Bacteria | 3561 |
| 264 | Ga0105239_10083019 | 3300010375 | Bacteria | 3528 |
| 265 | Ga0105239_10116920 | 3300010375 | Bacteria | 2959 |
| 266 | Ga0105239_10123837 | 3300010375 | Bacteria | 2872 |
| 267 | Ga0105239_10324481 | 3300010375 | Bacteria | 1736 |
| 268 | Ga0105239_10563582 | 3300010375 | Bacteria | 1298 |
| 269 | Ga0105239_10819389 | 3300010375 | Bacteria | 1067 |
| 270 | Ga0105246_10114144 | 3300011119 | Bacteria | 1990 |
| 271 | Ga0157370_10354215 | 3300013104 | Bacteria | 1353 |
| 272 | Ga0157369_10038612 | 3300013105 | Bacteria | 5220 |
| 273 | Ga0157369_10109012 | 3300013105 | Bacteria | 2945 |
| 274 | Ga0157374_10006943 | 3300013296 | Bacteria | 9631 |
| 275 | Ga0157378_10000365 | 3300013297 | Bacteria | 44708 |
| 276 | Ga0157378_10085942 | 3300013297 | Bacteria | 2851 |
| 277 | Ga0157378_10139529 | 3300013297 | Bacteria | 2250 |
| 278 | Ga0163162_10013288 | 3300013306 | Bacteria | 8042 |
| 279 | Ga0163162_10093948 | 3300013306 | Bacteria | 3085 |
| 280 | Ga0157375_10120330 | 3300013308 | Bacteria | 2734 |
| 281 | Ga0163163_10045070 | 3300014325 | Bacteria | 4328 |
| 282 | Ga0163163_10075450 | 3300014325 | Bacteria | 3365 |
| 283 | Ga0163163_10764770 | 3300014325 | Bacteria | 1029 |
| 284 | Ga0157380_10065341 | 3300014326 | Bacteria | 2924 |
| 285 | Ga0157379_10383884 | 3300014968 | Bacteria | 1289 |
| 286 | Ga0157379_10388965 | 3300014968 | Bacteria | 1281 |
| 287 | Ga0157376_10002020 | 3300014969 | Bacteria | 13604 |
| 288 | Ga0157376_10053794 | 3300014969 | Bacteria | 3354 |
| 289 | Ga0157376_10079948 | 3300014969 | Bacteria | 2803 |
| 290 | Ga0157376_10348463 | 3300014969 | Bacteria | 1416 |
| 291 | Ga0163161_10080958 | 3300017792 | Bacteria | 2391 |
| 292 | Ga0213876_10002040 | 3300021384 | Bacteria | 11998 |
| 293 | Ga0209758_1017728 | 3300025297 | Bacteria | 3526 |
| 294 | Ga0209758_1020717 | 3300025297 | Bacteria | 3096 |
| 295 | Ga0207656_10003907 | 3300025321 | Bacteria | 5163 |
| 296 | Ga0207653_10011526 | 3300025885 | Bacteria | 2758 |
| 297 | Ga0207692_10000493 | 3300025898 | Bacteria | 13965 |
| 298 | Ga0207692_10002127 | 3300025898 | Bacteria | 7560 |
| 299 | Ga0207642_10001661 | 3300025899 | Bacteria | 6866 |
| 300 | Ga0207642_10151408 | 3300025899 | Bacteria | 1235 |
| 301 | Ga0207688_10079684 | 3300025901 | Bacteria | 1868 |
| 302 | Ga0207647_10004518 | 3300025904 | Bacteria | 10306 |
| 303 | Ga0207647_10010711 | 3300025904 | Bacteria | 6458 |
| 304 | Ga0207699_10000145 | 3300025906 | Bacteria | 46647 |
| 305 | Ga0207699_10003326 | 3300025906 | Bacteria | 7664 |
| 306 | Ga0207699_10124561 | 3300025906 | Bacteria | 1672 |
| 307 | Ga0207699_10125180 | 3300025906 | Bacteria | 1668 |
| 308 | Ga0207645_10036807 | 3300025907 | Bacteria | 3142 |
| 309 | Ga0207643_10029932 | 3300025908 | Bacteria | 3029 |
| 310 | Ga0207684_10353589 | 3300025910 | Bacteria | 1264 |
| 311 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 312 | Ga0207654_10036015 | 3300025911 | Bacteria | 2762 |
| 313 | Ga0207654_10061904 | 3300025911 | Bacteria | 2191 |
| 314 | Ga0207707_10000818 | 3300025912 | Bacteria | 30499 |
| 315 | Ga0207707_10001462 | 3300025912 | Bacteria | 21837 |
| 316 | Ga0207707_10039291 | 3300025912 | Bacteria | 4137 |
| 317 | Ga0207707_10051302 | 3300025912 | Bacteria | 3592 |
| 318 | Ga0207707_10178818 | 3300025912 | Bacteria | 1852 |
| 319 | Ga0207707_10248631 | 3300025912 | Bacteria | 1545 |
| 320 | Ga0207707_10295727 | 3300025912 | Bacteria | 1401 |
| 321 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 322 | Ga0207695_10024634 | 3300025913 | Bacteria | 6761 |
| 323 | Ga0207695_10272735 | 3300025913 | Bacteria | 1587 |
| 324 | Ga0207695_10285615 | 3300025913 | Bacteria | 1543 |
| 325 | Ga0207671_10013631 | 3300025914 | Bacteria | 6464 |
| 326 | Ga0207671_10065046 | 3300025914 | Bacteria | 2712 |
| 327 | Ga0207671_10075209 | 3300025914 | Bacteria | 2525 |
| 328 | Ga0207671_10151806 | 3300025914 | Bacteria | 1790 |
| 329 | Ga0207693_10001606 | 3300025915 | Bacteria | 20003 |
| 330 | Ga0207693_10016445 | 3300025915 | Bacteria | 5910 |
| 331 | Ga0207693_10022371 | 3300025915 | Bacteria | 5024 |
| 332 | Ga0207693_10242097 | 3300025915 | Bacteria | 1416 |
| 333 | Ga0207663_10000390 | 3300025916 | Bacteria | 19024 |
| 334 | Ga0207663_10243466 | 3300025916 | Bacteria | 1320 |
| 335 | Ga0207660_10001409 | 3300025917 | Bacteria | 16130 |
| 336 | Ga0207660_10001663 | 3300025917 | Bacteria | 14898 |
| 337 | Ga0207660_10160795 | 3300025917 | Bacteria | 1732 |
| 338 | Ga0207662_10000122 | 3300025918 | Bacteria | 37342 |
| 339 | Ga0207662_10306421 | 3300025918 | Bacteria | 1057 |
| 340 | Ga0207657_10001095 | 3300025919 | Bacteria | 28754 |
| 341 | Ga0207657_10008750 | 3300025919 | Bacteria | 10246 |
| 342 | Ga0207652_10003169 | 3300025921 | Bacteria | 13699 |
| 343 | Ga0207652_10006226 | 3300025921 | Bacteria | 9635 |
| 344 | Ga0207652_10028827 | 3300025921 | Bacteria | 4634 |
| 345 | Ga0207652_10041550 | 3300025921 | Bacteria | 3909 |
| 346 | Ga0207652_10066553 | 3300025921 | Bacteria | 3123 |
| 347 | Ga0207652_10301643 | 3300025921 | Bacteria | 1446 |
| 348 | Ga0207646_10154033 | 3300025922 | Bacteria | 2073 |
| 349 | Ga0207646_10326769 | 3300025922 | Bacteria | 1386 |
| 350 | Ga0207694_10000564 | 3300025924 | Bacteria | 33580 |
| 351 | Ga0207694_10023140 | 3300025924 | Bacteria | 4717 |
| 352 | Ga0207694_10084582 | 3300025924 | Bacteria | 2495 |
| 353 | Ga0207694_10165683 | 3300025924 | Bacteria | 1787 |
| 354 | Ga0207687_10000178 | 3300025927 | Bacteria | 41733 |
| 355 | Ga0207687_10415182 | 3300025927 | Bacteria | 1110 |
| 356 | Ga0207664_10000131 | 3300025929 | Bacteria | 65529 |
| 357 | Ga0207664_10025264 | 3300025929 | Bacteria | 4472 |
| 358 | Ga0207664_10415313 | 3300025929 | Bacteria | 1198 |
| 359 | Ga0207644_10077473 | 3300025931 | Bacteria | 2448 |
| 360 | Ga0207690_10000308 | 3300025932 | Bacteria | 33627 |
| 361 | Ga0207690_10005794 | 3300025932 | Bacteria | 7307 |
| 362 | Ga0207690_10101022 | 3300025932 | Bacteria | 2060 |
| 363 | Ga0207690_10428836 | 3300025932 | Bacteria | 1059 |
| 364 | Ga0207706_10067990 | 3300025933 | Bacteria | 3136 |
| 365 | Ga0207706_10117341 | 3300025933 | Bacteria | 2341 |
| 366 | Ga0207686_10000838 | 3300025934 | Bacteria | 18676 |
| 367 | Ga0207686_10046294 | 3300025934 | Bacteria | 2682 |
| 368 | Ga0207709_10002153 | 3300025935 | Bacteria | 12611 |
| 369 | Ga0207709_10364651 | 3300025935 | Bacteria | 1095 |
| 370 | Ga0207670_10008018 | 3300025936 | Bacteria | 5936 |
| 371 | Ga0207669_10017701 | 3300025937 | Bacteria | 3662 |
| 372 | Ga0207669_10309509 | 3300025937 | Bacteria | 1204 |
| 373 | Ga0207704_10010347 | 3300025938 | Bacteria | 4547 |
| 374 | Ga0207665_10000444 | 3300025939 | Bacteria | 28370 |
| 375 | Ga0207665_10026200 | 3300025939 | Bacteria | 3848 |
| 376 | Ga0207665_10037525 | 3300025939 | Bacteria | 3225 |
| 377 | Ga0207665_10165683 | 3300025939 | Bacteria | 1593 |
| 378 | Ga0207691_10033936 | 3300025940 | Bacteria | 4750 |
| 379 | Ga0207691_10408155 | 3300025940 | Bacteria | 1158 |
| 380 | Ga0207711_10128429 | 3300025941 | Bacteria | 2270 |
| 381 | Ga0207689_10000535 | 3300025942 | Bacteria | 36056 |
| 382 | Ga0207689_10082533 | 3300025942 | Bacteria | 2643 |
| 383 | Ga0207661_10037684 | 3300025944 | Bacteria | 3784 |
| 384 | Ga0207661_10228839 | 3300025944 | Bacteria | 1646 |
| 385 | Ga0207679_10036408 | 3300025945 | Bacteria | 3490 |
| 386 | Ga0207667_10009339 | 3300025949 | Bacteria | 11566 |
| 387 | Ga0207667_10014006 | 3300025949 | Bacteria | 9157 |
| 388 | Ga0207667_10018267 | 3300025949 | Bacteria | 7870 |
| 389 | Ga0207667_10037421 | 3300025949 | Bacteria | 5186 |
| 390 | Ga0207667_10201536 | 3300025949 | Bacteria | 2041 |
| 391 | Ga0207667_10437837 | 3300025949 | Bacteria | 1329 |
| 392 | Ga0207712_10004784 | 3300025961 | Bacteria | 8552 |
| 393 | Ga0207712_10015222 | 3300025961 | Bacteria | 4958 |
| 394 | Ga0207668_10014433 | 3300025972 | Bacteria | 4889 |
| 395 | Ga0207668_10339612 | 3300025972 | Bacteria | 1252 |
| 396 | Ga0207668_10394418 | 3300025972 | Bacteria | 1168 |
| 397 | Ga0207640_10015461 | 3300025981 | Bacteria | 4418 |
| 398 | Ga0207640_10021908 | 3300025981 | Bacteria | 3816 |
| 399 | Ga0207640_10034634 | 3300025981 | Bacteria | 3153 |
| 400 | Ga0207640_10139644 | 3300025981 | Bacteria | 1764 |
| 401 | Ga0207640_10175336 | 3300025981 | Bacteria | 1602 |
| 402 | Ga0207677_10001104 | 3300026023 | Bacteria | 14730 |
| 403 | Ga0207703_10009082 | 3300026035 | Bacteria | 7827 |
| 404 | Ga0207703_10177174 | 3300026035 | Bacteria | 1879 |
| 405 | Ga0207703_10392333 | 3300026035 | Bacteria | 1286 |
| 406 | Ga0207639_10001424 | 3300026041 | Bacteria | 16178 |
| 407 | Ga0207639_10008949 | 3300026041 | Bacteria | 6891 |
| 408 | Ga0207639_10016555 | 3300026041 | Bacteria | 5219 |
| 409 | Ga0207639_10134168 | 3300026041 | Bacteria | 2054 |
| 410 | Ga0207639_10210909 | 3300026041 | Bacteria | 1672 |
| 411 | Ga0207639_10224901 | 3300026041 | Bacteria | 1623 |
| 412 | Ga0207678_10002319 | 3300026067 | Bacteria | 17246 |
| 413 | Ga0207678_10010067 | 3300026067 | Bacteria | 8296 |
| 414 | Ga0207678_10015000 | 3300026067 | Bacteria | 6817 |
| 415 | Ga0207678_10027531 | 3300026067 | Bacteria | 4960 |
| 416 | Ga0207678_10587648 | 3300026067 | Bacteria | 976 |
| 417 | Ga0207708_10000179 | 3300026075 | Bacteria | 50377 |
| 418 | Ga0207708_10001547 | 3300026075 | Bacteria | 17170 |
| 419 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 420 | Ga0207702_10008145 | 3300026078 | Bacteria | 8866 |
| 421 | Ga0207702_10028205 | 3300026078 | Bacteria | 4665 |
| 422 | Ga0207702_10071595 | 3300026078 | Bacteria | 2986 |
| 423 | Ga0207702_10092844 | 3300026078 | Bacteria | 2646 |
| 424 | Ga0207648_10000772 | 3300026089 | Bacteria | 36056 |
| 425 | Ga0207676_10059148 | 3300026095 | Bacteria | 3025 |
| 426 | Ga0207676_10121668 | 3300026095 | Bacteria | 2202 |
| 427 | Ga0207674_10005590 | 3300026116 | Bacteria | 14903 |
| 428 | Ga0207674_10006172 | 3300026116 | Bacteria | 14146 |
| 429 | Ga0207674_10006707 | 3300026116 | Bacteria | 13521 |
| 430 | Ga0207674_10014421 | 3300026116 | Bacteria | 8730 |
| 431 | Ga0207674_10037609 | 3300026116 | Bacteria | 5031 |
| 432 | Ga0207675_100000127 | 3300026118 | Bacteria | 63431 |
| 433 | Ga0207675_100015080 | 3300026118 | Bacteria | 7210 |
| 434 | Ga0207675_100281703 | 3300026118 | Bacteria | 1615 |
| 435 | Ga0207683_10048552 | 3300026121 | Bacteria | 3716 |
| 436 | Ga0207683_10266370 | 3300026121 | Bacteria | 1565 |
| 437 | Ga0207683_10467270 | 3300026121 | Bacteria | 1164 |
| 438 | Ga0207698_10014462 | 3300026142 | Bacteria | 5248 |
| 439 | Ga0207698_10048403 | 3300026142 | Bacteria | 3227 |
| 440 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 441 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 442 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 443 | Ga0209179_1001223 | 3300027512 | Bacteria | 3063 |
| 444 | Ga0209179_1004630 | 3300027512 | Bacteria | 2091 |
| 445 | Ga0209588_1006984 | 3300027671 | Bacteria | 3308 |
| 446 | Ga0207428_10032301 | 3300027907 | Bacteria | 4306 |
| 447 | Ga0207428_10350367 | 3300027907 | Bacteria | 1086 |
| 448 | Ga0268266_10000680 | 3300028379 | Bacteria | 45937 |
| 449 | Ga0268266_10012906 | 3300028379 | Bacteria | 7208 |
| 450 | Ga0268266_10080249 | 3300028379 | Bacteria | 2842 |
| 451 | Ga0268265_10001274 | 3300028380 | Bacteria | 21743 |
| 452 | Ga0268265_10002376 | 3300028380 | Bacteria | 14227 |
| 453 | Ga0268265_10020055 | 3300028380 | Bacteria | 4659 |
| 454 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 455 | Ga0268264_10002253 | 3300028381 | Bacteria | 17080 |
| 456 | Ga0268264_10002417 | 3300028381 | Bacteria | 16431 |
| 457 | Ga0268264_10179065 | 3300028381 | Bacteria | 1924 |
| 458 | Ga0307517_10000942 | 3300028786 | Bacteria | 49547 |
| 459 | Ga0307517_10137157 | 3300028786 | Bacteria | 1735 |
| 460 | Ga0307515_10068562 | 3300028794 | Bacteria | 4870 |
| 461 | Ga0265330_10006512 | 3300031235 | Bacteria | 5774 |
| 462 | Ga0265330_10040805 | 3300031235 | Bacteria | 2060 |
| 463 | Ga0265330_10076510 | 3300031235 | Bacteria | 1444 |
| 464 | Ga0265330_10116335 | 3300031235 | Bacteria | 1140 |
| 465 | Ga0265340_10002209 | 3300031247 | Bacteria | 11138 |
| 466 | Ga0265339_10001277 | 3300031249 | Bacteria | 18834 |
| 467 | Ga0265339_10117511 | 3300031249 | Bacteria | 1370 |
| 468 | Ga0265331_10031034 | 3300031250 | Bacteria | 2658 |
| 469 | Ga0265316_10157310 | 3300031344 | Bacteria | 1700 |
| 470 | Ga0265316_10333189 | 3300031344 | Bacteria | 1101 |
| 471 | Ga0307509_10006490 | 3300031507 | Bacteria | 15715 |
| 472 | Ga0307509_10107620 | 3300031507 | Bacteria | 2803 |
