F484830

General Info

Members Datasets Scaffolds Average Seq Length
890 290 1780 183

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0365726|Ga0495658_0365726_159_836
Length 225
Sequence MSRRFAKAALQGWAFGCAARDDSAVACSREAIIMNRSTLFPPPMNLDRVPAGKDAPEDCNVIIEIPMHGDAIKYEVDKETGAVFVDRFMSTSMHYPCNYGYIPQTLSDDGDPCDVLVLSPVPLITGVVVRCRPIGMLKMEDEAGGDAKILAVPIDRLSGLYRAIQSPRDLPEITIKQIAHFFEHYKDLEPGKWVRVSTWVEAAEAKKEVMAGIARYGAAVRSTPP

Samples

Sample ID Description Type Environment
1 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.26
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495658_0365726 3300046683 Bacteria 917
2 JGI24752J21851_1008514 3300001976 Bacteria 1338
3 JGI24743J22301_10001507 3300001991 Bacteria 3246
4 JGI24750J21931_1047374 3300002070 Bacteria 664
5 JGI24749J21850_1003442 3300002076 Bacteria 2214
6 JGI24035J26624_1019386 3300002126 Bacteria 712
7 JGI24034J26672_10002151 3300002239 Bacteria 2687
8 JGI24751J29686_10013755 3300002459 Bacteria 1670
9 Ga0065712_10209245 3300005290 Bacteria 1079
10 Ga0065715_10034978 3300005293 Bacteria 1593
11 Ga0065715_10287265 3300005293 Bacteria 1072
12 Ga0070658_10007975 3300005327 Bacteria 8521
13 Ga0070658_10678966 3300005327 Bacteria 894
14 Ga0070676_10000214 3300005328 Bacteria 24753
15 Ga0070676_10000744 3300005328 Bacteria 16010
16 Ga0070676_10021975 3300005328 Bacteria 3575
17 Ga0070676_10045208 3300005328 Bacteria 2564
18 Ga0070676_10138379 3300005328 Bacteria 1547
19 Ga0070676_10170916 3300005328 Bacteria 1406
20 Ga0070676_10184095 3300005328 Bacteria 1360
21 Ga0070676_10395994 3300005328 Bacteria 960
22 Ga0070683_100013846 3300005329 Bacteria 7044
23 Ga0070683_100052990 3300005329 Bacteria 3759
24 Ga0070683_100097679 3300005329 Bacteria 2763
25 Ga0070690_100006539 3300005330 Bacteria 6615
26 Ga0070690_100031081 3300005330 Bacteria 3323
27 Ga0070690_100040227 3300005330 Bacteria 2956
28 Ga0070670_100001469 3300005331 Bacteria 18968
29 Ga0070670_100005022 3300005331 Bacteria 11132
30 Ga0070670_100148860 3300005331 Bacteria 2026
31 Ga0070670_100203236 3300005331 Bacteria 1722
32 Ga0070670_100403816 3300005331 Bacteria 1206
33 Ga0070670_100438276 3300005331 Bacteria 1157
34 Ga0070677_10010206 3300005333 Bacteria 3207
35 Ga0070677_10023366 3300005333 Bacteria 2288
36 Ga0068869_100005557 3300005334 Bacteria 7934
37 Ga0068869_100053049 3300005334 Bacteria 2946
38 Ga0068869_100190880 3300005334 Bacteria 1611
39 Ga0068869_100201317 3300005334 Bacteria 1570
40 Ga0068869_100297666 3300005334 Bacteria 1302
41 Ga0068869_100347343 3300005334 Bacteria 1208
42 Ga0070666_10005903 3300005335 Bacteria 7522
43 Ga0070666_10014709 3300005335 Bacteria 4984
44 Ga0070666_10019443 3300005335 Bacteria 4384
45 Ga0070666_10024618 3300005335 Bacteria 3923
46 Ga0070666_10337158 3300005335 Bacteria 1077
47 Ga0070680_100120481 3300005336 Bacteria 2190
48 Ga0070680_100571407 3300005336 Bacteria 970
49 Ga0070682_100023737 3300005337 Bacteria 3644
50 Ga0070682_100693550 3300005337 Bacteria 816
51 Ga0068868_100004061 3300005338 Bacteria 10207
52 Ga0068868_100017518 3300005338 Bacteria 5340
53 Ga0068868_100022796 3300005338 Bacteria 4731
54 Ga0068868_100052991 3300005338 Bacteria 3195
55 Ga0068868_100106086 3300005338 Bacteria 2279
56 Ga0070660_100065988 3300005339 Bacteria 2817
57 Ga0070660_100076968 3300005339 Bacteria 2613
58 Ga0070660_100093703 3300005339 Bacteria 2372
59 Ga0070689_100000324 3300005340 Bacteria 27871
60 Ga0070689_100000650 3300005340 Bacteria 20990
61 Ga0070689_100032106 3300005340 Bacteria 3993
62 Ga0070687_100010907 3300005343 Bacteria 3954
63 Ga0070687_100016406 3300005343 Bacteria 3378
64 Ga0070661_100008349 3300005344 Bacteria 7154
65 Ga0070661_100157376 3300005344 Bacteria 1719
66 Ga0070661_100393450 3300005344 Bacteria 1094
67 Ga0070661_100850556 3300005344 Bacteria 751
68 Ga0070692_10046636 3300005345 Bacteria 2241
69 Ga0070692_10296993 3300005345 Bacteria 985
70 Ga0070668_100003856 3300005347 Bacteria 11068
71 Ga0070668_100004563 3300005347 Bacteria 10272
72 Ga0070668_100006505 3300005347 Bacteria 8664
73 Ga0070668_100018741 3300005347 Bacteria 5197
74 Ga0070668_100025622 3300005347 Bacteria 4473
75 Ga0070668_100032342 3300005347 Bacteria 3981
76 Ga0070668_100043430 3300005347 Bacteria 3447
77 Ga0070668_100107246 3300005347 Bacteria 2220
78 Ga0070668_100304243 3300005347 Bacteria 1338
79 Ga0070668_101070825 3300005347 Bacteria 727
80 Ga0070669_100008372 3300005353 Bacteria 7378
81 Ga0070669_100010664 3300005353 Bacteria 6521
82 Ga0070669_100026932 3300005353 Bacteria 4137
83 Ga0070669_100275635 3300005353 Bacteria 1346
84 Ga0070669_100287492 3300005353 Bacteria 1319
85 Ga0070669_100290198 3300005353 Bacteria 1313
86 Ga0070675_100000802 3300005354 Bacteria 22093
87 Ga0070675_100007226 3300005354 Bacteria 8561
88 Ga0070675_100009565 3300005354 Bacteria 7543
89 Ga0070675_100015454 3300005354 Bacteria 6036
90 Ga0070675_100016229 3300005354 Bacteria 5909
91 Ga0070675_100018750 3300005354 Bacteria 5508
92 Ga0070675_100125784 3300005354 Bacteria 2181
93 Ga0070671_100001313 3300005355 Bacteria 18668
94 Ga0070671_100029996 3300005355 Bacteria 4487
95 Ga0070671_100063870 3300005355 Bacteria 3067
96 Ga0070671_100249511 3300005355 Bacteria 1507
97 Ga0070671_100321566 3300005355 Bacteria 1318
98 Ga0070671_100464801 3300005355 Bacteria 1086
99 Ga0070671_100544628 3300005355 Bacteria 1000
100 Ga0070671_100774652 3300005355 Bacteria 834
101 Ga0070674_100000512 3300005356 Bacteria 19432
102 Ga0070674_100004443 3300005356 Bacteria 7998
103 Ga0070674_100004897 3300005356 Bacteria 7675
104 Ga0070674_100009097 3300005356 Bacteria 5942
105 Ga0070674_100067560 3300005356 Bacteria 2515
106 Ga0070674_100338322 3300005356 Bacteria 1211
107 Ga0070674_100512913 3300005356 Bacteria 1000
108 Ga0070673_100000898 3300005364 Bacteria 16796
109 Ga0070673_100006767 3300005364 Bacteria 7480
110 Ga0070673_100025616 3300005364 Bacteria 4345
111 Ga0070673_100213933 3300005364 Bacteria 1666
112 Ga0070673_100218979 3300005364 Bacteria 1647
113 Ga0070673_101302022 3300005364 Bacteria 682
114 Ga0070688_100003909 3300005365 Bacteria 7731
115 Ga0070688_100011922 3300005365 Bacteria 4853
116 Ga0070688_100057349 3300005365 Bacteria 2448
117 Ga0070688_100078175 3300005365 Bacteria 2134
118 Ga0070659_100023473 3300005366 Bacteria 4720
119 Ga0070659_100066353 3300005366 Bacteria 2859
120 Ga0070659_100195528 3300005366 Bacteria 1663
121 Ga0070667_100006506 3300005367 Bacteria 9713
122 Ga0070667_100018863 3300005367 Bacteria 5719
123 Ga0070667_100038861 3300005367 Bacteria 3989
124 Ga0070667_100048102 3300005367 Bacteria 3590
125 Ga0070667_100058862 3300005367 Bacteria 3249
126 Ga0070667_100101889 3300005367 Bacteria 2480
127 Ga0070667_100229378 3300005367 Bacteria 1655
128 Ga0070667_100345015 3300005367 Bacteria 1347
129 Ga0070709_10085217 3300005434 Bacteria 2072
130 Ga0070709_10127755 3300005434 Bacteria 1731
131 Ga0070709_10474162 3300005434 Bacteria 946
132 Ga0070714_100003295 3300005435 Bacteria 12036
133 Ga0070714_100012558 3300005435 Bacteria 6768
134 Ga0070714_100179862 3300005435 Bacteria 1924
135 Ga0070714_100234866 3300005435 Bacteria 1690
136 Ga0070713_100007196 3300005436 Bacteria 7787
137 Ga0070713_100016403 3300005436 Bacteria 5569
138 Ga0070713_100230985 3300005436 Bacteria 1681
139 Ga0070710_10009218 3300005437 Bacteria 4824
140 Ga0070710_10011674 3300005437 Bacteria 4346
141 Ga0070710_10036771 3300005437 Bacteria 2678
142 Ga0070701_10290377 3300005438 Bacteria 1002
143 Ga0070711_100009868 3300005439 Bacteria 5888
144 Ga0070711_100070966 3300005439 Bacteria 2454
145 Ga0070705_100056195 3300005440 Bacteria 2317
146 Ga0070700_100009084 3300005441 Bacteria 5448
147 Ga0070694_100119413 3300005444 Bacteria 1890
148 Ga0070708_100024762 3300005445 Bacteria 5125
149 Ga0070708_100103506 3300005445 Bacteria 2610
150 Ga0070708_100112294 3300005445 Bacteria 2506
151 Ga0070663_100042112 3300005455 Bacteria 3207
152 Ga0070663_100316960 3300005455 Bacteria 1253
153 Ga0070663_100369358 3300005455 Bacteria 1165
154 Ga0070678_100000282 3300005456 Bacteria 23627
155 Ga0070678_100001298 3300005456 Bacteria 13264
156 Ga0070678_100001846 3300005456 Bacteria 11419
157 Ga0070662_100005937 3300005457 Bacteria 7831
158 Ga0070662_100257470 3300005457 Bacteria 1405
159 Ga0070662_100686867 3300005457 Bacteria 865
160 Ga0068867_100004441 3300005459 Bacteria 9864