| 473 | Ga0307408_100210005 | 3300031548 | Bacteria | 1581 |
| 474 | Ga0307408_100603308 | 3300031548 | Bacteria | 976 |
| 475 | Ga0307508_10000108 | 3300031616 | Bacteria | 97443 |
| 476 | Ga0307508_10012397 | 3300031616 | Bacteria | 7796 |
| 477 | Ga0307508_10037820 | 3300031616 | Bacteria | 4339 |
| 478 | Ga0307508_10083297 | 3300031616 | Bacteria | 2780 |
| 479 | Ga0265314_10002048 | 3300031711 | Bacteria | 21322 |
| 480 | Ga0265314_10045576 | 3300031711 | Bacteria | 3099 |
| 481 | Ga0265314_10066862 | 3300031711 | Bacteria | 2423 |
| 482 | Ga0265342_10189225 | 3300031712 | Bacteria | 1124 |
| 483 | Ga0307516_10000908 | 3300031730 | Bacteria | 40669 |
| 484 | Ga0307516_10044620 | 3300031730 | Bacteria | 4384 |
| 485 | Ga0307516_10062483 | 3300031730 | Bacteria | 3609 |
| 486 | Ga0307516_10068912 | 3300031730 | Bacteria | 3404 |
| 487 | Ga0307516_10206850 | 3300031730 | Bacteria | 1679 |
| 488 | Ga0307413_10179716 | 3300031824 | Bacteria | 1507 |
| 489 | Ga0307415_100023277 | 3300032126 | Bacteria | 3842 |
| 490 | Ga0307510_10003483 | 3300033180 | Bacteria | 18332 |
| 491 | Ga0307510_10297932 | 3300033180 | Bacteria | 1076 |
| 492 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 493 | Ga0373930_0020576 | 3300034816 | Bacteria | 1287 |
| 494 | Ga0373958_0011429 | 3300034819 | Bacteria | 1501 |
| 495 | Ga0373934_0005625 | 3300035086 | Bacteria | 4642 |
| 496 | Ga0373934_0013237 | 3300035086 | Bacteria | 3118 |
| 497 | Ga0373934_0028140 | 3300035086 | Bacteria | 2188 |
| 498 | Ga0373949_0028848 | 3300035090 | Bacteria | 1312 |
| 499 | Ga0373923_0024780 | 3300035111 | Bacteria | 2371 |
| 500 | Ga0373923_0054009 | 3300035111 | Bacteria | 1690 |
| 501 | Ga0373923_0081850 | 3300035111 | Bacteria | 1401 |
| 502 | Ga0373932_0029061 | 3300035112 | Bacteria | 1524 |
| 503 | Ga0373936_0010488 | 3300035113 | Bacteria | 3496 |
| 504 | Ga0373936_0062179 | 3300035113 | Bacteria | 1526 |
| 505 | Ga0373939_0041433 | 3300035114 | Bacteria | 1388 |
| 506 | Ga0373939_0054530 | 3300035114 | Bacteria | 1252 |
| 507 | Ga0373945_0019064 | 3300035116 | Bacteria | 2339 |
| 508 | Ga0373945_0025780 | 3300035116 | Bacteria | 2045 |
| 509 | Ga0373953_0000037 | 3300035117 | Bacteria | 34731 |
| 510 | Ga0373954_0000242 | 3300035118 | Bacteria | 20003 |
| 511 | Ga0373954_0004339 | 3300035118 | Bacteria | 6098 |
| 512 | Ga0373954_0033727 | 3300035118 | Bacteria | 2369 |
| 513 | Ga0373956_0000631 | 3300035119 | Bacteria | 14442 |
| 514 | Ga0373957_0000417 | 3300035120 | Bacteria | 10760 |
| 515 | Ga0373957_0071680 | 3300035120 | Bacteria | 1356 |
| 516 | Ga0373943_0002237 | 3300035170 | Bacteria | 8797 |
| 517 | Ga0373946_0006294 | 3300035171 | Bacteria | 4302 |
| 518 | Ga0373946_0061766 | 3300035171 | Bacteria | 1596 |
| 519 | Ga0373955_0001044 | 3300035172 | Bacteria | 11768 |
| 520 | Ga0373955_0005369 | 3300035172 | Bacteria | 5754 |
| 521 | Ga0373955_0048879 | 3300035172 | Bacteria | 2295 |
| 522 | Ga0373955_0247208 | 3300035172 | Bacteria | 1069 |
| 523 | Ga0373942_0007848 | 3300035207 | Bacteria | 2481 |
| 524 | Ga0373961_0018293 | 3300035241 | Bacteria | 1828 |
| 525 | Ga0373962_0019495 | 3300035242 | Bacteria | 1775 |
| 526 | Ga0373924_0023154 | 3300035410 | Bacteria | 2433 |
| 527 | Ga0373924_0042213 | 3300035410 | Bacteria | 1870 |
| 528 | Ga0373924_0045195 | 3300035410 | Bacteria | 1811 |
| 529 | Ga0373931_0027612 | 3300035691 | Bacteria | 2899 |
| 530 | Ga0373931_0080472 | 3300035691 | Bacteria | 1796 |
| 531 | Ga0373931_0269970 | 3300035691 | Bacteria | 1041 |
| 532 | Ga0373935_0000500 | 3300035692 | Bacteria | 20245 |
| 533 | Ga0373935_0031449 | 3300035692 | Bacteria | 3294 |
| 534 | Ga0373927_0000337 | 3300035695 | Bacteria | 36861 |
| 535 | Ga0373927_0006763 | 3300035695 | Bacteria | 7801 |
| 536 | Ga0373927_0022849 | 3300035695 | Bacteria | 4096 |
| 537 | Ga0373927_0029973 | 3300035695 | Bacteria | 3549 |
| 538 | Ga0373927_0034171 | 3300035695 | Bacteria | 3308 |
| 539 | Ga0373933_0000487 | 3300035724 | Bacteria | 24768 |
| 540 | Ga0373933_0044281 | 3300035724 | Bacteria | 2636 |
| 541 | Ga0373947_0002043 | 3300035725 | Bacteria | 12316 |
| 542 | Ga0373947_0005807 | 3300035725 | Bacteria | 7195 |
| 543 | Ga0373947_0111496 | 3300035725 | Bacteria | 1729 |
| 544 | Ga0373947_0147476 | 3300035725 | Bacteria | 1513 |
| 545 | Ga0373937_0038100 | 3300036401 | Bacteria | 4382 |
| 546 | Ga0373937_0125555 | 3300036401 | Bacteria | 2393 |
| 547 | Ga0373937_0147029 | 3300036401 | Bacteria | 2206 |
| 548 | Ga0373937_0187235 | 3300036401 | Bacteria | 1944 |
| 549 | Ga0372808_006158 | 3300036459 | Bacteria | 1608 |
| 550 | Ga0373925_0003157 | 3300037068 | Bacteria | 12909 |
| 551 | Ga0373925_0013825 | 3300037068 | Bacteria | 5843 |
| 552 | Ga0373925_0042071 | 3300037068 | Bacteria | 3389 |
| 553 | Ga0373925_0153495 | 3300037068 | Bacteria | 1810 |
| 554 | Ga0395905_0151758 | 3300037471 | Bacteria | 2180 |
| 555 | Ga0395905_0327503 | 3300037471 | Bacteria | 1422 |
| 556 | Ga0436364_0336598 | 3300037853 | Bacteria | 4233 |
| 557 | Ga0436365_0116257 | 3300039437 | Bacteria | 988 |
| 558 | Ga0436365_0173083 | 3300039437 | Bacteria | 16286 |
| 559 | Ga0436365_0398617 | 3300039437 | Bacteria | 4806 |
| 560 | Ga0436365_0675687 | 3300039437 | Bacteria | 1242 |
| 561 | Ga0451853_3231558 | 3300041512 | Bacteria | 1189 |
| 562 | Ga0439448_0055361 | 3300042005 | Bacteria | 1304 |
| 563 | Ga0466967_0271578 | 3300045976 | Bacteria | 1625 |
| 564 | Ga0495592_0052315 | 3300046454 | Bacteria | 3033 |
| 565 | Ga0495592_0066449 | 3300046454 | Bacteria | 2638 |
| 566 | Ga0495603_0001388 | 3300046455 | Bacteria | 14063 |
| 567 | Ga0495603_0002436 | 3300046455 | Bacteria | 10943 |
| 568 | Ga0495603_0005675 | 3300046455 | Bacteria | 7457 |
| 569 | Ga0495591_041077 | 3300046458 | Bacteria | 1315 |
| 570 | Ga0495629_0000124 | 3300046459 | Bacteria | 68796 |
| 571 | Ga0495629_0000727 | 3300046459 | Bacteria | 26728 |
| 572 | Ga0495641_0007117 | 3300046461 | Bacteria | 7073 |
| 573 | Ga0495641_0079497 | 3300046461 | Bacteria | 1469 |
| 574 | Ga0495651_0039024 | 3300046462 | Bacteria | 3697 |
| 575 | Ga0495651_0041061 | 3300046462 | Bacteria | 3595 |
| 576 | Ga0495651_0280975 | 3300046462 | Bacteria | 1124 |
| 577 | Ga0495653_0000465 | 3300046463 | Bacteria | 31535 |
| 578 | Ga0495653_0041812 | 3300046463 | Bacteria | 3575 |
| 579 | Ga0495653_0251108 | 3300046463 | Bacteria | 1174 |
| 580 | Ga0495580_0002297 | 3300046472 | Bacteria | 16691 |
| 581 | Ga0495580_0031584 | 3300046472 | Bacteria | 3826 |
| 582 | Ga0495580_0034287 | 3300046472 | Bacteria | 3655 |
| 583 | Ga0495582_0000494 | 3300046473 | Bacteria | 21572 |
| 584 | Ga0495582_0020335 | 3300046473 | Bacteria | 3633 |
| 585 | Ga0495639_0000119 | 3300046475 | Bacteria | 39930 |
| 586 | Ga0495639_0091485 | 3300046475 | Bacteria | 1428 |
| 587 | Ga0495639_0105842 | 3300046475 | Bacteria | 1332 |
| 588 | Ga0495662_0001142 | 3300046476 | Bacteria | 13095 |
| 589 | Ga0495662_0074939 | 3300046476 | Bacteria | 1642 |
| 590 | Ga0495664_0001550 | 3300046477 | Bacteria | 12165 |
| 591 | Ga0495664_0007218 | 3300046477 | Bacteria | 6161 |
| 592 | Ga0495664_0012516 | 3300046477 | Bacteria | 4806 |
| 593 | Ga0495664_0055229 | 3300046477 | Bacteria | 2363 |
| 594 | Ga0495585_0010815 | 3300046492 | Bacteria | 5422 |
| 595 | Ga0495585_0017878 | 3300046492 | Bacteria | 4091 |
| 596 | Ga0495594_0031156 | 3300046499 | Bacteria | 2890 |
| 597 | Ga0495596_0042640 | 3300046500 | Bacteria | 1788 |
| 598 | Ga0495596_0052406 | 3300046500 | Bacteria | 1597 |
| 599 | Ga0495608_0001489 | 3300046511 | Bacteria | 16666 |
| 600 | Ga0495608_0068946 | 3300046511 | Bacteria | 2311 |
| 601 | Ga0495608_0087706 | 3300046511 | Bacteria | 2015 |
| 602 | Ga0495618_0010417 | 3300046514 | Bacteria | 5621 |
| 603 | Ga0495618_0136834 | 3300046514 | Bacteria | 1567 |
| 604 | Ga0495620_0030968 | 3300046515 | Bacteria | 2456 |
| 605 | Ga0495628_0006943 | 3300046516 | Bacteria | 9831 |
| 606 | Ga0495628_0017483 | 3300046516 | Bacteria | 5971 |
| 607 | Ga0495628_0023788 | 3300046516 | Bacteria | 5023 |
| 608 | Ga0495630_0140250 | 3300046517 | Bacteria | 1838 |
| 609 | Ga0495630_0257369 | 3300046517 | Bacteria | 1333 |
| 610 | Ga0495631_0008583 | 3300046518 | Bacteria | 5145 |
| 611 | Ga0495631_0123369 | 3300046518 | Bacteria | 1114 |
| 612 | Ga0495666_0030645 | 3300046526 | Bacteria | 2638 |
| 613 | Ga0495652_0001377 | 3300046529 | Bacteria | 27009 |
| 614 | Ga0495652_0069696 | 3300046529 | Bacteria | 2942 |
| 615 | Ga0495652_0170570 | 3300046529 | Bacteria | 1680 |
| 616 | Ga0495665_0000251 | 3300046531 | Bacteria | 26959 |
| 617 | Ga0495665_0015050 | 3300046531 | Bacteria | 4169 |
| 618 | Ga0495640_0026258 | 3300046533 | Bacteria | 4211 |
| 619 | Ga0495640_0036134 | 3300046533 | Bacteria | 3491 |
| 620 | Ga0495640_0205877 | 3300046533 | Bacteria | 1245 |
| 621 | Ga0495587_0033400 | 3300046536 | Bacteria | 3106 |
| 622 | Ga0495587_0048659 | 3300046536 | Bacteria | 2510 |
| 623 | Ga0495598_0026992 | 3300046537 | Bacteria | 1580 |
| 624 | Ga0495645_0017210 | 3300046543 | Bacteria | 5177 |
| 625 | Ga0495645_0258808 | 3300046543 | Bacteria | 1153 |
| 626 | Ga0495622_0024919 | 3300046557 | Bacteria | 2794 |
| 627 | Ga0495622_0038571 | 3300046557 | Bacteria | 2224 |
| 628 | Ga0495667_0001146 | 3300046559 | Bacteria | 17281 |
| 629 | Ga0495667_0027511 | 3300046559 | Bacteria | 3831 |
| 630 | Ga0495667_0036446 | 3300046559 | Bacteria | 3284 |
| 631 | Ga0495634_0000886 | 3300046642 | Bacteria | 28754 |
| 632 | Ga0495634_0014430 | 3300046642 | Bacteria | 5696 |
| 633 | Ga0495634_0053801 | 3300046642 | Bacteria | 2695 |
| 634 | Ga0495635_0000786 | 3300046663 | Bacteria | 20681 |
| 635 | Ga0495635_0001208 | 3300046663 | Bacteria | 17261 |
| 636 | Ga0495635_0019516 | 3300046663 | Bacteria | 4724 |
| 637 | Ga0495635_0060747 | 3300046663 | Bacteria | 2597 |
| 638 | Ga0495659_0011408 | 3300046664 | Bacteria | 2863 |
| 639 | Ga0495659_0041774 | 3300046664 | Bacteria | 1639 |
| 640 | Ga0495588_0017578 | 3300046674 | Bacteria | 3476 |
| 641 | Ga0495588_0019036 | 3300046674 | Bacteria | 3358 |
| 642 | Ga0495588_0204762 | 3300046674 | Bacteria | 1042 |
| 643 | Ga0495657_0001030 | 3300046675 | Bacteria | 24459 |
| 644 | Ga0495599_0031137 | 3300046678 | Bacteria | 3349 |
| 645 | Ga0495599_0092967 | 3300046678 | Bacteria | 1881 |
| 646 | Ga0495623_0014400 | 3300046679 | Bacteria | 5118 |
| 647 | Ga0495623_0172304 | 3300046679 | Bacteria | 1263 |
| 648 | Ga0495646_0023325 | 3300046680 | Bacteria | 3897 |
| 649 | Ga0495646_0033655 | 3300046680 | Bacteria | 3186 |
| 650 | Ga0495647_0000085 | 3300046681 | Bacteria | 22908 |
| 651 | Ga0495658_0000135 | 3300046683 | Bacteria | 40991 |
| 652 | Ga0495658_0012816 | 3300046683 | Bacteria | 4257 |
| 653 | Ga0495658_0272621 | 3300046683 | Bacteria | 1067 |
| 654 | Ga0495669_0000707 | 3300046684 | Bacteria | 14557 |
| 655 | Ga0495613_0001617 | 3300046689 | Bacteria | 17148 |
| 656 | Ga0495613_0073692 | 3300046689 | Bacteria | 2487 |
| 657 | Ga0495613_0148177 | 3300046689 | Bacteria | 1675 |
| 658 | Ga0495624_0000144 | 3300046690 | Bacteria | 51509 |
| 659 | Ga0495624_0032598 | 3300046690 | Bacteria | 3378 |
| 660 | Ga0495600_0000768 | 3300046809 | Bacteria | 16897 |
| 661 | Ga0495600_0046877 | 3300046809 | Bacteria | 2819 |
| 662 | Ga0495581_0000421 | 3300047315 | Bacteria | 21445 |
| 663 | Ga0495581_0016438 | 3300047315 | Bacteria | 4301 |
| 664 | Ga0495581_0079139 | 3300047315 | Bacteria | 1902 |
| 665 | Ga0495581_0253921 | 3300047315 | Bacteria | 1028 |
| 666 | Ga0495604_0009371 | 3300047317 | Bacteria | 7744 |
| 667 | Ga0495636_0031056 | 3300047318 | Bacteria | 2188 |
| 668 | Ga0495674_0001274 | 3300047319 | Bacteria | 24483 |
| 669 | Ga0495674_0035560 | 3300047319 | Bacteria | 4492 |
| 670 | Ga0495674_0067280 | 3300047319 | Bacteria | 3104 |
| 671 | Ga0495674_0082014 | 3300047319 | Bacteria | 2765 |
| 672 | Ga0495672_0011591 | 3300047320 | Bacteria | 6211 |
| 673 | Ga0495672_0077427 | 3300047320 | Bacteria | 1864 |
| 674 | Ga0495676_0012854 | 3300047321 | Bacteria | 7528 |
| 675 | Ga0495676_0020657 | 3300047321 | Bacteria | 5771 |
| 676 | Ga0495676_0096406 | 3300047321 | Bacteria | 2199 |
| 677 | Ga0495676_0169786 | 3300047321 | Bacteria | 1536 |
| 678 | Ga0495680_0001556 | 3300047322 | Bacteria | 24553 |
| 679 | Ga0495680_0050712 | 3300047322 | Bacteria | 3243 |
| 680 | Ga0495680_0292552 | 3300047322 | Bacteria | 1145 |
| 681 | Ga0495675_0003063 | 3300047444 | Bacteria | 10046 |
| 682 | Ga0495675_0019876 | 3300047444 | Bacteria | 4268 |
| 683 | Ga0495679_044115 | 3300047446 | Bacteria | 1367 |
| 684 | Ga0495673_0056264 | 3300047469 | Bacteria | 1703 |