161 Ga0068867_100005854 3300005459 Bacteria 8719
162 Ga0068867_100025973 3300005459 Bacteria 4202
163 Ga0068867_100129999 3300005459 Bacteria 1956
164 Ga0068867_100130059 3300005459 Bacteria 1955
165 Ga0070685_10000522 3300005466 Bacteria 21790
166 Ga0070685_10012020 3300005466 Bacteria 4538
167 Ga0070706_100183581 3300005467 Bacteria 1954
168 Ga0070706_100252372 3300005467 Bacteria 1647
169 Ga0070707_100039853 3300005468 Bacteria 4492
170 Ga0070707_100149935 3300005468 Bacteria 2270
171 Ga0070707_100401546 3300005468 Bacteria 1331
172 Ga0070698_100016152 3300005471 Bacteria 7881
173 Ga0070699_100071083 3300005518 Bacteria 3026
174 Ga0070699_100354796 3300005518 Bacteria 1321
175 Ga0070699_100753511 3300005518 Bacteria 891
176 Ga0070679_100053614 3300005530 Bacteria 4014
177 Ga0070679_100441316 3300005530 Bacteria 1246
178 Ga0070679_101096423 3300005530 Bacteria 741
179 Ga0070684_100025324 3300005535 Bacteria 4986
180 Ga0070684_100097224 3300005535 Bacteria 2625
181 Ga0070684_100247198 3300005535 Bacteria 1630
182 Ga0070697_100026299 3300005536 Bacteria 4647
183 Ga0070697_100048014 3300005536 Bacteria 3461
184 Ga0070697_100140130 3300005536 Bacteria 2033
185 Ga0068853_100011343 3300005539 Bacteria 7237
186 Ga0068853_100339975 3300005539 Bacteria 1394
187 Ga0068853_100343594 3300005539 Bacteria 1387
188 Ga0068853_100631304 3300005539 Bacteria 1019
189 Ga0068853_101228963 3300005539 Bacteria 724
190 Ga0070672_100001800 3300005543 Bacteria 13407
191 Ga0070672_100007333 3300005543 Bacteria 7479
192 Ga0070672_100007488 3300005543 Bacteria 7411
193 Ga0070672_100029001 3300005543 Bacteria 4145
194 Ga0070672_100042454 3300005543 Bacteria 3502
195 Ga0070672_100067015 3300005543 Bacteria 2844
196 Ga0070672_100276883 3300005543 Bacteria 1418
197 Ga0070672_100665361 3300005543 Bacteria 910
198 Ga0070686_100018280 3300005544 Bacteria 4110
199 Ga0070686_100029097 3300005544 Bacteria 3356
200 Ga0070695_100499207 3300005545 Bacteria 941
201 Ga0070696_100033653 3300005546 Bacteria 3523
202 Ga0070696_100117190 3300005546 Bacteria 1924
203 Ga0070696_100128568 3300005546 Bacteria 1841
204 Ga0070693_100019866 3300005547 Bacteria 3532
205 Ga0070693_100428143 3300005547 Bacteria 924
206 Ga0070693_101050469 3300005547 Bacteria 619
207 Ga0070665_100000755 3300005548 Bacteria 42946
208 Ga0070665_100007656 3300005548 Bacteria 10981
209 Ga0070665_100009807 3300005548 Bacteria 9683
210 Ga0070665_100012260 3300005548 Bacteria 8641
211 Ga0070665_100059749 3300005548 Bacteria 3821
212 Ga0070665_100137403 3300005548 Bacteria 2447
213 Ga0070665_100310380 3300005548 Bacteria 1581
214 Ga0070665_100349784 3300005548 Bacteria 1483
215 Ga0070704_100022083 3300005549 Bacteria 4137
216 Ga0070704_100091877 3300005549 Bacteria 2264
217 Ga0068855_100022600 3300005563 Bacteria 7536
218 Ga0068855_100062766 3300005563 Bacteria 4337
219 Ga0068855_100063552 3300005563 Bacteria 4308
220 Ga0068855_100220290 3300005563 Bacteria 2128
221 Ga0068855_101254028 3300005563 Bacteria 769
222 Ga0070664_100021792 3300005564 Bacteria 5283
223 Ga0070664_100023145 3300005564 Bacteria 5129
224 Ga0070664_100098547 3300005564 Bacteria 2539
225 Ga0070664_100099412 3300005564 Bacteria 2528
226 Ga0070664_100113311 3300005564 Bacteria 2368
227 Ga0070664_100245891 3300005564 Bacteria 1607
228 Ga0070664_100691049 3300005564 Bacteria 950
229 Ga0068857_100027579 3300005577 Bacteria 5010
230 Ga0068857_100047088 3300005577 Bacteria 3827
231 Ga0068854_100003556 3300005578 Bacteria 9747
232 Ga0068854_100225093 3300005578 Bacteria 1486
233 Ga0068854_100296237 3300005578 Bacteria 1307
234 Ga0068854_100353165 3300005578 Bacteria 1204
235 Ga0068856_100002173 3300005614 Bacteria 20321
236 Ga0068856_100178286 3300005614 Bacteria 2137
237 Ga0068856_100300789 3300005614 Bacteria 1622
238 Ga0068856_100516198 3300005614 Bacteria 1216
239 Ga0070702_100002946 3300005615 Bacteria 7500
240 Ga0070702_100006577 3300005615 Bacteria 5513
241 Ga0068852_100007283 3300005616 Bacteria 8068
242 Ga0068852_100016008 3300005616 Bacteria 5838
243 Ga0068852_100055896 3300005616 Bacteria 3408
244 Ga0068852_100098686 3300005616 Bacteria 2631
245 Ga0068852_100352976 3300005616 Bacteria 1436
246 Ga0068852_100465588 3300005616 Bacteria 1254
247 Ga0068852_100493197 3300005616 Bacteria 1219
248 Ga0068859_100014387 3300005617 Bacteria 7939
249 Ga0068859_100014902 3300005617 Bacteria 7806
250 Ga0068859_100069675 3300005617 Bacteria 3552
251 Ga0068864_100001000 3300005618 Bacteria 23647
252 Ga0068864_100002501 3300005618 Bacteria 15198
253 Ga0068864_100003431 3300005618 Bacteria 13103
254 Ga0068864_100003931 3300005618 Bacteria 12235
255 Ga0068864_100004467 3300005618 Bacteria 11496
256 Ga0068864_100008156 3300005618 Bacteria 8638
257 Ga0068864_100136358 3300005618 Bacteria 2210
258 Ga0068864_100141381 3300005618 Bacteria 2171
259 Ga0068864_100216211 3300005618 Bacteria 1767
260 Ga0068864_100889976 3300005618 Bacteria 879
261 Ga0068866_10031772 3300005718 Bacteria 2546
262 Ga0068866_10046376 3300005718 Bacteria 2185
263 Ga0068861_100009969 3300005719 Bacteria 6578
264 Ga0068861_100017014 3300005719 Bacteria 5155
265 Ga0068861_100029852 3300005719 Bacteria 3992
266 Ga0068861_100041017 3300005719 Bacteria 3465
267 Ga0068861_100056920 3300005719 Bacteria 2985
268 Ga0068861_100189356 3300005719 Bacteria 1719
269 Ga0068861_100304880 3300005719 Bacteria 1381
270 Ga0068861_100334229 3300005719 Bacteria 1324
271 Ga0068861_100612572 3300005719 Bacteria 1001
272 Ga0068851_10000760 3300005834 Bacteria 13876
273 Ga0068851_10002900 3300005834 Bacteria 7575
274 Ga0068851_10018417 3300005834 Bacteria 3362
275 Ga0068851_10029588 3300005834 Bacteria 2713
276 Ga0068870_10010351 3300005840 Bacteria 4283
277 Ga0068870_10034223 3300005840 Bacteria 2599
278 Ga0068870_10123666 3300005840 Bacteria 1493
279 Ga0068870_10329207 3300005840 Bacteria 973
280 Ga0068863_100002509 3300005841 Bacteria 18242
281 Ga0068863_100004438 3300005841 Bacteria 13833
282 Ga0068863_100007482 3300005841 Bacteria 10687
283 Ga0068863_100014344 3300005841 Bacteria 7632
284 Ga0068863_100019177 3300005841 Bacteria 6547
285 Ga0068863_100024468 3300005841 Bacteria 5758
286 Ga0068863_100056261 3300005841 Bacteria 3724
287 Ga0068863_100520796 3300005841 Bacteria 1172
288 Ga0068863_100693825 3300005841 Bacteria 1012
289 Ga0068858_100001616 3300005842 Bacteria 22981
290 Ga0068858_100003832 3300005842 Bacteria 14871
291 Ga0068858_100013427 3300005842 Bacteria 7729
292 Ga0068858_100040010 3300005842 Bacteria 4347
293 Ga0068858_100356369 3300005842 Bacteria 1402
294 Ga0068860_100012240 3300005843 Bacteria 8454
295 Ga0068860_100022453 3300005843 Bacteria 6103
296 Ga0068860_100045549 3300005843 Bacteria 4183
297 Ga0068860_100070846 3300005843 Bacteria 3314
298 Ga0068860_100100895 3300005843 Bacteria 2754
299 Ga0068860_100113608 3300005843 Bacteria 2589
300 Ga0068860_100277201 3300005843 Bacteria 1638
301 Ga0068860_100726973 3300005843 Bacteria 1003
302 Ga0068862_100040093 3300005844 Bacteria 3980
303 Ga0068862_100094281 3300005844 Bacteria 2611
304 Ga0068862_100226873 3300005844 Bacteria 1693
305 Ga0081539_10120190 3300005985 Bacteria 1306
306 Ga0081539_10194889 3300005985 Bacteria 940
307 Ga0070715_10005421 3300006163 Bacteria 4252
308 Ga0070716_100208729 3300006173 Bacteria 1304
309 Ga0070712_100005685 3300006175 Bacteria 7710
310 Ga0070712_101124297 3300006175 Bacteria 682
311 Ga0097621_100004791 3300006237 Bacteria 9468
312 Ga0097621_100012757 3300006237 Bacteria 6244
313 Ga0097621_100048808 3300006237 Bacteria 3436
314 Ga0097621_100115684 3300006237 Bacteria 2270
315 Ga0097621_100862876 3300006237 Bacteria 841
316 Ga0068871_100010378 3300006358 Bacteria 6794
317 Ga0068871_100024045 3300006358 Bacteria 4721
318 Ga0068871_100069668 3300006358 Bacteria 2889
319 Ga0068871_100131550 3300006358 Bacteria 2122
320 Ga0068871_100237936 3300006358 Bacteria 1582
321 Ga0068871_101097707 3300006358 Bacteria 744
322 Ga0068871_101141649 3300006358 Bacteria 729
323 Ga0075428_100099878 3300006844 Bacteria 3165
324 Ga0075431_100002144 3300006847 Bacteria 18865
325 Ga0075433_10231821 3300006852 Bacteria 1639
326 Ga0075433_10644211 3300006852 Bacteria 929
327 Ga0075434_100019391 3300006871 Bacteria 6582
328 Ga0075434_100056491 3300006871 Bacteria 3901
329 Ga0075434_100725418 3300006871 Bacteria 1011
330 Ga0075429_100034475 3300006880 Bacteria 4399