| 685 | Ga0495681_0105548 | 3300047470 | Bacteria | 1226 |
| 686 | Ga0495684_0000169 | 3300047471 | Bacteria | 49164 |
| 687 | Ga0495684_0033825 | 3300047471 | Bacteria | 3921 |
| 688 | Ga0495684_0084824 | 3300047471 | Bacteria | 2402 |
| 689 | Ga0495686_0037943 | 3300047472 | Bacteria | 3085 |
| 690 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 691 | Ga0495593_0004906 | 3300047673 | Bacteria | 7935 |
| 692 | Ga0495602_0018573 | 3300048088 | Bacteria | 6936 |
| 693 | Ga0495614_0009706 | 3300048089 | Bacteria | 4253 |
| 694 | Ga0495614_0061335 | 3300048089 | Bacteria | 1616 |
| 695 | Ga0495626_0102882 | 3300048091 | Bacteria | 1244 |
| 696 | Ga0496100_0012929 | 3300048903 | Bacteria | 4799 |
| 697 | Ga0496100_0108105 | 3300048903 | Bacteria | 1928 |
| 698 | Ga0496100_0116295 | 3300048903 | Bacteria | 1866 |
| 699 | Ga0496101_0006277 | 3300048904 | Bacteria | 7650 |
| 700 | Ga0496101_0030669 | 3300048904 | Bacteria | 3773 |
| 701 | Ga0496101_0064590 | 3300048904 | Bacteria | 2666 |
| 702 | Ga0496101_0067239 | 3300048904 | Bacteria | 2616 |
| 703 | Ga0496101_0172043 | 3300048904 | Bacteria | 1665 |
| 704 | Ga0496101_0425268 | 3300048904 | Bacteria | 1047 |
| 705 | Ga0496102_0002951 | 3300048905 | Bacteria | 14413 |
| 706 | Ga0496102_0008119 | 3300048905 | Bacteria | 8984 |
| 707 | Ga0496102_0009172 | 3300048905 | Bacteria | 8488 |
| 708 | Ga0496103_0042331 | 3300048906 | Bacteria | 2802 |
| 709 | Ga0496104_0080044 | 3300048907 | Bacteria | 3114 |
| 710 | Ga0496105_0032942 | 3300048908 | Bacteria | 4254 |
| 711 | Ga0496106_0000929 | 3300048909 | Bacteria | 21332 |
| 712 | Ga0496106_0002286 | 3300048909 | Bacteria | 14292 |
| 713 | Ga0496106_0010158 | 3300048909 | Bacteria | 6954 |
| 714 | Ga0496106_0014006 | 3300048909 | Bacteria | 5929 |
| 715 | Ga0496106_0025052 | 3300048909 | Bacteria | 4438 |
| 716 | Ga0496106_0037948 | 3300048909 | Bacteria | 3605 |
| 717 | Ga0496106_0067541 | 3300048909 | Bacteria | 2726 |
| 718 | Ga0496106_0074110 | 3300048909 | Bacteria | 2605 |
| 719 | Ga0496106_0093924 | 3300048909 | Bacteria | 2318 |
| 720 | Ga0496107_0005366 | 3300048910 | Bacteria | 8769 |
| 721 | Ga0496107_0007292 | 3300048910 | Bacteria | 7621 |
| 722 | Ga0496107_0131841 | 3300048910 | Bacteria | 1845 |
| 723 | Ga0496107_0165943 | 3300048910 | Bacteria | 1637 |
| 724 | Ga0496107_0289447 | 3300048910 | Bacteria | 1219 |
| 725 | Ga0496108_0007489 | 3300048911 | Bacteria | 8847 |
| 726 | Ga0496108_0013286 | 3300048911 | Bacteria | 6713 |
| 727 | Ga0496108_0026806 | 3300048911 | Bacteria | 4756 |
| 728 | Ga0496108_0029893 | 3300048911 | Bacteria | 4515 |
| 729 | Ga0496108_0034630 | 3300048911 | Bacteria | 4196 |
| 730 | Ga0496108_0045808 | 3300048911 | Bacteria | 3653 |
| 731 | Ga0496108_0300339 | 3300048911 | Bacteria | 1399 |
| 732 | Ga0496109_0003252 | 3300048912 | Bacteria | 13541 |
| 733 | Ga0496109_0155032 | 3300048912 | Bacteria | 2145 |
| 734 | Ga0496109_0158178 | 3300048912 | Bacteria | 2122 |
| 735 | Ga0496109_0191817 | 3300048912 | Bacteria | 1920 |
| 736 | Ga0496109_0293130 | 3300048912 | Bacteria | 1534 |
| 737 | Ga0496110_0020307 | 3300048913 | Bacteria | 5608 |
| 738 | Ga0496110_0079965 | 3300048913 | Bacteria | 2911 |
| 739 | Ga0496110_0127679 | 3300048913 | Bacteria | 2295 |
| 740 | Ga0496111_0198527 | 3300048914 | Bacteria | 1491 |
| 741 | Ga0496112_0000035 | 3300048915 | Bacteria | 106983 |
| 742 | Ga0496112_0003673 | 3300048915 | Bacteria | 12791 |
| 743 | Ga0496112_0074304 | 3300048915 | Bacteria | 3361 |
| 744 | Ga0496112_0087087 | 3300048915 | Bacteria | 3090 |
| 745 | Ga0496112_0098794 | 3300048915 | Bacteria | 2888 |
| 746 | Ga0496112_0150319 | 3300048915 | Bacteria | 2296 |
| 747 | Ga0496112_0270112 | 3300048915 | Bacteria | 1649 |
| 748 | Ga0496113_0012420 | 3300048916 | Bacteria | 5723 |
| 749 | Ga0496113_0063988 | 3300048916 | Bacteria | 2780 |
| 750 | Ga0496113_0079843 | 3300048916 | Bacteria | 2505 |
| 751 | Ga0496113_0216991 | 3300048916 | Bacteria | 1524 |
| 752 | Ga0496114_0061781 | 3300048917 | Bacteria | 3134 |
| 753 | Ga0496114_0205974 | 3300048917 | Bacteria | 1724 |
| 754 | Ga0496115_0002653 | 3300048918 | Bacteria | 12842 |
| 755 | Ga0496115_0012788 | 3300048918 | Bacteria | 6328 |
| 756 | Ga0496115_0025586 | 3300048918 | Bacteria | 4597 |
| 757 | Ga0496115_0047885 | 3300048918 | Bacteria | 3419 |
| 758 | Ga0496115_0049186 | 3300048918 | Bacteria | 3374 |
| 759 | Ga0496115_0419216 | 3300048918 | Bacteria | 1085 |
| 760 | Ga0496117_0010324 | 3300048920 | Bacteria | 8535 |
| 761 | Ga0496118_0007916 | 3300048921 | Bacteria | 11123 |
| 762 | Ga0496120_0098961 | 3300048923 | Bacteria | 1545 |
| 763 | Ga0496121_0000203 | 3300048924 | Bacteria | 130984 |
| 764 | Ga0496121_0000893 | 3300048924 | Bacteria | 53847 |
| 765 | Ga0496121_0007942 | 3300048924 | Bacteria | 12680 |
| 766 | Ga0496121_0106495 | 3300048924 | Bacteria | 2149 |
| 767 | Ga0496124_0001303 | 3300048927 | Bacteria | 37721 |
| 768 | Ga0496124_0068930 | 3300048927 | Bacteria | 2938 |
| 769 | Ga0496125_0064007 | 3300048928 | Bacteria | 2927 |
| 770 | Ga0496125_0090937 | 3300048928 | Bacteria | 2288 |
| 771 | Ga0496126_0014074 | 3300048929 | Bacteria | 8104 |
| 772 | Ga0496126_0021709 | 3300048929 | Bacteria | 6265 |
| 773 | Ga0496126_0072585 | 3300048929 | Bacteria | 3061 |
| 774 | Ga0496126_0148674 | 3300048929 | Bacteria | 2009 |
| 775 | Ga0496126_0165177 | 3300048929 | Bacteria | 1889 |
| 776 | Ga0496126_0283371 | 3300048929 | Bacteria | 1372 |
| 777 | Ga0501034_0022273 | 3300049571 | Bacteria | 6458 |
| 778 | Ga0501039_0390387 | 3300049575 | Bacteria | 1093 |
| 779 | Ga0501047_0036672 | 3300049581 | Bacteria | 4739 |
| 780 | Ga0501077_0070402 | 3300049593 | Bacteria | 2217 |
| 781 | Ga0501077_0248659 | 3300049593 | Bacteria | 1130 |
| 782 | Ga0501079_0248447 | 3300049741 | Bacteria | 1390 |
| 783 | Ga0501081_0025778 | 3300049743 | Bacteria | 3959 |
| 784 | Ga0501044_0016453 | 3300049823 | Bacteria | 7938 |
| 785 | nmdc:mga03n38_100_c1 | 3300050490 | Bacteria | 19063 |
| 786 | nmdc:mga06z11_13204_c1 | 3300050494 | Bacteria | 3618 |
| 787 | nmdc:mga07m45_52329_c1 | 3300050496 | Bacteria | 2305 |
| 788 | nmdc:mga05p37_172909_c1 | 3300050507 | Bacteria | 2633 |
| 789 | nmdc:mga05p37_462464_c1 | 3300050507 | Bacteria | 1466 |
| 790 | nmdc:mga09592_165572_c1 | 3300050508 | Bacteria | 1911 |
| 791 | nmdc:mga09592_64113_c1 | 3300050508 | Bacteria | 3111 |
| 792 | nmdc:mga0qj67_32117_c1 | 3300050509 | Bacteria | 4094 |
| 793 | nmdc:mga06r32_7402_c1 | 3300050510 | Bacteria | 9875 |
| 794 | nmdc:mga08y16_77109_c1 | 3300050511 | Bacteria | 3475 |
| 795 | nmdc:mga0n895_24405_c1 | 3300050512 | Bacteria | 5699 |
| 796 | nmdc:mga0n895_53433_c1 | 3300050512 | Bacteria | 3969 |
| 797 | nmdc:mga0rr50_41840_c1 | 3300050513 | Bacteria | 3342 |
| 798 | nmdc:mga0a205_11623_c2 | 3300050515 | Bacteria | 7704 |
| 799 | nmdc:mga0a205_506851_c1 | 3300050515 | Bacteria | 1063 |
| 800 | Ga0495601_0015001 | 3300053077 | Bacteria | 4680 |
| 801 | Ga0495601_0030171 | 3300053077 | Bacteria | 3366 |
| 802 | Ga0495601_0093245 | 3300053077 | Bacteria | 1940 |
| 803 | Ga0495612_0014984 | 3300053078 | Bacteria | 3109 |
| 804 | Ga0495612_0044248 | 3300053078 | Bacteria | 1821 |
| 805 | Ga0495655_0050413 | 3300053083 | Bacteria | 1100 |
| 806 | Ga0495595_0000329 | 3300053084 | Bacteria | 18457 |
| 807 | Ga0495619_0025638 | 3300053085 | Bacteria | 3788 |
| 808 | Ga0500643_001412 | 3300053087 | Bacteria | 13874 |
| 809 | Ga0500647_0004754 | 3300053091 | Bacteria | 5526 |
| 810 | Ga0500651_0001809 | 3300053093 | Bacteria | 10947 |
| 811 | Ga0500566_0000150 | 3300053094 | Bacteria | 35703 |
| 812 | Ga0500566_0001277 | 3300053094 | Bacteria | 14669 |
| 813 | Ga0500640_011476 | 3300053095 | Bacteria | 3612 |
| 814 | Ga0500641_0003982 | 3300053096 | Bacteria | 5222 |
| 815 | Ga0500641_0006532 | 3300053096 | Bacteria | 4135 |
| 816 | Ga0500554_002467 | 3300053102 | Bacteria | 3647 |
| 817 | Ga0500562_017692 | 3300053108 | Bacteria | 1839 |
| 818 | Ga0500572_009836 | 3300053111 | Bacteria | 2271 |
| 819 | Ga0500595_000258 | 3300053119 | Bacteria | 35116 |
| 820 | Ga0500595_002380 | 3300053119 | Bacteria | 9400 |
| 821 | Ga0500595_002973 | 3300053119 | Bacteria | 8073 |
| 822 | Ga0500595_003042 | 3300053119 | Bacteria | 7968 |
| 823 | Ga0500595_014145 | 3300053119 | Bacteria | 3034 |
| 824 | Ga0500642_0001001 | 3300053130 | Bacteria | 8113 |
| 825 | Ga0500655_006652 | 3300053133 | Bacteria | 2080 |
| 826 | Ga0500559_0000244 | 3300053136 | Bacteria | 42994 |
| 827 | Ga0500559_0134507 | 3300053136 | Bacteria | 1155 |
| 828 | Ga0500603_000762 | 3300053150 | Bacteria | 7755 |
| 829 | Ga0500603_008823 | 3300053150 | Bacteria | 2247 |
| 830 | Ga0500616_0000127 | 3300053153 | Bacteria | 134777 |
| 831 | Ga0500622_0033972 | 3300053156 | Bacteria | 2673 |
| 832 | Ga0500627_0131810 | 3300053158 | Bacteria | 1129 |
| 833 | Ga0500639_110654 | 3300053163 | Bacteria | 1336 |
| 834 | Ga0500637_0000140 | 3300053178 | Bacteria | 26532 |
| 835 | Ga0500637_0000147 | 3300053178 | Bacteria | 25930 |
| 836 | Ga0500637_0055835 | 3300053178 | Bacteria | 2256 |
| 837 | Ga0500657_132507 | 3300053728 | Bacteria | 963 |
| 838 | Ga0500552_005755 | 3300053733 | Bacteria | 1364 |
| 839 | Ga0500596_003380 | 3300053735 | Bacteria | 3042 |
| 840 | Ga0500661_003026 | 3300055283 | Bacteria | 3159 |
| 841 | Ga0501082_0123288 | 3300060353 | Bacteria | 2247 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10748804 | Ga0105240_107488042 | 262 |
| 2 | 3300025913 | Ga0207695_10024634 | Ga0207695_100246342 | 262 |
| 3 | 3300025914 | Ga0207671_10151806 | Ga0207671_101518062 | 262 |
| 4 | 3300025921 | Ga0207652_10028827 | Ga0207652_100288274 | 262 |
| 5 | 3300005327 | Ga0070658_10001807 | Ga0070658_100018079 | 263 |
| 6 | 3300005330 | Ga0070690_100000228 | Ga0070690_1000002284 | 263 |
| 7 | 3300005334 | Ga0068869_100000350 | Ga0068869_10000035011 | 263 |
| 8 | 3300005336 | Ga0070680_100000306 | Ga0070680_10000030619 | 263 |
| 9 | 3300005336 | Ga0070680_100596326 | Ga0070680_1005963261 | 263 |
| 10 | 3300005338 | Ga0068868_100000207 | Ga0068868_10000020711 | 263 |
| 11 | 3300005340 | Ga0070689_100018355 | Ga0070689_1000183554 | 263 |
| 12 | 3300005341 | Ga0070691_10001525 | Ga0070691_100015256 | 263 |
| 13 | 3300005343 | Ga0070687_100000055 | Ga0070687_10000005511 | 263 |
| 14 | 3300005344 | Ga0070661_100096527 | Ga0070661_1000965272 | 263 |
| 15 | 3300005345 | Ga0070692_10000296 | Ga0070692_100002964 | 263 |
| 16 | 3300005355 | Ga0070671_100067099 | Ga0070671_1000670992 | 263 |
| 17 | 3300005406 | Ga0070703_10011767 | Ga0070703_100117672 | 263 |
| 18 | 3300005435 | Ga0070714_100000597 | Ga0070714_1000005979 | 263 |
| 19 | 3300005438 | Ga0070701_10001180 | Ga0070701_100011806 | 263 |
| 20 | 3300005440 | Ga0070705_100000161 | Ga0070705_10000016124 | 263 |
| 21 | 3300005441 | Ga0070700_100000137 | Ga0070700_10000013713 | 263 |
| 22 | 3300005444 | Ga0070694_100000106 | Ga0070694_10000010611 | 263 |
| 23 | 3300005444 | Ga0070694_100124203 | Ga0070694_1001242032 | 263 |
| 24 | 3300005457 | Ga0070662_100038283 | Ga0070662_1000382834 | 263 |
| 25 | 3300005458 | Ga0070681_10189290 | Ga0070681_101892903 | 263 |
| 26 | 3300005459 | Ga0068867_100000230 | Ga0068867_10000023011 | 263 |
| 27 | 3300005530 | Ga0070679_100008011 | Ga0070679_1000080113 | 263 |
| 28 | 3300005539 | Ga0068853_100022948 | Ga0068853_1000229483 | 263 |
| 29 | 3300005539 | Ga0068853_100650114 | Ga0068853_1006501141 | 263 |
| 30 | 3300005544 | Ga0070686_100000546 | Ga0070686_1000005464 | 263 |
| 31 | 3300005545 | Ga0070695_100000200 | Ga0070695_10000020023 | 263 |
| 32 | 3300005546 | Ga0070696_100000189 | Ga0070696_10000018915 | 263 |
| 33 | 3300005547 | Ga0070693_100000170 | Ga0070693_1000001705 | 263 |
| 34 | 3300005549 | Ga0070704_100000028 | Ga0070704_10000002811 | 263 |
| 35 | 3300005563 | Ga0068855_100002784 | Ga0068855_10000278413 | 263 |
| 36 | 3300005577 | Ga0068857_100224233 | Ga0068857_1002242332 | 263 |
| 37 | 3300005578 | Ga0068854_100012220 | Ga0068854_1000122204 | 263 |
| 38 | 3300005615 | Ga0070702_100000089 | Ga0070702_10000008913 | 263 |
| 39 | 3300005617 | Ga0068859_100001708 | Ga0068859_10000170819 | 263 |
| 40 | 3300005718 | Ga0068866_10003103 | Ga0068866_100031035 | 263 |
| 41 | 3300005719 | Ga0068861_100001248 | Ga0068861_10000124811 | 263 |
| 42 | 3300005840 | Ga0068870_10034857 | Ga0068870_100348573 | 263 |
| 43 | 3300005842 | Ga0068858_100001236 | Ga0068858_1000012365 | 263 |
| 44 | 3300005843 | Ga0068860_100004410 | Ga0068860_1000044103 | 263 |
| 45 | 3300005844 | Ga0068862_100003737 | Ga0068862_1000037372 | 263 |
| 46 | 3300006358 | Ga0068871_100000322 | Ga0068871_10000032210 | 263 |
| 47 | 3300006881 | Ga0068865_100000108 | Ga0068865_10000010811 | 263 |
| 48 | 3300006931 | Ga0097620_100001708 | Ga0097620_10000170819 | 263 |
| 49 | 3300009093 | Ga0105240_10001597 | Ga0105240_1000159715 | 263 |
| 50 | 3300009098 | Ga0105245_10000481 | Ga0105245_1000048111 | 263 |
| 51 | 3300009148 | Ga0105243_10000575 | Ga0105243_1000057511 | 263 |
| 52 | 3300009174 | Ga0105241_10017805 | Ga0105241_100178052 | 263 |
| 53 | 3300009176 | Ga0105242_10000342 | Ga0105242_1000034225 | 263 |
| 54 | 3300009553 | Ga0105249_10003783 | Ga0105249_1000378313 | 263 |
| 55 | 3300010375 | Ga0105239_10081518 | Ga0105239_100815184 | 263 |
| 56 | 3300010375 | Ga0105239_10563582 | Ga0105239_105635821 | 263 |
| 57 | 3300013297 | Ga0157378_10000365 | Ga0157378_1000036511 | 263 |
| 58 | 3300013297 | Ga0157378_10139529 | Ga0157378_101395291 | 263 |
| 59 | 3300013306 | Ga0163162_10093948 | Ga0163162_100939482 | 263 |
| 60 | 3300014968 | Ga0157379_10388965 | Ga0157379_103889652 | 263 |
| 61 | 3300025885 | Ga0207653_10011526 | Ga0207653_100115263 | 263 |
| 62 | 3300025899 | Ga0207642_10001661 | Ga0207642_100016614 | 263 |
| 63 | 3300025904 | Ga0207647_10010711 | Ga0207647_100107115 | 263 |
| 64 | 3300025911 | Ga0207654_10061904 | Ga0207654_100619042 | 263 |
| 65 | 3300025912 | Ga0207707_10039291 | Ga0207707_100392914 | 263 |
| 66 | 3300025912 | Ga0207707_10295727 | Ga0207707_102957272 | 263 |
| 67 | 3300025917 | Ga0207660_10001409 | Ga0207660_100014095 | 263 |
| 68 | 3300025917 | Ga0207660_10160795 | Ga0207660_101607953 | 263 |
| 69 | 3300025918 | Ga0207662_10000122 | Ga0207662_1000012211 | 263 |
| 70 | 3300025919 | Ga0207657_10008750 | Ga0207657_100087509 | 263 |
| 71 | 3300025921 | Ga0207652_10041550 | Ga0207652_100415504 | 263 |
| 72 | 3300025927 | Ga0207687_10000178 | Ga0207687_1000017827 | 263 |
| 73 | 3300025929 | Ga0207664_10000131 | Ga0207664_100001319 | 263 |
| 74 | 3300025932 | Ga0207690_10000308 | Ga0207690_1000030819 | 263 |
| 75 | 3300025932 | Ga0207690_10005794 | Ga0207690_100057944 | 263 |
| 76 | 3300025934 | Ga0207686_10000838 | Ga0207686_1000083812 | 263 |
| 77 | 3300025935 | Ga0207709_10002153 | Ga0207709_100021532 | 263 |
| 78 | 3300025936 | Ga0207670_10008018 | Ga0207670_100080185 | 263 |
| 79 | 3300025938 | Ga0207704_10010347 | Ga0207704_100103472 | 263 |
| 80 | 3300025942 | Ga0207689_10000535 | Ga0207689_1000053511 | 263 |
| 81 | 3300025949 | Ga0207667_10014006 | Ga0207667_100140068 | 263 |
| 82 | 3300025949 | Ga0207667_10201536 | Ga0207667_102015361 | 263 |
| 83 | 3300025949 | Ga0207667_10437837 | Ga0207667_104378371 | 263 |
| 84 | 3300025961 | Ga0207712_10004784 | Ga0207712_100047846 | 263 |
| 85 | 3300025981 | Ga0207640_10015461 | Ga0207640_100154612 | 263 |
| 86 | 3300026023 | Ga0207677_10001104 | Ga0207677_1000110412 | 263 |
| 87 | 3300026035 | Ga0207703_10009082 | Ga0207703_100090828 | 263 |
| 88 | 3300026041 | Ga0207639_10016555 | Ga0207639_100165553 | 263 |
| 89 | 3300026075 | Ga0207708_10000179 | Ga0207708_1000017933 | 263 |
| 90 | 3300026078 | Ga0207702_10008145 | Ga0207702_100081454 | 263 |
| 91 | 3300026089 | Ga0207648_10000772 | Ga0207648_1000077224 | 263 |
| 92 | 3300026118 | Ga0207675_100000127 | Ga0207675_10000012715 | 263 |
| 93 | 3300028380 | Ga0268265_10002376 | Ga0268265_1000237611 | 263 |
| 94 | 3300028381 | Ga0268264_10002417 | Ga0268264_1000241715 | 263 |
| 95 | 3300035207 | Ga0373942_0007848 | Ga0373942_0007848_649_1467 | 263 |
| 96 | 3300035691 | Ga0373931_0080472 | Ga0373931_0080472_945_1763 | 263 |
| 97 | 3300042005 | Ga0439448_0055361 | Ga0439448_0055361_304_1122 | 263 |
| 98 | 3300048909 | Ga0496106_0067541 | Ga0496106_0067541_570_1388 | 263 |
| 99 | 3300048916 | Ga0496113_0216991 | Ga0496113_0216991_46_864 | 263 |
| 100 | 3300049581 | Ga0501047_0036672 | Ga0501047_0036672_3881_4699 | 263 |
| 101 | 3300049823 | Ga0501044_0016453 | Ga0501044_0016453_2816_3634 | 263 |
| 102 | 3300006237 | Ga0097621_100007162 | Ga0097621_1000071623 | 264 |
| 103 | 3300009093 | Ga0105240_10104006 | Ga0105240_101040063 | 264 |
| 104 | 3300009174 | Ga0105241_10028964 | Ga0105241_100289644 | 264 |
| 105 | 3300009545 | Ga0105237_10267871 | Ga0105237_102678713 | 264 |
| 106 | 3300009551 | Ga0105238_10028317 | Ga0105238_100283174 | 264 |
| 107 | 3300013297 | Ga0157378_10085942 | Ga0157378_100859424 | 264 |
| 108 | 3300014968 | Ga0157379_10383884 | Ga0157379_103838842 | 264 |
| 109 | 3300014969 | Ga0157376_10079948 | Ga0157376_100799484 | 264 |
| 110 | 3300025911 | Ga0207654_10036015 | Ga0207654_100360154 | 264 |
| 111 | 3300025913 | Ga0207695_10272735 | Ga0207695_102727353 | 264 |
| 112 | 3300025924 | Ga0207694_10084582 | Ga0207694_100845823 | 264 |
| 113 | 3300025927 | Ga0207687_10415182 | Ga0207687_104151821 | 264 |
| 114 | 3300026078 | Ga0207702_10092844 | Ga0207702_100928444 | 264 |
| 115 | 3300031548 | Ga0307408_100210005 | Ga0307408_1002100052 | 264 |
| 116 | 3300048904 | Ga0496101_0067239 | Ga0496101_0067239_234_1070 | 264 |
| 117 | 3300048915 | Ga0496112_0074304 | Ga0496112_0074304_389_1225 | 264 |
| 118 | 3300048918 | Ga0496115_0025586 | Ga0496115_0025586_1714_2550 | 264 |
| 119 | 3300006844 | Ga0075428_100007574 | Ga0075428_10000757411 | 265 |
| 120 | 3300009147 | Ga0114129_10028708 | Ga0114129_100287088 | 265 |
| 121 | 3300053087 | Ga0500643_001412 | Ga0500643_001412_7571_8398 | 265 |
| 122 | 3300049593 | Ga0501077_0070402 | Ga0501077_0070402_397_1314 | 266 |
| 123 | 3300046463 | Ga0495653_0251108 | Ga0495653_0251108_295_1149 | 269 |
| 124 | 3300048911 | Ga0496108_0034630 | Ga0496108_0034630_910_1782 | 270 |
| 125 | 3300049571 | Ga0501034_0022273 | Ga0501034_0022273_2502_3359 | 270 |
| 126 | 3300053108 | Ga0500562_017692 | Ga0500562_017692_561_1430 | 270 |
| 127 | 3300053156 | Ga0500622_0033972 | Ga0500622_0033972_171_1040 | 270 |
| 128 | iso_pu_bacteria | 2513237104 | 2513721303 | 270 |
| 129 | iso_pu_bacteria | 2513237104 | 2513724155 | 270 |
| 130 | iso_pu_bacteria | 2744054633 | 2745082556 | 270 |
| 131 | iso_pu_bacteria | 2847930680 | 2847935430 | 270 |
| 132 | iso_pu_bacteria | 2876761206 | 2876769200 | 270 |
| 133 | 3300005339 | Ga0070660_100166384 | Ga0070660_1001663842 | 271 |
| 134 | 3300006042 | Ga0075368_10019963 | Ga0075368_100199632 | 271 |
| 135 | 3300006178 | Ga0075367_10008366 | Ga0075367_100083662 | 271 |
| 136 | 3300010375 | Ga0105239_10083019 | Ga0105239_100830192 | 271 |
| 137 | 3300014325 | Ga0163163_10075450 | Ga0163163_100754502 | 271 |
| 138 | 3300025914 | Ga0207671_10013631 | Ga0207671_100136318 | 271 |
| 139 | 3300026067 | Ga0207678_10587648 | Ga0207678_105876481 | 271 |
| 140 | 3300035691 | Ga0373931_0027612 | Ga0373931_0027612_1210_2106 | 271 |
| 141 | 3300048904 | Ga0496101_0425268 | Ga0496101_0425268_39_935 | 271 |
| 142 | 3300048905 | Ga0496102_0009172 | Ga0496102_0009172_5460_6356 | 271 |
| 143 | 3300048908 | Ga0496105_0032942 | Ga0496105_0032942_1072_1968 | 271 |
| 144 | 3300048909 | Ga0496106_0037948 | Ga0496106_0037948_1346_2242 | 271 |
| 145 | 3300048910 | Ga0496107_0131841 | Ga0496107_0131841_931_1827 | 271 |
| 146 | 3300048911 | Ga0496108_0026806 | Ga0496108_0026806_2049_2945 | 271 |
| 147 | 3300048913 | Ga0496110_0020307 | Ga0496110_0020307_1787_2683 | 271 |
| 148 | 3300048914 | Ga0496111_0198527 | Ga0496111_0198527_264_1160 | 271 |
| 149 | 3300048915 | Ga0496112_0003673 | Ga0496112_0003673_9175_10071 | 271 |
| 150 | 3300048916 | Ga0496113_0079843 | Ga0496113_0079843_525_1421 | 271 |
| 151 | 3300048917 | Ga0496114_0205974 | Ga0496114_0205974_815_1711 | 271 |
| 152 | 3300048918 | Ga0496115_0419216 | Ga0496115_0419216_115_1011 | 271 |
| 153 | 3300025937 | Ga0207669_10309509 | Ga0207669_103095092 | 272 |
| 154 | 3300031235 | Ga0265330_10076510 | Ga0265330_100765101 | 272 |
| 155 | 3300031250 | Ga0265331_10031034 | Ga0265331_100310343 | 272 |
| 156 | 3300031711 | Ga0265314_10045576 | Ga0265314_100455763 | 272 |
| 157 | 3300035118 | Ga0373954_0004339 | Ga0373954_0004339_5148_6011 | 272 |
| 158 | 3300037853 | Ga0436364_0336598 | Ga0436364_0336598_245_1153 | 272 |
| 159 | 3300048923 | Ga0496120_0098961 | Ga0496120_0098961_536_1432 | 272 |
| 160 | 3300048924 | Ga0496121_0007942 | Ga0496121_0007942_8388_9284 | 272 |
| 161 | 3300053119 | Ga0500595_002973 | Ga0500595_002973_456_1352 | 272 |
| 162 | 3300053119 | Ga0500595_003042 | Ga0500595_003042_1634_2530 | 272 |
| 163 | 3300053158 | Ga0500627_0131810 | Ga0500627_0131810_35_931 | 272 |
| 164 | iso_pu_bacteria | 2513237096 | 2513658867 | 272 |
| 165 | iso_pu_bacteria | 2513237137 | 2513860873 | 272 |
| 166 | iso_pu_bacteria | 2513237145 | 2513921131 | 272 |
| 167 | iso_pu_bacteria | 2728368998 | 2728755041 | 272 |
| 168 | iso_pu_bacteria | 2791355197 | 2793072985 | 272 |
| 169 | iso_pu_bacteria | 2885374607 | 2885377505 | 272 |
| 170 | iso_pu_bacteria | 2903748898 | 2903752079 | 272 |
| 171 | iso_pu_bacteria | 2904690495 | 2904691147 | 272 |
| 172 | iso_pu_bacteria | 2904699407 | 2904708628 | 272 |
| 173 | iso_pu_bacteria | 2906635258 | 2906642277 | 272 |
| 174 | iso_pu_bacteria | 2906660503 | 2906667305 | 272 |
| 175 | iso_pu_bacteria | 2908739725 | 2908747498 | 272 |
| 176 | iso_pu_bacteria | 2908756301 | 2908756541 | 272 |
| 177 | 3300005530 | Ga0070679_100054833 | Ga0070679_1000548333 | 273 |
| 178 | 3300025921 | Ga0207652_10066553 | Ga0207652_100665533 | 273 |
| 179 | 3300005434 | Ga0070709_10000409 | Ga0070709_1000040910 | 274 |
| 180 | 3300005437 | Ga0070710_10000191 | Ga0070710_100001918 | 274 |
| 181 | 3300005439 | Ga0070711_100000851 | Ga0070711_1000008512 | 274 |
| 182 | 3300005468 | Ga0070707_100125368 | Ga0070707_1001253682 | 274 |
| 183 | 3300005471 | Ga0070698_100410792 | Ga0070698_1004107921 | 274 |
| 184 | 3300005536 | Ga0070697_100080131 | Ga0070697_1000801311 | 274 |
| 185 | 3300005539 | Ga0068853_100302820 | Ga0068853_1003028201 | 274 |
| 186 | 3300006028 | Ga0070717_10110826 | Ga0070717_101108262 | 274 |
| 187 | 3300006173 | Ga0070716_100051286 | Ga0070716_1000512863 | 274 |
| 188 | 3300007788 | Ga0099795_10032687 | Ga0099795_100326873 | 274 |
| 189 | 3300009545 | Ga0105237_10331659 | Ga0105237_103316592 | 274 |
| 190 | 3300010159 | Ga0099796_10000761 | Ga0099796_100007617 | 274 |
| 191 | 3300013105 | Ga0157369_10109012 | Ga0157369_101090122 | 274 |
| 192 | 3300021384 | Ga0213876_10002040 | Ga0213876_100020405 | 274 |
| 193 | 3300025898 | Ga0207692_10000493 | Ga0207692_100004933 | 274 |
| 194 | 3300025906 | Ga0207699_10000145 | Ga0207699_1000014525 | 274 |
| 195 | 3300025910 | Ga0207684_10353589 | Ga0207684_103535892 | 274 |
| 196 | 3300025929 | Ga0207664_10025264 | Ga0207664_100252644 | 274 |
| 197 | 3300025939 | Ga0207665_10037525 | Ga0207665_100375252 | 274 |
| 198 | 3300026041 | Ga0207639_10210909 | Ga0207639_102109091 | 274 |
| 199 | 3300034819 | Ga0373958_0011429 | Ga0373958_0011429_35_904 | 274 |
| 200 | 3300039437 | Ga0436365_0173083 | Ga0436365_0173083_8000_8869 | 274 |
| 201 | 3300047320 | Ga0495672_0077427 | Ga0495672_0077427_116_994 | 274 |
| 202 | 3300048929 | Ga0496126_0283371 | Ga0496126_0283371_393_1262 | 274 |
| 203 | 3300049593 | Ga0501077_0248659 | Ga0501077_0248659_42_923 | 274 |
| 204 | 3300049741 | Ga0501079_0248447 | Ga0501079_0248447_271_1152 | 274 |
| 205 | 3300049743 | Ga0501081_0025778 | Ga0501081_0025778_253_1134 | 274 |
| 206 | 3300060353 | Ga0501082_0123288 | Ga0501082_0123288_419_1300 | 274 |
| 207 | 3300005336 | Ga0070680_100061102 | Ga0070680_1000611022 | 275 |
| 208 | 3300005347 | Ga0070668_100305617 | Ga0070668_1003056172 | 275 |
| 209 | 3300005440 | Ga0070705_100002001 | Ga0070705_10000200111 | 275 |
| 210 | 3300005441 | Ga0070700_100000998 | Ga0070700_10000099810 | 275 |
| 211 | 3300005444 | Ga0070694_100007725 | Ga0070694_1000077252 | 275 |
| 212 | 3300005444 | Ga0070694_100026302 | Ga0070694_1000263021 | 275 |
| 213 | 3300005518 | Ga0070699_100000836 | Ga0070699_10000083622 | 275 |
| 214 | 3300005530 | Ga0070679_100316216 | Ga0070679_1003162162 | 275 |
| 215 | 3300005536 | Ga0070697_100029852 | Ga0070697_1000298523 | 275 |
| 216 | 3300005545 | Ga0070695_100043789 | Ga0070695_1000437892 | 275 |
| 217 | 3300005546 | Ga0070696_100001033 | Ga0070696_10000103313 | 275 |
| 218 | 3300005577 | Ga0068857_100009318 | Ga0068857_1000093187 | 275 |
| 219 | 3300005615 | Ga0070702_100010659 | Ga0070702_1000106592 | 275 |
| 220 | 3300005618 | Ga0068864_100322955 | Ga0068864_1003229552 | 275 |
| 221 | 3300005843 | Ga0068860_100000926 | Ga0068860_10000092612 | 275 |
| 222 | 3300005844 | Ga0068862_100000934 | Ga0068862_10000093417 | 275 |
| 223 | 3300005937 | Ga0081455_10000230 | Ga0081455_1000023018 | 275 |
| 224 | 3300006058 | Ga0075432_10109043 | Ga0075432_101090431 | 275 |