331 Ga0068865_100010750 3300006881 Bacteria 5706
332 Ga0068865_100025893 3300006881 Bacteria 3864
333 Ga0068865_100029292 3300006881 Bacteria 3651
334 Ga0068865_100077974 3300006881 Bacteria 2369
335 Ga0097620_100014386 3300006931 Bacteria 7939
336 Ga0097620_100014900 3300006931 Bacteria 7806
337 Ga0097620_100069680 3300006931 Bacteria 3552
338 Ga0075435_100041477 3300007076 Bacteria 3679
339 Ga0075435_100195672 3300007076 Bacteria 1712
340 Ga0075435_100748968 3300007076 Bacteria 850
341 Ga0075435_100828482 3300007076 Bacteria 806
342 Ga0105240_10051113 3300009093 Bacteria 5204
343 Ga0105240_10054022 3300009093 Bacteria 5037
344 Ga0105240_10482605 3300009093 Bacteria 1381
345 Ga0111539_10137058 3300009094 Bacteria 2866
346 Ga0111539_10243173 3300009094 Bacteria 2095
347 Ga0105245_10036008 3300009098 Bacteria 4395
348 Ga0105245_10044063 3300009098 Bacteria 3981
349 Ga0105245_10469787 3300009098 Bacteria 1269
350 Ga0105247_10013579 3300009101 Bacteria 4884
351 Ga0105247_10138616 3300009101 Bacteria 1592
352 Ga0105247_10336001 3300009101 Bacteria 1058
353 Ga0114129_10097191 3300009147 Bacteria 4076
354 Ga0114129_10328673 3300009147 Bacteria 2031
355 Ga0105243_10221975 3300009148 Bacteria 1671
356 Ga0105241_10003899 3300009174 Bacteria 11049
357 Ga0105241_10042070 3300009174 Bacteria 3455
358 Ga0105241_10070821 3300009174 Bacteria 2706
359 Ga0105241_10275689 3300009174 Bacteria 1434
360 Ga0105241_10534313 3300009174 Bacteria 1050
361 Ga0105242_10176047 3300009176 Bacteria 1884
362 Ga0105248_10015655 3300009177 Bacteria 8357
363 Ga0105248_10023395 3300009177 Bacteria 6863
364 Ga0105248_10159540 3300009177 Bacteria 2544
365 Ga0105248_10303349 3300009177 Bacteria 1798
366 Ga0105248_10495674 3300009177 Bacteria 1377
367 Ga0105248_10792728 3300009177 Bacteria 1069
368 Ga0105237_10026918 3300009545 Bacteria 5875
369 Ga0105238_10006515 3300009551 Bacteria 11619
370 Ga0105238_10008114 3300009551 Bacteria 10501
371 Ga0105238_10077572 3300009551 Bacteria 3313
372 Ga0105249_10038854 3300009553 Bacteria 4319
373 Ga0105249_10209728 3300009553 Bacteria 1911
374 Ga0105249_10544205 3300009553 Bacteria 1211
375 Ga0105249_10841150 3300009553 Bacteria 983
376 Ga0105239_10609064 3300010375 Bacteria 1246
377 Ga0105239_10805496 3300010375 Bacteria 1076
378 Ga0105246_10176709 3300011119 Bacteria 1640
379 Ga0157373_10005591 3300013100 Bacteria 9424
380 Ga0157373_10041623 3300013100 Bacteria 3286
381 Ga0157373_10055969 3300013100 Bacteria 2801
382 Ga0157373_10199852 3300013100 Bacteria 1409
383 Ga0157373_10479416 3300013100 Bacteria 897
384 Ga0157371_10019019 3300013102 Bacteria 5070
385 Ga0157371_10033685 3300013102 Bacteria 3679
386 Ga0157371_10069094 3300013102 Bacteria 2501
387 Ga0157371_10254125 3300013102 Bacteria 1266
388 Ga0157370_10026926 3300013104 Bacteria 5670
389 Ga0157370_10047064 3300013104 Bacteria 4135
390 Ga0157370_10066379 3300013104 Bacteria 3412
391 Ga0157370_10090956 3300013104 Bacteria 2865
392 Ga0157370_10240945 3300013104 Bacteria 1673
393 Ga0157369_10010583 3300013105 Bacteria 10501
394 Ga0157369_10049776 3300013105 Bacteria 4540
395 Ga0157374_10002330 3300013296 Bacteria 16033
396 Ga0157374_10002543 3300013296 Bacteria 15382
397 Ga0157374_10009894 3300013296 Bacteria 8183
398 Ga0157374_10045485 3300013296 Bacteria 4063
399 Ga0157374_10134511 3300013296 Bacteria 2395
400 Ga0157374_11212014 3300013296 Bacteria 776
401 Ga0157378_10022056 3300013297 Bacteria 5601
402 Ga0157378_10273371 3300013297 Bacteria 1626
403 Ga0157378_10343746 3300013297 Bacteria 1456
404 Ga0157378_10895463 3300013297 Bacteria 918
405 Ga0157378_11622463 3300013297 Bacteria 693
406 Ga0163162_10003179 3300013306 Bacteria 15705
407 Ga0163162_10035896 3300013306 Bacteria 4938
408 Ga0163162_10064452 3300013306 Bacteria 3709
409 Ga0163162_10072782 3300013306 Bacteria 3492
410 Ga0163162_10160734 3300013306 Bacteria 2368
411 Ga0163162_10431019 3300013306 Bacteria 1451
412 Ga0163162_10628880 3300013306 Bacteria 1198
413 Ga0163162_11055796 3300013306 Bacteria 920
414 Ga0157372_10004917 3300013307 Bacteria 14202
415 Ga0157372_10046075 3300013307 Bacteria 4839
416 Ga0157372_10194528 3300013307 Bacteria 2349
417 Ga0157372_10489255 3300013307 Bacteria 1434
418 Ga0157372_11551509 3300013307 Bacteria 763
419 Ga0157375_10003041 3300013308 Bacteria 14564
420 Ga0157375_10017959 3300013308 Bacteria 6402
421 Ga0157375_10198476 3300013308 Bacteria 2162
422 Ga0157375_10205753 3300013308 Bacteria 2124
423 Ga0157375_10241910 3300013308 Bacteria 1964
424 Ga0157375_10282132 3300013308 Bacteria 1824
425 Ga0157375_10416057 3300013308 Bacteria 1510
426 Ga0157375_10491502 3300013308 Bacteria 1392
427 Ga0157375_10510583 3300013308 Bacteria 1366
428 Ga0157375_11387818 3300013308 Bacteria 827
429 Ga0163163_10004410 3300014325 Bacteria 11996
430 Ga0163163_10019921 3300014325 Bacteria 6309
431 Ga0163163_10382093 3300014325 Bacteria 1466
432 Ga0163163_10900563 3300014325 Bacteria 948
433 Ga0163163_11043633 3300014325 Bacteria 881
434 Ga0163163_12108928 3300014325 Bacteria 623
435 Ga0157380_10015361 3300014326 Bacteria 5628
436 Ga0157380_10042701 3300014326 Bacteria 3545
437 Ga0157380_10092123 3300014326 Bacteria 2504
438 Ga0157380_10317265 3300014326 Bacteria 1443
439 Ga0157380_10452150 3300014326 Bacteria 1234
440 Ga0157380_11626316 3300014326 Bacteria 702
441 Ga0182008_10183890 3300014497 Bacteria 1058
442 Ga0157377_10014844 3300014745 Bacteria 3973
443 Ga0157379_10000544 3300014968 Bacteria 30401
444 Ga0157379_10013818 3300014968 Bacteria 7075
445 Ga0157379_10031598 3300014968 Bacteria 4718
446 Ga0157379_10446611 3300014968 Bacteria 1193
447 Ga0157379_10563792 3300014968 Bacteria 1060
448 Ga0157376_10017692 3300014969 Bacteria 5444
449 Ga0157376_10060056 3300014969 Bacteria 3191
450 Ga0157376_10076386 3300014969 Bacteria 2862
451 Ga0157376_10083894 3300014969 Bacteria 2742
452 Ga0157376_10185216 3300014969 Bacteria 1906
453 Ga0157376_10442756 3300014969 Bacteria 1266
454 Ga0163161_10007139 3300017792 Bacteria 7723
455 Ga0163161_10012679 3300017792 Bacteria 5854
456 Ga0163161_10054057 3300017792 Bacteria 2914
457 Ga0163161_10136415 3300017792 Bacteria 1855
458 Ga0163161_10139148 3300017792 Bacteria 1837
459 Ga0207666_1002641 3300025271 Bacteria 2168
460 Ga0207673_1004095 3300025290 Bacteria 1731
461 Ga0207697_10000474 3300025315 Bacteria 22692
462 Ga0207697_10014153 3300025315 Bacteria 3316
463 Ga0207656_10009549 3300025321 Bacteria 3604
464 Ga0207682_10000224 3300025893 Bacteria 25591
465 Ga0207682_10002853 3300025893 Bacteria 7625
466 Ga0207692_10035074 3300025898 Bacteria 2435
467 Ga0207692_10075173 3300025898 Bacteria 1791
468 Ga0207642_10051950 3300025899 Bacteria 1857
469 Ga0207642_10076098 3300025899 Bacteria 1614
470 Ga0207710_10020412 3300025900 Bacteria 2832
471 Ga0207688_10001248 3300025901 Bacteria 13208
472 Ga0207688_10421448 3300025901 Bacteria 829
473 Ga0207680_10017979 3300025903 Bacteria 3746
474 Ga0207680_10065128 3300025903 Bacteria 2236
475 Ga0207680_10320205 3300025903 Bacteria 1084
476 Ga0207685_10022878 3300025905 Bacteria 2119
477 Ga0207699_10008850 3300025906 Bacteria 4987
478 Ga0207699_10059254 3300025906 Bacteria 2294
479 Ga0207645_10000488 3300025907 Bacteria 32821
480 Ga0207645_10001172 3300025907 Bacteria 21640
481 Ga0207645_10003895 3300025907 Bacteria 11158
482 Ga0207645_10020904 3300025907 Bacteria 4276
483 Ga0207645_10220063 3300025907 Bacteria 1251
484 Ga0207645_10276534 3300025907 Bacteria 1114
485 Ga0207645_10471002 3300025907 Bacteria 849
486 Ga0207643_10000241 3300025908 Bacteria 38063
487 Ga0207643_10009328 3300025908 Bacteria 5274
488 Ga0207643_10044848 3300025908 Bacteria 2496
489 Ga0207643_10155832 3300025908 Bacteria 1372
490 Ga0207705_10124679 3300025909 Bacteria 1913
491 Ga0207684_10031913 3300025910 Bacteria 4481
492 Ga0207684_10887322 3300025910 Bacteria 750
493 Ga0207654_10188960 3300025911 Bacteria 1349
494 Ga0207707_10010933 3300025912 Bacteria 7893
495 Ga0207707_10092524 3300025912 Bacteria 2642
496 Ga0207695_10042039 3300025913 Bacteria 4887
497 Ga0207695_10184913 3300025913 Bacteria 2003
498 Ga0207693_10000069 3300025915 Bacteria 90103
499 Ga0207693_10006208 3300025915 Bacteria 9911
500 Ga0207663_10009044 3300025916 Bacteria 5246
501 Ga0207663_10171738 3300025916 Bacteria 1540
502 Ga0207663_10308783 3300025916 Bacteria 1184
503 Ga0207660_10003901 3300025917 Bacteria 9720