| 225 | 3300006844 | Ga0075428_100447024 | Ga0075428_1004470241 | 275 |
| 226 | 3300006846 | Ga0075430_100043772 | Ga0075430_1000437722 | 275 |
| 227 | 3300006847 | Ga0075431_100043785 | Ga0075431_1000437853 | 275 |
| 228 | 3300006852 | Ga0075433_10001174 | Ga0075433_1000117418 | 275 |
| 229 | 3300006871 | Ga0075434_100011494 | Ga0075434_10001149410 | 275 |
| 230 | 3300006880 | Ga0075429_100119058 | Ga0075429_1001190582 | 275 |
| 231 | 3300007076 | Ga0075435_100160360 | Ga0075435_1001603601 | 275 |
| 232 | 3300009553 | Ga0105249_10029065 | Ga0105249_100290652 | 275 |
| 233 | 3300025917 | Ga0207660_10001663 | Ga0207660_1000166316 | 275 |
| 234 | 3300025921 | Ga0207652_10301643 | Ga0207652_103016432 | 275 |
| 235 | 3300025942 | Ga0207689_10082533 | Ga0207689_100825334 | 275 |
| 236 | 3300025972 | Ga0207668_10339612 | Ga0207668_103396122 | 275 |
| 237 | 3300026067 | Ga0207678_10002319 | Ga0207678_100023197 | 275 |
| 238 | 3300026075 | Ga0207708_10001547 | Ga0207708_100015479 | 275 |
| 239 | 3300026095 | Ga0207676_10121668 | Ga0207676_101216682 | 275 |
| 240 | 3300026116 | Ga0207674_10006172 | Ga0207674_1000617216 | 275 |
| 241 | 3300027907 | Ga0207428_10032301 | Ga0207428_100323013 | 275 |
| 242 | 3300027907 | Ga0207428_10350367 | Ga0207428_103503671 | 275 |
| 243 | 3300028380 | Ga0268265_10001274 | Ga0268265_100012744 | 275 |
| 244 | 3300028381 | Ga0268264_10002253 | Ga0268264_100022533 | 275 |
| 245 | 3300035114 | Ga0373939_0054530 | Ga0373939_0054530_113_1012 | 275 |
| 246 | 3300035241 | Ga0373961_0018293 | Ga0373961_0018293_883_1782 | 275 |
| 247 | 3300035242 | Ga0373962_0019495 | Ga0373962_0019495_640_1539 | 275 |
| 248 | 3300048905 | Ga0496102_0002951 | Ga0496102_0002951_417_1289 | 275 |
| 249 | 3300048909 | Ga0496106_0000929 | Ga0496106_0000929_19303_20175 | 275 |
| 250 | 3300048910 | Ga0496107_0007292 | Ga0496107_0007292_4748_5620 | 275 |
| 251 | 3300048911 | Ga0496108_0045808 | Ga0496108_0045808_118_990 | 275 |
| 252 | 3300050507 | nmdc:mga05p37_462464_c1 | nmdc:mga05p37_462464_c1_581_1453 | 275 |
| 253 | 3300050508 | nmdc:mga09592_165572_c1 | nmdc:mga09592_165572_c1_638_1510 | 275 |
| 254 | 3300050508 | nmdc:mga09592_64113_c1 | nmdc:mga09592_64113_c1_2198_3070 | 275 |
| 255 | 3300050509 | nmdc:mga0qj67_32117_c1 | nmdc:mga0qj67_32117_c1_2741_3613 | 275 |
| 256 | 3300050510 | nmdc:mga06r32_7402_c1 | nmdc:mga06r32_7402_c1_7933_8805 | 275 |
| 257 | 3300050511 | nmdc:mga08y16_77109_c1 | nmdc:mga08y16_77109_c1_172_1071 | 275 |
| 258 | 3300050512 | nmdc:mga0n895_24405_c1 | nmdc:mga0n895_24405_c1_1987_2886 | 275 |
| 259 | 3300050513 | nmdc:mga0rr50_41840_c1 | nmdc:mga0rr50_41840_c1_113_1012 | 275 |
| 260 | 3300050515 | nmdc:mga0a205_11623_c2 | nmdc:mga0a205_11623_c2_1312_2211 | 275 |
| 261 | iso_pu_bacteria | 2667528175 | 2671122501 | 275 |
| 262 | 3300005434 | Ga0070709_10064221 | Ga0070709_100642212 | 276 |
| 263 | 3300005435 | Ga0070714_100092250 | Ga0070714_1000922502 | 276 |
| 264 | 3300005437 | Ga0070710_10000880 | Ga0070710_100008806 | 276 |
| 265 | 3300005439 | Ga0070711_100007845 | Ga0070711_1000078454 | 276 |
| 266 | 3300005842 | Ga0068858_100222799 | Ga0068858_1002227992 | 276 |
| 267 | 3300005843 | Ga0068860_100000433 | Ga0068860_10000043316 | 276 |
| 268 | 3300006028 | Ga0070717_10002236 | Ga0070717_100022363 | 276 |
| 269 | 3300006163 | Ga0070715_10002923 | Ga0070715_100029234 | 276 |
| 270 | 3300006173 | Ga0070716_100009934 | Ga0070716_1000099343 | 276 |
| 271 | 3300009148 | Ga0105243_10197565 | Ga0105243_101975652 | 276 |
| 272 | 3300009551 | Ga0105238_10676724 | Ga0105238_106767241 | 276 |
| 273 | 3300010375 | Ga0105239_10324481 | Ga0105239_103244812 | 276 |
| 274 | 3300010375 | Ga0105239_10819389 | Ga0105239_108193891 | 276 |
| 275 | 3300025898 | Ga0207692_10002127 | Ga0207692_100021279 | 276 |
| 276 | 3300025906 | Ga0207699_10003326 | Ga0207699_100033262 | 276 |
| 277 | 3300025915 | Ga0207693_10001606 | Ga0207693_100016066 | 276 |
| 278 | 3300025916 | Ga0207663_10000390 | Ga0207663_1000039011 | 276 |
| 279 | 3300025924 | Ga0207694_10165683 | Ga0207694_101656832 | 276 |
| 280 | 3300025929 | Ga0207664_10415313 | Ga0207664_104153131 | 276 |
| 281 | 3300025939 | Ga0207665_10000444 | Ga0207665_1000044418 | 276 |
| 282 | 3300028381 | Ga0268264_10000062 | Ga0268264_1000006271 | 276 |
| 283 | 3300031507 | Ga0307509_10006490 | Ga0307509_1000649014 | 276 |
| 284 | 3300031616 | Ga0307508_10083297 | Ga0307508_100832972 | 276 |
| 285 | 3300031730 | Ga0307516_10000908 | Ga0307516_1000090825 | 276 |
| 286 | 3300031730 | Ga0307516_10062483 | Ga0307516_100624831 | 276 |
| 287 | 3300031730 | Ga0307516_10068912 | Ga0307516_100689122 | 276 |
| 288 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008255 | 276 |
| 289 | 3300035692 | Ga0373935_0031449 | Ga0373935_0031449_2105_2980 | 276 |
| 290 | 3300035695 | Ga0373927_0034171 | Ga0373927_0034171_1570_2445 | 276 |
| 291 | 3300036459 | Ga0372808_006158 | Ga0372808_006158_429_1304 | 276 |
| 292 | 3300037068 | Ga0373925_0042071 | Ga0373925_0042071_1025_1900 | 276 |
| 293 | 3300039437 | Ga0436365_0116257 | Ga0436365_0116257_31_912 | 276 |
| 294 | 3300046475 | Ga0495639_0105842 | Ga0495639_0105842_295_1170 | 276 |
| 295 | 3300046557 | Ga0495622_0024919 | Ga0495622_0024919_416_1291 | 276 |
| 296 | 3300048909 | Ga0496106_0002286 | Ga0496106_0002286_13211_14086 | 276 |
| 297 | 3300048910 | Ga0496107_0165943 | Ga0496107_0165943_134_1009 | 276 |
| 298 | 3300048920 | Ga0496117_0010324 | Ga0496117_0010324_1818_2693 | 276 |
| 299 | 3300048921 | Ga0496118_0007916 | Ga0496118_0007916_1972_2847 | 276 |
| 300 | 3300048924 | Ga0496121_0000203 | Ga0496121_0000203_77242_78117 | 276 |
| 301 | 3300048927 | Ga0496124_0001303 | Ga0496124_0001303_36459_37334 | 276 |
| 302 | 3300048928 | Ga0496125_0064007 | Ga0496125_0064007_1812_2687 | 276 |
| 303 | 3300053178 | Ga0500637_0055835 | Ga0500637_0055835_148_1023 | 276 |
| 304 | 3300053728 | Ga0500657_132507 | Ga0500657_132507_68_943 | 276 |
| 305 | 3300053733 | Ga0500552_005755 | Ga0500552_005755_413_1288 | 276 |
| 306 | 3300005548 | Ga0070665_100024863 | Ga0070665_1000248632 | 277 |
| 307 | iso_pu_bacteria | 2513237098 | 2513675092 | 277 |
| 308 | iso_pu_bacteria | 2513237101 | 2513695148 | 277 |
| 309 | iso_pu_bacteria | 2517572143 | 2517888895 | 277 |
| 310 | iso_pu_bacteria | 2524023210 | 2524469504 | 277 |
| 311 | iso_pu_bacteria | 2524023228 | 2524536993 | 277 |
| 312 | iso_pu_bacteria | 2721755755 | 2723841678 | 277 |
| 313 | iso_pu_bacteria | 2791355199 | 2793083619 | 277 |
| 314 | iso_pu_bacteria | 2874604998 | 2874608027 | 277 |
| 315 | iso_pu_bacteria | 2876808645 | 2876816140 | 277 |
| 316 | iso_pu_bacteria | 2879110137 | 2879112213 | 277 |
| 317 | iso_pu_bacteria | 2885383462 | 2885392604 | 277 |
| 318 | iso_pu_bacteria | 2889033259 | 2889035448 | 277 |
| 319 | iso_pu_bacteria | 2903768456 | 2903771821 | 277 |
| 320 | iso_pu_bacteria | 2906610324 | 2906613923 | 277 |
| 321 | iso_pu_bacteria | 2922361189 | 2922363961 | 277 |
| 322 | iso_pu_bacteria | 2922425934 | 2922434169 | 277 |
| 323 | iso_pu_bacteria | 2935630451 | 2935637086 | 277 |
| 324 | iso_pu_bacteria | 2941507105 | 2941513647 | 277 |
| 325 | iso_pu_bacteria | 2941515067 | 2941521610 | 277 |
| 326 | iso_pu_bacteria | 2941523033 | 2941529441 | 277 |
| 327 | iso_pu_bacteria | 3005474847 | 3005475121 | 277 |
| 328 | iso_pu_bacteria | 8006933436 | 8006936170 | 277 |
| 329 | iso_pu_bacteria | 8006964411 | 8006967495 | 277 |
| 330 | iso_pu_bacteria | 8006973647 | 8006976116 | 277 |
| 331 | iso_pu_bacteria | 8006984368 | 8006990961 | 277 |
| 332 | iso_pu_bacteria | 8006994254 | 8006996472 | 277 |
| 333 | iso_pu_bacteria | 8019555841 | 8019562461 | 277 |
| 334 | iso_pu_bacteria | 8019565922 | 8019572536 | 277 |
| 335 | iso_pu_bacteria | 8056673599 | 8056675774 | 277 |
| 336 | iso_pu_bacteria | 8056681323 | 8056686570 | 277 |
| 337 | 3300005468 | Ga0070707_100178214 | Ga0070707_1001782142 | 278 |
| 338 | 3300005471 | Ga0070698_100025240 | Ga0070698_1000252403 | 278 |
| 339 | 3300005937 | Ga0081455_10014288 | Ga0081455_100142883 | 278 |
| 340 | 3300025922 | Ga0207646_10154033 | Ga0207646_101540332 | 278 |
| 341 | 3300035113 | Ga0373936_0010488 | Ga0373936_0010488_1746_2642 | 278 |
| 342 | 3300053091 | Ga0500647_0004754 | Ga0500647_0004754_3155_4051 | 278 |
| 343 | 3300053093 | Ga0500651_0001809 | Ga0500651_0001809_6971_7867 | 278 |
| 344 | 3300053094 | Ga0500566_0000150 | Ga0500566_0000150_15673_16569 | 278 |
| 345 | 3300053095 | Ga0500640_011476 | Ga0500640_011476_1938_2834 | 278 |
| 346 | 3300053111 | Ga0500572_009836 | Ga0500572_009836_641_1537 | 278 |
| 347 | 3300053130 | Ga0500642_0001001 | Ga0500642_0001001_1388_2284 | 278 |
| 348 | 3300053136 | Ga0500559_0134507 | Ga0500559_0134507_222_1118 | 278 |
| 349 | 3300053150 | Ga0500603_008823 | Ga0500603_008823_722_1618 | 278 |
| 350 | 3300053163 | Ga0500639_110654 | Ga0500639_110654_113_1009 | 278 |
| 351 | 3300005355 | Ga0070671_100218788 | Ga0070671_1002187882 | 279 |
| 352 | 3300005844 | Ga0068862_100338283 | Ga0068862_1003382832 | 279 |
| 353 | 3300006042 | Ga0075368_10049264 | Ga0075368_100492642 | 279 |
| 354 | 3300009177 | Ga0105248_10170084 | Ga0105248_101700842 | 279 |
| 355 | 3300025941 | Ga0207711_10128429 | Ga0207711_101284292 | 279 |
| 356 | 3300047320 | Ga0495672_0011591 | Ga0495672_0011591_1873_2763 | 279 |
| 357 | 3300048913 | Ga0496110_0127679 | Ga0496110_0127679_808_1704 | 279 |
| 358 | 3300053153 | Ga0500616_0000127 | Ga0500616_0000127_109539_110429 | 279 |
| 359 | 3300003203 | JGI25406J46586_10000241 | JGI25406J46586_1000024125 | 280 |
| 360 | 3300005434 | Ga0070709_10031279 | Ga0070709_100312793 | 280 |
| 361 | 3300005436 | Ga0070713_100095939 | Ga0070713_1000959392 | 280 |
| 362 | 3300005437 | Ga0070710_10103186 | Ga0070710_101031862 | 280 |
| 363 | 3300005983 | Ga0081540_1016558 | Ga0081540_10165585 | 280 |
| 364 | 3300005985 | Ga0081539_10000064 | Ga0081539_100000642 | 280 |
| 365 | 3300025906 | Ga0207699_10124561 | Ga0207699_101245612 | 280 |
| 366 | 3300025915 | Ga0207693_10016445 | Ga0207693_100164457 | 280 |
| 367 | 3300031235 | Ga0265330_10116335 | Ga0265330_101163351 | 280 |
| 368 | 3300048915 | Ga0496112_0000035 | Ga0496112_0000035_98938_99831 | 280 |
| 369 | 3300001979 | JGI24740J21852_10000570 | JGI24740J21852_100005705 | 281 |
| 370 | 3300001990 | JGI24737J22298_10004785 | JGI24737J22298_100047853 | 281 |
| 371 | 3300003203 | JGI25406J46586_10013397 | JGI25406J46586_100133972 | 281 |
| 372 | 3300003659 | JGI25404J52841_10004528 | JGI25404J52841_100045281 | 281 |
| 373 | 3300003659 | JGI25404J52841_10007061 | JGI25404J52841_100070611 | 281 |
| 374 | 3300003659 | JGI25404J52841_10007351 | JGI25404J52841_100073512 | 281 |
| 375 | 3300003659 | JGI25404J52841_10007389 | JGI25404J52841_100073892 | 281 |
| 376 | 3300005329 | Ga0070683_100037797 | Ga0070683_1000377975 | 281 |
| 377 | 3300005329 | Ga0070683_100225403 | Ga0070683_1002254032 | 281 |
| 378 | 3300005334 | Ga0068869_100072897 | Ga0068869_1000728972 | 281 |
| 379 | 3300005337 | Ga0070682_100252250 | Ga0070682_1002522501 | 281 |
| 380 | 3300005337 | Ga0070682_100309236 | Ga0070682_1003092361 | 281 |
| 381 | 3300005339 | Ga0070660_100357109 | Ga0070660_1003571091 | 281 |
| 382 | 3300005344 | Ga0070661_100117627 | Ga0070661_1001176272 | 281 |
| 383 | 3300005347 | Ga0070668_100046241 | Ga0070668_1000462413 | 281 |
| 384 | 3300005347 | Ga0070668_100120400 | Ga0070668_1001204001 | 281 |
| 385 | 3300005347 | Ga0070668_100297631 | Ga0070668_1002976311 | 281 |
| 386 | 3300005354 | Ga0070675_100340193 | Ga0070675_1003401931 | 281 |
| 387 | 3300005355 | Ga0070671_100035152 | Ga0070671_1000351523 | 281 |
| 388 | 3300005355 | Ga0070671_100314254 | Ga0070671_1003142541 | 281 |
| 389 | 3300005356 | Ga0070674_100042324 | Ga0070674_1000423243 | 281 |
| 390 | 3300005356 | Ga0070674_100056310 | Ga0070674_1000563101 | 281 |
| 391 | 3300005356 | Ga0070674_100424577 | Ga0070674_1004245771 | 281 |
| 392 | 3300005364 | Ga0070673_100367322 | Ga0070673_1003673221 | 281 |
| 393 | 3300005366 | Ga0070659_100016139 | Ga0070659_1000161391 | 281 |
| 394 | 3300005366 | Ga0070659_100105951 | Ga0070659_1001059512 | 281 |
| 395 | 3300005366 | Ga0070659_100307266 | Ga0070659_1003072662 | 281 |
| 396 | 3300005434 | Ga0070709_10240437 | Ga0070709_102404371 | 281 |
| 397 | 3300005455 | Ga0070663_100004604 | Ga0070663_1000046042 | 281 |
| 398 | 3300005455 | Ga0070663_100076375 | Ga0070663_1000763752 | 281 |
| 399 | 3300005455 | Ga0070663_100229337 | Ga0070663_1002293372 | 281 |
| 400 | 3300005455 | Ga0070663_100307637 | Ga0070663_1003076371 | 281 |
| 401 | 3300005456 | Ga0070678_100027488 | Ga0070678_1000274882 | 281 |