504 Ga0207660_10055842 3300025917 Bacteria 2824
505 Ga0207662_10010967 3300025918 Bacteria 5013
506 Ga0207662_10036933 3300025918 Bacteria 2857
507 Ga0207657_10021040 3300025919 Bacteria 6150
508 Ga0207649_10061084 3300025920 Bacteria 2371
509 Ga0207649_10583947 3300025920 Bacteria 858
510 Ga0207652_10001143 3300025921 Bacteria 23866
511 Ga0207652_10023819 3300025921 Bacteria 5076
512 Ga0207652_10101505 3300025921 Bacteria 2541
513 Ga0207646_10027520 3300025922 Bacteria 5185
514 Ga0207646_10242741 3300025922 Bacteria 1627
515 Ga0207646_10285750 3300025922 Bacteria 1491
516 Ga0207681_10008866 3300025923 Bacteria 6145
517 Ga0207681_10016156 3300025923 Bacteria 4663
518 Ga0207681_10166400 3300025923 Bacteria 1667
519 Ga0207694_10011462 3300025924 Bacteria 6691
520 Ga0207694_10141237 3300025924 Bacteria 1936
521 Ga0207694_10236969 3300025924 Bacteria 1491
522 Ga0207650_10006364 3300025925 Bacteria 8041
523 Ga0207650_10007771 3300025925 Bacteria 7309
524 Ga0207650_10007867 3300025925 Bacteria 7257
525 Ga0207650_10029683 3300025925 Bacteria 3933
526 Ga0207650_10076551 3300025925 Bacteria 2528
527 Ga0207650_10084892 3300025925 Bacteria 2407
528 Ga0207650_10157528 3300025925 Bacteria 1797
529 Ga0207650_10506673 3300025925 Bacteria 1009
530 Ga0207650_10679555 3300025925 Bacteria 869
531 Ga0207659_10004534 3300025926 Bacteria 8405
532 Ga0207659_10005318 3300025926 Bacteria 7803
533 Ga0207659_10007612 3300025926 Bacteria 6678
534 Ga0207659_10014481 3300025926 Bacteria 5089
535 Ga0207659_10048788 3300025926 Bacteria 3001
536 Ga0207659_10070001 3300025926 Bacteria 2557
537 Ga0207687_10008061 3300025927 Bacteria 6893
538 Ga0207687_10837358 3300025927 Bacteria 786
539 Ga0207700_10001882 3300025928 Bacteria 11909
540 Ga0207700_10010851 3300025928 Bacteria 5779
541 Ga0207700_10363638 3300025928 Bacteria 1262
542 Ga0207664_10001100 3300025929 Bacteria 18018
543 Ga0207664_10015121 3300025929 Bacteria 5591
544 Ga0207664_10040208 3300025929 Bacteria 3635
545 Ga0207664_10079989 3300025929 Bacteria 2655
546 Ga0207644_10001001 3300025931 Bacteria 18052
547 Ga0207644_10010748 3300025931 Bacteria 6037
548 Ga0207644_10016811 3300025931 Bacteria 4927
549 Ga0207644_10041280 3300025931 Bacteria 3263
550 Ga0207644_10171178 3300025931 Bacteria 1695
551 Ga0207644_10313396 3300025931 Bacteria 1267
552 Ga0207644_10359193 3300025931 Bacteria 1184
553 Ga0207644_10610095 3300025931 Bacteria 906
554 Ga0207690_10074874 3300025932 Bacteria 2346
555 Ga0207690_10162037 3300025932 Bacteria 1668
556 Ga0207706_10000488 3300025933 Bacteria 42317
557 Ga0207706_10012193 3300025933 Bacteria 7833
558 Ga0207706_10043521 3300025933 Bacteria 3979
559 Ga0207706_10895797 3300025933 Bacteria 749
560 Ga0207686_10000118 3300025934 Bacteria 64531
561 Ga0207686_10177606 3300025934 Bacteria 1507
562 Ga0207670_10003274 3300025936 Bacteria 8578
563 Ga0207670_10006315 3300025936 Bacteria 6565
564 Ga0207670_10022230 3300025936 Bacteria 3928
565 Ga0207669_10000937 3300025937 Bacteria 12328
566 Ga0207669_10004593 3300025937 Bacteria 6094
567 Ga0207669_10006911 3300025937 Bacteria 5218
568 Ga0207669_10012907 3300025937 Bacteria 4127
569 Ga0207669_10024282 3300025937 Bacteria 3255
570 Ga0207669_10079181 3300025937 Bacteria 2097
571 Ga0207669_10175489 3300025937 Bacteria 1530
572 Ga0207669_10210315 3300025937 Bacteria 1419
573 Ga0207704_10008365 3300025938 Bacteria 4943
574 Ga0207704_10155440 3300025938 Bacteria 1620
575 Ga0207704_10280151 3300025938 Bacteria 1267
576 Ga0207665_10031075 3300025939 Bacteria 3532
577 Ga0207665_10045530 3300025939 Bacteria 2938
578 Ga0207665_10161882 3300025939 Bacteria 1610
579 Ga0207665_10639471 3300025939 Bacteria 833
580 Ga0207691_10000458 3300025940 Bacteria 40362
581 Ga0207691_10000572 3300025940 Bacteria 36827
582 Ga0207691_10024787 3300025940 Bacteria 5638
583 Ga0207691_10026691 3300025940 Bacteria 5419
584 Ga0207691_10030643 3300025940 Bacteria 5025
585 Ga0207691_10043789 3300025940 Bacteria 4123
586 Ga0207691_10165429 3300025940 Bacteria 1939
587 Ga0207691_10172875 3300025940 Bacteria 1891
588 Ga0207691_10697946 3300025940 Bacteria 856
589 Ga0207711_10000515 3300025941 Bacteria 39690
590 Ga0207711_10003360 3300025941 Bacteria 13861
591 Ga0207711_10014797 3300025941 Bacteria 6483
592 Ga0207711_10065514 3300025941 Bacteria 3141
593 Ga0207711_10089785 3300025941 Bacteria 2700
594 Ga0207689_10000421 3300025942 Bacteria 39749
595 Ga0207689_10000719 3300025942 Bacteria 31673
596 Ga0207689_10101654 3300025942 Bacteria 2361
597 Ga0207689_10163357 3300025942 Bacteria 1835
598 Ga0207689_10200950 3300025942 Bacteria 1645
599 Ga0207661_10092618 3300025944 Bacteria 2520
600 Ga0207661_10109892 3300025944 Bacteria 2329
601 Ga0207661_10129118 3300025944 Bacteria 2162
602 Ga0207679_10005081 3300025945 Bacteria 8228
603 Ga0207679_10030087 3300025945 Bacteria 3788
604 Ga0207679_10037021 3300025945 Bacteria 3465
605 Ga0207679_10089146 3300025945 Bacteria 2380
606 Ga0207679_10248824 3300025945 Bacteria 1510
607 Ga0207679_10357807 3300025945 Bacteria 1274
608 Ga0207679_10600580 3300025945 Bacteria 992
609 Ga0207667_10030255 3300025949 Bacteria 5860
610 Ga0207667_10091512 3300025949 Bacteria 3142
611 Ga0207667_10246114 3300025949 Bacteria 1829
612 Ga0207667_10346050 3300025949 Bacteria 1516
613 Ga0207651_10001969 3300025960 Bacteria 9653
614 Ga0207651_10002981 3300025960 Bacteria 8191
615 Ga0207651_10009524 3300025960 Bacteria 5327
616 Ga0207651_10067538 3300025960 Bacteria 2516
617 Ga0207651_10187409 3300025960 Bacteria 1647
618 Ga0207651_10289339 3300025960 Bacteria 1358
619 Ga0207651_11210998 3300025960 Bacteria 678
620 Ga0207712_10098595 3300025961 Bacteria 2168
621 Ga0207712_10115059 3300025961 Bacteria 2024
622 Ga0207712_10764334 3300025961 Bacteria 847
623 Ga0207712_11296989 3300025961 Bacteria 651
624 Ga0207668_10003117 3300025972 Bacteria 9711
625 Ga0207668_10003880 3300025972 Bacteria 8813
626 Ga0207668_10005978 3300025972 Bacteria 7174
627 Ga0207668_10021299 3300025972 Bacteria 4133
628 Ga0207668_10024979 3300025972 Bacteria 3862
629 Ga0207668_10052264 3300025972 Bacteria 2826
630 Ga0207668_10063277 3300025972 Bacteria 2609
631 Ga0207668_10088887 3300025972 Bacteria 2264
632 Ga0207668_10091659 3300025972 Bacteria 2234
633 Ga0207668_10170227 3300025972 Bacteria 1707
634 Ga0207668_10317924 3300025972 Bacteria 1291
635 Ga0207640_10008553 3300025981 Bacteria 5684
636 Ga0207640_10494244 3300025981 Bacteria 1017
637 Ga0207640_10817150 3300025981 Bacteria 809
638 Ga0207658_10007690 3300025986 Bacteria 7338
639 Ga0207658_10011693 3300025986 Bacteria 5976
640 Ga0207658_10012660 3300025986 Bacteria 5761
641 Ga0207658_10014000 3300025986 Bacteria 5490
642 Ga0207658_10014476 3300025986 Bacteria 5401
643 Ga0207658_10049696 3300025986 Bacteria 3082
644 Ga0207658_10141366 3300025986 Bacteria 1948
645 Ga0207658_10267733 3300025986 Bacteria 1459
646 Ga0207677_10003500 3300026023 Bacteria 8322
647 Ga0207677_10006248 3300026023 Bacteria 6515
648 Ga0207677_10047725 3300026023 Bacteria 2877
649 Ga0207677_10105985 3300026023 Bacteria 2081
650 Ga0207677_10169989 3300026023 Bacteria 1703
651 Ga0207677_10446257 3300026023 Bacteria 1107
652 Ga0207677_11469471 3300026023 Bacteria 629
653 Ga0207703_10002644 3300026035 Bacteria 15435
654 Ga0207703_10011990 3300026035 Bacteria 6751
655 Ga0207703_10015545 3300026035 Bacteria 5935
656 Ga0207703_10023846 3300026035 Bacteria 4812
657 Ga0207703_10124618 3300026035 Bacteria 2216
658 Ga0207703_10139403 3300026035 Bacteria 2103
659 Ga0207639_10022474 3300026041 Bacteria 4543
660 Ga0207639_10315171 3300026041 Bacteria 1387
661 Ga0207639_10549341 3300026041 Bacteria 1060
662 Ga0207639_10680972 3300026041 Bacteria 953
663 Ga0207639_10992572 3300026041 Bacteria 786
664 Ga0207678_10005480 3300026067 Bacteria 11348
665 Ga0207678_10006243 3300026067 Bacteria 10586
666 Ga0207678_10011514 3300026067 Bacteria 7770
667 Ga0207678_10116000 3300026067 Bacteria 2285
668 Ga0207678_10127320 3300026067 Bacteria 2172
669 Ga0207708_10005086 3300026075 Bacteria 9702
670 Ga0207702_10008839 3300026078 Bacteria 8491
671 Ga0207641_10000588 3300026088 Bacteria 39984
672 Ga0207641_10002776 3300026088 Bacteria 15957
673 Ga0207641_10009170 3300026088 Bacteria 8170
674 Ga0207641_10020806 3300026088 Bacteria 5392
675 Ga0207641_10022296 3300026088 Bacteria 5212
676 Ga0207641_10032620 3300026088 Bacteria 4324
677 Ga0207641_10095043 3300026088 Bacteria 2615
678 Ga0207641_10382301 3300026088 Bacteria 1348
679 Ga0207641_10669220 3300026088 Bacteria 1021
680 Ga0207648_10000364 3300026089 Bacteria 49697
681 Ga0207648_10003329 3300026089 Bacteria 16878
682 Ga0207648_10007103 3300026089 Bacteria 11049
683 Ga0207648_10008038 3300026089 Bacteria 10277
684 Ga0207648_10019354 3300026089 Bacteria 6145
685 Ga0207648_10139771 3300026089 Bacteria 2134
686 Ga0207648_10164325 3300026089 Bacteria 1961
687 Ga0207648_10801163 3300026089 Bacteria 877
688 Ga0207676_10001838 3300026095 Bacteria 15554
689 Ga0207676_10005263 3300026095 Bacteria 9157
690 Ga0207676_10010876 3300026095 Bacteria 6491
691 Ga0207676_10029303 3300026095 Bacteria 4119
692 Ga0207676_10042063 3300026095 Bacteria 3513
693 Ga0207676_10076846 3300026095 Bacteria 2699
694 Ga0207676_10094604 3300026095 Bacteria 2462
695 Ga0207676_10118451 3300026095 Bacteria 2228
696 Ga0207676_10309243 3300026095 Bacteria 1446
697 Ga0207676_10519036 3300026095 Bacteria 1134
698 Ga0207674_10002737 3300026116 Bacteria 21985
699 Ga0207674_10006639 3300026116 Bacteria 13591
700 Ga0207674_10066888 3300026116 Bacteria 3619
701 Ga0207675_100008479 3300026118 Bacteria 9683
702 Ga0207675_100013544 3300026118 Bacteria 7611
703 Ga0207675_100021323 3300026118 Bacteria 6035
704 Ga0207675_100024335 3300026118 Bacteria 5631
705 Ga0207675_100033578 3300026118 Bacteria 4780
706 Ga0207675_100177647 3300026118 Bacteria 2037
707 Ga0207675_100367875 3300026118 Bacteria 1412
708 Ga0207675_100472446 3300026118 Bacteria 1245
709 Ga0207675_100810817 3300026118 Bacteria 950
710 Ga0207675_101721798 3300026118 Bacteria 647
711 Ga0207683_10000076 3300026121 Bacteria 77762
712 Ga0207683_10000218 3300026121 Bacteria 50151
713 Ga0207683_10001799 3300026121 Bacteria 18984
714 Ga0207683_10005087 3300026121 Bacteria 11285
715 Ga0207683_10017518 3300026121 Bacteria 6106
716 Ga0207683_10024809 3300026121 Bacteria 5166
717 Ga0207683_10096864 3300026121 Bacteria 2631
718 Ga0207683_10438216 3300026121 Bacteria 1204
719 Ga0207698_10002381 3300026142 Bacteria 11142
720 Ga0207698_10018570 3300026142 Bacteria 4741
721 Ga0207698_10035981 3300026142 Bacteria 3629
722 Ga0207698_10109945 3300026142 Bacteria 2307
723 Ga0207698_10122160 3300026142 Bacteria 2206
724 Ga0207698_10239913 3300026142 Bacteria 1651
725 Ga0207428_10199808 3300027907 Bacteria 1504
726 Ga0268266_10003578 3300028379 Bacteria 15404
727 Ga0268266_10014526 3300028379 Bacteria 6769
728 Ga0268266_10017452 3300028379 Bacteria 6121
729 Ga0268266_10018819 3300028379 Bacteria 5885
730 Ga0268266_10086443 3300028379 Bacteria 2742
731 Ga0268266_10141465 3300028379 Bacteria 2159
732 Ga0268266_10361952 3300028379 Bacteria 1365
733 Ga0268265_10024064 3300028380 Bacteria 4303
734 Ga0268265_10024477 3300028380 Bacteria 4272
735 Ga0268265_10190097 3300028380 Bacteria 1772
736 Ga0268265_10467838 3300028380 Bacteria 1181
737 Ga0268264_10003660 3300028381 Bacteria 13217
738 Ga0268264_10009693 3300028381 Bacteria 7977
739 Ga0268264_10017111 3300028381 Bacteria 5936
740 Ga0268264_10057016 3300028381 Bacteria 3266
741 Ga0268264_10078712 3300028381 Bacteria 2811
742 Ga0268264_10092446 3300028381 Bacteria 2612
743 Ga0268264_10110620 3300028381 Bacteria 2406
744 Ga0268264_10139271 3300028381 Bacteria 2161
745 Ga0265330_10000546 3300031235 Bacteria 24652
746 Ga0265332_10003000 3300031238 Bacteria 8280
747 Ga0265339_10072728 3300031249 Bacteria 1829
748 Ga0265331_10001620 3300031250 Bacteria 16437
749 Ga0265327_10007592 3300031251 Bacteria 8325
750 Ga0265316_10044839 3300031344 Bacteria 3514
751 Ga0307408_100029133 3300031548 Bacteria 3821
752 Ga0265314_10005632 3300031711 Bacteria 11251
753 Ga0265342_10034247 3300031712 Bacteria 3117
754 Ga0307405_10029979 3300031731 Bacteria 3185
755 Ga0307410_10001615 3300031852 Bacteria 10350
756 Ga0307410_10019419 3300031852 Bacteria 4134
757 Ga0307406_10016654 3300031901 Bacteria 4277
758 Ga0307407_10003364 3300031903 Bacteria 6544
759 Ga0307412_10007245 3300031911 Bacteria 6288
760 Ga0307409_100031116 3300031995 Bacteria 3846
761 Ga0307409_100069496 3300031995 Bacteria 2791
762 Ga0307416_100001805 3300032002 Bacteria 11892
763 Ga0307416_100053428 3300032002 Bacteria 3241
764 Ga0307416_101013295 3300032002 Bacteria 934
765 Ga0307416_101786294 3300032002 Bacteria 719
766 Ga0307414_10015815 3300032004 Bacteria 4568
767 Ga0307411_10029859 3300032005 Bacteria 3335
768 Ga0307411_10106600 3300032005 Bacteria 1995
769 Ga0307411_10466678 3300032005 Bacteria 1060
770 Ga0373934_0040718 3300035086 Bacteria 1833
771 Ga0373944_0037954 3300035089 Bacteria 1478
772 Ga0373953_0093506 3300035117 Bacteria 1259
773 Ga0373954_0195839 3300035118 Bacteria 992
774 Ga0373956_0009855 3300035119 Bacteria 3892
775 Ga0373957_0006995 3300035120 Bacteria 3586
776 Ga0373943_0032494 3300035170 Bacteria 2481
777 Ga0373943_0174358 3300035170 Bacteria 1178
778 Ga0373946_0060219 3300035171 Bacteria 1613
779 Ga0373946_0136708 3300035171 Bacteria 1132
780 Ga0373955_0013907 3300035172 Bacteria 3904
781 Ga0373955_0081354 3300035172 Bacteria 1831
782 Ga0373924_0098616 3300035410 Bacteria 1255
783 Ga0373931_0126129 3300035691 Bacteria 1468
784 Ga0373927_0034038 3300035695 Bacteria 3315
785 Ga0373927_0085289 3300035695 Bacteria 2049
786 Ga0373933_0005379 3300035724 Bacteria 6973
787 Ga0373933_0149262 3300035724 Bacteria 1480
788 Ga0373933_0247253 3300035724 Bacteria 1148
789 Ga0373933_0631218 3300035724 Bacteria 704
790 Ga0373947_0016015 3300035725 Bacteria 4308
791 Ga0373947_0068067 3300035725 Bacteria 2177
792 Ga0373947_0074117 3300035725 Bacteria 2093
793 Ga0373947_0293063 3300035725 Bacteria 1084
794 Ga0373947_0507943 3300035725 Bacteria 819
795 Ga0373937_0002839 3300036401 Bacteria 14477
796 Ga0373937_0010161 3300036401 Bacteria 8210
797 Ga0373937_0137801 3300036401 Bacteria 2282
798 Ga0373937_0228209 3300036401 Bacteria 1753
799 Ga0373937_0518248 3300036401 Bacteria 1133
800 Ga0373937_0531811 3300036401 Bacteria 1117
801 Ga0373925_0027705 3300037068 Bacteria 4147
802 Ga0373925_0363635 3300037068 Bacteria 1176
803 Ga0373925_0764890 3300037068 Bacteria 796
804 Ga0395898_0365052 3300037466 Bacteria 1377
805 Ga0395905_0396226 3300037471 Bacteria 1275
806 Ga0451802_1191024 3300041460 Bacteria 848
807 Ga0451845_0059238 3300041501 Bacteria 792
808 Ga0439448_0062518 3300042005 Bacteria 1232
809 Ga0451577_0258166 3300042876 Bacteria 1578
810 Ga0466957_0603850 3300044842 Bacteria 768
811 Ga0495580_0026036 3300046472 Bacteria 4268
812 Ga0495580_0115264 3300046472 Bacteria 1866
813 Ga0495582_0032219 3300046473 Bacteria 2883
814 Ga0495639_0142314 3300046475 Bacteria 1153
815 Ga0495662_0246951 3300046476 Bacteria 879
816 Ga0495664_0174276 3300046477 Bacteria 1305
817 Ga0495628_0460430 3300046516 Bacteria 923
818 Ga0495665_0149935 3300046531 Bacteria 1217
819 Ga0495586_0118326 3300046535 Bacteria 1479
820 Ga0495621_0004963 3300046539 Bacteria 3787
821 Ga0495645_0020392 3300046543 Bacteria 4781
822 Ga0495647_0013845 3300046681 Bacteria 2802
823 Ga0495658_0009925 3300046683 Bacteria 4750
824 Ga0495581_0001804 3300047315 Bacteria 11968
825 Ga0495684_0011314 3300047471 Bacteria 6888
826 Ga0495602_0200549 3300048088 Bacteria 1523
827 Ga0496100_0004262 3300048903 Bacteria 7564
828 Ga0496101_0006151 3300048904 Bacteria 7707
829 Ga0496102_0011726 3300048905 Bacteria 7565
830 Ga0496102_0112457 3300048905 Bacteria 2540
831 Ga0496103_0190656 3300048906 Bacteria 1318
832 Ga0496104_0004333 3300048907 Bacteria 12345
833 Ga0496104_0010541 3300048907 Bacteria 8254
834 Ga0496105_0008136 3300048908 Bacteria 8155
835 Ga0496106_0040063 3300048909 Bacteria 3507
836 Ga0496106_0348158 3300048909 Bacteria 1190
837 Ga0496106_1123322 3300048909 Bacteria 615
838 Ga0496107_0027057 3300048910 Bacteria 4071
839 Ga0496107_0138205 3300048910 Bacteria 1801
840 Ga0496107_0278923 3300048910 Bacteria 1244
841 Ga0496108_0134239 3300048911 Bacteria 2128
842 Ga0496108_0621271 3300048911 Bacteria 941
843 Ga0496108_0629278 3300048911 Bacteria 934
844 Ga0496109_0002292 3300048912 Bacteria 15916
845 Ga0496109_0176900 3300048912 Bacteria 2003
846 Ga0496109_0429556 3300048912 Bacteria 1248
847 Ga0496110_0001542 3300048913 Bacteria 16768
848 Ga0496110_0095256 3300048913 Bacteria 2666
849 Ga0496112_0003810 3300048915 Bacteria 12602
850 Ga0496112_0201440 3300048915 Bacteria 1950
851 Ga0496114_0157771 3300048917 Bacteria 1971