| 402 | 3300005458 | Ga0070681_10019890 | Ga0070681_100198903 | 281 |
| 403 | 3300005458 | Ga0070681_10139496 | Ga0070681_101394962 | 281 |
| 404 | 3300005458 | Ga0070681_10255009 | Ga0070681_102550091 | 281 |
| 405 | 3300005466 | Ga0070685_10098273 | Ga0070685_100982732 | 281 |
| 406 | 3300005530 | Ga0070679_100034506 | Ga0070679_1000345061 | 281 |
| 407 | 3300005530 | Ga0070679_100070822 | Ga0070679_1000708222 | 281 |
| 408 | 3300005539 | Ga0068853_100021754 | Ga0068853_1000217543 | 281 |
| 409 | 3300005539 | Ga0068853_100028465 | Ga0068853_1000284653 | 281 |
| 410 | 3300005539 | Ga0068853_100097555 | Ga0068853_1000975552 | 281 |
| 411 | 3300005539 | Ga0068853_100240107 | Ga0068853_1002401072 | 281 |
| 412 | 3300005543 | Ga0070672_100253068 | Ga0070672_1002530682 | 281 |
| 413 | 3300005543 | Ga0070672_100412787 | Ga0070672_1004127871 | 281 |
| 414 | 3300005548 | Ga0070665_100014247 | Ga0070665_1000142472 | 281 |
| 415 | 3300005548 | Ga0070665_100022311 | Ga0070665_1000223113 | 281 |
| 416 | 3300005548 | Ga0070665_100057086 | Ga0070665_1000570863 | 281 |
| 417 | 3300005548 | Ga0070665_100160327 | Ga0070665_1001603272 | 281 |
| 418 | 3300005548 | Ga0070665_100227451 | Ga0070665_1002274511 | 281 |
| 419 | 3300005563 | Ga0068855_100033709 | Ga0068855_1000337092 | 281 |
| 420 | 3300005563 | Ga0068855_100136247 | Ga0068855_1001362472 | 281 |
| 421 | 3300005564 | Ga0070664_100189368 | Ga0070664_1001893681 | 281 |
| 422 | 3300005577 | Ga0068857_100016536 | Ga0068857_1000165364 | 281 |
| 423 | 3300005577 | Ga0068857_100017840 | Ga0068857_1000178405 | 281 |
| 424 | 3300005577 | Ga0068857_100090238 | Ga0068857_1000902382 | 281 |
| 425 | 3300005577 | Ga0068857_100095293 | Ga0068857_1000952932 | 281 |
| 426 | 3300005578 | Ga0068854_100003786 | Ga0068854_1000037863 | 281 |
| 427 | 3300005578 | Ga0068854_100022987 | Ga0068854_1000229873 | 281 |
| 428 | 3300005578 | Ga0068854_100043384 | Ga0068854_1000433843 | 281 |
| 429 | 3300005578 | Ga0068854_100112458 | Ga0068854_1001124582 | 281 |
| 430 | 3300005578 | Ga0068854_100244220 | Ga0068854_1002442202 | 281 |
| 431 | 3300005614 | Ga0068856_100002838 | Ga0068856_1000028382 | 281 |
| 432 | 3300005614 | Ga0068856_100038677 | Ga0068856_1000386771 | 281 |
| 433 | 3300005614 | Ga0068856_100074451 | Ga0068856_1000744512 | 281 |
| 434 | 3300005614 | Ga0068856_100245193 | Ga0068856_1002451932 | 281 |
| 435 | 3300005616 | Ga0068852_100034244 | Ga0068852_1000342442 | 281 |
| 436 | 3300005616 | Ga0068852_100034788 | Ga0068852_1000347882 | 281 |
| 437 | 3300005616 | Ga0068852_100231241 | Ga0068852_1002312412 | 281 |
| 438 | 3300005617 | Ga0068859_100102722 | Ga0068859_1001027222 | 281 |
| 439 | 3300005618 | Ga0068864_100044923 | Ga0068864_1000449232 | 281 |
| 440 | 3300005618 | Ga0068864_100209235 | Ga0068864_1002092352 | 281 |
| 441 | 3300005718 | Ga0068866_10133392 | Ga0068866_101333922 | 281 |
| 442 | 3300005834 | Ga0068851_10000402 | Ga0068851_1000040211 | 281 |
| 443 | 3300005841 | Ga0068863_100421635 | Ga0068863_1004216352 | 281 |
| 444 | 3300005842 | Ga0068858_100171384 | Ga0068858_1001713842 | 281 |
| 445 | 3300005843 | Ga0068860_100031878 | Ga0068860_1000318783 | 281 |
| 446 | 3300005843 | Ga0068860_100537803 | Ga0068860_1005378032 | 281 |
| 447 | 3300005844 | Ga0068862_100195807 | Ga0068862_1001958072 | 281 |
| 448 | 3300005937 | Ga0081455_10005195 | Ga0081455_1000519510 | 281 |
| 449 | 3300005937 | Ga0081455_10105341 | Ga0081455_101053412 | 281 |
| 450 | 3300005983 | Ga0081540_1002478 | Ga0081540_10024782 | 281 |
| 451 | 3300005983 | Ga0081540_1003002 | Ga0081540_10030029 | 281 |
| 452 | 3300005983 | Ga0081540_1003538 | Ga0081540_100353813 | 281 |
| 453 | 3300005983 | Ga0081540_1010331 | Ga0081540_10103313 | 281 |
| 454 | 3300005983 | Ga0081540_1021616 | Ga0081540_10216164 | 281 |
| 455 | 3300005983 | Ga0081540_1028192 | Ga0081540_10281922 | 281 |
| 456 | 3300005983 | Ga0081540_1034870 | Ga0081540_10348702 | 281 |
| 457 | 3300005983 | Ga0081540_1036882 | Ga0081540_10368822 | 281 |
| 458 | 3300005983 | Ga0081540_1037256 | Ga0081540_10372562 | 281 |
| 459 | 3300005985 | Ga0081539_10004421 | Ga0081539_100044215 | 281 |
| 460 | 3300005985 | Ga0081539_10046439 | Ga0081539_100464392 | 281 |
| 461 | 3300005985 | Ga0081539_10131132 | Ga0081539_101311321 | 281 |
| 462 | 3300006038 | Ga0075365_10020178 | Ga0075365_100201784 | 281 |
| 463 | 3300006048 | Ga0075363_100045503 | Ga0075363_1000455032 | 281 |
| 464 | 3300006048 | Ga0075363_100134716 | Ga0075363_1001347162 | 281 |
| 465 | 3300006173 | Ga0070716_100081810 | Ga0070716_1000818102 | 281 |
| 466 | 3300006175 | Ga0070712_100261001 | Ga0070712_1002610012 | 281 |
| 467 | 3300006177 | Ga0075362_10058990 | Ga0075362_100589902 | 281 |
| 468 | 3300006237 | Ga0097621_100046443 | Ga0097621_1000464433 | 281 |
| 469 | 3300006844 | Ga0075428_100108955 | Ga0075428_1001089552 | 281 |
| 470 | 3300006852 | Ga0075433_10169168 | Ga0075433_101691681 | 281 |
| 471 | 3300006871 | Ga0075434_100039303 | Ga0075434_1000393032 | 281 |
| 472 | 3300006871 | Ga0075434_100146177 | Ga0075434_1001461772 | 281 |
| 473 | 3300006931 | Ga0097620_100102716 | Ga0097620_1001027162 | 281 |
| 474 | 3300006942 | Ga0099824_1004053 | Ga0099824_10040533 | 281 |
| 475 | 3300006943 | Ga0099822_1000007 | Ga0099822_100000755 | 281 |
| 476 | 3300007265 | Ga0099794_10014507 | Ga0099794_100145072 | 281 |
| 477 | 3300007788 | Ga0099795_10007946 | Ga0099795_100079462 | 281 |
| 478 | 3300007788 | Ga0099795_10079999 | Ga0099795_100799992 | 281 |
| 479 | 3300007788 | Ga0099795_10112859 | Ga0099795_101128591 | 281 |
| 480 | 3300009092 | Ga0105250_10024567 | Ga0105250_100245672 | 281 |
| 481 | 3300009093 | Ga0105240_10004430 | Ga0105240_1000443014 | 281 |
| 482 | 3300009093 | Ga0105240_10008378 | Ga0105240_100083782 | 281 |
| 483 | 3300009093 | Ga0105240_10021247 | Ga0105240_100212476 | 281 |
| 484 | 3300009093 | Ga0105240_10187454 | Ga0105240_101874542 | 281 |
| 485 | 3300009094 | Ga0111539_10488979 | Ga0111539_104889792 | 281 |
| 486 | 3300009098 | Ga0105245_10044805 | Ga0105245_100448052 | 281 |
| 487 | 3300009098 | Ga0105245_10271604 | Ga0105245_102716042 | 281 |
| 488 | 3300009101 | Ga0105247_10120819 | Ga0105247_101208192 | 281 |
| 489 | 3300009147 | Ga0114129_10455552 | Ga0114129_104555522 | 281 |
| 490 | 3300009174 | Ga0105241_10026741 | Ga0105241_100267413 | 281 |
| 491 | 3300009174 | Ga0105241_10156616 | Ga0105241_101566162 | 281 |
| 492 | 3300009174 | Ga0105241_10226545 | Ga0105241_102265451 | 281 |
| 493 | 3300009174 | Ga0105241_10293797 | Ga0105241_102937972 | 281 |
| 494 | 3300009177 | Ga0105248_10065189 | Ga0105248_100651892 | 281 |
| 495 | 3300009545 | Ga0105237_10059559 | Ga0105237_100595592 | 281 |
| 496 | 3300009545 | Ga0105237_10081851 | Ga0105237_100818512 | 281 |
| 497 | 3300009545 | Ga0105237_10489285 | Ga0105237_104892852 | 281 |
| 498 | 3300009551 | Ga0105238_10006342 | Ga0105238_100063426 | 281 |
| 499 | 3300009551 | Ga0105238_10007309 | Ga0105238_100073094 | 281 |
| 500 | 3300009551 | Ga0105238_10009143 | Ga0105238_100091432 | 281 |
| 501 | 3300009551 | Ga0105238_10014918 | Ga0105238_100149183 | 281 |
| 502 | 3300009551 | Ga0105238_10077621 | Ga0105238_100776212 | 281 |
| 503 | 3300010375 | Ga0105239_10020173 | Ga0105239_100201736 | 281 |
| 504 | 3300010375 | Ga0105239_10029909 | Ga0105239_100299092 | 281 |
| 505 | 3300010375 | Ga0105239_10032328 | Ga0105239_100323283 | 281 |
| 506 | 3300010375 | Ga0105239_10116920 | Ga0105239_101169203 | 281 |
| 507 | 3300010375 | Ga0105239_10123837 | Ga0105239_101238372 | 281 |
| 508 | 3300011119 | Ga0105246_10114144 | Ga0105246_101141442 | 281 |
| 509 | 3300013104 | Ga0157370_10354215 | Ga0157370_103542151 | 281 |
| 510 | 3300013105 | Ga0157369_10038612 | Ga0157369_100386121 | 281 |
| 511 | 3300013296 | Ga0157374_10006943 | Ga0157374_100069433 | 281 |
| 512 | 3300013306 | Ga0163162_10013288 | Ga0163162_100132885 | 281 |
| 513 | 3300013308 | Ga0157375_10120330 | Ga0157375_101203302 | 281 |
| 514 | 3300014325 | Ga0163163_10045070 | Ga0163163_100450703 | 281 |
| 515 | 3300014325 | Ga0163163_10764770 | Ga0163163_107647701 | 281 |
| 516 | 3300014326 | Ga0157380_10065341 | Ga0157380_100653412 | 281 |
| 517 | 3300014969 | Ga0157376_10002020 | Ga0157376_100020207 | 281 |
| 518 | 3300014969 | Ga0157376_10053794 | Ga0157376_100537942 | 281 |
| 519 | 3300014969 | Ga0157376_10348463 | Ga0157376_103484632 | 281 |
| 520 | 3300017792 | Ga0163161_10080958 | Ga0163161_100809581 | 281 |
| 521 | 3300025297 | Ga0209758_1017728 | Ga0209758_10177283 | 281 |
| 522 | 3300025297 | Ga0209758_1020717 | Ga0209758_10207172 | 281 |
| 523 | 3300025321 | Ga0207656_10003907 | Ga0207656_100039076 | 281 |
| 524 | 3300025899 | Ga0207642_10151408 | Ga0207642_101514082 | 281 |
| 525 | 3300025901 | Ga0207688_10079684 | Ga0207688_100796842 | 281 |
| 526 | 3300025904 | Ga0207647_10004518 | Ga0207647_100045182 | 281 |
| 527 | 3300025906 | Ga0207699_10125180 | Ga0207699_101251802 | 281 |
| 528 | 3300025907 | Ga0207645_10036807 | Ga0207645_100368072 | 281 |
| 529 | 3300025908 | Ga0207643_10029932 | Ga0207643_100299322 | 281 |
| 530 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005822 | 281 |
| 531 | 3300025912 | Ga0207707_10000818 | Ga0207707_1000081828 | 281 |
| 532 | 3300025912 | Ga0207707_10001462 | Ga0207707_100014624 | 281 |
| 533 | 3300025912 | Ga0207707_10051302 | Ga0207707_100513021 | 281 |
| 534 | 3300025912 | Ga0207707_10178818 | Ga0207707_101788182 | 281 |
| 535 | 3300025912 | Ga0207707_10248631 | Ga0207707_102486312 | 281 |
| 536 | 3300025913 | Ga0207695_10000453 | Ga0207695_100004538 | 281 |
| 537 | 3300025913 | Ga0207695_10285615 | Ga0207695_102856152 | 281 |
| 538 | 3300025914 | Ga0207671_10065046 | Ga0207671_100650462 | 281 |
| 539 | 3300025914 | Ga0207671_10075209 | Ga0207671_100752092 | 281 |
| 540 | 3300025915 | Ga0207693_10022371 | Ga0207693_100223712 | 281 |
| 541 | 3300025915 | Ga0207693_10242097 | Ga0207693_102420972 | 281 |
| 542 | 3300025916 | Ga0207663_10243466 | Ga0207663_102434662 | 281 |
| 543 | 3300025918 | Ga0207662_10306421 | Ga0207662_103064211 | 281 |
| 544 | 3300025919 | Ga0207657_10001095 | Ga0207657_100010958 | 281 |
| 545 | 3300025921 | Ga0207652_10003169 | Ga0207652_100031694 | 281 |
| 546 | 3300025921 | Ga0207652_10006226 | Ga0207652_100062264 | 281 |
| 547 | 3300025922 | Ga0207646_10326769 | Ga0207646_103267692 | 281 |
| 548 | 3300025924 | Ga0207694_10000564 | Ga0207694_1000056419 | 281 |
| 549 | 3300025924 | Ga0207694_10023140 | Ga0207694_100231403 | 281 |
| 550 | 3300025931 | Ga0207644_10077473 | Ga0207644_100774732 | 281 |
| 551 | 3300025932 | Ga0207690_10101022 | Ga0207690_101010222 | 281 |
| 552 | 3300025932 | Ga0207690_10428836 | Ga0207690_104288361 | 281 |
| 553 | 3300025933 | Ga0207706_10067990 | Ga0207706_100679903 | 281 |
| 554 | 3300025933 | Ga0207706_10117341 | Ga0207706_101173412 | 281 |
| 555 | 3300025934 | Ga0207686_10046294 | Ga0207686_100462942 | 281 |
| 556 | 3300025935 | Ga0207709_10364651 | Ga0207709_103646511 | 281 |
| 557 | 3300025937 | Ga0207669_10017701 | Ga0207669_100177011 | 281 |
| 558 | 3300025939 | Ga0207665_10026200 | Ga0207665_100262004 | 281 |
| 559 | 3300025939 | Ga0207665_10165683 | Ga0207665_101656832 | 281 |
| 560 | 3300025940 | Ga0207691_10033936 | Ga0207691_100339363 | 281 |
| 561 | 3300025940 | Ga0207691_10408155 | Ga0207691_104081551 | 281 |
| 562 | 3300025944 | Ga0207661_10037684 | Ga0207661_100376844 | 281 |
| 563 | 3300025944 | Ga0207661_10228839 | Ga0207661_102288392 | 281 |
| 564 | 3300025945 | Ga0207679_10036408 | Ga0207679_100364082 | 281 |
| 565 | 3300025949 | Ga0207667_10009339 | Ga0207667_100093394 | 281 |
| 566 | 3300025949 | Ga0207667_10018267 | Ga0207667_100182673 | 281 |
| 567 | 3300025949 | Ga0207667_10037421 | Ga0207667_100374214 | 281 |
| 568 | 3300025961 | Ga0207712_10015222 | Ga0207712_100152223 | 281 |
| 569 | 3300025972 | Ga0207668_10014433 | Ga0207668_100144332 | 281 |
| 570 | 3300025972 | Ga0207668_10394418 | Ga0207668_103944182 | 281 |
| 571 | 3300025981 | Ga0207640_10021908 | Ga0207640_100219082 | 281 |
| 572 | 3300025981 | Ga0207640_10034634 | Ga0207640_100346343 | 281 |
| 573 | 3300025981 | Ga0207640_10139644 | Ga0207640_101396442 | 281 |
| 574 | 3300025981 | Ga0207640_10175336 | Ga0207640_101753361 | 281 |
| 575 | 3300026035 | Ga0207703_10177174 | Ga0207703_101771741 | 281 |
| 576 | 3300026035 | Ga0207703_10392333 | Ga0207703_103923331 | 281 |
| 577 | 3300026041 | Ga0207639_10001424 | Ga0207639_100014247 | 281 |
| 578 | 3300026041 | Ga0207639_10008949 | Ga0207639_100089494 | 281 |
| 579 | 3300026041 | Ga0207639_10134168 | Ga0207639_101341682 | 281 |