852 Ga0496114_0522999 3300048917 Bacteria 1049
853 Ga0496115_0161289 3300048918 Bacteria 1853
854 Ga0496115_0909124 3300048918 Bacteria 678
855 Ga0501031_0065118 3300049568 Bacteria 2374
856 Ga0501032_0003756 3300049569 Bacteria 11518
857 Ga0501033_0001343 3300049570 Bacteria 21882
858 Ga0501034_0039070 3300049571 Bacteria 4807
859 Ga0501036_0003237 3300049572 Bacteria 12983
860 Ga0501036_0044422 3300049572 Bacteria 3763
861 Ga0501037_0129590 3300049573 Bacteria 1809
862 Ga0501038_0045132 3300049574 Bacteria 3826
863 Ga0501038_0427386 3300049574 Bacteria 1021
864 Ga0501039_0001150 3300049575 Bacteria 19517
865 Ga0501043_0016804 3300049579 Bacteria 5734
866 Ga0501046_0007421 3300049580 Bacteria 9637
867 Ga0501046_0010791 3300049580 Bacteria 7833
868 Ga0501069_0459588 3300049585 Bacteria 757
869 Ga0501035_0000158 3300049822 Bacteria 82890
870 Ga0501044_0041405 3300049823 Bacteria 4795
871 nmdc:mga0k408_324036_c1 3300050493 Bacteria 919
872 nmdc:mga05p37_1110231_c1 3300050507 Bacteria 827
873 nmdc:mga09592_36973_c1 3300050508 Bacteria 4092
874 nmdc:mga08y16_1006394_c1 3300050511 Bacteria 813
875 nmdc:mga08y16_51608_c1 3300050511 Bacteria 4303
876 nmdc:mga0n895_431500_c1 3300050512 Bacteria 1331
877 nmdc:mga0n895_45001_c1 3300050512 Bacteria 4305
878 nmdc:mga0n895_71750_c1 3300050512 Bacteria 3434
879 nmdc:mga0rr50_117377_c1 3300050513 Bacteria 2113
880 nmdc:mga0rr50_45287_c1 3300050513 Bacteria 3232
881 nmdc:mga08x19_106069_c1 3300050514 Bacteria 1869
882 nmdc:mga08x19_392199_c1 3300050514 Bacteria 973
883 nmdc:mga0a205_123229_c1 3300050515 Bacteria 2492
884 nmdc:mga0a205_540523_c1 3300050515 Bacteria 1021
885 Ga0495612_0021443 3300053078 Bacteria 2592
886 Ga0495612_0451942 3300053078 Bacteria 587
887 Ga0495595_0074127 3300053084 Bacteria 1613
888 Ga0495619_0132791 3300053085 Bacteria 1711
889 Ga0495619_0291805 3300053085 Bacteria 1130
890 Ga0501082_0495701 3300060353 Bacteria 1068
891 Ga0495658_0365726
892 JGI24752J21851_1008514
893 JGI24743J22301_10001507
894 JGI24750J21931_1047374
895 JGI24749J21850_1003442
896 JGI24035J26624_1019386
897 JGI24034J26672_10002151
898 JGI24751J29686_10013755
899 Ga0065712_10209245
900 Ga0065715_10034978
901 Ga0065715_10287265
902 Ga0070658_10007975
903 Ga0070658_10678966
904 Ga0070676_10000214
905 Ga0070676_10000744
906 Ga0070676_10021975
907 Ga0070676_10045208
908 Ga0070676_10138379
909 Ga0070676_10170916
910 Ga0070676_10184095
911 Ga0070676_10395994
912 Ga0070683_100013846
913 Ga0070683_100052990
914 Ga0070683_100097679
915 Ga0070690_100006539
916 Ga0070690_100031081
917 Ga0070690_100040227
918 Ga0070670_100001469
919 Ga0070670_100005022
920 Ga0070670_100148860
921 Ga0070670_100203236
922 Ga0070670_100403816
923 Ga0070670_100438276
924 Ga0070677_10010206
925 Ga0070677_10023366
926 Ga0068869_100005557
927 Ga0068869_100053049
928 Ga0068869_100190880
929 Ga0068869_100201317
930 Ga0068869_100297666
931 Ga0068869_100347343
932 Ga0070666_10005903
933 Ga0070666_10014709
934 Ga0070666_10019443
935 Ga0070666_10024618
936 Ga0070666_10337158
937 Ga0070680_100120481
938 Ga0070680_100571407
939 Ga0070682_100023737
940 Ga0070682_100693550
941 Ga0068868_100004061
942 Ga0068868_100017518
943 Ga0068868_100022796
944 Ga0068868_100052991
945 Ga0068868_100106086
946 Ga0070660_100065988
947 Ga0070660_100076968
948 Ga0070660_100093703
949 Ga0070689_100000324
950 Ga0070689_100000650
951 Ga0070689_100032106
952 Ga0070687_100010907
953 Ga0070687_100016406
954 Ga0070661_100008349
955 Ga0070661_100157376
956 Ga0070661_100393450
957 Ga0070661_100850556
958 Ga0070692_10046636
959 Ga0070692_10296993
960 Ga0070668_100003856
961 Ga0070668_100004563
962 Ga0070668_100006505
963 Ga0070668_100018741
964 Ga0070668_100025622
965 Ga0070668_100032342
966 Ga0070668_100043430
967 Ga0070668_100107246
968 Ga0070668_100304243
969 Ga0070668_101070825
970 Ga0070669_100008372
971 Ga0070669_100010664
972 Ga0070669_100026932
973 Ga0070669_100275635
974 Ga0070669_100287492
975 Ga0070669_100290198
976 Ga0070675_100000802
977 Ga0070675_100007226
978 Ga0070675_100009565
979 Ga0070675_100015454
980 Ga0070675_100016229
981 Ga0070675_100018750
982 Ga0070675_100125784
983 Ga0070671_100001313
984 Ga0070671_100029996
985 Ga0070671_100063870
986 Ga0070671_100249511
987 Ga0070671_100321566
988 Ga0070671_100464801
989 Ga0070671_100544628
990 Ga0070671_100774652
991 Ga0070674_100000512
992 Ga0070674_100004443
993 Ga0070674_100004897
994 Ga0070674_100009097
995 Ga0070674_100067560
996 Ga0070674_100338322
997 Ga0070674_100512913
998 Ga0070673_100000898
999 Ga0070673_100006767
1000 Ga0070673_100025616
1001 Ga0070673_100213933
1002 Ga0070673_100218979
1003 Ga0070673_101302022
1004 Ga0070688_100003909
1005 Ga0070688_100011922
1006 Ga0070688_100057349
1007 Ga0070688_100078175
1008 Ga0070659_100023473
1009 Ga0070659_100066353
1010 Ga0070659_100195528
1011 Ga0070667_100006506
1012 Ga0070667_100018863
1013 Ga0070667_100038861
1014 Ga0070667_100048102
1015 Ga0070667_100058862
1016 Ga0070667_100101889
1017 Ga0070667_100229378
1018 Ga0070667_100345015
1019 Ga0070709_10085217
1020 Ga0070709_10127755
1021 Ga0070709_10474162
1022 Ga0070714_100003295
1023 Ga0070714_100012558
1024 Ga0070714_100179862
1025 Ga0070714_100234866
1026 Ga0070713_100007196
1027 Ga0070713_100016403
1028 Ga0070713_100230985
1029 Ga0070710_10009218
1030 Ga0070710_10011674
1031 Ga0070710_10036771
1032 Ga0070701_10290377
1033 Ga0070711_100009868
1034 Ga0070711_100070966
1035 Ga0070705_100056195
1036 Ga0070700_100009084
1037 Ga0070694_100119413
1038 Ga0070708_100024762
1039 Ga0070708_100103506
1040 Ga0070708_100112294
1041 Ga0070663_100042112
1042 Ga0070663_100316960
1043 Ga0070663_100369358
1044 Ga0070678_100000282
1045 Ga0070678_100001298
1046 Ga0070678_100001846
1047 Ga0070662_100005937
1048 Ga0070662_100257470
1049 Ga0070662_100686867
1050 Ga0068867_100004441
1051 Ga0068867_100005854
1052 Ga0068867_100025973
1053 Ga0068867_100129999
1054 Ga0068867_100130059
1055 Ga0070685_10000522
1056 Ga0070685_10012020
1057 Ga0070706_100183581
1058 Ga0070706_100252372
1059 Ga0070707_100039853
1060 Ga0070707_100149935
1061 Ga0070707_100401546
1062 Ga0070698_100016152
1063 Ga0070699_100071083
1064 Ga0070699_100354796
1065 Ga0070699_100753511
1066 Ga0070679_100053614
1067 Ga0070679_100441316
1068 Ga0070679_101096423
1069 Ga0070684_100025324
1070 Ga0070684_100097224
1071 Ga0070684_100247198
1072 Ga0070697_100026299
1073 Ga0070697_100048014
1074 Ga0070697_100140130
1075 Ga0068853_100011343
1076 Ga0068853_100339975
1077 Ga0068853_100343594
1078 Ga0068853_100631304
1079 Ga0068853_101228963
1080 Ga0070672_100001800
1081 Ga0070672_100007333
1082 Ga0070672_100007488
1083 Ga0070672_100029001
1084 Ga0070672_100042454
1085 Ga0070672_100067015
1086 Ga0070672_100276883
1087 Ga0070672_100665361
1088 Ga0070686_100018280
1089 Ga0070686_100029097
1090 Ga0070695_100499207
1091 Ga0070696_100033653
1092 Ga0070696_100117190
1093 Ga0070696_100128568
1094 Ga0070693_100019866
1095 Ga0070693_100428143
1096 Ga0070693_101050469
1097 Ga0070665_100000755
1098 Ga0070665_100007656
1099 Ga0070665_100009807
1100 Ga0070665_100012260
1101 Ga0070665_100059749
1102 Ga0070665_100137403
1103 Ga0070665_100310380
1104 Ga0070665_100349784
1105 Ga0070704_100022083
1106 Ga0070704_100091877
1107 Ga0068855_100022600
1108 Ga0068855_100062766
1109 Ga0068855_100063552
1110 Ga0068855_100220290
1111 Ga0068855_101254028
1112 Ga0070664_100021792
1113 Ga0070664_100023145
1114 Ga0070664_100098547
1115 Ga0070664_100099412
1116 Ga0070664_100113311
1117 Ga0070664_100245891
1118 Ga0070664_100691049
1119 Ga0068857_100027579
1120 Ga0068857_100047088
1121 Ga0068854_100003556
1122 Ga0068854_100225093
1123 Ga0068854_100296237
1124 Ga0068854_100353165
1125 Ga0068856_100002173
1126 Ga0068856_100178286
1127 Ga0068856_100300789
1128 Ga0068856_100516198
1129 Ga0070702_100002946
1130 Ga0070702_100006577
1131 Ga0068852_100007283
1132 Ga0068852_100016008
1133 Ga0068852_100055896
1134 Ga0068852_100098686
1135 Ga0068852_100352976
1136 Ga0068852_100465588
1137 Ga0068852_100493197
1138 Ga0068859_100014387
1139 Ga0068859_100014902
1140 Ga0068859_100069675
1141 Ga0068864_100001000
1142 Ga0068864_100002501
1143 Ga0068864_100003431
1144 Ga0068864_100003931
1145 Ga0068864_100004467
1146 Ga0068864_100008156
1147 Ga0068864_100136358
1148 Ga0068864_100141381
1149 Ga0068864_100216211
1150 Ga0068864_100889976
1151 Ga0068866_10031772
1152 Ga0068866_10046376
1153 Ga0068861_100009969
1154 Ga0068861_100017014
1155 Ga0068861_100029852
1156 Ga0068861_100041017
1157 Ga0068861_100056920
1158 Ga0068861_100189356
1159 Ga0068861_100304880
1160 Ga0068861_100334229
1161 Ga0068861_100612572
1162 Ga0068851_10000760
1163 Ga0068851_10002900
1164 Ga0068851_10018417
1165 Ga0068851_10029588
1166 Ga0068870_10010351
1167 Ga0068870_10034223
1168 Ga0068870_10123666
1169 Ga0068870_10329207
1170 Ga0068863_100002509
1171 Ga0068863_100004438
1172 Ga0068863_100007482
1173 Ga0068863_100014344
1174 Ga0068863_100019177
1175 Ga0068863_100024468
1176 Ga0068863_100056261
1177 Ga0068863_100520796
1178 Ga0068863_100693825
1179 Ga0068858_100001616
1180 Ga0068858_100003832
1181 Ga0068858_100013427
1182 Ga0068858_100040010
1183 Ga0068858_100356369
1184 Ga0068860_100012240
1185 Ga0068860_100022453
1186 Ga0068860_100045549
1187 Ga0068860_100070846
1188 Ga0068860_100100895
1189 Ga0068860_100113608
1190 Ga0068860_100277201
1191 Ga0068860_100726973
1192 Ga0068862_100040093
1193 Ga0068862_100094281
1194 Ga0068862_100226873
1195 Ga0081539_10120190
1196 Ga0081539_10194889
1197 Ga0070715_10005421
1198 Ga0070716_100208729
1199 Ga0070712_100005685
1200 Ga0070712_101124297
1201 Ga0097621_100004791
1202 Ga0097621_100012757
1203 Ga0097621_100048808
1204 Ga0097621_100115684
1205 Ga0097621_100862876
1206 Ga0068871_100010378
1207 Ga0068871_100024045
1208 Ga0068871_100069668
1209 Ga0068871_100131550
1210 Ga0068871_100237936
1211 Ga0068871_101097707
1212 Ga0068871_101141649
1213 Ga0075428_100099878
1214 Ga0075431_100002144
1215 Ga0075433_10231821
1216 Ga0075433_10644211
1217 Ga0075434_100019391
1218 Ga0075434_100056491
1219 Ga0075434_100725418
1220 Ga0075429_100034475
1221 Ga0068865_100010750
1222 Ga0068865_100025893
1223 Ga0068865_100029292
1224 Ga0068865_100077974
1225 Ga0097620_100014386
1226 Ga0097620_100014900
1227 Ga0097620_100069680
1228 Ga0075435_100041477
1229 Ga0075435_100195672
1230 Ga0075435_100748968
1231 Ga0075435_100828482
1232 Ga0105240_10051113
1233 Ga0105240_10054022
1234 Ga0105240_10482605
1235 Ga0111539_10137058
1236 Ga0111539_10243173
1237 Ga0105245_10036008
1238 Ga0105245_10044063
1239 Ga0105245_10469787
1240 Ga0105247_10013579
1241 Ga0105247_10138616
1242 Ga0105247_10336001
1243 Ga0114129_10097191
1244 Ga0114129_10328673
1245 Ga0105243_10221975
1246 Ga0105241_10003899
1247 Ga0105241_10042070
1248 Ga0105241_10070821
1249 Ga0105241_10275689
1250 Ga0105241_10534313
1251 Ga0105242_10176047
1252 Ga0105248_10015655
1253 Ga0105248_10023395
1254 Ga0105248_10159540
1255 Ga0105248_10303349
1256 Ga0105248_10495674
1257 Ga0105248_10792728
1258 Ga0105237_10026918
1259 Ga0105238_10006515
1260 Ga0105238_10008114
1261 Ga0105238_10077572
1262 Ga0105249_10038854
1263 Ga0105249_10209728
1264 Ga0105249_10544205
1265 Ga0105249_10841150
1266 Ga0105239_10609064
1267 Ga0105239_10805496
1268 Ga0105246_10176709
1269 Ga0157373_10005591
1270 Ga0157373_10041623
1271 Ga0157373_10055969
1272 Ga0157373_10199852
1273 Ga0157373_10479416
1274 Ga0157371_10019019
1275 Ga0157371_10033685
1276 Ga0157371_10069094
1277 Ga0157371_10254125
1278 Ga0157370_10026926
1279 Ga0157370_10047064
1280 Ga0157370_10066379
1281 Ga0157370_10090956
1282 Ga0157370_10240945
1283 Ga0157369_10010583
1284 Ga0157369_10049776
1285 Ga0157374_10002330
1286 Ga0157374_10002543
1287 Ga0157374_10009894
1288 Ga0157374_10045485
1289 Ga0157374_10134511
1290 Ga0157374_11212014
1291 Ga0157378_10022056
1292 Ga0157378_10273371
1293 Ga0157378_10343746
1294 Ga0157378_10895463
1295 Ga0157378_11622463
1296 Ga0163162_10003179
1297 Ga0163162_10035896
1298 Ga0163162_10064452
1299 Ga0163162_10072782
1300 Ga0163162_10160734
1301 Ga0163162_10431019
1302 Ga0163162_10628880
1303 Ga0163162_11055796
1304 Ga0157372_10004917
1305 Ga0157372_10046075
1306 Ga0157372_10194528
1307 Ga0157372_10489255
1308 Ga0157372_11551509
1309 Ga0157375_10003041
1310 Ga0157375_10017959
1311 Ga0157375_10198476
1312 Ga0157375_10205753
1313 Ga0157375_10241910
1314 Ga0157375_10282132
1315 Ga0157375_10416057
1316 Ga0157375_10491502
1317 Ga0157375_10510583
1318 Ga0157375_11387818
1319 Ga0163163_10004410
1320 Ga0163163_10019921
1321 Ga0163163_10382093
1322 Ga0163163_10900563
1323 Ga0163163_11043633
1324 Ga0163163_12108928
1325 Ga0157380_10015361
1326 Ga0157380_10042701
1327 Ga0157380_10092123
1328 Ga0157380_10317265
1329 Ga0157380_10452150
1330 Ga0157380_11626316
1331 Ga0182008_10183890
1332 Ga0157377_10014844
1333 Ga0157379_10000544
1334 Ga0157379_10013818
1335 Ga0157379_10031598
1336 Ga0157379_10446611
1337 Ga0157379_10563792
1338 Ga0157376_10017692
1339 Ga0157376_10060056
1340 Ga0157376_10076386
1341 Ga0157376_10083894
1342 Ga0157376_10185216
1343 Ga0157376_10442756
1344 Ga0163161_10007139
1345 Ga0163161_10012679
1346 Ga0163161_10054057
1347 Ga0163161_10136415
1348 Ga0163161_10139148
1349 Ga0207666_1002641
1350 Ga0207673_1004095
1351 Ga0207697_10000474
1352 Ga0207697_10014153
1353 Ga0207656_10009549
1354 Ga0207682_10000224
1355 Ga0207682_10002853
1356 Ga0207692_10035074
1357 Ga0207692_10075173
1358 Ga0207642_10051950
1359 Ga0207642_10076098
1360 Ga0207710_10020412
1361 Ga0207688_10001248
1362 Ga0207688_10421448
1363 Ga0207680_10017979
1364 Ga0207680_10065128
1365 Ga0207680_10320205
1366 Ga0207685_10022878
1367 Ga0207699_10008850
1368 Ga0207699_10059254
1369 Ga0207645_10000488
1370 Ga0207645_10001172
1371 Ga0207645_10003895
1372 Ga0207645_10020904
1373 Ga0207645_10220063
1374 Ga0207645_10276534
1375 Ga0207645_10471002
1376 Ga0207643_10000241
1377 Ga0207643_10009328
1378 Ga0207643_10044848
1379 Ga0207643_10155832
1380 Ga0207705_10124679
1381 Ga0207684_10031913
1382 Ga0207684_10887322
1383 Ga0207654_10188960
1384 Ga0207707_10010933
1385 Ga0207707_10092524
1386 Ga0207695_10042039
1387 Ga0207695_10184913
1388 Ga0207693_10000069
1389 Ga0207693_10006208
1390 Ga0207663_10009044
1391 Ga0207663_10171738
1392 Ga0207663_10308783
1393 Ga0207660_10003901
1394 Ga0207660_10055842
1395 Ga0207662_10010967
1396 Ga0207662_10036933
1397 Ga0207657_10021040
1398 Ga0207649_10061084
1399 Ga0207649_10583947
1400 Ga0207652_10001143
1401 Ga0207652_10023819
1402 Ga0207652_10101505
1403 Ga0207646_10027520
1404 Ga0207646_10242741
1405 Ga0207646_10285750
1406 Ga0207681_10008866
1407 Ga0207681_10016156
1408 Ga0207681_10166400
1409 Ga0207694_10011462
1410 Ga0207694_10141237
1411 Ga0207694_10236969
1412 Ga0207650_10006364
1413 Ga0207650_10007771
1414 Ga0207650_10007867
1415 Ga0207650_10029683
1416 Ga0207650_10076551
1417 Ga0207650_10084892
1418 Ga0207650_10157528
1419 Ga0207650_10506673
1420 Ga0207650_10679555
1421 Ga0207659_10004534
1422 Ga0207659_10005318
1423 Ga0207659_10007612
1424 Ga0207659_10014481
1425 Ga0207659_10048788
1426 Ga0207659_10070001
1427 Ga0207687_10008061
1428 Ga0207687_10837358
1429 Ga0207700_10001882
1430 Ga0207700_10010851
1431 Ga0207700_10363638
1432 Ga0207664_10001100
1433 Ga0207664_10015121
1434 Ga0207664_10040208
1435 Ga0207664_10079989
1436 Ga0207644_10001001
1437 Ga0207644_10010748
1438 Ga0207644_10016811
1439 Ga0207644_10041280
1440 Ga0207644_10171178
1441 Ga0207644_10313396
1442 Ga0207644_10359193
1443 Ga0207644_10610095
1444 Ga0207690_10074874
1445 Ga0207690_10162037
1446 Ga0207706_10000488
1447 Ga0207706_10012193
1448 Ga0207706_10043521
1449 Ga0207706_10895797
1450 Ga0207686_10000118
1451 Ga0207686_10177606
1452 Ga0207670_10003274
1453 Ga0207670_10006315
1454 Ga0207670_10022230
1455 Ga0207669_10000937
1456 Ga0207669_10004593
1457 Ga0207669_10006911
1458 Ga0207669_10012907
1459 Ga0207669_10024282
1460 Ga0207669_10079181
1461 Ga0207669_10175489
1462 Ga0207669_10210315
1463 Ga0207704_10008365
1464 Ga0207704_10155440
1465 Ga0207704_10280151
1466 Ga0207665_10031075
1467 Ga0207665_10045530
1468 Ga0207665_10161882
1469 Ga0207665_10639471
1470 Ga0207691_10000458
1471 Ga0207691_10000572
1472 Ga0207691_10024787
1473 Ga0207691_10026691
1474 Ga0207691_10030643
1475 Ga0207691_10043789
1476 Ga0207691_10165429
1477 Ga0207691_10172875
1478 Ga0207691_10697946
1479 Ga0207711_10000515
1480 Ga0207711_10003360
1481 Ga0207711_10014797
1482 Ga0207711_10065514
1483 Ga0207711_10089785
1484 Ga0207689_10000421
1485 Ga0207689_10000719
1486 Ga0207689_10101654
1487 Ga0207689_10163357
1488 Ga0207689_10200950
1489 Ga0207661_10092618
1490 Ga0207661_10109892
1491 Ga0207661_10129118
1492 Ga0207679_10005081
1493 Ga0207679_10030087
1494 Ga0207679_10037021
1495 Ga0207679_10089146
1496 Ga0207679_10248824
1497 Ga0207679_10357807
1498 Ga0207679_10600580
1499 Ga0207667_10030255
1500 Ga0207667_10091512
1501 Ga0207667_10246114
1502 Ga0207667_10346050
1503 Ga0207651_10001969
1504 Ga0207651_10002981
1505 Ga0207651_10009524
1506 Ga0207651_10067538
1507 Ga0207651_10187409
1508 Ga0207651_10289339
1509 Ga0207651_11210998
1510 Ga0207712_10098595
1511 Ga0207712_10115059
1512 Ga0207712_10764334
1513 Ga0207712_11296989
1514 Ga0207668_10003117
1515 Ga0207668_10003880
1516 Ga0207668_10005978
1517 Ga0207668_10021299
1518 Ga0207668_10024979
1519 Ga0207668_10052264
1520 Ga0207668_10063277
1521 Ga0207668_10088887
1522 Ga0207668_10091659
1523 Ga0207668_10170227
1524 Ga0207668_10317924
1525 Ga0207640_10008553
1526 Ga0207640_10494244
1527 Ga0207640_10817150
1528 Ga0207658_10007690
1529 Ga0207658_10011693
1530 Ga0207658_10012660
1531 Ga0207658_10014000
1532 Ga0207658_10014476
1533 Ga0207658_10049696
1534 Ga0207658_10141366
1535 Ga0207658_10267733
1536 Ga0207677_10003500
1537 Ga0207677_10006248
1538 Ga0207677_10047725
1539 Ga0207677_10105985
1540 Ga0207677_10169989
1541 Ga0207677_10446257
1542 Ga0207677_11469471
1543 Ga0207703_10002644
1544 Ga0207703_10011990
1545 Ga0207703_10015545
1546 Ga0207703_10023846
1547 Ga0207703_10124618
1548 Ga0207703_10139403
1549 Ga0207639_10022474
1550 Ga0207639_10315171
1551 Ga0207639_10549341
1552 Ga0207639_10680972
1553 Ga0207639_10992572
1554 Ga0207678_10005480
1555 Ga0207678_10006243
1556 Ga0207678_10011514
1557 Ga0207678_10116000
1558 Ga0207678_10127320
1559 Ga0207708_10005086
1560 Ga0207702_10008839
1561 Ga0207641_10000588
1562 Ga0207641_10002776
1563 Ga0207641_10009170
1564 Ga0207641_10020806
1565 Ga0207641_10022296
1566 Ga0207641_10032620
1567 Ga0207641_10095043
1568 Ga0207641_10382301
1569 Ga0207641_10669220
1570 Ga0207648_10000364
1571 Ga0207648_10003329
1572 Ga0207648_10007103
1573 Ga0207648_10008038
1574 Ga0207648_10019354
1575 Ga0207648_10139771
1576 Ga0207648_10164325
1577 Ga0207648_10801163
1578 Ga0207676_10001838
1579 Ga0207676_10005263
1580 Ga0207676_10010876
1581 Ga0207676_10029303
1582 Ga0207676_10042063
1583 Ga0207676_10076846
1584 Ga0207676_10094604
1585 Ga0207676_10118451
1586 Ga0207676_10309243
1587 Ga0207676_10519036
1588 Ga0207674_10002737
1589 Ga0207674_10006639
1590 Ga0207674_10066888
1591 Ga0207675_100008479
1592 Ga0207675_100013544
1593 Ga0207675_100021323
1594 Ga0207675_100024335
1595 Ga0207675_100033578
1596 Ga0207675_100177647
1597 Ga0207675_100367875
1598 Ga0207675_100472446
1599 Ga0207675_100810817
1600 Ga0207675_101721798
1601 Ga0207683_10000076
1602 Ga0207683_10000218
1603 Ga0207683_10001799
1604 Ga0207683_10005087
1605 Ga0207683_10017518
1606 Ga0207683_10024809
1607 Ga0207683_10096864
1608 Ga0207683_10438216
1609 Ga0207698_10002381
1610 Ga0207698_10018570
1611 Ga0207698_10035981
1612 Ga0207698_10109945
1613 Ga0207698_10122160
1614 Ga0207698_10239913
1615 Ga0207428_10199808
1616 Ga0268266_10003578
1617 Ga0268266_10014526
1618 Ga0268266_10017452
1619 Ga0268266_10018819
1620 Ga0268266_10086443
1621 Ga0268266_10141465
1622 Ga0268266_10361952
1623 Ga0268265_10024064
1624 Ga0268265_10024477
1625 Ga0268265_10190097
1626 Ga0268265_10467838
1627 Ga0268264_10003660
1628 Ga0268264_10009693
1629 Ga0268264_10017111
1630 Ga0268264_10057016
1631 Ga0268264_10078712
1632 Ga0268264_10092446
1633 Ga0268264_10110620
1634 Ga0268264_10139271
1635 Ga0265330_10000546
1636 Ga0265332_10003000
1637 Ga0265339_10072728
1638 Ga0265331_10001620
1639 Ga0265327_10007592
1640 Ga0265316_10044839
1641 Ga0307408_100029133
1642 Ga0265314_10005632
1643 Ga0265342_10034247
1644 Ga0307405_10029979
1645 Ga0307410_10001615
1646 Ga0307410_10019419
1647 Ga0307406_10016654
1648 Ga0307407_10003364
1649 Ga0307412_10007245
1650 Ga0307409_100031116
1651 Ga0307409_100069496
1652 Ga0307416_100001805
1653 Ga0307416_100053428
1654 Ga0307416_101013295
1655 Ga0307416_101786294
1656 Ga0307414_10015815
1657 Ga0307411_10029859
1658 Ga0307411_10106600
1659 Ga0307411_10466678
1660 Ga0373934_0040718
1661 Ga0373944_0037954
1662 Ga0373953_0093506
1663 Ga0373954_0195839
1664 Ga0373956_0009855
1665 Ga0373957_0006995
1666 Ga0373943_0032494
1667 Ga0373943_0174358
1668 Ga0373946_0060219
1669 Ga0373946_0136708
1670 Ga0373955_0013907
1671 Ga0373955_0081354
1672 Ga0373924_0098616
1673 Ga0373931_0126129
1674 Ga0373927_0034038
1675 Ga0373927_0085289
1676 Ga0373933_0005379
1677 Ga0373933_0149262
1678 Ga0373933_0247253
1679 Ga0373933_0631218
1680 Ga0373947_0016015
1681 Ga0373947_0068067
1682 Ga0373947_0074117
1683 Ga0373947_0293063
1684 Ga0373947_0507943
1685 Ga0373937_0002839
1686 Ga0373937_0010161
1687 Ga0373937_0137801
1688 Ga0373937_0228209
1689 Ga0373937_0518248
1690 Ga0373937_0531811
1691 Ga0373925_0027705
1692 Ga0373925_0363635
1693 Ga0373925_0764890
1694 Ga0395898_0365052
1695 Ga0395905_0396226
1696 Ga0451802_1191024
1697 Ga0451845_0059238
1698 Ga0439448_0062518
1699 Ga0451577_0258166
1700 Ga0466957_0603850
1701 Ga0495580_0026036
1702 Ga0495580_0115264
1703 Ga0495582_0032219
1704 Ga0495639_0142314
1705 Ga0495662_0246951
1706 Ga0495664_0174276
1707 Ga0495628_0460430
1708 Ga0495665_0149935
1709 Ga0495586_0118326
1710 Ga0495621_0004963
1711 Ga0495645_0020392
1712 Ga0495647_0013845
1713 Ga0495658_0009925
1714 Ga0495581_0001804
1715 Ga0495684_0011314
1716 Ga0495602_0200549
1717 Ga0496100_0004262
1718 Ga0496101_0006151
1719 Ga0496102_0011726
1720 Ga0496102_0112457
1721 Ga0496103_0190656
1722 Ga0496104_0004333
1723 Ga0496104_0010541
1724 Ga0496105_0008136
1725 Ga0496106_0040063
1726 Ga0496106_0348158
1727 Ga0496106_1123322
1728 Ga0496107_0027057
1729 Ga0496107_0138205
1730 Ga0496107_0278923
1731 Ga0496108_0134239
1732 Ga0496108_0621271
1733 Ga0496108_0629278
1734 Ga0496109_0002292
1735 Ga0496109_0176900
1736 Ga0496109_0429556
1737 Ga0496110_0001542
1738 Ga0496110_0095256
1739 Ga0496112_0003810
1740 Ga0496112_0201440
1741 Ga0496114_0157771
1742 Ga0496114_0522999
1743 Ga0496115_0161289
1744 Ga0496115_0909124
1745 Ga0501031_0065118
1746 Ga0501032_0003756
1747 Ga0501033_0001343
1748 Ga0501034_0039070
1749 Ga0501036_0003237
1750 Ga0501036_0044422
1751 Ga0501037_0129590
1752 Ga0501038_0045132
1753 Ga0501038_0427386
1754 Ga0501039_0001150
1755 Ga0501043_0016804
1756 Ga0501046_0007421
1757 Ga0501046_0010791
1758 Ga0501069_0459588
1759 Ga0501035_0000158
1760 Ga0501044_0041405
1761 nmdc:mga0k408_324036_c1
1762 nmdc:mga05p37_1110231_c1
1763 nmdc:mga09592_36973_c1
1764 nmdc:mga08y16_1006394_c1
1765 nmdc:mga08y16_51608_c1
1766 nmdc:mga0n895_431500_c1
1767 nmdc:mga0n895_45001_c1
1768 nmdc:mga0n895_71750_c1
1769 nmdc:mga0rr50_117377_c1
1770 nmdc:mga0rr50_45287_c1
1771 nmdc:mga08x19_106069_c1
1772 nmdc:mga08x19_392199_c1
1773 nmdc:mga0a205_123229_c1
1774 nmdc:mga0a205_540523_c1
1775 Ga0495612_0021443
1776 Ga0495612_0451942
1777 Ga0495595_0074127
1778 Ga0495619_0132791
1779 Ga0495619_0291805
1780 Ga0501082_0495701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

61

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9357 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9352 2 174
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9253 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9246 2 174
3i4q-assembly1.cif.gz_A structure of a putative inorganic pyrophosphatase from the oil-degrading bacterium oleispira antarctica 0.9219 4 173
ID Description Score Start End Superfamily
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9189 2 175 3.90.80.10
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9088 2 175 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9071 3 175 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8978 17 172 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8894 15 176 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A257JFP8-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.991 68 176 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3D5Q6T3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.99 50 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2M8TYQ3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9875 73 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A1Y5ETG5-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9829 57 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3M6FPT4-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9828 73 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map