| 580 | 3300026041 | Ga0207639_10224901 | Ga0207639_102249012 | 281 |
| 581 | 3300026067 | Ga0207678_10010067 | Ga0207678_100100679 | 281 |
| 582 | 3300026067 | Ga0207678_10015000 | Ga0207678_100150002 | 281 |
| 583 | 3300026067 | Ga0207678_10027531 | Ga0207678_100275312 | 281 |
| 584 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004205 | 281 |
| 585 | 3300026078 | Ga0207702_10028205 | Ga0207702_100282053 | 281 |
| 586 | 3300026078 | Ga0207702_10071595 | Ga0207702_100715953 | 281 |
| 587 | 3300026095 | Ga0207676_10059148 | Ga0207676_100591482 | 281 |
| 588 | 3300026116 | Ga0207674_10005590 | Ga0207674_100055908 | 281 |
| 589 | 3300026116 | Ga0207674_10006707 | Ga0207674_1000670714 | 281 |
| 590 | 3300026116 | Ga0207674_10014421 | Ga0207674_100144214 | 281 |
| 591 | 3300026116 | Ga0207674_10037609 | Ga0207674_100376095 | 281 |
| 592 | 3300026118 | Ga0207675_100015080 | Ga0207675_1000150805 | 281 |
| 593 | 3300026118 | Ga0207675_100281703 | Ga0207675_1002817032 | 281 |
| 594 | 3300026121 | Ga0207683_10048552 | Ga0207683_100485522 | 281 |
| 595 | 3300026121 | Ga0207683_10266370 | Ga0207683_102663701 | 281 |
| 596 | 3300026121 | Ga0207683_10467270 | Ga0207683_104672702 | 281 |
| 597 | 3300026142 | Ga0207698_10014462 | Ga0207698_100144626 | 281 |
| 598 | 3300026142 | Ga0207698_10048403 | Ga0207698_100484032 | 281 |
| 599 | 3300027357 | Ga0209589_1000021 | Ga0209589_100002165 | 281 |
| 600 | 3300027361 | Ga0209489_100028 | Ga0209489_10002865 | 281 |
| 601 | 3300027363 | Ga0209700_100037 | Ga0209700_10003765 | 281 |
| 602 | 3300027512 | Ga0209179_1001223 | Ga0209179_10012232 | 281 |
| 603 | 3300027512 | Ga0209179_1004630 | Ga0209179_10046302 | 281 |
| 604 | 3300027671 | Ga0209588_1006984 | Ga0209588_10069843 | 281 |
| 605 | 3300028379 | Ga0268266_10000680 | Ga0268266_1000068039 | 281 |
| 606 | 3300028379 | Ga0268266_10012906 | Ga0268266_100129064 | 281 |
| 607 | 3300028379 | Ga0268266_10080249 | Ga0268266_100802492 | 281 |
| 608 | 3300028380 | Ga0268265_10020055 | Ga0268265_100200553 | 281 |
| 609 | 3300028381 | Ga0268264_10179065 | Ga0268264_101790651 | 281 |
| 610 | 3300028786 | Ga0307517_10000942 | Ga0307517_100009425 | 281 |
| 611 | 3300028786 | Ga0307517_10137157 | Ga0307517_101371572 | 281 |
| 612 | 3300028794 | Ga0307515_10068562 | Ga0307515_100685624 | 281 |
| 613 | 3300031235 | Ga0265330_10006512 | Ga0265330_100065123 | 281 |
| 614 | 3300031235 | Ga0265330_10040805 | Ga0265330_100408052 | 281 |
| 615 | 3300031247 | Ga0265340_10002209 | Ga0265340_100022094 | 281 |
| 616 | 3300031249 | Ga0265339_10001277 | Ga0265339_100012777 | 281 |
| 617 | 3300031249 | Ga0265339_10117511 | Ga0265339_101175111 | 281 |
| 618 | 3300031344 | Ga0265316_10157310 | Ga0265316_101573101 | 281 |
| 619 | 3300031344 | Ga0265316_10333189 | Ga0265316_103331891 | 281 |
| 620 | 3300031507 | Ga0307509_10107620 | Ga0307509_101076202 | 281 |
| 621 | 3300031548 | Ga0307408_100603308 | Ga0307408_1006033081 | 281 |
| 622 | 3300031616 | Ga0307508_10000108 | Ga0307508_100001085 | 281 |
| 623 | 3300031616 | Ga0307508_10012397 | Ga0307508_100123972 | 281 |
| 624 | 3300031616 | Ga0307508_10037820 | Ga0307508_100378203 | 281 |
| 625 | 3300031711 | Ga0265314_10002048 | Ga0265314_1000204816 | 281 |
| 626 | 3300031711 | Ga0265314_10066862 | Ga0265314_100668621 | 281 |
| 627 | 3300031712 | Ga0265342_10189225 | Ga0265342_101892252 | 281 |
| 628 | 3300031730 | Ga0307516_10044620 | Ga0307516_100446203 | 281 |
| 629 | 3300031730 | Ga0307516_10206850 | Ga0307516_102068502 | 281 |
| 630 | 3300031824 | Ga0307413_10179716 | Ga0307413_101797162 | 281 |
| 631 | 3300032126 | Ga0307415_100023277 | Ga0307415_1000232774 | 281 |
| 632 | 3300033180 | Ga0307510_10003483 | Ga0307510_100034831 | 281 |
| 633 | 3300033180 | Ga0307510_10297932 | Ga0307510_102979322 | 281 |
| 634 | 3300034816 | Ga0373930_0020576 | Ga0373930_0020576_352_1248 | 281 |
| 635 | 3300035086 | Ga0373934_0005625 | Ga0373934_0005625_1913_2812 | 281 |
| 636 | 3300035086 | Ga0373934_0013237 | Ga0373934_0013237_1835_2731 | 281 |
| 637 | 3300035086 | Ga0373934_0028140 | Ga0373934_0028140_698_1594 | 281 |
| 638 | 3300035090 | Ga0373949_0028848 | Ga0373949_0028848_64_960 | 281 |
| 639 | 3300035111 | Ga0373923_0024780 | Ga0373923_0024780_844_1740 | 281 |
| 640 | 3300035111 | Ga0373923_0054009 | Ga0373923_0054009_699_1595 | 281 |
| 641 | 3300035111 | Ga0373923_0081850 | Ga0373923_0081850_204_1100 | 281 |
| 642 | 3300035112 | Ga0373932_0029061 | Ga0373932_0029061_25_921 | 281 |
| 643 | 3300035113 | Ga0373936_0062179 | Ga0373936_0062179_19_915 | 281 |
| 644 | 3300035114 | Ga0373939_0041433 | Ga0373939_0041433_364_1260 | 281 |
| 645 | 3300035116 | Ga0373945_0019064 | Ga0373945_0019064_1038_1934 | 281 |
| 646 | 3300035116 | Ga0373945_0025780 | Ga0373945_0025780_1010_1906 | 281 |
| 647 | 3300035117 | Ga0373953_0000037 | Ga0373953_0000037_14823_15722 | 281 |
| 648 | 3300035118 | Ga0373954_0000242 | Ga0373954_0000242_18421_19320 | 281 |
| 649 | 3300035118 | Ga0373954_0033727 | Ga0373954_0033727_425_1321 | 281 |
| 650 | 3300035119 | Ga0373956_0000631 | Ga0373956_0000631_8932_9831 | 281 |
| 651 | 3300035120 | Ga0373957_0000417 | Ga0373957_0000417_5864_6760 | 281 |
| 652 | 3300035120 | Ga0373957_0071680 | Ga0373957_0071680_17_913 | 281 |
| 653 | 3300035170 | Ga0373943_0002237 | Ga0373943_0002237_990_1886 | 281 |
| 654 | 3300035171 | Ga0373946_0006294 | Ga0373946_0006294_3131_4027 | 281 |
| 655 | 3300035171 | Ga0373946_0061766 | Ga0373946_0061766_21_917 | 281 |
| 656 | 3300035172 | Ga0373955_0001044 | Ga0373955_0001044_10328_11227 | 281 |
| 657 | 3300035172 | Ga0373955_0005369 | Ga0373955_0005369_3968_4864 | 281 |
| 658 | 3300035172 | Ga0373955_0048879 | Ga0373955_0048879_479_1375 | 281 |
| 659 | 3300035172 | Ga0373955_0247208 | Ga0373955_0247208_120_1016 | 281 |
| 660 | 3300035410 | Ga0373924_0023154 | Ga0373924_0023154_340_1236 | 281 |
| 661 | 3300035410 | Ga0373924_0042213 | Ga0373924_0042213_316_1212 | 281 |
| 662 | 3300035410 | Ga0373924_0045195 | Ga0373924_0045195_883_1782 | 281 |
| 663 | 3300035691 | Ga0373931_0269970 | Ga0373931_0269970_35_931 | 281 |
| 664 | 3300035692 | Ga0373935_0000500 | Ga0373935_0000500_13534_14430 | 281 |
| 665 | 3300035695 | Ga0373927_0000337 | Ga0373927_0000337_11381_12277 | 281 |
| 666 | 3300035695 | Ga0373927_0006763 | Ga0373927_0006763_4732_5628 | 281 |
| 667 | 3300035695 | Ga0373927_0022849 | Ga0373927_0022849_2858_3757 | 281 |
| 668 | 3300035695 | Ga0373927_0029973 | Ga0373927_0029973_2517_3413 | 281 |
| 669 | 3300035724 | Ga0373933_0000487 | Ga0373933_0000487_2952_3851 | 281 |
| 670 | 3300035724 | Ga0373933_0044281 | Ga0373933_0044281_388_1284 | 281 |
| 671 | 3300035725 | Ga0373947_0002043 | Ga0373947_0002043_6818_7714 | 281 |
| 672 | 3300035725 | Ga0373947_0005807 | Ga0373947_0005807_5881_6777 | 281 |
| 673 | 3300035725 | Ga0373947_0111496 | Ga0373947_0111496_570_1469 | 281 |
| 674 | 3300035725 | Ga0373947_0147476 | Ga0373947_0147476_310_1206 | 281 |
| 675 | 3300036401 | Ga0373937_0038100 | Ga0373937_0038100_976_1875 | 281 |
| 676 | 3300036401 | Ga0373937_0125555 | Ga0373937_0125555_540_1436 | 281 |
| 677 | 3300036401 | Ga0373937_0147029 | Ga0373937_0147029_881_1777 | 281 |
| 678 | 3300036401 | Ga0373937_0187235 | Ga0373937_0187235_596_1492 | 281 |
| 679 | 3300037068 | Ga0373925_0003157 | Ga0373925_0003157_5960_6856 | 281 |
| 680 | 3300037068 | Ga0373925_0013825 | Ga0373925_0013825_1307_2203 | 281 |
| 681 | 3300037068 | Ga0373925_0153495 | Ga0373925_0153495_519_1415 | 281 |
| 682 | 3300037471 | Ga0395905_0151758 | Ga0395905_0151758_340_1236 | 281 |
| 683 | 3300037471 | Ga0395905_0327503 | Ga0395905_0327503_419_1315 | 281 |
| 684 | 3300039437 | Ga0436365_0398617 | Ga0436365_0398617_1046_1942 | 281 |
| 685 | 3300039437 | Ga0436365_0675687 | Ga0436365_0675687_166_1062 | 281 |
| 686 | 3300041512 | Ga0451853_3231558 | Ga0451853_3231558_257_1153 | 281 |
| 687 | 3300045976 | Ga0466967_0271578 | Ga0466967_0271578_121_1017 | 281 |
| 688 | 3300046454 | Ga0495592_0052315 | Ga0495592_0052315_398_1294 | 281 |
| 689 | 3300046454 | Ga0495592_0066449 | Ga0495592_0066449_1087_1986 | 281 |
| 690 | 3300046455 | Ga0495603_0001388 | Ga0495603_0001388_10302_11198 | 281 |
| 691 | 3300046455 | Ga0495603_0002436 | Ga0495603_0002436_2355_3251 | 281 |
| 692 | 3300046455 | Ga0495603_0005675 | Ga0495603_0005675_4179_5075 | 281 |
| 693 | 3300046458 | Ga0495591_041077 | Ga0495591_041077_273_1169 | 281 |
| 694 | 3300046459 | Ga0495629_0000124 | Ga0495629_0000124_23015_23914 | 281 |
| 695 | 3300046459 | Ga0495629_0000727 | Ga0495629_0000727_15184_16080 | 281 |
| 696 | 3300046461 | Ga0495641_0007117 | Ga0495641_0007117_4474_5370 | 281 |
| 697 | 3300046461 | Ga0495641_0079497 | Ga0495641_0079497_79_975 | 281 |
| 698 | 3300046462 | Ga0495651_0039024 | Ga0495651_0039024_1712_2611 | 281 |
| 699 | 3300046462 | Ga0495651_0041061 | Ga0495651_0041061_366_1262 | 281 |
| 700 | 3300046462 | Ga0495651_0280975 | Ga0495651_0280975_199_1095 | 281 |
| 701 | 3300046463 | Ga0495653_0000465 | Ga0495653_0000465_4226_5125 | 281 |
| 702 | 3300046463 | Ga0495653_0041812 | Ga0495653_0041812_1567_2463 | 281 |
| 703 | 3300046472 | Ga0495580_0002297 | Ga0495580_0002297_5072_5968 | 281 |
| 704 | 3300046472 | Ga0495580_0031584 | Ga0495580_0031584_2322_3218 | 281 |
| 705 | 3300046472 | Ga0495580_0034287 | Ga0495580_0034287_1914_2810 | 281 |
| 706 | 3300046473 | Ga0495582_0000494 | Ga0495582_0000494_2878_3774 | 281 |
| 707 | 3300046473 | Ga0495582_0020335 | Ga0495582_0020335_1650_2546 | 281 |
| 708 | 3300046475 | Ga0495639_0000119 | Ga0495639_0000119_28156_29052 | 281 |
| 709 | 3300046475 | Ga0495639_0091485 | Ga0495639_0091485_67_963 | 281 |
| 710 | 3300046476 | Ga0495662_0001142 | Ga0495662_0001142_12154_13050 | 281 |
| 711 | 3300046476 | Ga0495662_0074939 | Ga0495662_0074939_471_1367 | 281 |
| 712 | 3300046477 | Ga0495664_0001550 | Ga0495664_0001550_9167_10063 | 281 |
| 713 | 3300046477 | Ga0495664_0007218 | Ga0495664_0007218_11_907 | 281 |
| 714 | 3300046477 | Ga0495664_0012516 | Ga0495664_0012516_2066_2962 | 281 |
| 715 | 3300046477 | Ga0495664_0055229 | Ga0495664_0055229_518_1414 | 281 |
| 716 | 3300046492 | Ga0495585_0010815 | Ga0495585_0010815_2087_2983 | 281 |
| 717 | 3300046492 | Ga0495585_0017878 | Ga0495585_0017878_1157_2053 | 281 |
| 718 | 3300046499 | Ga0495594_0031156 | Ga0495594_0031156_353_1249 | 281 |
| 719 | 3300046500 | Ga0495596_0042640 | Ga0495596_0042640_244_1140 | 281 |
| 720 | 3300046500 | Ga0495596_0052406 | Ga0495596_0052406_508_1404 | 281 |
| 721 | 3300046511 | Ga0495608_0001489 | Ga0495608_0001489_5567_6466 | 281 |
| 722 | 3300046511 | Ga0495608_0068946 | Ga0495608_0068946_880_1776 | 281 |
| 723 | 3300046511 | Ga0495608_0087706 | Ga0495608_0087706_397_1293 | 281 |
| 724 | 3300046514 | Ga0495618_0010417 | Ga0495618_0010417_1294_2190 | 281 |
| 725 | 3300046514 | Ga0495618_0136834 | Ga0495618_0136834_109_1005 | 281 |
| 726 | 3300046515 | Ga0495620_0030968 | Ga0495620_0030968_497_1393 | 281 |
| 727 | 3300046516 | Ga0495628_0006943 | Ga0495628_0006943_1070_1966 | 281 |
| 728 | 3300046516 | Ga0495628_0017483 | Ga0495628_0017483_3605_4501 | 281 |
| 729 | 3300046516 | Ga0495628_0023788 | Ga0495628_0023788_2502_3401 | 281 |
| 730 | 3300046517 | Ga0495630_0140250 | Ga0495630_0140250_601_1497 | 281 |
| 731 | 3300046517 | Ga0495630_0257369 | Ga0495630_0257369_22_918 | 281 |
| 732 | 3300046518 | Ga0495631_0008583 | Ga0495631_0008583_1826_2722 | 281 |
| 733 | 3300046518 | Ga0495631_0123369 | Ga0495631_0123369_153_1049 | 281 |
| 734 | 3300046526 | Ga0495666_0030645 | Ga0495666_0030645_1582_2478 | 281 |
| 735 | 3300046529 | Ga0495652_0001377 | Ga0495652_0001377_7493_8392 | 281 |
| 736 | 3300046529 | Ga0495652_0069696 | Ga0495652_0069696_618_1514 | 281 |
| 737 | 3300046529 | Ga0495652_0170570 | Ga0495652_0170570_361_1257 | 281 |
| 738 | 3300046531 | Ga0495665_0000251 | Ga0495665_0000251_15186_16082 | 281 |
| 739 | 3300046531 | Ga0495665_0015050 | Ga0495665_0015050_2993_3889 | 281 |
| 740 | 3300046533 | Ga0495640_0026258 | Ga0495640_0026258_2377_3273 | 281 |
| 741 | 3300046533 | Ga0495640_0036134 | Ga0495640_0036134_830_1726 | 281 |
| 742 | 3300046533 | Ga0495640_0205877 | Ga0495640_0205877_168_1064 | 281 |
| 743 | 3300046536 | Ga0495587_0033400 | Ga0495587_0033400_1671_2567 | 281 |
| 744 | 3300046536 | Ga0495587_0048659 | Ga0495587_0048659_525_1424 | 281 |
| 745 | 3300046537 | Ga0495598_0026992 | Ga0495598_0026992_315_1211 | 281 |
| 746 | 3300046543 | Ga0495645_0017210 | Ga0495645_0017210_3695_4594 | 281 |
| 747 | 3300046543 | Ga0495645_0258808 | Ga0495645_0258808_206_1102 | 281 |
| 748 | 3300046557 | Ga0495622_0038571 | Ga0495622_0038571_78_974 | 281 |
| 749 | 3300046559 | Ga0495667_0001146 | Ga0495667_0001146_525_1424 | 281 |
| 750 | 3300046559 | Ga0495667_0027511 | Ga0495667_0027511_445_1341 | 281 |
| 751 | 3300046559 | Ga0495667_0036446 | Ga0495667_0036446_922_1818 | 281 |
| 752 | 3300046642 | Ga0495634_0000886 | Ga0495634_0000886_1730_2626 | 281 |
| 753 | 3300046642 | Ga0495634_0014430 | Ga0495634_0014430_4603_5502 | 281 |
| 754 | 3300046642 | Ga0495634_0053801 | Ga0495634_0053801_585_1481 | 281 |
| 755 | 3300046663 | Ga0495635_0000786 | Ga0495635_0000786_18824_19723 | 281 |
| 756 | 3300046663 | Ga0495635_0001208 | Ga0495635_0001208_1359_2255 | 281 |
| 757 | 3300046663 | Ga0495635_0019516 | Ga0495635_0019516_1809_2705 | 281 |
| 758 | 3300046663 | Ga0495635_0060747 | Ga0495635_0060747_425_1321 | 281 |
| 759 | 3300046664 | Ga0495659_0011408 | Ga0495659_0011408_84_980 | 281 |
| 760 | 3300046664 | Ga0495659_0041774 | Ga0495659_0041774_663_1559 | 281 |
| 761 | 3300046674 | Ga0495588_0017578 | Ga0495588_0017578_2413_3309 | 281 |
| 762 | 3300046674 | Ga0495588_0019036 | Ga0495588_0019036_1199_2095 | 281 |
| 763 | 3300046674 | Ga0495588_0204762 | Ga0495588_0204762_28_924 | 281 |
| 764 | 3300046675 | Ga0495657_0001030 | Ga0495657_0001030_6716_7615 | 281 |
| 765 | 3300046678 | Ga0495599_0031137 | Ga0495599_0031137_1256_2152 | 281 |
| 766 | 3300046678 | Ga0495599_0092967 | Ga0495599_0092967_458_1357 | 281 |
| 767 | 3300046679 | Ga0495623_0014400 | Ga0495623_0014400_1584_2483 | 281 |
| 768 | 3300046679 | Ga0495623_0172304 | Ga0495623_0172304_42_938 | 281 |
| 769 | 3300046680 | Ga0495646_0023325 | Ga0495646_0023325_1011_1910 | 281 |
| 770 | 3300046680 | Ga0495646_0033655 | Ga0495646_0033655_822_1718 | 281 |
| 771 | 3300046681 | Ga0495647_0000085 | Ga0495647_0000085_16078_16974 | 281 |
| 772 | 3300046683 | Ga0495658_0000135 | Ga0495658_0000135_29349_30245 | 281 |
| 773 | 3300046683 | Ga0495658_0012816 | Ga0495658_0012816_2901_3797 | 281 |
| 774 | 3300046683 | Ga0495658_0272621 | Ga0495658_0272621_143_1039 | 281 |
| 775 | 3300046684 | Ga0495669_0000707 | Ga0495669_0000707_8006_8902 | 281 |
| 776 | 3300046689 | Ga0495613_0001617 | Ga0495613_0001617_5569_6465 | 281 |
| 777 | 3300046689 | Ga0495613_0073692 | Ga0495613_0073692_1103_2002 | 281 |
| 778 | 3300046689 | Ga0495613_0148177 | Ga0495613_0148177_623_1519 | 281 |
| 779 | 3300046690 | Ga0495624_0000144 | Ga0495624_0000144_41042_41938 | 281 |
| 780 | 3300046690 | Ga0495624_0032598 | Ga0495624_0032598_351_1247 | 281 |
| 781 | 3300046809 | Ga0495600_0000768 | Ga0495600_0000768_15346_16245 | 281 |
| 782 | 3300046809 | Ga0495600_0046877 | Ga0495600_0046877_1010_1906 | 281 |
| 783 | 3300047315 | Ga0495581_0000421 | Ga0495581_0000421_2751_3647 | 281 |
| 784 | 3300047315 | Ga0495581_0016438 | Ga0495581_0016438_148_1044 | 281 |
| 785 | 3300047315 | Ga0495581_0079139 | Ga0495581_0079139_101_997 | 281 |
| 786 | 3300047315 | Ga0495581_0253921 | Ga0495581_0253921_49_945 | 281 |
| 787 | 3300047317 | Ga0495604_0009371 | Ga0495604_0009371_1814_2713 | 281 |
| 788 | 3300047318 | Ga0495636_0031056 | Ga0495636_0031056_316_1212 | 281 |
| 789 | 3300047319 | Ga0495674_0001274 | Ga0495674_0001274_10724_11620 | 281 |
| 790 | 3300047319 | Ga0495674_0035560 | Ga0495674_0035560_1364_2263 | 281 |
| 791 | 3300047319 | Ga0495674_0067280 | Ga0495674_0067280_932_1828 | 281 |
| 792 | 3300047319 | Ga0495674_0082014 | Ga0495674_0082014_684_1580 | 281 |
| 793 | 3300047321 | Ga0495676_0012854 | Ga0495676_0012854_4984_5880 | 281 |
| 794 | 3300047321 | Ga0495676_0020657 | Ga0495676_0020657_2566_3462 | 281 |
| 795 | 3300047321 | Ga0495676_0096406 | Ga0495676_0096406_1009_1908 | 281 |
| 796 | 3300047321 | Ga0495676_0169786 | Ga0495676_0169786_76_972 | 281 |
| 797 | 3300047322 | Ga0495680_0001556 | Ga0495680_0001556_21659_22558 | 281 |
| 798 | 3300047322 | Ga0495680_0050712 | Ga0495680_0050712_1594_2490 | 281 |
| 799 | 3300047322 | Ga0495680_0292552 | Ga0495680_0292552_49_945 | 281 |
| 800 | 3300047444 | Ga0495675_0003063 | Ga0495675_0003063_6588_7487 | 281 |
| 801 | 3300047444 | Ga0495675_0019876 | Ga0495675_0019876_1188_2084 | 281 |
| 802 | 3300047446 | Ga0495679_044115 | Ga0495679_044115_111_1007 | 281 |
| 803 | 3300047469 | Ga0495673_0056264 | Ga0495673_0056264_227_1123 | 281 |
| 804 | 3300047470 | Ga0495681_0105548 | Ga0495681_0105548_112_1008 | 281 |
| 805 | 3300047471 | Ga0495684_0000169 | Ga0495684_0000169_27345_28244 | 281 |
| 806 | 3300047471 | Ga0495684_0033825 | Ga0495684_0033825_646_1542 | 281 |
| 807 | 3300047471 | Ga0495684_0084824 | Ga0495684_0084824_794_1690 | 281 |
| 808 | 3300047472 | Ga0495686_0037943 | Ga0495686_0037943_1473_2369 | 281 |
| 809 | 3300047673 | Ga0495593_0000007 | Ga0495593_0000007_9868_10764 | 281 |
| 810 | 3300047673 | Ga0495593_0004906 | Ga0495593_0004906_4978_5877 | 281 |
| 811 | 3300048088 | Ga0495602_0018573 | Ga0495602_0018573_3909_4808 | 281 |
| 812 | 3300048089 | Ga0495614_0009706 | Ga0495614_0009706_2458_3354 | 281 |
| 813 | 3300048089 | Ga0495614_0061335 | Ga0495614_0061335_440_1336 | 281 |
| 814 | 3300048091 | Ga0495626_0102882 | Ga0495626_0102882_17_913 | 281 |
| 815 | 3300048903 | Ga0496100_0012929 | Ga0496100_0012929_2248_3144 | 281 |
| 816 | 3300048903 | Ga0496100_0108105 | Ga0496100_0108105_823_1731 | 281 |
| 817 | 3300048903 | Ga0496100_0116295 | Ga0496100_0116295_529_1425 | 281 |
| 818 | 3300048904 | Ga0496101_0006277 | Ga0496101_0006277_6183_7079 | 281 |
| 819 | 3300048904 | Ga0496101_0030669 | Ga0496101_0030669_2796_3692 | 281 |
| 820 | 3300048904 | Ga0496101_0064590 | Ga0496101_0064590_1541_2437 | 281 |
| 821 | 3300048904 | Ga0496101_0172043 | Ga0496101_0172043_578_1474 | 281 |
| 822 | 3300048905 | Ga0496102_0008119 | Ga0496102_0008119_1333_2229 | 281 |
| 823 | 3300048906 | Ga0496103_0042331 | Ga0496103_0042331_1321_2217 | 281 |
| 824 | 3300048907 | Ga0496104_0080044 | Ga0496104_0080044_2097_2993 | 281 |
| 825 | 3300048909 | Ga0496106_0010158 | Ga0496106_0010158_5997_6905 | 281 |
| 826 | 3300048909 | Ga0496106_0014006 | Ga0496106_0014006_2988_3884 | 281 |
| 827 | 3300048909 | Ga0496106_0025052 | Ga0496106_0025052_1308_2204 | 281 |
| 828 | 3300048909 | Ga0496106_0074110 | Ga0496106_0074110_824_1720 | 281 |
| 829 | 3300048909 | Ga0496106_0093924 | Ga0496106_0093924_292_1188 | 281 |
| 830 | 3300048910 | Ga0496107_0005366 | Ga0496107_0005366_4103_4999 | 281 |
| 831 | 3300048910 | Ga0496107_0289447 | Ga0496107_0289447_74_970 | 281 |
| 832 | 3300048911 | Ga0496108_0007489 | Ga0496108_0007489_1031_1939 | 281 |
| 833 | 3300048911 | Ga0496108_0013286 | Ga0496108_0013286_4041_4937 | 281 |
| 834 | 3300048911 | Ga0496108_0029893 | Ga0496108_0029893_823_1719 | 281 |
| 835 | 3300048911 | Ga0496108_0300339 | Ga0496108_0300339_205_1101 | 281 |
| 836 | 3300048912 | Ga0496109_0003252 | Ga0496109_0003252_417_1325 | 281 |
| 837 | 3300048912 | Ga0496109_0155032 | Ga0496109_0155032_903_1799 | 281 |
| 838 | 3300048912 | Ga0496109_0158178 | Ga0496109_0158178_1093_1989 | 281 |
| 839 | 3300048912 | Ga0496109_0191817 | Ga0496109_0191817_438_1334 | 281 |
| 840 | 3300048912 | Ga0496109_0293130 | Ga0496109_0293130_578_1474 | 281 |
| 841 | 3300048913 | Ga0496110_0079965 | Ga0496110_0079965_1309_2205 | 281 |
| 842 | 3300048915 | Ga0496112_0087087 | Ga0496112_0087087_666_1562 | 281 |
| 843 | 3300048915 | Ga0496112_0098794 | Ga0496112_0098794_30_926 | 281 |
| 844 | 3300048915 | Ga0496112_0150319 | Ga0496112_0150319_476_1372 | 281 |
| 845 | 3300048915 | Ga0496112_0270112 | Ga0496112_0270112_340_1236 | 281 |
| 846 | 3300048916 | Ga0496113_0012420 | Ga0496113_0012420_4241_5137 | 281 |
| 847 | 3300048916 | Ga0496113_0063988 | Ga0496113_0063988_727_1623 | 281 |
| 848 | 3300048917 | Ga0496114_0061781 | Ga0496114_0061781_722_1618 | 281 |
| 849 | 3300048918 | Ga0496115_0002653 | Ga0496115_0002653_2620_3516 | 281 |
| 850 | 3300048918 | Ga0496115_0012788 | Ga0496115_0012788_5020_5916 | 281 |
| 851 | 3300048918 | Ga0496115_0047885 | Ga0496115_0047885_684_1580 | 281 |
| 852 | 3300048918 | Ga0496115_0049186 | Ga0496115_0049186_1480_2376 | 281 |
| 853 | 3300048924 | Ga0496121_0000893 | Ga0496121_0000893_37283_38179 | 281 |
| 854 | 3300048924 | Ga0496121_0106495 | Ga0496121_0106495_1093_1989 | 281 |
| 855 | 3300048927 | Ga0496124_0068930 | Ga0496124_0068930_434_1444 | 281 |
| 856 | 3300048928 | Ga0496125_0090937 | Ga0496125_0090937_620_1618 | 281 |
| 857 | 3300048929 | Ga0496126_0014074 | Ga0496126_0014074_6182_7078 | 281 |
| 858 | 3300048929 | Ga0496126_0021709 | Ga0496126_0021709_4741_5637 | 281 |
| 859 | 3300048929 | Ga0496126_0072585 | Ga0496126_0072585_1109_2005 | 281 |
| 860 | 3300048929 | Ga0496126_0148674 | Ga0496126_0148674_835_1731 | 281 |
| 861 | 3300048929 | Ga0496126_0165177 | Ga0496126_0165177_946_1842 | 281 |
| 862 | 3300049575 | Ga0501039_0390387 | Ga0501039_0390387_53_949 | 281 |
| 863 | 3300050490 | nmdc:mga03n38_100_c1 | nmdc:mga03n38_100_c1_5263_6159 | 281 |
| 864 | 3300050494 | nmdc:mga06z11_13204_c1 | nmdc:mga06z11_13204_c1_2142_3038 | 281 |
| 865 | 3300050496 | nmdc:mga07m45_52329_c1 | nmdc:mga07m45_52329_c1_464_1360 | 281 |
| 866 | 3300050507 | nmdc:mga05p37_172909_c1 | nmdc:mga05p37_172909_c1_222_1118 | 281 |
| 867 | 3300050512 | nmdc:mga0n895_53433_c1 | nmdc:mga0n895_53433_c1_305_1201 | 281 |
| 868 | 3300050515 | nmdc:mga0a205_506851_c1 | nmdc:mga0a205_506851_c1_129_1025 | 281 |
| 869 | 3300053077 | Ga0495601_0015001 | Ga0495601_0015001_2128_3024 | 281 |
| 870 | 3300053077 | Ga0495601_0030171 | Ga0495601_0030171_943_1842 | 281 |
| 871 | 3300053077 | Ga0495601_0093245 | Ga0495601_0093245_343_1239 | 281 |
| 872 | 3300053078 | Ga0495612_0014984 | Ga0495612_0014984_301_1197 | 281 |
| 873 | 3300053078 | Ga0495612_0044248 | Ga0495612_0044248_791_1687 | 281 |
| 874 | 3300053083 | Ga0495655_0050413 | Ga0495655_0050413_192_1088 | 281 |
| 875 | 3300053084 | Ga0495595_0000329 | Ga0495595_0000329_16973_17872 | 281 |
| 876 | 3300053085 | Ga0495619_0025638 | Ga0495619_0025638_2282_3178 | 281 |
| 877 | 3300053094 | Ga0500566_0001277 | Ga0500566_0001277_4462_5385 | 281 |
| 878 | 3300053096 | Ga0500641_0003982 | Ga0500641_0003982_1334_2230 | 281 |
| 879 | 3300053096 | Ga0500641_0006532 | Ga0500641_0006532_822_1718 | 281 |
| 880 | 3300053102 | Ga0500554_002467 | Ga0500554_002467_682_1578 | 281 |
| 881 | 3300053119 | Ga0500595_000258 | Ga0500595_000258_10941_11864 | 281 |
| 882 | 3300053119 | Ga0500595_002380 | Ga0500595_002380_3775_4671 | 281 |
| 883 | 3300053119 | Ga0500595_014145 | Ga0500595_014145_1891_2787 | 281 |
| 884 | 3300053133 | Ga0500655_006652 | Ga0500655_006652_345_1241 | 281 |
| 885 | 3300053136 | Ga0500559_0000244 | Ga0500559_0000244_20704_21600 | 281 |
| 886 | 3300053150 | Ga0500603_000762 | Ga0500603_000762_2239_3135 | 281 |
| 887 | 3300053178 | Ga0500637_0000140 | Ga0500637_0000140_4731_5627 | 281 |
| 888 | 3300053178 | Ga0500637_0000147 | Ga0500637_0000147_13472_14395 | 281 |
| 889 | 3300053735 | Ga0500596_003380 | Ga0500596_003380_1093_1989 | 281 |
| 890 | 3300055283 | Ga0500661_003026 | Ga0500661_003026_1890_2813 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kvo-assembly3.cif.gz_B | crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) | 0.9418 | 1 | 266 |
| 3e03-assembly1.cif.gz_C-2 | crystal structure of a putative dehydrogenase from xanthomonas campestris | 0.9414 | 3 | 266 |
| 3kvo-assembly3.cif.gz_A | crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) | 0.9351 | 1 | 265 |
| 3sc4-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile | 0.922 | 3 | 265 |
| 3e03-assembly3.cif.gz_A-4 | crystal structure of a putative dehydrogenase from xanthomonas campestris | 0.914 | 3 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6P5L8_1_275_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9467 | 1 | 265 | 3.40.50.720 |
| af_Q6P5L8_1_275_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9093 | 1 | 265 | 3.40.50.720 |
| af_Q2QLP7_18_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8727 | 54 | 188 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8702 | 91 | 185 | 3.40.50.720 |
| af_I6YCF0_1_258_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8561 | 1 | 234 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D8XLV9-F1-model_v4 | Oxidoreductase, short chain dehydrogenase/reductase family protein | 0.9934 | 75 | 187 |
GO:0005739
|
| AF-A0A0D8XLV9-F1-model_v4 | Oxidoreductase, short chain dehydrogenase/reductase family protein | 0.9762 | 75 | 187 |
GO:0005739
|
| AF-A0A1A9NGH1-F1-model_v4 | Short chain dehydrogenase | 0.966 | 3 | 264 |
|
| AF-A0A433A4X0-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9641 | 1 | 269 |
|
| AF-A0A5C8B4H1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9486 | 7 | 266 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar