F484667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 885 | 298 | 1770 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10084938|Ga0265316_100849384 |
| Length | 139 |
| Sequence | MEVILREDVEKLGSRGDMVRVASGYARNFLLPKRLAVAATDANRKIVEQERQAHLREDLSKLLTGVTVTIMQKAGEQDQLFGSVTSKDVADALAAKNFTIDRRKIQLDEPIKTLGEFKVPVKLHKDVIAEVTVVVAKED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 1.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 95.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10084938 | 3300031344 | Unclassified | 2423 |
| 2 | LJNas_1000260 | 3300000546 | Bacteria | 9129 |
| 3 | JGI24737J22298_10091288 | 3300001990 | Bacteria | 903 |
| 4 | rootL2_10241530 | 3300003322 | Bacteria | 1268 |
| 5 | Ga0058863_10029568 | 3300004799 | Bacteria | 2846 |
| 6 | Ga0065712_10353710 | 3300005290 | Bacteria | 784 |
| 7 | Ga0070658_10047356 | 3300005327 | Bacteria | 3480 |
| 8 | Ga0070658_10426613 | 3300005327 | Unclassified | 1141 |
| 9 | Ga0070658_11086340 | 3300005327 | Unclassified | 696 |
| 10 | Ga0070683_100030293 | 3300005329 | Bacteria | 4910 |
| 11 | Ga0070683_100133717 | 3300005329 | Bacteria | 2348 |
| 12 | Ga0070683_100170304 | 3300005329 | Bacteria | 2067 |
| 13 | Ga0070683_100758586 | 3300005329 | Bacteria | 930 |
| 14 | Ga0070690_100073959 | 3300005330 | Unclassified | 2218 |
| 15 | Ga0070690_100221945 | 3300005330 | Unclassified | 1324 |
| 16 | Ga0070690_100234369 | 3300005330 | Unclassified | 1292 |
| 17 | Ga0070670_100001671 | 3300005331 | Bacteria | 18007 |
| 18 | Ga0068869_100029513 | 3300005334 | Bacteria | 3844 |
| 19 | Ga0068869_100318641 | 3300005334 | Bacteria | 1260 |
| 20 | Ga0068869_100964164 | 3300005334 | Unclassified | 741 |
| 21 | Ga0068869_101312210 | 3300005334 | Unclassified | 639 |
| 22 | Ga0070666_10012008 | 3300005335 | Bacteria | 5451 |
| 23 | Ga0070680_100000603 | 3300005336 | Bacteria | 24867 |
| 24 | Ga0070680_100053548 | 3300005336 | Bacteria | 3294 |
| 25 | Ga0070680_100186234 | 3300005336 | Bacteria | 1749 |
| 26 | Ga0070680_100257035 | 3300005336 | Bacteria | 1477 |
| 27 | Ga0070680_100740923 | 3300005336 | Unclassified | 846 |
| 28 | Ga0070680_100839079 | 3300005336 | Bacteria | 792 |
| 29 | Ga0070682_100224682 | 3300005337 | Bacteria | 1339 |
| 30 | Ga0070682_100274201 | 3300005337 | Bacteria | 1227 |
| 31 | Ga0068868_100002128 | 3300005338 | Bacteria | 13662 |
| 32 | Ga0068868_100026427 | 3300005338 | Bacteria | 4424 |
| 33 | Ga0068868_100727563 | 3300005338 | Bacteria | 890 |
| 34 | Ga0070660_100104824 | 3300005339 | Bacteria | 2243 |
| 35 | Ga0070660_100190960 | 3300005339 | Bacteria | 1659 |
| 36 | Ga0070660_100218661 | 3300005339 | Bacteria | 1548 |
| 37 | Ga0070660_100462584 | 3300005339 | Bacteria | 1053 |
| 38 | Ga0070660_100597898 | 3300005339 | Bacteria | 922 |
| 39 | Ga0070660_100944342 | 3300005339 | Unclassified | 728 |
| 40 | Ga0070689_100085443 | 3300005340 | Bacteria | 2481 |
| 41 | Ga0070689_100211546 | 3300005340 | Unclassified | 1587 |
| 42 | Ga0070691_10136978 | 3300005341 | Bacteria | 1245 |
| 43 | Ga0070691_10175990 | 3300005341 | Bacteria | 1111 |
| 44 | Ga0070691_10447080 | 3300005341 | Bacteria | 737 |
| 45 | Ga0070661_100010828 | 3300005344 | Bacteria | 6349 |
| 46 | Ga0070661_100230274 | 3300005344 | Unclassified | 1424 |
| 47 | Ga0070692_10041886 | 3300005345 | Bacteria | 2348 |
| 48 | Ga0070675_100110258 | 3300005354 | Bacteria | 2327 |
| 49 | Ga0070671_100151886 | 3300005355 | Bacteria | 1955 |
| 50 | Ga0070671_100595585 | 3300005355 | Bacteria | 955 |
| 51 | Ga0070671_101525399 | 3300005355 | Bacteria | 592 |
| 52 | Ga0070673_100152664 | 3300005364 | Bacteria | 1957 |
| 53 | Ga0070673_100896487 | 3300005364 | Unclassified | 822 |
| 54 | Ga0070688_101037073 | 3300005365 | Bacteria | 653 |
| 55 | Ga0070659_100238255 | 3300005366 | Unclassified | 1505 |
| 56 | Ga0070667_101696926 | 3300005367 | Bacteria | 594 |
| 57 | Ga0070709_10009188 | 3300005434 | Bacteria | 5441 |
| 58 | Ga0070714_100022904 | 3300005435 | Bacteria | 5125 |
| 59 | Ga0070714_100048017 | 3300005435 | Unclassified | 3629 |
| 60 | Ga0070714_100067282 | 3300005435 | Bacteria | 3088 |
| 61 | Ga0070714_100238236 | 3300005435 | Unclassified | 1679 |
| 62 | Ga0070713_100108983 | 3300005436 | Bacteria | 2412 |
| 63 | Ga0070713_100210965 | 3300005436 | Bacteria | 1758 |
| 64 | Ga0070713_101568210 | 3300005436 | Bacteria | 639 |
| 65 | Ga0070710_10026888 | 3300005437 | Unclassified | 3064 |
| 66 | Ga0070711_100049597 | 3300005439 | Bacteria | 2875 |
| 67 | Ga0070711_100291837 | 3300005439 | Bacteria | 1294 |
| 68 | Ga0070711_100654909 | 3300005439 | Bacteria | 881 |
| 69 | Ga0070705_100276861 | 3300005440 | Unclassified | 1191 |
| 70 | Ga0070705_100445621 | 3300005440 | Bacteria | 970 |
| 71 | Ga0070705_101343203 | 3300005440 | Unclassified | 594 |
| 72 | Ga0070694_100250825 | 3300005444 | Unclassified | 1339 |
| 73 | Ga0070694_100603521 | 3300005444 | Bacteria | 884 |
| 74 | Ga0070708_100146004 | 3300005445 | Unclassified | 2197 |
| 75 | Ga0070708_102110438 | 3300005445 | Unclassified | 521 |
| 76 | Ga0070663_100360518 | 3300005455 | Bacteria | 1179 |
| 77 | Ga0070678_100137445 | 3300005456 | Unclassified | 1951 |
| 78 | Ga0070662_100036046 | 3300005457 | Bacteria | 3497 |
| 79 | Ga0070662_100154443 | 3300005457 | Unclassified | 1790 |
| 80 | Ga0070681_10008575 | 3300005458 | Bacteria | 10016 |
| 81 | Ga0070681_10015594 | 3300005458 | Bacteria | 7568 |
| 82 | Ga0070681_10046181 | 3300005458 | Bacteria | 4355 |
| 83 | Ga0070681_10186958 | 3300005458 | Bacteria | 1992 |
| 84 | Ga0070681_10235636 | 3300005458 | Unclassified | 1744 |
| 85 | Ga0070681_10288102 | 3300005458 | Bacteria | 1553 |
| 86 | Ga0070681_10299743 | 3300005458 | Bacteria | 1517 |
| 87 | Ga0070681_10800734 | 3300005458 | Unclassified | 859 |
| 88 | Ga0068867_100005572 | 3300005459 | Bacteria | 8920 |
| 89 | Ga0068867_100093076 | 3300005459 | Bacteria | 2290 |
| 90 | Ga0068867_100667512 | 3300005459 | Bacteria | 914 |
| 91 | Ga0068867_100777916 | 3300005459 | Bacteria | 852 |
| 92 | Ga0070706_100064219 | 3300005467 | Unclassified | 3393 |
| 93 | Ga0070706_100152926 | 3300005467 | Unclassified | 2154 |
| 94 | Ga0070707_100658794 | 3300005468 | Bacteria | 1009 |
| 95 | Ga0070707_101057716 | 3300005468 | Bacteria | 777 |
| 96 | Ga0070698_101823791 | 3300005471 | Bacteria | 561 |
| 97 | Ga0070699_100012164 | 3300005518 | Bacteria | 7427 |
| 98 | Ga0070699_100305666 | 3300005518 | Bacteria | 1427 |
| 99 | Ga0070679_100040984 | 3300005530 | Bacteria | 4609 |
| 100 | Ga0070679_100049582 | 3300005530 | Bacteria | 4181 |
| 101 | Ga0070679_100206472 | 3300005530 | Bacteria | 1929 |
| 102 | Ga0070679_100313845 | 3300005530 | Bacteria | 1517 |
| 103 | Ga0070679_100342935 | 3300005530 | Unclassified | 1442 |
| 104 | Ga0070679_100467399 | 3300005530 | Unclassified | 1206 |
| 105 | Ga0070679_101577942 | 3300005530 | Unclassified | 604 |
| 106 | Ga0070684_100072993 | 3300005535 | Bacteria | 3022 |
| 107 | Ga0070684_100202791 | 3300005535 | Bacteria | 1807 |
| 108 | Ga0070684_100217205 | 3300005535 | Unclassified | 1744 |
| 109 | Ga0070684_100245860 | 3300005535 | Unclassified | 1635 |
| 110 | Ga0070684_100284655 | 3300005535 | Bacteria | 1515 |
| 111 | Ga0070684_100439588 | 3300005535 | Bacteria | 1205 |
| 112 | Ga0070684_100862559 | 3300005535 | Bacteria | 848 |
| 113 | Ga0070684_101326550 | 3300005535 | Unclassified | 677 |
| 114 | Ga0070697_100016006 | 3300005536 | Bacteria | 5896 |
| 115 | Ga0070697_100347231 | 3300005536 | Unclassified | 1281 |
| 116 | Ga0070697_100367250 | 3300005536 | Bacteria | 1245 |
| 117 | Ga0070697_100672455 | 3300005536 | Bacteria | 912 |
| 118 | Ga0070697_101280403 | 3300005536 | Unclassified | 654 |
| 119 | Ga0068853_100582451 | 3300005539 | Bacteria | 1062 |
| 120 | Ga0068853_100675777 | 3300005539 | Bacteria | 984 |
| 121 | Ga0068853_101337001 | 3300005539 | Bacteria | 693 |
| 122 | Ga0070686_100201282 | 3300005544 | Unclassified | 1428 |
| 123 | Ga0070686_101488033 | 3300005544 | Unclassified | 570 |
| 124 | Ga0070695_100025319 | 3300005545 | Bacteria | 3663 |
| 125 | Ga0070695_100269446 | 3300005545 | Bacteria | 1247 |
| 126 | Ga0070695_101214386 | 3300005545 | Bacteria | 620 |
| 127 | Ga0070696_100001210 | 3300005546 | Bacteria | 16756 |
| 128 | Ga0070696_100094269 | 3300005546 | Unclassified | 2136 |
| 129 | Ga0070693_100172898 | 3300005547 | Bacteria | 1385 |
| 130 | Ga0070693_101099947 | 3300005547 | Bacteria | 606 |
| 131 | Ga0070665_100409824 | 3300005548 | Bacteria | 1364 |
| 132 | Ga0070665_100427863 | 3300005548 | Bacteria | 1333 |
| 133 | Ga0070665_100446507 | 3300005548 | Bacteria | 1303 |
| 134 | Ga0068855_100000151 | 3300005563 | Bacteria | 88133 |
| 135 | Ga0068855_100010918 | 3300005563 | Bacteria | 10963 |
| 136 | Ga0068855_100017859 | 3300005563 | Bacteria | 8526 |
| 137 | Ga0068855_100025976 | 3300005563 | Bacteria | 7005 |
| 138 | Ga0068855_100042280 | 3300005563 | Bacteria | 5399 |
| 139 | Ga0068855_100065294 | 3300005563 | Bacteria | 4243 |
| 140 | Ga0068855_100072180 | 3300005563 | Bacteria | 4013 |
| 141 | Ga0068855_100087433 | 3300005563 | Bacteria | 3602 |
| 142 | Ga0068855_100100591 | 3300005563 | Bacteria | 3328 |
| 143 | Ga0068855_100472093 | 3300005563 | Unclassified | 1366 |
| 144 | Ga0068855_101680624 | 3300005563 | Unclassified | 648 |
| 145 | Ga0070664_100001009 | 3300005564 | Bacteria | 22089 |
| 146 | Ga0070664_100111532 | 3300005564 | Bacteria | 2387 |
| 147 | Ga0070664_100179827 | 3300005564 | Bacteria | 1879 |
| 148 | Ga0070664_100193668 | 3300005564 | Unclassified | 1812 |
| 149 | Ga0068857_100000121 | 3300005577 | Bacteria | 46931 |
| 150 | Ga0068857_100004298 | 3300005577 | Bacteria | 12017 |
| 151 | Ga0068857_100026488 | 3300005577 | Bacteria | 5111 |
| 152 | Ga0068857_100031584 | 3300005577 | Bacteria | 4680 |
| 153 | Ga0068857_100116933 | 3300005577 | Bacteria | 2399 |
| 154 | Ga0068857_100162622 | 3300005577 | Unclassified | 2026 |
| 155 | Ga0068854_100020450 | 3300005578 | Bacteria | 4479 |
| 156 | Ga0068854_100094766 | 3300005578 | Bacteria | 2227 |
| 157 | Ga0068854_100160717 | 3300005578 | Unclassified | 1740 |
| 158 | Ga0068854_100588422 | 3300005578 | Bacteria | 948 |
| 159 | Ga0068854_100896702 | 3300005578 | Unclassified | 779 |
| 160 | Ga0068854_101069616 | 3300005578 | Unclassified | 717 |
| 161 | Ga0068856_100000119 | 3300005614 | Bacteria | 78324 |
| 162 | Ga0068856_100000735 | 3300005614 | Bacteria | 35512 |
| 163 | Ga0068856_100003101 | 3300005614 | Bacteria | 16968 |
| 164 | Ga0068856_100005370 | 3300005614 | Bacteria | 12631 |
| 165 | Ga0068856_100104896 | 3300005614 | Bacteria | 2821 |
| 166 | Ga0068856_100152066 | 3300005614 | Bacteria | 2324 |
| 167 | Ga0068856_100176386 | 3300005614 | Bacteria | 2149 |
| 168 | Ga0068856_100188191 | 3300005614 | Bacteria | 2078 |
| 169 | Ga0068856_100213106 | 3300005614 | Unclassified | 1947 |
| 170 | Ga0068856_100473431 | 3300005614 | Bacteria | 1273 |
| 171 | Ga0068856_100704711 | 3300005614 | Unclassified | 1030 |
| 172 | Ga0070702_100096426 | 3300005615 | Bacteria | 1805 |
| 173 | Ga0070702_100519309 | 3300005615 | Unclassified | 878 |
| 174 | Ga0070702_101096792 | 3300005615 | Bacteria | 636 |
| 175 | Ga0068852_100655159 | 3300005616 | Bacteria | 1058 |
| 176 | Ga0068852_100760022 | 3300005616 | Bacteria | 982 |
| 177 | Ga0068852_100818414 | 3300005616 | Bacteria | 946 |
| 178 | Ga0068859_100000415 | 3300005617 | Bacteria | 42515 |
| 179 | Ga0068859_100172739 | 3300005617 | Bacteria | 2243 |
| 180 | Ga0068859_100254457 | 3300005617 | Bacteria | 1847 |
| 181 | Ga0068859_100531129 | 3300005617 | Unclassified | 1271 |
| 182 | Ga0068859_100732096 | 3300005617 | Unclassified | 1079 |
| 183 | Ga0068859_100835072 | 3300005617 | Bacteria | 1008 |
| 184 | Ga0068864_100001353 | 3300005618 | Bacteria | 20389 |
| 185 | Ga0068864_100045482 | 3300005618 | Bacteria | 3766 |
| 186 | Ga0068864_100066790 | 3300005618 | Bacteria | 3122 |
| 187 | Ga0068864_100373628 | 3300005618 | Unclassified | 1350 |
| 188 | Ga0068864_101214695 | 3300005618 | Bacteria | 753 |
| 189 | Ga0068866_10001235 | 3300005718 | Bacteria | 11081 |
| 190 | Ga0068866_10051523 | 3300005718 | Bacteria | 2096 |
| 191 | Ga0068866_10465404 | 3300005718 | Bacteria | 830 |
| 192 | Ga0068861_100826992 | 3300005719 | Bacteria | 871 |
| 193 | Ga0068861_101732483 | 3300005719 | Bacteria | 618 |
| 194 | Ga0068870_10122968 | 3300005840 | Bacteria | 1497 |
| 195 | Ga0068863_100012184 | 3300005841 | Bacteria | 8305 |
| 196 | Ga0068863_100244731 | 3300005841 | Bacteria | 1732 |
| 197 | Ga0068863_100853159 | 3300005841 | Bacteria | 910 |
| 198 | Ga0068863_100947889 | 3300005841 | Bacteria | 862 |
| 199 | Ga0068858_100001756 | 3300005842 | Bacteria | 22108 |
| 200 | Ga0068858_100002944 | 3300005842 | Bacteria | 17125 |
| 201 | Ga0068858_100029443 | 3300005842 | Bacteria | 5099 |
| 202 | Ga0068858_100030314 | 3300005842 | Bacteria | 5022 |
| 203 | Ga0068858_100066403 | 3300005842 | Unclassified | 3339 |
| 204 | Ga0068858_100193802 | 3300005842 | Unclassified | 1920 |
| 205 | Ga0068858_100538773 | 3300005842 | Bacteria | 1130 |
| 206 | Ga0068858_100571175 | 3300005842 | Unclassified | 1096 |
| 207 | Ga0068860_100040407 | 3300005843 | Bacteria | 4458 |
| 208 | Ga0068860_100047838 | 3300005843 | Bacteria | 4076 |
| 209 | Ga0068860_100064485 | 3300005843 | Bacteria | 3479 |
| 210 | Ga0068860_100324231 | 3300005843 | Unclassified | 1512 |
| 211 | Ga0068860_101168585 | 3300005843 | Unclassified | 790 |
| 212 | Ga0068862_101190671 | 3300005844 | Unclassified | 760 |
| 213 | Ga0081540_1025365 | 3300005983 | Bacteria | 3412 |
| 214 | Ga0070717_10000964 | 3300006028 | Bacteria | 19200 |
| 215 | Ga0070717_10031513 | 3300006028 | Bacteria | 4266 |
| 216 | Ga0070717_10038841 | 3300006028 | Bacteria | 3870 |
| 217 | Ga0070717_10225872 | 3300006028 | Bacteria | 1647 |
| 218 | Ga0070717_12110205 | 3300006028 | Unclassified | 507 |
| 219 | Ga0070715_10030273 | 3300006163 | Bacteria | 2187 |
| 220 | Ga0070715_10756531 | 3300006163 | Unclassified | 586 |
| 221 | Ga0070716_100013191 | 3300006173 | Bacteria | 4208 |
| 222 | Ga0070716_100679363 | 3300006173 | Bacteria | 784 |
| 223 | Ga0070716_100794311 | 3300006173 | Unclassified | 732 |
| 224 | Ga0097621_100000073 | 3300006237 | Bacteria | 52012 |
| 225 | Ga0097621_100001536 | 3300006237 | Bacteria | 15817 |
| 226 | Ga0097621_100045384 | 3300006237 | Bacteria | 3549 |
| 227 | Ga0097621_100053414 | 3300006237 | Bacteria | 3294 |
| 228 | Ga0097621_100053609 | 3300006237 | Bacteria | 3287 |
| 229 | Ga0097621_100744980 | 3300006237 | Unclassified | 905 |
| 230 | Ga0097621_100947316 | 3300006237 | Unclassified | 803 |
| 231 | Ga0097621_101364691 | 3300006237 | Bacteria | 671 |
| 232 | Ga0068871_100000258 | 3300006358 | Bacteria | 36543 |
| 233 | Ga0068871_100000932 | 3300006358 | Bacteria | 19540 |
| 234 | Ga0068871_100131493 | 3300006358 | Unclassified | 2122 |
| 235 | Ga0068871_100235455 | 3300006358 | Unclassified | 1590 |
| 236 | Ga0068871_100263619 | 3300006358 | Bacteria | 1504 |
| 237 | Ga0068871_100286378 | 3300006358 | Unclassified | 1442 |
| 238 | Ga0068871_100332643 | 3300006358 | Unclassified | 1340 |
| 239 | Ga0068871_100395697 | 3300006358 | Bacteria | 1230 |
| 240 | Ga0068871_100480215 | 3300006358 | Unclassified | 1118 |
| 241 | Ga0068871_100784342 | 3300006358 | Unclassified | 877 |
| 242 | Ga0075431_101128561 | 3300006847 | Unclassified | 748 |
| 243 | Ga0075433_10000203 | 3300006852 | Bacteria | 33282 |
| 244 | Ga0075434_100000016 | 3300006871 | Bacteria | 75294 |
| 245 | Ga0075434_100779867 | 3300006871 | Bacteria | 972 |
| 246 | Ga0068865_100010820 | 3300006881 | Bacteria | 5692 |
| 247 | Ga0068865_100061318 | 3300006881 | Bacteria | 2636 |
| 248 | Ga0068865_100135800 | 3300006881 | Bacteria | 1848 |
| 249 | Ga0068865_100140494 | 3300006881 | Unclassified | 1820 |
| 250 | Ga0075436_100000459 | 3300006914 | Bacteria | 26338 |
| 251 | Ga0075436_100001267 | 3300006914 | Bacteria | 17156 |
| 252 | Ga0075436_100002867 | 3300006914 | Bacteria | 11813 |
| 253 | Ga0075436_100707132 | 3300006914 | Bacteria | 747 |
| 254 | Ga0075436_100754662 | 3300006914 | Unclassified | 723 |
| 255 | Ga0097620_100000415 | 3300006931 | Bacteria | 42515 |
| 256 | Ga0097620_100172739 | 3300006931 | Bacteria | 2243 |
| 257 | Ga0097620_100254442 | 3300006931 | Bacteria | 1847 |
| 258 | Ga0097620_100531146 | 3300006931 | Unclassified | 1271 |
| 259 | Ga0097620_100732077 | 3300006931 | Unclassified | 1079 |
| 260 | Ga0097620_100835014 | 3300006931 | Bacteria | 1008 |
| 261 | Ga0075435_100000506 | 3300007076 | Bacteria | 23788 |
| 262 | Ga0075435_100055926 | 3300007076 | Unclassified | 3189 |
| 263 | Ga0075435_100218484 | 3300007076 | Unclassified | 1618 |
| 264 | Ga0075435_100694859 | 3300007076 | Unclassified | 884 |
| 265 | Ga0105240_10002859 | 3300009093 | Bacteria | 27290 |
| 266 | Ga0105240_10011668 | 3300009093 | Bacteria | 12212 |
| 267 | Ga0105240_10055622 | 3300009093 | Bacteria | 4954 |
| 268 | Ga0105240_10074432 | 3300009093 | Bacteria | 4192 |
| 269 | Ga0105240_10126413 | 3300009093 | Unclassified | 3072 |
| 270 | Ga0105240_10149958 | 3300009093 | Bacteria | 2778 |
| 271 | Ga0105240_10152022 | 3300009093 | Bacteria | 2756 |
| 272 | Ga0105240_10163889 | 3300009093 | Unclassified | 2638 |
| 273 | Ga0105240_10225186 | 3300009093 | Bacteria | 2182 |
| 274 | Ga0105240_10266938 | 3300009093 | Bacteria | 1972 |
| 275 | Ga0105240_10505847 | 3300009093 | Bacteria | 1343 |
| 276 | Ga0105240_10963439 | 3300009093 | Unclassified | 914 |
| 277 | Ga0105240_11080391 | 3300009093 | Unclassified | 855 |
| 278 | Ga0105240_11111378 | 3300009093 | Unclassified | 840 |
| 279 | Ga0105240_11896834 | 3300009093 | Unclassified | 620 |
| 280 | Ga0111539_11336227 | 3300009094 | Bacteria | 832 |
| 281 | Ga0105245_10018588 | 3300009098 | Bacteria | 6079 |
| 282 | Ga0105245_10138886 | 3300009098 | Bacteria | 2287 |
| 283 | Ga0105245_10447635 | 3300009098 | Bacteria | 1299 |
| 284 | Ga0105245_10607340 | 3300009098 | Unclassified | 1121 |
| 285 | Ga0105245_10675867 | 3300009098 | Bacteria | 1064 |
| 286 | Ga0105245_10800632 | 3300009098 | Unclassified | 980 |
| 287 | Ga0105245_10954363 | 3300009098 | Bacteria | 901 |
| 288 | Ga0105245_11327280 | 3300009098 | Unclassified | 769 |
| 289 | Ga0105245_11467994 | 3300009098 | Bacteria | 732 |
| 290 | Ga0105245_11684623 | 3300009098 | Bacteria | 686 |
| 291 | Ga0105245_11730465 | 3300009098 | Unclassified | 678 |
| 292 | Ga0105245_11799322 | 3300009098 | Unclassified | 665 |
| 293 | Ga0105247_10455044 | 3300009101 | Unclassified | 924 |
| 294 | Ga0114129_10759829 | 3300009147 | Bacteria | 1240 |
| 295 | Ga0105243_10137707 | 3300009148 | Unclassified | 2079 |
| 296 | Ga0105243_10915486 | 3300009148 | Unclassified | 873 |
| 297 | Ga0105241_10024522 | 3300009174 | Bacteria | 4479 |
| 298 | Ga0105241_10051100 | 3300009174 | Bacteria | 3151 |
| 299 | Ga0105241_10096184 | 3300009174 | Bacteria | 2345 |
| 300 | Ga0105241_10280535 | 3300009174 | Bacteria | 1423 |
| 301 | Ga0105241_10349158 | 3300009174 | Bacteria | 1284 |
| 302 | Ga0105241_10451776 | 3300009174 | Bacteria | 1137 |
| 303 | Ga0105241_10636674 | 3300009174 | Unclassified | 967 |
| 304 | Ga0105241_10653210 | 3300009174 | Unclassified | 955 |
| 305 | Ga0105241_10697188 | 3300009174 | Unclassified | 927 |
| 306 | Ga0105241_11337663 | 3300009174 | Unclassified | 684 |
| 307 | Ga0105241_11378370 | 3300009174 | Bacteria | 674 |
| 308 | Ga0105242_10051667 | 3300009176 | Bacteria | 3350 |
| 309 | Ga0105242_10128723 | 3300009176 | Unclassified | 2182 |
| 310 | Ga0105242_10180895 | 3300009176 | Bacteria | 1860 |
| 311 | Ga0105242_10265127 | 3300009176 | Unclassified | 1553 |
| 312 | Ga0105242_10358027 | 3300009176 | Bacteria | 1350 |
| 313 | Ga0105242_10458144 | 3300009176 | Unclassified | 1204 |
| 314 | Ga0105242_10583780 | 3300009176 | Bacteria | 1077 |
| 315 | Ga0105242_10786875 | 3300009176 | Bacteria | 940 |
| 316 | Ga0105242_10908710 | 3300009176 | Bacteria | 881 |
| 317 | Ga0105248_10003718 | 3300009177 | Bacteria | 16919 |
| 318 | Ga0105248_10022851 | 3300009177 | Bacteria | 6943 |
| 319 | Ga0105248_10050489 | 3300009177 | Bacteria | 4665 |
| 320 | Ga0105248_10069163 | 3300009177 | Bacteria | 3964 |
| 321 | Ga0105248_10082903 | 3300009177 | Bacteria | 3607 |
| 322 | Ga0105248_10316600 | 3300009177 | Unclassified | 1757 |
| 323 | Ga0105248_10359047 | 3300009177 | Bacteria | 1640 |
| 324 | Ga0105248_11443114 | 3300009177 | Unclassified | 779 |
| 325 | Ga0105237_10030803 | 3300009545 | Bacteria | 5445 |
| 326 | Ga0105237_10059246 | 3300009545 | Bacteria | 3831 |
| 327 | Ga0105237_10192802 | 3300009545 | Unclassified | 2037 |
| 328 | Ga0105237_10244406 | 3300009545 | Unclassified | 1796 |
| 329 | Ga0105237_10456339 | 3300009545 | Unclassified | 1284 |
| 330 | Ga0105237_10773254 | 3300009545 | Bacteria | 967 |
| 331 | Ga0105238_10000497 | 3300009551 | Bacteria | 41307 |
| 332 | Ga0105238_10033919 | 3300009551 | Bacteria | 5194 |
| 333 | Ga0105238_10067929 | 3300009551 | Bacteria | 3565 |
| 334 | Ga0105238_10071243 | 3300009551 | Bacteria | 3473 |
| 335 | Ga0105238_10183731 | 3300009551 | Bacteria | 2068 |
| 336 | Ga0105238_10207556 | 3300009551 | Unclassified | 1935 |
| 337 | Ga0105238_10528402 | 3300009551 | Bacteria | 1183 |
| 338 | Ga0105238_11604236 | 3300009551 | Bacteria | 681 |
| 339 | Ga0105249_10218529 | 3300009553 | Bacteria | 1874 |
| 340 | Ga0105249_12043156 | 3300009553 | Bacteria | 646 |
| 341 | Ga0105239_10005844 | 3300010375 | Bacteria | 14340 |
| 342 | Ga0105239_10008299 | 3300010375 | Bacteria | 11837 |
| 343 | Ga0105239_10028421 | 3300010375 | Bacteria | 6151 |
| 344 | Ga0105239_10074153 | 3300010375 | Bacteria | 3742 |
| 345 | Ga0105239_10125966 | 3300010375 | Bacteria | 2847 |
| 346 | Ga0105239_10129667 | 3300010375 | Unclassified | 2804 |
| 347 | Ga0105239_10261588 | 3300010375 | Bacteria | 1945 |
| 348 | Ga0105239_10462414 | 3300010375 | Unclassified | 1440 |
| 349 | Ga0105246_10124900 | 3300011119 | Bacteria | 1913 |
| 350 | Ga0105246_10167946 | 3300011119 | Bacteria | 1677 |
| 351 | Ga0105246_10691381 | 3300011119 | Unclassified | 893 |
| 352 | Ga0105246_11357212 | 3300011119 | Bacteria | 661 |
| 353 | Ga0157373_10101562 | 3300013100 | Bacteria | 2023 |
| 354 | Ga0157373_10136753 | 3300013100 | Bacteria | 1723 |
| 355 | Ga0157373_10646498 | 3300013100 | Bacteria | 772 |
| 356 | Ga0157371_10037166 | 3300013102 | Bacteria | 3486 |
| 357 | Ga0157371_10121215 | 3300013102 | Bacteria | 1859 |
| 358 | Ga0157371_11004229 | 3300013102 | Unclassified | 637 |
| 359 | Ga0157370_10000944 | 3300013104 | Bacteria | 36878 |
| 360 | Ga0157370_10024274 | 3300013104 | Bacteria | 6006 |
| 361 | Ga0157370_10029683 | 3300013104 | Bacteria | 5363 |
| 362 | Ga0157370_10041967 | 3300013104 | Bacteria | 4410 |
| 363 | Ga0157370_10212700 | 3300013104 | Unclassified | 1792 |
| 364 | Ga0157370_11240894 | 3300013104 | Unclassified | 672 |
| 365 | Ga0157369_10000108 | 3300013105 | Bacteria | 117027 |
| 366 | Ga0157369_10000788 | 3300013105 | Bacteria | 40686 |
| 367 | Ga0157369_10025124 | 3300013105 | Bacteria | 6616 |
| 368 | Ga0157369_10028125 | 3300013105 | Bacteria | 6224 |
| 369 | Ga0157369_10068636 | 3300013105 | Bacteria | 3809 |
| 370 | Ga0157369_10255562 | 3300013105 | Bacteria | 1828 |
| 371 | Ga0157369_10353424 | 3300013105 | Unclassified | 1526 |
| 372 | Ga0157374_10001477 | 3300013296 | Bacteria | 19860 |
| 373 | Ga0157374_10007082 | 3300013296 | Bacteria | 9549 |
| 374 | Ga0157374_10034864 | 3300013296 | Unclassified | 4601 |
| 375 | Ga0157374_10107114 | 3300013296 | Bacteria | 2686 |
| 376 | Ga0157374_10889543 | 3300013296 | Bacteria | 908 |
| 377 | Ga0157374_10925980 | 3300013296 | Unclassified | 890 |
| 378 | Ga0157374_12571566 | 3300013296 | Bacteria | 537 |
| 379 | Ga0157378_10000030 | 3300013297 | Bacteria | 124811 |
| 380 | Ga0157378_10000099 | 3300013297 | Bacteria | 81561 |
| 381 | Ga0157378_10027391 | 3300013297 | Bacteria | 5029 |
| 382 | Ga0157378_10033299 | 3300013297 | Bacteria | 4555 |
| 383 | Ga0157378_10821145 | 3300013297 | Bacteria | 956 |
| 384 | Ga0157378_11143870 | 3300013297 | Bacteria | 816 |
| 385 | Ga0157378_11233450 | 3300013297 | Unclassified | 788 |
| 386 | Ga0157378_11559682 | 3300013297 | Bacteria | 706 |
| 387 | Ga0163162_10351169 | 3300013306 | Unclassified | 1607 |
| 388 | Ga0163162_10469492 | 3300013306 | Unclassified | 1390 |
| 389 | Ga0163162_10573224 | 3300013306 | Bacteria | 1256 |
| 390 | Ga0163162_11469449 | 3300013306 | Unclassified | 776 |
| 391 | Ga0163162_11517565 | 3300013306 | Bacteria | 763 |
| 392 | Ga0163162_11718973 | 3300013306 | Bacteria | 717 |
| 393 | Ga0163162_12812770 | 3300013306 | Unclassified | 560 |
| 394 | Ga0157372_10000218 | 3300013307 | Bacteria | 63626 |
| 395 | Ga0157372_10000576 | 3300013307 | Bacteria | 40151 |
| 396 | Ga0157372_10003314 | 3300013307 | Bacteria | 17396 |
| 397 | Ga0157372_10018887 | 3300013307 | Bacteria | 7418 |
| 398 | Ga0157372_10347598 | 3300013307 | Unclassified | 1728 |
| 399 | Ga0157372_11366814 | 3300013307 | Unclassified | 817 |
| 400 | Ga0157372_11543121 | 3300013307 | Bacteria | 765 |
| 401 | Ga0157375_10343291 | 3300013308 | Bacteria | 1658 |
| 402 | Ga0157375_10468911 | 3300013308 | Unclassified | 1424 |
| 403 | Ga0157375_10768762 | 3300013308 | Bacteria | 1113 |
| 404 | Ga0157375_11207331 | 3300013308 | Bacteria | 887 |
| 405 | Ga0157375_11541638 | 3300013308 | Bacteria | 785 |
| 406 | Ga0163163_10003193 | 3300014325 | Bacteria | 13888 |
| 407 | Ga0163163_10126344 | 3300014325 | Bacteria | 2595 |
| 408 | Ga0163163_10296747 | 3300014325 | Bacteria | 1668 |
| 409 | Ga0163163_10414130 | 3300014325 | Bacteria | 1406 |
| 410 | Ga0163163_10820960 | 3300014325 | Bacteria | 993 |
| 411 | Ga0163163_10922272 | 3300014325 | Viruses | 937 |
| 412 | Ga0163163_11588391 | 3300014325 | Unclassified | 715 |
| 413 | Ga0157380_11278834 | 3300014326 | Bacteria | 780 |
| 414 | Ga0182008_10279655 | 3300014497 | Bacteria | 868 |
| 415 | Ga0157377_10522872 | 3300014745 | Bacteria | 833 |
| 416 | Ga0157379_10057957 | 3300014968 | Bacteria | 3461 |
| 417 | Ga0157379_11597250 | 3300014968 | Bacteria | 637 |
| 418 | Ga0157376_10159329 | 3300014969 | Bacteria | 2044 |
| 419 | Ga0157376_10300887 | 3300014969 | Unclassified | 1518 |
| 420 | Ga0157376_10430725 | 3300014969 | Unclassified | 1282 |
| 421 | Ga0157376_10997675 | 3300014969 | Unclassified | 860 |
| 422 | Ga0182006_1009694 | 3300015261 | Bacteria | 4307 |
| 423 | Ga0182007_10035405 | 3300015262 | Bacteria | 1682 |
| 424 | Ga0163161_10908819 | 3300017792 | Bacteria | 746 |
| 425 | Ga0184603_118414 | 3300019192 | Bacteria | 515 |
| 426 | Ga0197907_10817353 | 3300020069 | Bacteria | 504 |
| 427 | Ga0206356_10589427 | 3300020070 | Unclassified | 736 |
| 428 | Ga0213876_10145779 | 3300021384 | Unclassified | 1259 |
| 429 | Ga0213876_10343582 | 3300021384 | Unclassified | 794 |
| 430 | Ga0213875_10000008 | 3300021388 | Bacteria | 533344 |
| 431 | Ga0213875_10003390 | 3300021388 | Bacteria | 9075 |
| 432 | Ga0213875_10230615 | 3300021388 | Unclassified | 872 |
| 433 | Ga0213875_10592503 | 3300021388 | Unclassified | 535 |
| 434 | Ga0224712_10054675 | 3300022467 | Bacteria | 1568 |
| 435 | Ga0207692_10061557 | 3300025898 | Bacteria | 1945 |
| 436 | Ga0207692_10177530 | 3300025898 | Bacteria | 1239 |
| 437 | Ga0207642_10002153 | 3300025899 | Bacteria | 6104 |
| 438 | Ga0207642_10069655 | 3300025899 | Unclassified | 1669 |
| 439 | Ga0207710_10078754 | 3300025900 | Unclassified | 1525 |
| 440 | Ga0207688_10895023 | 3300025901 | Unclassified | 562 |
| 441 | Ga0207680_10004915 | 3300025903 | Bacteria | 6363 |
| 442 | Ga0207680_10305859 | 3300025903 | Bacteria | 1109 |
| 443 | Ga0207680_10598216 | 3300025903 | Unclassified | 789 |
| 444 | Ga0207647_10036752 | 3300025904 | Bacteria | 3110 |
| 445 | Ga0207685_10011090 | 3300025905 | Bacteria | 2694 |
| 446 | Ga0207699_10004846 | 3300025906 | Bacteria | 6438 |
| 447 | Ga0207699_10224593 | 3300025906 | Bacteria | 1284 |
| 448 | Ga0207643_10062713 | 3300025908 | Bacteria | 2124 |
| 449 | Ga0207705_10029996 | 3300025909 | Bacteria | 3880 |
| 450 | Ga0207705_10088826 | 3300025909 | Bacteria | 2261 |
| 451 | Ga0207705_10319983 | 3300025909 | Unclassified | 1192 |
| 452 | Ga0207705_10426277 | 3300025909 | Unclassified | 1027 |
| 453 | Ga0207684_10307436 | 3300025910 | Unclassified | 1367 |
| 454 | Ga0207684_10942292 | 3300025910 | Bacteria | 724 |
| 455 | Ga0207654_10011466 | 3300025911 | Bacteria | 4523 |
| 456 | Ga0207654_10080529 | 3300025911 | Unclassified | 1958 |
| 457 | Ga0207654_10199344 | 3300025911 | Bacteria | 1317 |
| 458 | Ga0207654_10414551 | 3300025911 | Unclassified | 939 |
| 459 | Ga0207654_10474055 | 3300025911 | Unclassified | 881 |
| 460 | Ga0207654_10633397 | 3300025911 | Unclassified | 765 |
| 461 | Ga0207654_10778137 | 3300025911 | Unclassified | 690 |
| 462 | Ga0207707_10001130 | 3300025912 | Bacteria | 25296 |
| 463 | Ga0207707_10003004 | 3300025912 | Bacteria | 14996 |
| 464 | Ga0207707_10013950 | 3300025912 | Bacteria | 7005 |
| 465 | Ga0207707_10051604 | 3300025912 | Bacteria | 3582 |
| 466 | Ga0207707_10058678 | 3300025912 | Bacteria | 3349 |
| 467 | Ga0207707_10065705 | 3300025912 | Bacteria | 3159 |
| 468 | Ga0207707_10110376 | 3300025912 | Bacteria | 2404 |
| 469 | Ga0207707_10305232 | 3300025912 | Bacteria | 1376 |
| 470 | Ga0207707_10420784 | 3300025912 | Bacteria | 1145 |
| 471 | Ga0207707_10672798 | 3300025912 | Bacteria | 871 |
| 472 | Ga0207695_10005972 | 3300025913 | Bacteria | 15924 |
| 473 | Ga0207695_10030294 | 3300025913 | Bacteria | 5959 |
| 474 | Ga0207695_10036038 | 3300025913 | Bacteria | 5353 |
| 475 | Ga0207695_10080344 | 3300025913 | Bacteria | 3302 |
| 476 | Ga0207695_10191675 | 3300025913 | Bacteria | 1962 |
| 477 | Ga0207695_10258296 | 3300025913 | Unclassified | 1640 |
| 478 | Ga0207695_10264046 | 3300025913 | Bacteria | 1618 |
| 479 | Ga0207695_10349043 | 3300025913 | Unclassified | 1367 |
| 480 | Ga0207695_10937945 | 3300025913 | Bacteria | 745 |
| 481 | Ga0207671_10026181 | 3300025914 | Bacteria | 4373 |
| 482 | Ga0207671_10279347 | 3300025914 | Unclassified | 1317 |
| 483 | Ga0207671_10423196 | 3300025914 | Unclassified | 1060 |
| 484 | Ga0207671_10479775 | 3300025914 | Bacteria | 991 |
| 485 | Ga0207693_10031852 | 3300025915 | Unclassified | 4166 |
| 486 | Ga0207693_10351606 | 3300025915 | Bacteria | 1153 |
| 487 | Ga0207693_10941343 | 3300025915 | Unclassified | 662 |
| 488 | Ga0207693_10942109 | 3300025915 | Bacteria | 661 |
| 489 | Ga0207663_10026767 | 3300025916 | Bacteria | 3352 |
| 490 | Ga0207663_10175750 | 3300025916 | Bacteria | 1525 |
| 491 | Ga0207663_10325424 | 3300025916 | Bacteria | 1156 |
| 492 | Ga0207663_10882148 | 3300025916 | Bacteria | 715 |
| 493 | Ga0207660_10031472 | 3300025917 | Bacteria | 3655 |
| 494 | Ga0207660_10145553 | 3300025917 | Bacteria | 1816 |
| 495 | Ga0207660_10325393 | 3300025917 | Bacteria | 1228 |
| 496 | Ga0207660_10346657 | 3300025917 | Bacteria | 1190 |
| 497 | Ga0207657_10001039 | 3300025919 | Bacteria | 29386 |
| 498 | Ga0207657_10211729 | 3300025919 | Bacteria | 1555 |
| 499 | Ga0207657_10324397 | 3300025919 | Unclassified | 1217 |
| 500 | Ga0207657_10931894 | 3300025919 | Bacteria | 668 |
| 501 | Ga0207649_10060976 | 3300025920 | Bacteria | 2372 |
| 502 | Ga0207652_10050077 | 3300025921 | Unclassified | 3578 |
| 503 | Ga0207652_10056104 | 3300025921 | Bacteria | 3390 |
| 504 | Ga0207652_10344626 | 3300025921 | Bacteria | 1345 |
| 505 | Ga0207652_10440044 | 3300025921 | Bacteria | 1175 |
| 506 | Ga0207652_10484184 | 3300025921 | Bacteria | 1114 |
| 507 | Ga0207694_10000864 | 3300025924 | Bacteria | 26978 |
| 508 | Ga0207694_10006080 | 3300025924 | Bacteria | 9228 |
| 509 | Ga0207694_10071633 | 3300025924 | Bacteria | 2709 |
| 510 | Ga0207694_10221607 | 3300025924 | Bacteria | 1543 |
| 511 | Ga0207694_10318201 | 3300025924 | Bacteria | 1284 |
| 512 | Ga0207694_10367811 | 3300025924 | Unclassified | 1192 |
| 513 | Ga0207694_11225399 | 3300025924 | Unclassified | 635 |
| 514 | Ga0207650_10003703 | 3300025925 | Bacteria | 10449 |
| 515 | Ga0207659_10157442 | 3300025926 | Bacteria | 1780 |
| 516 | Ga0207659_10266856 | 3300025926 | Bacteria | 1395 |
| 517 | Ga0207687_10001617 | 3300025927 | Bacteria | 15514 |
| 518 | Ga0207687_10020606 | 3300025927 | Bacteria | 4376 |
| 519 | Ga0207687_10239296 | 3300025927 | Bacteria | 1438 |
| 520 | Ga0207687_10301882 | 3300025927 | Bacteria | 1290 |
| 521 | Ga0207687_10367417 | 3300025927 | Bacteria | 1176 |
| 522 | Ga0207687_10436811 | 3300025927 | Unclassified | 1083 |
| 523 | Ga0207687_11166020 | 3300025927 | Bacteria | 662 |
| 524 | Ga0207700_10010317 | 3300025928 | Bacteria | 5886 |
| 525 | Ga0207700_10065618 | 3300025928 | Unclassified | 2770 |
| 526 | Ga0207700_10118302 | 3300025928 | Bacteria | 2144 |
| 527 | Ga0207700_10256924 | 3300025928 | Bacteria | 1494 |
| 528 | Ga0207700_10261079 | 3300025928 | Bacteria | 1483 |
| 529 | Ga0207700_10692226 | 3300025928 | Bacteria | 910 |
| 530 | Ga0207664_10052997 | 3300025929 | Bacteria | 3209 |
| 531 | Ga0207664_10088924 | 3300025929 | Unclassified | 2528 |
| 532 | Ga0207664_10098070 | 3300025929 | Bacteria | 2416 |
| 533 | Ga0207664_10247446 | 3300025929 | Unclassified | 1555 |
| 534 | Ga0207644_10124014 | 3300025931 | Bacteria | 1970 |
| 535 | Ga0207644_10939082 | 3300025931 | Unclassified | 725 |
| 536 | Ga0207690_10111658 | 3300025932 | Unclassified | 1970 |
| 537 | Ga0207706_10041282 | 3300025933 | Bacteria | 4090 |
| 538 | Ga0207706_10059041 | 3300025933 | Bacteria | 3378 |
| 539 | Ga0207686_10021731 | 3300025934 | Bacteria | 3687 |
| 540 | Ga0207686_10050845 | 3300025934 | Bacteria | 2579 |
| 541 | Ga0207686_10075785 | 3300025934 | Unclassified | 2179 |
| 542 | Ga0207686_10168493 | 3300025934 | Bacteria | 1542 |
| 543 | Ga0207686_10275895 | 3300025934 | Unclassified | 1239 |
| 544 | Ga0207686_10365162 | 3300025934 | Bacteria | 1091 |
| 545 | Ga0207686_11126482 | 3300025934 | Unclassified | 640 |
| 546 | Ga0207709_10033070 | 3300025935 | Bacteria | 3033 |
| 547 | Ga0207709_10816363 | 3300025935 | Unclassified | 753 |
| 548 | Ga0207670_10049345 | 3300025936 | Unclassified | 2815 |
| 549 | Ga0207670_10948948 | 3300025936 | Bacteria | 722 |
| 550 | Ga0207704_10005386 | 3300025938 | Bacteria | 5897 |
| 551 | Ga0207704_10053592 | 3300025938 | Unclassified | 2453 |
| 552 | Ga0207704_11517537 | 3300025938 | Unclassified | 575 |
| 553 | Ga0207665_10005780 | 3300025939 | Bacteria | 8227 |
| 554 | Ga0207665_10078549 | 3300025939 | Unclassified | 2267 |
| 555 | Ga0207665_10372921 | 3300025939 | Bacteria | 1081 |
| 556 | Ga0207665_10471540 | 3300025939 | Unclassified | 966 |
| 557 | Ga0207691_11092354 | 3300025940 | Bacteria | 664 |
| 558 | Ga0207711_10010118 | 3300025941 | Bacteria | 7835 |
| 559 | Ga0207711_10136868 | 3300025941 | Unclassified | 2200 |
| 560 | Ga0207711_10189255 | 3300025941 | Unclassified | 1875 |
| 561 | Ga0207711_10197481 | 3300025941 | Bacteria | 1835 |
| 562 | Ga0207711_11196554 | 3300025941 | Unclassified | 701 |
| 563 | Ga0207689_10042194 | 3300025942 | Bacteria | 3775 |
| 564 | Ga0207689_10221253 | 3300025942 | Bacteria | 1564 |
| 565 | Ga0207689_10277432 | 3300025942 | Bacteria | 1388 |
| 566 | Ga0207689_10523033 | 3300025942 | Bacteria | 995 |
| 567 | Ga0207689_10897352 | 3300025942 | Bacteria | 748 |
| 568 | Ga0207661_10239101 | 3300025944 | Bacteria | 1611 |
| 569 | Ga0207661_10266920 | 3300025944 | Bacteria | 1526 |
| 570 | Ga0207661_10362529 | 3300025944 | Bacteria | 1309 |
| 571 | Ga0207661_10546056 | 3300025944 | Bacteria | 1061 |
| 572 | Ga0207679_10046295 | 3300025945 | Bacteria | 3152 |
| 573 | Ga0207679_10058802 | 3300025945 | Bacteria | 2850 |
| 574 | Ga0207679_10231353 | 3300025945 | Bacteria | 1561 |
| 575 | Ga0207679_10721241 | 3300025945 | Bacteria | 906 |
| 576 | Ga0207679_10957655 | 3300025945 | Unclassified | 784 |
| 577 | Ga0207667_10003037 | 3300025949 | Bacteria | 20829 |
| 578 | Ga0207667_10012644 | 3300025949 | Bacteria | 9700 |
| 579 | Ga0207667_10021676 | 3300025949 | Bacteria | 7117 |
| 580 | Ga0207667_10036366 | 3300025949 | Bacteria | 5278 |
| 581 | Ga0207667_10042110 | 3300025949 | Bacteria | 4856 |
| 582 | Ga0207667_10343965 | 3300025949 | Unclassified | 1522 |
| 583 | Ga0207667_10641230 | 3300025949 | Bacteria | 1068 |
| 584 | Ga0207667_10671437 | 3300025949 | Unclassified | 1040 |
| 585 | Ga0207651_10469943 | 3300025960 | Bacteria | 1082 |
| 586 | Ga0207651_10576241 | 3300025960 | Bacteria | 981 |
| 587 | Ga0207651_10794431 | 3300025960 | Bacteria | 839 |
| 588 | Ga0207712_10231448 | 3300025961 | Bacteria | 1484 |
| 589 | Ga0207640_10002147 | 3300025981 | Bacteria | 10603 |
| 590 | Ga0207640_10088182 | 3300025981 | Bacteria | 2141 |
| 591 | Ga0207640_10232897 | 3300025981 | Bacteria | 1418 |
| 592 | Ga0207640_10370682 | 3300025981 | Unclassified | 1157 |
| 593 | Ga0207658_10669747 | 3300025986 | Unclassified | 936 |
| 594 | Ga0207677_10012343 | 3300026023 | Bacteria | 4907 |
| 595 | Ga0207677_10208523 | 3300026023 | Bacteria | 1559 |
| 596 | Ga0207677_10269512 | 3300026023 | Bacteria | 1392 |
| 597 | Ga0207677_10317495 | 3300026023 | Unclassified | 1293 |
| 598 | Ga0207677_10533689 | 3300026023 | Bacteria | 1020 |
| 599 | Ga0207677_10608972 | 3300026023 | Bacteria | 959 |
| 600 | Ga0207703_10008197 | 3300026035 | Bacteria | 8255 |
| 601 | Ga0207703_10018303 | 3300026035 | Bacteria | 5471 |
| 602 | Ga0207703_10068702 | 3300026035 | Bacteria | 2920 |
| 603 | Ga0207703_10473994 | 3300026035 | Bacteria | 1172 |
| 604 | Ga0207703_10988579 | 3300026035 | Bacteria | 807 |
| 605 | Ga0207703_11632435 | 3300026035 | Unclassified | 620 |
| 606 | Ga0207703_12189417 | 3300026035 | Unclassified | 529 |
| 607 | Ga0207639_10182795 | 3300026041 | Bacteria | 1785 |
| 608 | Ga0207639_10212706 | 3300026041 | Bacteria | 1665 |
| 609 | Ga0207639_10300737 | 3300026041 | Bacteria | 1418 |
| 610 | Ga0207639_10347622 | 3300026041 | Bacteria | 1324 |
| 611 | Ga0207639_10486777 | 3300026041 | Bacteria | 1125 |
| 612 | Ga0207639_10702478 | 3300026041 | Bacteria | 938 |
| 613 | Ga0207702_10000086 | 3300026078 | Bacteria | 106199 |
| 614 | Ga0207702_10000764 | 3300026078 | Bacteria | 34175 |
| 615 | Ga0207702_10001551 | 3300026078 | Bacteria | 22731 |
| 616 | Ga0207702_10060549 | 3300026078 | Bacteria | 3227 |
| 617 | Ga0207702_10076477 | 3300026078 | Unclassified | 2894 |
| 618 | Ga0207702_10126543 | 3300026078 | Bacteria | 2295 |
| 619 | Ga0207702_10137446 | 3300026078 | Bacteria | 2207 |
| 620 | Ga0207702_10260293 | 3300026078 | Bacteria | 1633 |
| 621 | Ga0207702_10354693 | 3300026078 | Unclassified | 1404 |
| 622 | Ga0207641_10044529 | 3300026088 | Bacteria | 3733 |
| 623 | Ga0207641_10096455 | 3300026088 | Bacteria | 2597 |
| 624 | Ga0207641_10977987 | 3300026088 | Bacteria | 842 |
| 625 | Ga0207641_11733735 | 3300026088 | Bacteria | 626 |
| 626 | Ga0207648_10010395 | 3300026089 | Bacteria | 8822 |
| 627 | Ga0207648_10078615 | 3300026089 | Bacteria | 2878 |
| 628 | Ga0207648_10126556 | 3300026089 | Bacteria | 2248 |
| 629 | Ga0207648_10199089 | 3300026089 | Bacteria | 1776 |
| 630 | Ga0207648_10604125 | 3300026089 | Bacteria | 1011 |
| 631 | Ga0207676_10007435 | 3300026095 | Bacteria | 7769 |
| 632 | Ga0207676_10028966 | 3300026095 | Bacteria | 4142 |
| 633 | Ga0207676_10771882 | 3300026095 | Unclassified | 936 |
| 634 | Ga0207676_10845005 | 3300026095 | Bacteria | 895 |
| 635 | Ga0207676_10880594 | 3300026095 | Bacteria | 877 |
| 636 | Ga0207674_10000281 | 3300026116 | Bacteria | 64232 |
| 637 | Ga0207674_10002923 | 3300026116 | Bacteria | 21216 |
| 638 | Ga0207674_10003767 | 3300026116 | Bacteria | 18504 |
| 639 | Ga0207674_10005414 | 3300026116 | Bacteria | 15175 |
| 640 | Ga0207674_10087427 | 3300026116 | Bacteria | 3110 |
| 641 | Ga0207674_10663714 | 3300026116 | Bacteria | 1007 |
| 642 | Ga0207683_10165829 | 3300026121 | Unclassified | 1999 |
| 643 | Ga0207683_10259963 | 3300026121 | Bacteria | 1585 |
| 644 | Ga0207698_10175167 | 3300026142 | Bacteria | 1893 |
| 645 | Ga0207698_10783760 | 3300026142 | Bacteria | 954 |
| 646 | Ga0207428_11225953 | 3300027907 | Unclassified | 521 |
| 647 | Ga0265354_1002668 | 3300028016 | Unclassified | 2161 |
| 648 | Ga0265354_1009161 | 3300028016 | Bacteria | 952 |
| 649 | Ga0268266_10048282 | 3300028379 | Unclassified | 3648 |
| 650 | Ga0268266_10150356 | 3300028379 | Unclassified | 2098 |
| 651 | Ga0268266_10367815 | 3300028379 | Bacteria | 1354 |
| 652 | Ga0268266_11030164 | 3300028379 | Unclassified | 796 |
| 653 | Ga0268265_10715355 | 3300028380 | Bacteria | 969 |
| 654 | Ga0268264_10035203 | 3300028381 | Bacteria | 4122 |
| 655 | Ga0268264_10231403 | 3300028381 | Unclassified | 1707 |
| 656 | Ga0268264_10232076 | 3300028381 | Bacteria | 1705 |
| 657 | Ga0268264_10293396 | 3300028381 | Bacteria | 1528 |
| 658 | Ga0268264_10527066 | 3300028381 | Unclassified | 1156 |
| 659 | Ga0268264_10655158 | 3300028381 | Unclassified | 1039 |
| 660 | Ga0268264_10729019 | 3300028381 | Bacteria | 986 |
| 661 | Ga0265318_10202923 | 3300028577 | Unclassified | 725 |
| 662 | Ga0265336_10034555 | 3300028666 | Bacteria | 1562 |
| 663 | Ga0265338_10012644 | 3300028800 | Bacteria | 9610 |
| 664 | Ga0265338_10079554 | 3300028800 | Unclassified | 2758 |
| 665 | Ga0265338_10127337 | 3300028800 | Unclassified | 2018 |
| 666 | Ga0265338_10908303 | 3300028800 | Unclassified | 599 |
| 667 | Ga0265324_10023178 | 3300029957 | Bacteria | 2213 |
| 668 | Ga0265779_112912 | 3300031043 | Unclassified | 533 |
| 669 | Ga0265760_10000817 | 3300031090 | Bacteria | 8977 |
| 670 | Ga0265760_10007880 | 3300031090 | Bacteria | 3043 |
| 671 | Ga0265760_10045693 | 3300031090 | Archaea | 1313 |
| 672 | Ga0265760_10299426 | 3300031090 | Unclassified | 569 |
| 673 | Ga0265330_10106803 | 3300031235 | Bacteria | 1197 |
| 674 | Ga0265332_10018593 | 3300031238 | Bacteria | 3066 |
| 675 | Ga0265328_10009924 | 3300031239 | Bacteria | 3852 |
| 676 | Ga0265320_10059887 | 3300031240 | Bacteria | 1819 |
| 677 | Ga0265325_10028309 | 3300031241 | Bacteria | 3021 |
| 678 | Ga0265325_10069949 | 3300031241 | Unclassified | 1764 |
| 679 | Ga0265340_10037949 | 3300031247 | Bacteria | 2385 |
| 680 | Ga0265339_10115353 | 3300031249 | Unclassified | 1386 |
| 681 | Ga0265331_10002235 | 3300031250 | Bacteria | 13252 |
| 682 | Ga0265331_10048448 | 3300031250 | Unclassified | 2043 |
| 683 | Ga0265327_10156072 | 3300031251 | Bacteria | 1057 |
| 684 | Ga0265316_10004839 | 3300031344 | Bacteria | 13275 |
| 685 | Ga0265316_10005224 | 3300031344 | Bacteria | 12688 |
| 686 | Ga0265316_10034153 | 3300031344 | Bacteria | 4134 |
| 687 | Ga0265313_10056517 | 3300031595 | Bacteria | 1856 |
| 688 | Ga0265314_10003389 | 3300031711 | Bacteria | 15445 |
| 689 | Ga0265314_10007710 | 3300031711 | Bacteria | 9307 |
| 690 | Ga0265314_10032599 | 3300031711 | Bacteria | 3831 |
| 691 | Ga0265342_10049946 | 3300031712 | Bacteria | 2501 |
| 692 | Ga0265342_10421963 | 3300031712 | Unclassified | 687 |
| 693 | Ga0373930_0045806 | 3300034816 | Bacteria | 943 |
| 694 | Ga0373926_0008935 | 3300035083 | Unclassified | 3341 |
| 695 | Ga0373926_0010008 | 3300035083 | Bacteria | 3174 |
| 696 | Ga0373934_0223481 | 3300035086 | Unclassified | 777 |
| 697 | Ga0373923_0676094 | 3300035111 | Unclassified | 512 |
| 698 | Ga0373932_0335996 | 3300035112 | Unclassified | 571 |
| 699 | Ga0373936_0035404 | 3300035113 | Unclassified | 1987 |
| 700 | Ga0373936_0241510 | 3300035113 | Bacteria | 805 |
| 701 | Ga0373954_0020632 | 3300035118 | Bacteria | 2982 |
| 702 | Ga0373954_0494909 | 3300035118 | Bacteria | 606 |
| 703 | Ga0373954_0561074 | 3300035118 | Unclassified | 566 |
| 704 | Ga0373957_0090127 | 3300035120 | Bacteria | 1218 |
| 705 | Ga0373943_0009063 | 3300035170 | Bacteria | 4461 |
| 706 | Ga0373943_0346304 | 3300035170 | Bacteria | 851 |
| 707 | Ga0373946_0075247 | 3300035171 | Bacteria | 1467 |
| 708 | Ga0373946_0509298 | 3300035171 | Bacteria | 618 |
| 709 | Ga0373955_0284032 | 3300035172 | Bacteria | 996 |
| 710 | Ga0373961_0103573 | 3300035241 | Bacteria | 924 |
| 711 | Ga0373931_0008193 | 3300035691 | Bacteria | 4951 |
| 712 | Ga0373935_0002744 | 3300035692 | Bacteria | 10136 |
| 713 | Ga0373935_0051208 | 3300035692 | Bacteria | 2622 |
| 714 | Ga0373927_0001178 | 3300035695 | Bacteria | 19819 |
| 715 | Ga0373927_0002368 | 3300035695 | Bacteria | 13732 |
| 716 | Ga0373927_0019125 | 3300035695 | Bacteria | 4492 |
| 717 | Ga0373927_0099736 | 3300035695 | Bacteria | 1889 |
| 718 | Ga0373927_0164270 | 3300035695 | Unclassified | 1455 |
| 719 | Ga0373927_0987642 | 3300035695 | Bacteria | 555 |
| 720 | Ga0373933_0108299 | 3300035724 | Bacteria | 1731 |
| 721 | Ga0373933_0289983 | 3300035724 | Bacteria | 1058 |
| 722 | Ga0373933_0290090 | 3300035724 | Unclassified | 1058 |
| 723 | Ga0373947_0000791 | 3300035725 | Bacteria | 19015 |
| 724 | Ga0373947_0010631 | 3300035725 | Bacteria | 5280 |
| 725 | Ga0373947_0011446 | 3300035725 | Bacteria | 5090 |
| 726 | Ga0373937_0050240 | 3300036401 | Bacteria | 3819 |
| 727 | Ga0373937_0064239 | 3300036401 | Bacteria | 3376 |
| 728 | Ga0373937_0162599 | 3300036401 | Bacteria | 2093 |
| 729 | Ga0373937_0274716 | 3300036401 | Bacteria | 1591 |
| 730 | Ga0373937_0300286 | 3300036401 | Unclassified | 1518 |
| 731 | Ga0373937_0342455 | 3300036401 | Bacteria | 1416 |
| 732 | Ga0373925_0001414 | 3300037068 | Bacteria | 20838 |
| 733 | Ga0373925_0006773 | 3300037068 | Bacteria | 8398 |
| 734 | Ga0373925_0097371 | 3300037068 | Bacteria | 2256 |
| 735 | Ga0373925_0317902 | 3300037068 | Bacteria | 1259 |
| 736 | Ga0373925_0673340 | 3300037068 | Bacteria | 853 |
| 737 | Ga0373925_0706349 | 3300037068 | Bacteria | 831 |
| 738 | Ga0373925_0706405 | 3300037068 | Bacteria | 831 |
| 739 | Ga0395905_0927736 | 3300037471 | Bacteria | 774 |
| 740 | Ga0436364_0264121 | 3300037853 | Bacteria | 2719 |
| 741 | Ga0436364_0273915 | 3300037853 | Bacteria | 1347 |
| 742 | Ga0436364_0683917 | 3300037853 | Bacteria | 8658 |
| 743 | Ga0436364_0800017 | 3300037853 | Unclassified | 966 |
| 744 | Ga0436364_0877214 | 3300037853 | Bacteria | 3174 |
| 745 | Ga0436364_1415525 | 3300037853 | Bacteria | 425173 |
| 746 | Ga0436364_1426312 | 3300037853 | Bacteria | 3513 |
| 747 | Ga0436364_1528712 | 3300037853 | Bacteria | 1640 |
| 748 | Ga0395901_0314352 | 3300038443 | Unclassified | 1622 |
| 749 | Ga0395901_1890523 | 3300038443 | Unclassified | 545 |
| 750 | Ga0436365_0277120 | 3300039437 | Unclassified | 1360 |
| 751 | Ga0436365_0447678 | 3300039437 | Unclassified | 2718 |
| 752 | Ga0436365_0655522 | 3300039437 | Bacteria | 1586 |
| 753 | Ga0436365_0879694 | 3300039437 | Unclassified | 1755 |
| 754 | Ga0436365_1203388 | 3300039437 | Unclassified | 684 |
| 755 | Ga0436365_1707053 | 3300039437 | Unclassified | 1195 |
| 756 | Ga0436363_0612734 | 3300039450 | Unclassified | 662 |
| 757 | Ga0436362_0187453 | 3300039453 | Bacteria | 756 |
| 758 | Ga0436362_0413443 | 3300039453 | Bacteria | 767 |
| 759 | Ga0436362_0430208 | 3300039453 | Bacteria | 650 |
| 760 | Ga0436362_0981073 | 3300039453 | Bacteria | 2238 |
| 761 | Ga0439448_0206994 | 3300042005 | Bacteria | 688 |
| 762 | Ga0451577_1800257 | 3300042876 | Unclassified | 537 |
| 763 | Ga0466966_0661164 | 3300044684 | Unclassified | 629 |
| 764 | Ga0466961_0060946 | 3300044693 | Unclassified | 2399 |
| 765 | Ga0466964_0070967 | 3300044706 | Bacteria | 1473 |
| 766 | Ga0466971_0244778 | 3300044719 | Unclassified | 853 |
| 767 | Ga0466968_0202473 | 3300044735 | Bacteria | 930 |
| 768 | Ga0466957_0077705 | 3300044842 | Unclassified | 2063 |
| 769 | Ga0466959_0831934 | 3300045049 | Unclassified | 617 |
| 770 | Ga0451576_1262280 | 3300045051 | Bacteria | 771 |
| 771 | Ga0451576_1630038 | 3300045051 | Bacteria | 669 |
| 772 | Ga0466958_0728219 | 3300045836 | Unclassified | 646 |
| 773 | Ga0466967_0119153 | 3300045976 | Bacteria | 2436 |
| 774 | Ga0466967_0288577 | 3300045976 | Unclassified | 1576 |
| 775 | Ga0495592_0033185 | 3300046454 | Bacteria | 3894 |
| 776 | Ga0495651_0061861 | 3300046462 | Bacteria | 2865 |
| 777 | Ga0495653_0110226 | 3300046463 | Bacteria | 1979 |
| 778 | Ga0495580_0005708 | 3300046472 | Bacteria | 10237 |
| 779 | Ga0495580_0008511 | 3300046472 | Bacteria | 8156 |
| 780 | Ga0495580_0035060 | 3300046472 | Bacteria | 3609 |
| 781 | Ga0495580_0059078 | 3300046472 | Unclassified | 2695 |
| 782 | Ga0495580_0109030 | 3300046472 | Bacteria | 1922 |
| 783 | Ga0495580_0196975 | 3300046472 | Unclassified | 1389 |
| 784 | Ga0495580_0199371 | 3300046472 | Bacteria | 1379 |
| 785 | Ga0495580_0276101 | 3300046472 | Bacteria | 1147 |
| 786 | Ga0495580_0494976 | 3300046472 | Unclassified | 816 |
| 787 | Ga0495582_0001573 | 3300046473 | Bacteria | 12875 |
| 788 | Ga0495582_0021526 | 3300046473 | Bacteria | 3529 |
| 789 | Ga0495582_0101287 | 3300046473 | Bacteria | 1613 |
| 790 | Ga0495639_0601203 | 3300046475 | Unclassified | 565 |
| 791 | Ga0495662_0017566 | 3300046476 | Bacteria | 3462 |
| 792 | Ga0495664_0006701 | 3300046477 | Bacteria | 6371 |
| 793 | Ga0495664_0259746 | 3300046477 | Bacteria | 1050 |
| 794 | Ga0495608_0040514 | 3300046511 | Bacteria | 3120 |
| 795 | Ga0495618_0238947 | 3300046514 | Bacteria | 1142 |
| 796 | Ga0495628_0010921 | 3300046516 | Bacteria | 7690 |
| 797 | Ga0495630_0009909 | 3300046517 | Bacteria | 6862 |
| 798 | Ga0495630_0319430 | 3300046517 | Bacteria | 1187 |
| 799 | Ga0495630_0933209 | 3300046517 | Bacteria | 661 |
| 800 | Ga0495666_0100346 | 3300046526 | Bacteria | 1364 |
| 801 | Ga0495652_0007150 | 3300046529 | Bacteria | 10301 |
| 802 | Ga0495665_0014059 | 3300046531 | Bacteria | 4323 |
| 803 | Ga0495665_0162388 | 3300046531 | Unclassified | 1164 |
| 804 | Ga0495665_0197162 | 3300046531 | Unclassified | 1044 |
| 805 | Ga0495640_0022814 | 3300046533 | Bacteria | 4570 |
| 806 | Ga0495587_0026684 | 3300046536 | Bacteria | 3521 |
| 807 | Ga0495587_0131832 | 3300046536 | Bacteria | 1428 |
| 808 | Ga0495587_0690319 | 3300046536 | Bacteria | 560 |
| 809 | Ga0495645_0003842 | 3300046543 | Bacteria | 10223 |
| 810 | Ga0495645_0257816 | 3300046543 | Bacteria | 1156 |
| 811 | Ga0495667_0042546 | 3300046559 | Bacteria | 3012 |
| 812 | Ga0495634_0008872 | 3300046642 | Bacteria | 7455 |
| 813 | Ga0495635_0029254 | 3300046663 | Bacteria | 3830 |
| 814 | Ga0495635_0452855 | 3300046663 | Unclassified | 848 |
| 815 | Ga0495657_0361740 | 3300046675 | Bacteria | 857 |
| 816 | Ga0495599_0006439 | 3300046678 | Bacteria | 7083 |
| 817 | Ga0495599_0533057 | 3300046678 | Unclassified | 689 |
| 818 | Ga0495623_0058656 | 3300046679 | Unclassified | 2420 |
| 819 | Ga0495623_0135753 | 3300046679 | Unclassified | 1468 |
| 820 | Ga0495646_0207300 | 3300046680 | Bacteria | 1065 |
| 821 | Ga0495647_0452949 | 3300046681 | Bacteria | 594 |
| 822 | Ga0495658_0204434 | 3300046683 | Unclassified | 1232 |
| 823 | Ga0495669_0070932 | 3300046684 | Bacteria | 1588 |
| 824 | Ga0495669_0376496 | 3300046684 | Bacteria | 687 |
| 825 | Ga0495613_0047448 | 3300046689 | Bacteria | 3173 |
| 826 | Ga0495613_0262314 | 3300046689 | Bacteria | 1203 |
| 827 | Ga0495600_0044601 | 3300046809 | Bacteria | 2893 |
| 828 | Ga0495581_0023298 | 3300047315 | Unclassified | 3588 |
| 829 | Ga0495581_0348572 | 3300047315 | Bacteria | 864 |
| 830 | Ga0495581_0567926 | 3300047315 | Bacteria | 658 |
| 831 | Ga0495604_0014207 | 3300047317 | Bacteria | 6347 |
| 832 | Ga0495636_0176896 | 3300047318 | Bacteria | 967 |
| 833 | Ga0495674_0032395 | 3300047319 | Bacteria | 4740 |
| 834 | Ga0495674_0221808 | 3300047319 | Bacteria | 1562 |
| 835 | Ga0495674_0297388 | 3300047319 | Bacteria | 1319 |
| 836 | Ga0495680_0063802 | 3300047322 | Bacteria | 2827 |
| 837 | Ga0495675_0044588 | 3300047444 | Bacteria | 2825 |
| 838 | Ga0495685_278766 | 3300047447 | Unclassified | 527 |
| 839 | Ga0495684_0020315 | 3300047471 | Bacteria | 5116 |
| 840 | Ga0495684_0088444 | 3300047471 | Bacteria | 2348 |
| 841 | Ga0495684_0520988 | 3300047471 | Bacteria | 814 |
| 842 | Ga0495593_0635758 | 3300047673 | Unclassified | 536 |
| 843 | Ga0495602_0082199 | 3300048088 | Bacteria | 2704 |
| 844 | Ga0495602_0088109 | 3300048088 | Unclassified | 2585 |
| 845 | Ga0495602_0327665 | 3300048088 | Bacteria | 1112 |
| 846 | Ga0496102_1046635 | 3300048905 | Unclassified | 736 |
| 847 | Ga0496105_0134025 | 3300048908 | Bacteria | 2041 |
| 848 | Ga0496106_0847972 | 3300048909 | Bacteria | 723 |
| 849 | Ga0496109_0507547 | 3300048912 | Bacteria | 1138 |
| 850 | Ga0496109_1577145 | 3300048912 | Bacteria | 591 |
| 851 | Ga0496110_0842663 | 3300048913 | Unclassified | 822 |
| 852 | Ga0496111_0316450 | 3300048914 | Bacteria | 1156 |
| 853 | Ga0496112_0006449 | 3300048915 | Bacteria | 10300 |
| 854 | Ga0496112_0100051 | 3300048915 | Unclassified | 2869 |
| 855 | Ga0496112_0461037 | 3300048915 | Bacteria | 1208 |
| 856 | Ga0496112_0924573 | 3300048915 | Bacteria | 794 |
| 857 | Ga0496112_1578382 | 3300048915 | Unclassified | 570 |
| 858 | Ga0496113_0464732 | 3300048916 | Bacteria | 1017 |
| 859 | Ga0496115_0122639 | 3300048918 | Bacteria | 2139 |
| 860 | Ga0496115_0155535 | 3300048918 | Bacteria | 1889 |
| 861 | Ga0496115_0513016 | 3300048918 | Bacteria | 962 |
| 862 | Ga0501047_0667679 | 3300049581 | Bacteria | 858 |
| 863 | Ga0501073_0599093 | 3300049589 | Bacteria | 761 |
| 864 | Ga0501075_0498456 | 3300049591 | Bacteria | 929 |
| 865 | Ga0501044_0061261 | 3300049823 | Unclassified | 3850 |
| 866 | Ga0501044_0470085 | 3300049823 | Bacteria | 1162 |
| 867 | Ga0501045_1287931 | 3300049824 | Bacteria | 532 |
| 868 | nmdc:mga05p37_764514_c1 | 3300050507 | Bacteria | 1063 |
| 869 | nmdc:mga08y16_1758137_c1 | 3300050511 | Unclassified | 574 |
| 870 | nmdc:mga08y16_498733_c1 | 3300050511 | Bacteria | 1237 |
| 871 | nmdc:mga0n895_164043_c1 | 3300050512 | Bacteria | 2253 |
| 872 | nmdc:mga0n895_825817_c1 | 3300050512 | Bacteria | 916 |
| 873 | nmdc:mga0rr50_1105429_c1 | 3300050513 | Unclassified | 674 |
| 874 | nmdc:mga0rr50_182698_c1 | 3300050513 | Bacteria | 1715 |
| 875 | nmdc:mga0rr50_1847_c1 | 3300050513 | Unclassified | 4141 |
| 876 | nmdc:mga0rr50_25385_c1 | 3300050513 | Bacteria | 4119 |
| 877 | nmdc:mga08x19_1063_c1 | 3300050514 | Bacteria | 17156 |
| 878 | nmdc:mga08x19_142149_c1 | 3300050514 | Bacteria | 1621 |
| 879 | nmdc:mga08x19_32527_c1 | 3300050514 | Bacteria | 3288 |
| 880 | nmdc:mga08x19_9104_c1 | 3300050514 | Bacteria | 5928 |
| 881 | nmdc:mga0a205_225_c1 | 3300050515 | Bacteria | 39886 |
| 882 | Ga0495612_0370210 | 3300053078 | Bacteria | 648 |
| 883 | Ga0495619_1000452 | 3300053085 | Bacteria | 559 |
| 884 | Ga0587088_145161 | 3300059508 | Bacteria | 570 |
| 885 | Ga0501082_0000163 | 3300060353 | Bacteria | 56753 |
| 886 | Ga0265316_10084938 | |||
| 887 | LJNas_1000260 | |||
| 888 | JGI24737J22298_10091288 | |||
| 889 | rootL2_10241530 | |||
| 890 | Ga0058863_10029568 | |||
| 891 | Ga0065712_10353710 | |||
| 892 | Ga0070658_10047356 | |||
| 893 | Ga0070658_10426613 | |||
| 894 | Ga0070658_11086340 | |||
| 895 | Ga0070683_100030293 | |||
| 896 | Ga0070683_100133717 | |||
| 897 | Ga0070683_100170304 | |||
| 898 | Ga0070683_100758586 | |||
| 899 | Ga0070690_100073959 | |||
| 900 | Ga0070690_100221945 | |||
| 901 | Ga0070690_100234369 | |||
| 902 | Ga0070670_100001671 | |||
| 903 | Ga0068869_100029513 | |||
| 904 | Ga0068869_100318641 | |||
| 905 | Ga0068869_100964164 | |||
| 906 | Ga0068869_101312210 | |||
| 907 | Ga0070666_10012008 | |||
| 908 | Ga0070680_100000603 | |||
| 909 | Ga0070680_100053548 | |||
| 910 | Ga0070680_100186234 | |||
| 911 | Ga0070680_100257035 | |||
| 912 | Ga0070680_100740923 | |||
| 913 | Ga0070680_100839079 | |||
| 914 | Ga0070682_100224682 | |||
| 915 | Ga0070682_100274201 | |||
| 916 | Ga0068868_100002128 | |||
| 917 | Ga0068868_100026427 | |||
| 918 | Ga0068868_100727563 | |||
| 919 | Ga0070660_100104824 | |||
| 920 | Ga0070660_100190960 | |||
| 921 | Ga0070660_100218661 | |||
| 922 | Ga0070660_100462584 | |||
| 923 | Ga0070660_100597898 | |||
| 924 | Ga0070660_100944342 | |||
| 925 | Ga0070689_100085443 | |||
| 926 | Ga0070689_100211546 | |||
| 927 | Ga0070691_10136978 | |||
| 928 | Ga0070691_10175990 | |||
| 929 | Ga0070691_10447080 | |||
| 930 | Ga0070661_100010828 | |||
| 931 | Ga0070661_100230274 | |||
| 932 | Ga0070692_10041886 | |||
| 933 | Ga0070675_100110258 | |||
| 934 | Ga0070671_100151886 | |||
| 935 | Ga0070671_100595585 | |||
| 936 | Ga0070671_101525399 | |||
| 937 | Ga0070673_100152664 | |||
| 938 | Ga0070673_100896487 | |||
| 939 | Ga0070688_101037073 | |||
| 940 | Ga0070659_100238255 | |||
| 941 | Ga0070667_101696926 | |||
| 942 | Ga0070709_10009188 | |||
| 943 | Ga0070714_100022904 | |||
| 944 | Ga0070714_100048017 | |||
| 945 | Ga0070714_100067282 | |||
| 946 | Ga0070714_100238236 | |||
| 947 | Ga0070713_100108983 | |||
| 948 | Ga0070713_100210965 | |||
| 949 | Ga0070713_101568210 | |||
| 950 | Ga0070710_10026888 | |||
| 951 | Ga0070711_100049597 | |||
| 952 | Ga0070711_100291837 | |||
| 953 | Ga0070711_100654909 | |||
| 954 | Ga0070705_100276861 | |||
| 955 | Ga0070705_100445621 | |||
| 956 | Ga0070705_101343203 | |||
| 957 | Ga0070694_100250825 | |||
| 958 | Ga0070694_100603521 | |||
| 959 | Ga0070708_100146004 | |||
| 960 | Ga0070708_102110438 | |||
| 961 | Ga0070663_100360518 | |||
| 962 | Ga0070678_100137445 | |||
| 963 | Ga0070662_100036046 | |||
| 964 | Ga0070662_100154443 | |||
| 965 | Ga0070681_10008575 | |||
| 966 | Ga0070681_10015594 | |||
| 967 | Ga0070681_10046181 | |||
| 968 | Ga0070681_10186958 | |||
| 969 | Ga0070681_10235636 | |||
| 970 | Ga0070681_10288102 | |||
| 971 | Ga0070681_10299743 | |||
| 972 | Ga0070681_10800734 | |||
| 973 | Ga0068867_100005572 | |||
| 974 | Ga0068867_100093076 | |||
| 975 | Ga0068867_100667512 | |||
| 976 | Ga0068867_100777916 | |||
| 977 | Ga0070706_100064219 | |||
| 978 | Ga0070706_100152926 | |||
| 979 | Ga0070707_100658794 | |||
| 980 | Ga0070707_101057716 | |||
| 981 | Ga0070698_101823791 | |||
| 982 | Ga0070699_100012164 | |||
| 983 | Ga0070699_100305666 | |||
| 984 | Ga0070679_100040984 | |||
| 985 | Ga0070679_100049582 | |||
| 986 | Ga0070679_100206472 | |||
| 987 | Ga0070679_100313845 | |||
| 988 | Ga0070679_100342935 | |||
| 989 | Ga0070679_100467399 | |||
| 990 | Ga0070679_101577942 | |||
| 991 | Ga0070684_100072993 | |||
| 992 | Ga0070684_100202791 | |||
| 993 | Ga0070684_100217205 | |||
| 994 | Ga0070684_100245860 | |||
| 995 | Ga0070684_100284655 | |||
| 996 | Ga0070684_100439588 | |||
| 997 | Ga0070684_100862559 | |||
| 998 | Ga0070684_101326550 | |||
| 999 | Ga0070697_100016006 | |||
| 1000 | Ga0070697_100347231 | |||
| 1001 | Ga0070697_100367250 | |||
| 1002 | Ga0070697_100672455 | |||
| 1003 | Ga0070697_101280403 | |||
| 1004 | Ga0068853_100582451 | |||
| 1005 | Ga0068853_100675777 | |||
| 1006 | Ga0068853_101337001 | |||
| 1007 | Ga0070686_100201282 | |||
| 1008 | Ga0070686_101488033 | |||
| 1009 | Ga0070695_100025319 | |||
| 1010 | Ga0070695_100269446 | |||
| 1011 | Ga0070695_101214386 | |||
| 1012 | Ga0070696_100001210 | |||
| 1013 | Ga0070696_100094269 | |||
| 1014 | Ga0070693_100172898 | |||
| 1015 | Ga0070693_101099947 | |||
| 1016 | Ga0070665_100409824 | |||
| 1017 | Ga0070665_100427863 | |||
| 1018 | Ga0070665_100446507 | |||
| 1019 | Ga0068855_100000151 | |||
| 1020 | Ga0068855_100010918 | |||
| 1021 | Ga0068855_100017859 | |||
| 1022 | Ga0068855_100025976 | |||
| 1023 | Ga0068855_100042280 | |||
| 1024 | Ga0068855_100065294 | |||
| 1025 | Ga0068855_100072180 | |||
| 1026 | Ga0068855_100087433 | |||
| 1027 | Ga0068855_100100591 | |||
| 1028 | Ga0068855_100472093 | |||
| 1029 | Ga0068855_101680624 | |||
| 1030 | Ga0070664_100001009 | |||
| 1031 | Ga0070664_100111532 | |||
| 1032 | Ga0070664_100179827 | |||
| 1033 | Ga0070664_100193668 | |||
| 1034 | Ga0068857_100000121 | |||
| 1035 | Ga0068857_100004298 | |||
| 1036 | Ga0068857_100026488 | |||
| 1037 | Ga0068857_100031584 | |||
| 1038 | Ga0068857_100116933 | |||
| 1039 | Ga0068857_100162622 | |||
| 1040 | Ga0068854_100020450 | |||
| 1041 | Ga0068854_100094766 | |||
| 1042 | Ga0068854_100160717 | |||
| 1043 | Ga0068854_100588422 | |||
| 1044 | Ga0068854_100896702 | |||
| 1045 | Ga0068854_101069616 | |||
| 1046 | Ga0068856_100000119 | |||
| 1047 | Ga0068856_100000735 | |||
| 1048 | Ga0068856_100003101 | |||
| 1049 | Ga0068856_100005370 | |||
| 1050 | Ga0068856_100104896 | |||
| 1051 | Ga0068856_100152066 | |||
| 1052 | Ga0068856_100176386 | |||
| 1053 | Ga0068856_100188191 | |||
| 1054 | Ga0068856_100213106 | |||
| 1055 | Ga0068856_100473431 | |||
| 1056 | Ga0068856_100704711 | |||
| 1057 | Ga0070702_100096426 | |||
| 1058 | Ga0070702_100519309 | |||
| 1059 | Ga0070702_101096792 | |||
| 1060 | Ga0068852_100655159 | |||
| 1061 | Ga0068852_100760022 | |||
| 1062 | Ga0068852_100818414 | |||
| 1063 | Ga0068859_100000415 | |||
| 1064 | Ga0068859_100172739 | |||
| 1065 | Ga0068859_100254457 | |||
| 1066 | Ga0068859_100531129 | |||
| 1067 | Ga0068859_100732096 | |||
| 1068 | Ga0068859_100835072 | |||
| 1069 | Ga0068864_100001353 | |||
| 1070 | Ga0068864_100045482 | |||
| 1071 | Ga0068864_100066790 | |||
| 1072 | Ga0068864_100373628 | |||
| 1073 | Ga0068864_101214695 | |||
| 1074 | Ga0068866_10001235 | |||
| 1075 | Ga0068866_10051523 | |||
| 1076 | Ga0068866_10465404 | |||
| 1077 | Ga0068861_100826992 | |||
| 1078 | Ga0068861_101732483 | |||
| 1079 | Ga0068870_10122968 | |||
| 1080 | Ga0068863_100012184 | |||
| 1081 | Ga0068863_100244731 | |||
| 1082 | Ga0068863_100853159 | |||
| 1083 | Ga0068863_100947889 | |||
| 1084 | Ga0068858_100001756 | |||
| 1085 | Ga0068858_100002944 | |||
| 1086 | Ga0068858_100029443 | |||
| 1087 | Ga0068858_100030314 | |||
| 1088 | Ga0068858_100066403 | |||
| 1089 | Ga0068858_100193802 | |||
| 1090 | Ga0068858_100538773 | |||
| 1091 | Ga0068858_100571175 | |||
| 1092 | Ga0068860_100040407 | |||
| 1093 | Ga0068860_100047838 | |||
| 1094 | Ga0068860_100064485 | |||
| 1095 | Ga0068860_100324231 | |||
| 1096 | Ga0068860_101168585 | |||
| 1097 | Ga0068862_101190671 | |||
| 1098 | Ga0081540_1025365 | |||
| 1099 | Ga0070717_10000964 | |||
| 1100 | Ga0070717_10031513 | |||
| 1101 | Ga0070717_10038841 | |||
| 1102 | Ga0070717_10225872 | |||
| 1103 | Ga0070717_12110205 | |||
| 1104 | Ga0070715_10030273 | |||
| 1105 | Ga0070715_10756531 | |||
| 1106 | Ga0070716_100013191 | |||
| 1107 | Ga0070716_100679363 | |||
| 1108 | Ga0070716_100794311 | |||
| 1109 | Ga0097621_100000073 | |||
| 1110 | Ga0097621_100001536 | |||
| 1111 | Ga0097621_100045384 | |||
| 1112 | Ga0097621_100053414 | |||
| 1113 | Ga0097621_100053609 | |||
| 1114 | Ga0097621_100744980 | |||
| 1115 | Ga0097621_100947316 | |||
| 1116 | Ga0097621_101364691 | |||
| 1117 | Ga0068871_100000258 | |||
| 1118 | Ga0068871_100000932 | |||
| 1119 | Ga0068871_100131493 | |||
| 1120 | Ga0068871_100235455 | |||
| 1121 | Ga0068871_100263619 | |||
| 1122 | Ga0068871_100286378 | |||
| 1123 | Ga0068871_100332643 | |||
| 1124 | Ga0068871_100395697 | |||
| 1125 | Ga0068871_100480215 | |||
| 1126 | Ga0068871_100784342 | |||
| 1127 | Ga0075431_101128561 | |||
| 1128 | Ga0075433_10000203 | |||
| 1129 | Ga0075434_100000016 | |||
| 1130 | Ga0075434_100779867 | |||
| 1131 | Ga0068865_100010820 | |||
| 1132 | Ga0068865_100061318 | |||
| 1133 | Ga0068865_100135800 | |||
| 1134 | Ga0068865_100140494 | |||
| 1135 | Ga0075436_100000459 | |||
| 1136 | Ga0075436_100001267 | |||
| 1137 | Ga0075436_100002867 | |||
| 1138 | Ga0075436_100707132 | |||
| 1139 | Ga0075436_100754662 | |||
| 1140 | Ga0097620_100000415 | |||
| 1141 | Ga0097620_100172739 | |||
| 1142 | Ga0097620_100254442 | |||
| 1143 | Ga0097620_100531146 | |||
| 1144 | Ga0097620_100732077 | |||
| 1145 | Ga0097620_100835014 | |||
| 1146 | Ga0075435_100000506 | |||
| 1147 | Ga0075435_100055926 | |||
| 1148 | Ga0075435_100218484 | |||
| 1149 | Ga0075435_100694859 | |||
| 1150 | Ga0105240_10002859 | |||
| 1151 | Ga0105240_10011668 | |||
| 1152 | Ga0105240_10055622 | |||
| 1153 | Ga0105240_10074432 | |||
| 1154 | Ga0105240_10126413 | |||
| 1155 | Ga0105240_10149958 | |||
| 1156 | Ga0105240_10152022 | |||
| 1157 | Ga0105240_10163889 | |||
| 1158 | Ga0105240_10225186 | |||
| 1159 | Ga0105240_10266938 | |||
| 1160 | Ga0105240_10505847 | |||
| 1161 | Ga0105240_10963439 | |||
| 1162 | Ga0105240_11080391 | |||
| 1163 | Ga0105240_11111378 | |||
| 1164 | Ga0105240_11896834 | |||
| 1165 | Ga0111539_11336227 | |||
| 1166 | Ga0105245_10018588 | |||
| 1167 | Ga0105245_10138886 | |||
| 1168 | Ga0105245_10447635 | |||
| 1169 | Ga0105245_10607340 | |||
| 1170 | Ga0105245_10675867 | |||
| 1171 | Ga0105245_10800632 | |||
| 1172 | Ga0105245_10954363 | |||
| 1173 | Ga0105245_11327280 | |||
| 1174 | Ga0105245_11467994 | |||
| 1175 | Ga0105245_11684623 | |||
| 1176 | Ga0105245_11730465 | |||
| 1177 | Ga0105245_11799322 | |||
| 1178 | Ga0105247_10455044 | |||
| 1179 | Ga0114129_10759829 | |||
| 1180 | Ga0105243_10137707 | |||
| 1181 | Ga0105243_10915486 | |||
| 1182 | Ga0105241_10024522 | |||
| 1183 | Ga0105241_10051100 | |||
| 1184 | Ga0105241_10096184 | |||
| 1185 | Ga0105241_10280535 | |||
| 1186 | Ga0105241_10349158 | |||
| 1187 | Ga0105241_10451776 | |||
| 1188 | Ga0105241_10636674 | |||
| 1189 | Ga0105241_10653210 | |||
| 1190 | Ga0105241_10697188 | |||
| 1191 | Ga0105241_11337663 | |||
| 1192 | Ga0105241_11378370 | |||
| 1193 | Ga0105242_10051667 | |||
| 1194 | Ga0105242_10128723 | |||
| 1195 | Ga0105242_10180895 | |||
| 1196 | Ga0105242_10265127 | |||
| 1197 | Ga0105242_10358027 | |||
| 1198 | Ga0105242_10458144 | |||
| 1199 | Ga0105242_10583780 | |||
| 1200 | Ga0105242_10786875 | |||
| 1201 | Ga0105242_10908710 | |||
| 1202 | Ga0105248_10003718 | |||
| 1203 | Ga0105248_10022851 | |||
| 1204 | Ga0105248_10050489 | |||
| 1205 | Ga0105248_10069163 | |||
| 1206 | Ga0105248_10082903 | |||
| 1207 | Ga0105248_10316600 | |||
| 1208 | Ga0105248_10359047 | |||
| 1209 | Ga0105248_11443114 | |||
| 1210 | Ga0105237_10030803 | |||
| 1211 | Ga0105237_10059246 | |||
| 1212 | Ga0105237_10192802 | |||
| 1213 | Ga0105237_10244406 | |||
| 1214 | Ga0105237_10456339 | |||
| 1215 | Ga0105237_10773254 | |||
| 1216 | Ga0105238_10000497 | |||
| 1217 | Ga0105238_10033919 | |||
| 1218 | Ga0105238_10067929 | |||
| 1219 | Ga0105238_10071243 | |||
| 1220 | Ga0105238_10183731 | |||
| 1221 | Ga0105238_10207556 | |||
| 1222 | Ga0105238_10528402 | |||
| 1223 | Ga0105238_11604236 | |||
| 1224 | Ga0105249_10218529 | |||
| 1225 | Ga0105249_12043156 | |||
| 1226 | Ga0105239_10005844 | |||
| 1227 | Ga0105239_10008299 | |||
| 1228 | Ga0105239_10028421 | |||
| 1229 | Ga0105239_10074153 | |||
| 1230 | Ga0105239_10125966 | |||
| 1231 | Ga0105239_10129667 | |||
| 1232 | Ga0105239_10261588 | |||
| 1233 | Ga0105239_10462414 | |||
| 1234 | Ga0105246_10124900 | |||
| 1235 | Ga0105246_10167946 | |||
| 1236 | Ga0105246_10691381 | |||
| 1237 | Ga0105246_11357212 | |||
| 1238 | Ga0157373_10101562 | |||
| 1239 | Ga0157373_10136753 | |||
| 1240 | Ga0157373_10646498 | |||
| 1241 | Ga0157371_10037166 | |||
| 1242 | Ga0157371_10121215 | |||
| 1243 | Ga0157371_11004229 | |||
| 1244 | Ga0157370_10000944 | |||
| 1245 | Ga0157370_10024274 | |||
| 1246 | Ga0157370_10029683 | |||
| 1247 | Ga0157370_10041967 | |||
| 1248 | Ga0157370_10212700 | |||
| 1249 | Ga0157370_11240894 | |||
| 1250 | Ga0157369_10000108 | |||
| 1251 | Ga0157369_10000788 | |||
| 1252 | Ga0157369_10025124 | |||
| 1253 | Ga0157369_10028125 | |||
| 1254 | Ga0157369_10068636 | |||
| 1255 | Ga0157369_10255562 | |||
| 1256 | Ga0157369_10353424 | |||
| 1257 | Ga0157374_10001477 | |||
| 1258 | Ga0157374_10007082 | |||
| 1259 | Ga0157374_10034864 | |||
| 1260 | Ga0157374_10107114 | |||
| 1261 | Ga0157374_10889543 | |||
| 1262 | Ga0157374_10925980 | |||
| 1263 | Ga0157374_12571566 | |||
| 1264 | Ga0157378_10000030 | |||
| 1265 | Ga0157378_10000099 | |||
| 1266 | Ga0157378_10027391 | |||
| 1267 | Ga0157378_10033299 | |||
| 1268 | Ga0157378_10821145 | |||
| 1269 | Ga0157378_11143870 | |||
| 1270 | Ga0157378_11233450 | |||
| 1271 | Ga0157378_11559682 | |||
| 1272 | Ga0163162_10351169 | |||
| 1273 | Ga0163162_10469492 | |||
| 1274 | Ga0163162_10573224 | |||
| 1275 | Ga0163162_11469449 | |||
| 1276 | Ga0163162_11517565 | |||
| 1277 | Ga0163162_11718973 | |||
| 1278 | Ga0163162_12812770 | |||
| 1279 | Ga0157372_10000218 | |||
| 1280 | Ga0157372_10000576 | |||
| 1281 | Ga0157372_10003314 | |||
| 1282 | Ga0157372_10018887 | |||
| 1283 | Ga0157372_10347598 | |||
| 1284 | Ga0157372_11366814 | |||
| 1285 | Ga0157372_11543121 | |||
| 1286 | Ga0157375_10343291 | |||
| 1287 | Ga0157375_10468911 | |||
| 1288 | Ga0157375_10768762 | |||
| 1289 | Ga0157375_11207331 | |||
| 1290 | Ga0157375_11541638 | |||
| 1291 | Ga0163163_10003193 | |||
| 1292 | Ga0163163_10126344 | |||
| 1293 | Ga0163163_10296747 | |||
| 1294 | Ga0163163_10414130 | |||
| 1295 | Ga0163163_10820960 | |||
| 1296 | Ga0163163_10922272 | |||
| 1297 | Ga0163163_11588391 | |||
| 1298 | Ga0157380_11278834 | |||
| 1299 | Ga0182008_10279655 | |||
| 1300 | Ga0157377_10522872 | |||
| 1301 | Ga0157379_10057957 | |||
| 1302 | Ga0157379_11597250 | |||
| 1303 | Ga0157376_10159329 | |||
| 1304 | Ga0157376_10300887 | |||
| 1305 | Ga0157376_10430725 | |||
| 1306 | Ga0157376_10997675 | |||
| 1307 | Ga0182006_1009694 | |||
| 1308 | Ga0182007_10035405 | |||
| 1309 | Ga0163161_10908819 | |||
| 1310 | Ga0184603_118414 | |||
| 1311 | Ga0197907_10817353 | |||
| 1312 | Ga0206356_10589427 | |||
| 1313 | Ga0213876_10145779 | |||
| 1314 | Ga0213876_10343582 | |||
| 1315 | Ga0213875_10000008 | |||
| 1316 | Ga0213875_10003390 | |||
| 1317 | Ga0213875_10230615 | |||
| 1318 | Ga0213875_10592503 | |||
| 1319 | Ga0224712_10054675 | |||
| 1320 | Ga0207692_10061557 | |||
| 1321 | Ga0207692_10177530 | |||
| 1322 | Ga0207642_10002153 | |||
| 1323 | Ga0207642_10069655 | |||
| 1324 | Ga0207710_10078754 | |||
| 1325 | Ga0207688_10895023 | |||
| 1326 | Ga0207680_10004915 | |||
| 1327 | Ga0207680_10305859 | |||
| 1328 | Ga0207680_10598216 | |||
| 1329 | Ga0207647_10036752 | |||
| 1330 | Ga0207685_10011090 | |||
| 1331 | Ga0207699_10004846 | |||
| 1332 | Ga0207699_10224593 | |||
| 1333 | Ga0207643_10062713 | |||
| 1334 | Ga0207705_10029996 | |||
| 1335 | Ga0207705_10088826 | |||
| 1336 | Ga0207705_10319983 | |||
| 1337 | Ga0207705_10426277 | |||
| 1338 | Ga0207684_10307436 | |||
| 1339 | Ga0207684_10942292 | |||
| 1340 | Ga0207654_10011466 | |||
| 1341 | Ga0207654_10080529 | |||
| 1342 | Ga0207654_10199344 | |||
| 1343 | Ga0207654_10414551 | |||
| 1344 | Ga0207654_10474055 | |||
| 1345 | Ga0207654_10633397 | |||
| 1346 | Ga0207654_10778137 | |||
| 1347 | Ga0207707_10001130 | |||
| 1348 | Ga0207707_10003004 | |||
| 1349 | Ga0207707_10013950 | |||
| 1350 | Ga0207707_10051604 | |||
| 1351 | Ga0207707_10058678 | |||
| 1352 | Ga0207707_10065705 | |||
| 1353 | Ga0207707_10110376 | |||
| 1354 | Ga0207707_10305232 | |||
| 1355 | Ga0207707_10420784 | |||
| 1356 | Ga0207707_10672798 | |||
| 1357 | Ga0207695_10005972 | |||
| 1358 | Ga0207695_10030294 | |||
| 1359 | Ga0207695_10036038 | |||
| 1360 | Ga0207695_10080344 | |||
| 1361 | Ga0207695_10191675 | |||
| 1362 | Ga0207695_10258296 | |||
| 1363 | Ga0207695_10264046 | |||
| 1364 | Ga0207695_10349043 | |||
| 1365 | Ga0207695_10937945 | |||
| 1366 | Ga0207671_10026181 | |||
| 1367 | Ga0207671_10279347 | |||
| 1368 | Ga0207671_10423196 | |||
| 1369 | Ga0207671_10479775 | |||
| 1370 | Ga0207693_10031852 | |||
| 1371 | Ga0207693_10351606 | |||
| 1372 | Ga0207693_10941343 | |||
| 1373 | Ga0207693_10942109 | |||
| 1374 | Ga0207663_10026767 | |||
| 1375 | Ga0207663_10175750 | |||
| 1376 | Ga0207663_10325424 | |||
| 1377 | Ga0207663_10882148 | |||
| 1378 | Ga0207660_10031472 | |||
| 1379 | Ga0207660_10145553 | |||
| 1380 | Ga0207660_10325393 | |||
| 1381 | Ga0207660_10346657 | |||
| 1382 | Ga0207657_10001039 | |||
| 1383 | Ga0207657_10211729 | |||
| 1384 | Ga0207657_10324397 | |||
| 1385 | Ga0207657_10931894 | |||
| 1386 | Ga0207649_10060976 | |||
| 1387 | Ga0207652_10050077 | |||
| 1388 | Ga0207652_10056104 | |||
| 1389 | Ga0207652_10344626 | |||
| 1390 | Ga0207652_10440044 | |||
| 1391 | Ga0207652_10484184 | |||
| 1392 | Ga0207694_10000864 | |||
| 1393 | Ga0207694_10006080 | |||
| 1394 | Ga0207694_10071633 | |||
| 1395 | Ga0207694_10221607 | |||
| 1396 | Ga0207694_10318201 | |||
| 1397 | Ga0207694_10367811 | |||
| 1398 | Ga0207694_11225399 | |||
| 1399 | Ga0207650_10003703 | |||
| 1400 | Ga0207659_10157442 | |||
| 1401 | Ga0207659_10266856 | |||
| 1402 | Ga0207687_10001617 | |||
| 1403 | Ga0207687_10020606 | |||
| 1404 | Ga0207687_10239296 | |||
| 1405 | Ga0207687_10301882 | |||
| 1406 | Ga0207687_10367417 | |||
| 1407 | Ga0207687_10436811 | |||
| 1408 | Ga0207687_11166020 | |||
| 1409 | Ga0207700_10010317 | |||
| 1410 | Ga0207700_10065618 | |||
| 1411 | Ga0207700_10118302 | |||
| 1412 | Ga0207700_10256924 | |||
| 1413 | Ga0207700_10261079 | |||
| 1414 | Ga0207700_10692226 | |||
| 1415 | Ga0207664_10052997 | |||
| 1416 | Ga0207664_10088924 | |||
| 1417 | Ga0207664_10098070 | |||
| 1418 | Ga0207664_10247446 | |||
| 1419 | Ga0207644_10124014 | |||
| 1420 | Ga0207644_10939082 | |||
| 1421 | Ga0207690_10111658 | |||
| 1422 | Ga0207706_10041282 | |||
| 1423 | Ga0207706_10059041 | |||
| 1424 | Ga0207686_10021731 | |||
| 1425 | Ga0207686_10050845 | |||
| 1426 | Ga0207686_10075785 | |||
| 1427 | Ga0207686_10168493 | |||
| 1428 | Ga0207686_10275895 | |||
| 1429 | Ga0207686_10365162 | |||
| 1430 | Ga0207686_11126482 | |||
| 1431 | Ga0207709_10033070 | |||
| 1432 | Ga0207709_10816363 | |||
| 1433 | Ga0207670_10049345 | |||
| 1434 | Ga0207670_10948948 | |||
| 1435 | Ga0207704_10005386 | |||
| 1436 | Ga0207704_10053592 | |||
| 1437 | Ga0207704_11517537 | |||
| 1438 | Ga0207665_10005780 | |||
| 1439 | Ga0207665_10078549 | |||
| 1440 | Ga0207665_10372921 | |||
| 1441 | Ga0207665_10471540 | |||
| 1442 | Ga0207691_11092354 | |||
| 1443 | Ga0207711_10010118 | |||
| 1444 | Ga0207711_10136868 | |||
| 1445 | Ga0207711_10189255 | |||
| 1446 | Ga0207711_10197481 | |||
| 1447 | Ga0207711_11196554 | |||
| 1448 | Ga0207689_10042194 | |||
| 1449 | Ga0207689_10221253 | |||
| 1450 | Ga0207689_10277432 | |||
| 1451 | Ga0207689_10523033 | |||
| 1452 | Ga0207689_10897352 | |||
| 1453 | Ga0207661_10239101 | |||
| 1454 | Ga0207661_10266920 | |||
| 1455 | Ga0207661_10362529 | |||
| 1456 | Ga0207661_10546056 | |||
| 1457 | Ga0207679_10046295 | |||
| 1458 | Ga0207679_10058802 | |||
| 1459 | Ga0207679_10231353 | |||
| 1460 | Ga0207679_10721241 | |||
| 1461 | Ga0207679_10957655 | |||
| 1462 | Ga0207667_10003037 | |||
| 1463 | Ga0207667_10012644 | |||
| 1464 | Ga0207667_10021676 | |||
| 1465 | Ga0207667_10036366 | |||
| 1466 | Ga0207667_10042110 | |||
| 1467 | Ga0207667_10343965 | |||
| 1468 | Ga0207667_10641230 | |||
| 1469 | Ga0207667_10671437 | |||
| 1470 | Ga0207651_10469943 | |||
| 1471 | Ga0207651_10576241 | |||
| 1472 | Ga0207651_10794431 | |||
| 1473 | Ga0207712_10231448 | |||
| 1474 | Ga0207640_10002147 | |||
| 1475 | Ga0207640_10088182 | |||
| 1476 | Ga0207640_10232897 | |||
| 1477 | Ga0207640_10370682 | |||
| 1478 | Ga0207658_10669747 | |||
| 1479 | Ga0207677_10012343 | |||
| 1480 | Ga0207677_10208523 | |||
| 1481 | Ga0207677_10269512 | |||
| 1482 | Ga0207677_10317495 | |||
| 1483 | Ga0207677_10533689 | |||
| 1484 | Ga0207677_10608972 | |||
| 1485 | Ga0207703_10008197 | |||
| 1486 | Ga0207703_10018303 | |||
| 1487 | Ga0207703_10068702 | |||
| 1488 | Ga0207703_10473994 | |||
| 1489 | Ga0207703_10988579 | |||
| 1490 | Ga0207703_11632435 | |||
| 1491 | Ga0207703_12189417 | |||
| 1492 | Ga0207639_10182795 | |||
| 1493 | Ga0207639_10212706 | |||
| 1494 | Ga0207639_10300737 | |||
| 1495 | Ga0207639_10347622 | |||
| 1496 | Ga0207639_10486777 | |||
| 1497 | Ga0207639_10702478 | |||
| 1498 | Ga0207702_10000086 | |||
| 1499 | Ga0207702_10000764 | |||
| 1500 | Ga0207702_10001551 | |||
| 1501 | Ga0207702_10060549 | |||
| 1502 | Ga0207702_10076477 | |||
| 1503 | Ga0207702_10126543 | |||
| 1504 | Ga0207702_10137446 | |||
| 1505 | Ga0207702_10260293 | |||
| 1506 | Ga0207702_10354693 | |||
| 1507 | Ga0207641_10044529 | |||
| 1508 | Ga0207641_10096455 | |||
| 1509 | Ga0207641_10977987 | |||
| 1510 | Ga0207641_11733735 | |||
| 1511 | Ga0207648_10010395 | |||
| 1512 | Ga0207648_10078615 | |||
| 1513 | Ga0207648_10126556 | |||
| 1514 | Ga0207648_10199089 | |||
| 1515 | Ga0207648_10604125 | |||
| 1516 | Ga0207676_10007435 | |||
| 1517 | Ga0207676_10028966 | |||
| 1518 | Ga0207676_10771882 | |||
| 1519 | Ga0207676_10845005 | |||
| 1520 | Ga0207676_10880594 | |||
| 1521 | Ga0207674_10000281 | |||
| 1522 | Ga0207674_10002923 | |||
| 1523 | Ga0207674_10003767 | |||
| 1524 | Ga0207674_10005414 | |||
| 1525 | Ga0207674_10087427 | |||
| 1526 | Ga0207674_10663714 | |||
| 1527 | Ga0207683_10165829 | |||
| 1528 | Ga0207683_10259963 | |||
| 1529 | Ga0207698_10175167 | |||
| 1530 | Ga0207698_10783760 | |||
| 1531 | Ga0207428_11225953 | |||
| 1532 | Ga0265354_1002668 | |||
| 1533 | Ga0265354_1009161 | |||
| 1534 | Ga0268266_10048282 | |||
| 1535 | Ga0268266_10150356 | |||
| 1536 | Ga0268266_10367815 | |||
| 1537 | Ga0268266_11030164 | |||
| 1538 | Ga0268265_10715355 | |||
| 1539 | Ga0268264_10035203 | |||
| 1540 | Ga0268264_10231403 | |||
| 1541 | Ga0268264_10232076 | |||
| 1542 | Ga0268264_10293396 | |||
| 1543 | Ga0268264_10527066 | |||
| 1544 | Ga0268264_10655158 | |||
| 1545 | Ga0268264_10729019 | |||
| 1546 | Ga0265318_10202923 | |||
| 1547 | Ga0265336_10034555 | |||
| 1548 | Ga0265338_10012644 | |||
| 1549 | Ga0265338_10079554 | |||
| 1550 | Ga0265338_10127337 | |||
| 1551 | Ga0265338_10908303 | |||
| 1552 | Ga0265324_10023178 | |||
| 1553 | Ga0265779_112912 | |||
| 1554 | Ga0265760_10000817 | |||
| 1555 | Ga0265760_10007880 | |||
| 1556 | Ga0265760_10045693 | |||
| 1557 | Ga0265760_10299426 | |||
| 1558 | Ga0265330_10106803 | |||
| 1559 | Ga0265332_10018593 | |||
| 1560 | Ga0265328_10009924 | |||
| 1561 | Ga0265320_10059887 | |||
| 1562 | Ga0265325_10028309 | |||
| 1563 | Ga0265325_10069949 | |||
| 1564 | Ga0265340_10037949 | |||
| 1565 | Ga0265339_10115353 | |||
| 1566 | Ga0265331_10002235 | |||
| 1567 | Ga0265331_10048448 | |||
| 1568 | Ga0265327_10156072 | |||
| 1569 | Ga0265316_10004839 | |||
| 1570 | Ga0265316_10005224 | |||
| 1571 | Ga0265316_10034153 | |||
| 1572 | Ga0265313_10056517 | |||
| 1573 | Ga0265314_10003389 | |||
| 1574 | Ga0265314_10007710 | |||
| 1575 | Ga0265314_10032599 | |||
| 1576 | Ga0265342_10049946 | |||
| 1577 | Ga0265342_10421963 | |||
| 1578 | Ga0373930_0045806 | |||
| 1579 | Ga0373926_0008935 | |||
| 1580 | Ga0373926_0010008 | |||
| 1581 | Ga0373934_0223481 | |||
| 1582 | Ga0373923_0676094 | |||
| 1583 | Ga0373932_0335996 | |||
| 1584 | Ga0373936_0035404 | |||
| 1585 | Ga0373936_0241510 | |||
| 1586 | Ga0373954_0020632 | |||
| 1587 | Ga0373954_0494909 | |||
| 1588 | Ga0373954_0561074 | |||
| 1589 | Ga0373957_0090127 | |||
| 1590 | Ga0373943_0009063 | |||
| 1591 | Ga0373943_0346304 | |||
| 1592 | Ga0373946_0075247 | |||
| 1593 | Ga0373946_0509298 | |||
| 1594 | Ga0373955_0284032 | |||
| 1595 | Ga0373961_0103573 | |||
| 1596 | Ga0373931_0008193 | |||
| 1597 | Ga0373935_0002744 | |||
| 1598 | Ga0373935_0051208 | |||
| 1599 | Ga0373927_0001178 | |||
| 1600 | Ga0373927_0002368 | |||
| 1601 | Ga0373927_0019125 | |||
| 1602 | Ga0373927_0099736 | |||
| 1603 | Ga0373927_0164270 | |||
| 1604 | Ga0373927_0987642 | |||
| 1605 | Ga0373933_0108299 | |||
| 1606 | Ga0373933_0289983 | |||
| 1607 | Ga0373933_0290090 | |||
| 1608 | Ga0373947_0000791 | |||
| 1609 | Ga0373947_0010631 | |||
| 1610 | Ga0373947_0011446 | |||
| 1611 | Ga0373937_0050240 | |||
| 1612 | Ga0373937_0064239 | |||
| 1613 | Ga0373937_0162599 | |||
| 1614 | Ga0373937_0274716 | |||
| 1615 | Ga0373937_0300286 | |||
| 1616 | Ga0373937_0342455 | |||
| 1617 | Ga0373925_0001414 | |||
| 1618 | Ga0373925_0006773 | |||
| 1619 | Ga0373925_0097371 | |||
| 1620 | Ga0373925_0317902 | |||
| 1621 | Ga0373925_0673340 | |||
| 1622 | Ga0373925_0706349 | |||
| 1623 | Ga0373925_0706405 | |||
| 1624 | Ga0395905_0927736 | |||
| 1625 | Ga0436364_0264121 | |||
| 1626 | Ga0436364_0273915 | |||
| 1627 | Ga0436364_0683917 | |||
| 1628 | Ga0436364_0800017 | |||
| 1629 | Ga0436364_0877214 | |||
| 1630 | Ga0436364_1415525 | |||
| 1631 | Ga0436364_1426312 | |||
| 1632 | Ga0436364_1528712 | |||
| 1633 | Ga0395901_0314352 | |||
| 1634 | Ga0395901_1890523 | |||
| 1635 | Ga0436365_0277120 | |||
| 1636 | Ga0436365_0447678 | |||
| 1637 | Ga0436365_0655522 | |||
| 1638 | Ga0436365_0879694 | |||
| 1639 | Ga0436365_1203388 | |||
| 1640 | Ga0436365_1707053 | |||
| 1641 | Ga0436363_0612734 | |||
| 1642 | Ga0436362_0187453 | |||
| 1643 | Ga0436362_0413443 | |||
| 1644 | Ga0436362_0430208 | |||
| 1645 | Ga0436362_0981073 | |||
| 1646 | Ga0439448_0206994 | |||
| 1647 | Ga0451577_1800257 | |||
| 1648 | Ga0466966_0661164 | |||
| 1649 | Ga0466961_0060946 | |||
| 1650 | Ga0466964_0070967 | |||
| 1651 | Ga0466971_0244778 | |||
| 1652 | Ga0466968_0202473 | |||
| 1653 | Ga0466957_0077705 | |||
| 1654 | Ga0466959_0831934 | |||
| 1655 | Ga0451576_1262280 | |||
| 1656 | Ga0451576_1630038 | |||
| 1657 | Ga0466958_0728219 | |||
| 1658 | Ga0466967_0119153 | |||
| 1659 | Ga0466967_0288577 | |||
| 1660 | Ga0495592_0033185 | |||
| 1661 | Ga0495651_0061861 | |||
| 1662 | Ga0495653_0110226 | |||
| 1663 | Ga0495580_0005708 | |||
| 1664 | Ga0495580_0008511 | |||
| 1665 | Ga0495580_0035060 | |||
| 1666 | Ga0495580_0059078 | |||
| 1667 | Ga0495580_0109030 | |||
| 1668 | Ga0495580_0196975 | |||
| 1669 | Ga0495580_0199371 | |||
| 1670 | Ga0495580_0276101 | |||
| 1671 | Ga0495580_0494976 | |||
| 1672 | Ga0495582_0001573 | |||
| 1673 | Ga0495582_0021526 | |||
| 1674 | Ga0495582_0101287 | |||
| 1675 | Ga0495639_0601203 | |||
| 1676 | Ga0495662_0017566 | |||
| 1677 | Ga0495664_0006701 | |||
| 1678 | Ga0495664_0259746 | |||
| 1679 | Ga0495608_0040514 | |||
| 1680 | Ga0495618_0238947 | |||
| 1681 | Ga0495628_0010921 | |||
| 1682 | Ga0495630_0009909 | |||
| 1683 | Ga0495630_0319430 | |||
| 1684 | Ga0495630_0933209 | |||
| 1685 | Ga0495666_0100346 | |||
| 1686 | Ga0495652_0007150 | |||
| 1687 | Ga0495665_0014059 | |||
| 1688 | Ga0495665_0162388 | |||
| 1689 | Ga0495665_0197162 | |||
| 1690 | Ga0495640_0022814 | |||
| 1691 | Ga0495587_0026684 | |||
| 1692 | Ga0495587_0131832 | |||
| 1693 | Ga0495587_0690319 | |||
| 1694 | Ga0495645_0003842 | |||
| 1695 | Ga0495645_0257816 | |||
| 1696 | Ga0495667_0042546 | |||
| 1697 | Ga0495634_0008872 | |||
| 1698 | Ga0495635_0029254 | |||
| 1699 | Ga0495635_0452855 | |||
| 1700 | Ga0495657_0361740 | |||
| 1701 | Ga0495599_0006439 | |||
| 1702 | Ga0495599_0533057 | |||
| 1703 | Ga0495623_0058656 | |||
| 1704 | Ga0495623_0135753 | |||
| 1705 | Ga0495646_0207300 | |||
| 1706 | Ga0495647_0452949 | |||
| 1707 | Ga0495658_0204434 | |||
| 1708 | Ga0495669_0070932 | |||
| 1709 | Ga0495669_0376496 | |||
| 1710 | Ga0495613_0047448 | |||
| 1711 | Ga0495613_0262314 | |||
| 1712 | Ga0495600_0044601 | |||
| 1713 | Ga0495581_0023298 | |||
| 1714 | Ga0495581_0348572 | |||
| 1715 | Ga0495581_0567926 | |||
| 1716 | Ga0495604_0014207 | |||
| 1717 | Ga0495636_0176896 | |||
| 1718 | Ga0495674_0032395 | |||
| 1719 | Ga0495674_0221808 | |||
| 1720 | Ga0495674_0297388 | |||
| 1721 | Ga0495680_0063802 | |||
| 1722 | Ga0495675_0044588 | |||
| 1723 | Ga0495685_278766 | |||
| 1724 | Ga0495684_0020315 | |||
| 1725 | Ga0495684_0088444 | |||
| 1726 | Ga0495684_0520988 | |||
| 1727 | Ga0495593_0635758 | |||
| 1728 | Ga0495602_0082199 | |||
| 1729 | Ga0495602_0088109 | |||
| 1730 | Ga0495602_0327665 | |||
| 1731 | Ga0496102_1046635 | |||
| 1732 | Ga0496105_0134025 | |||
| 1733 | Ga0496106_0847972 | |||
| 1734 | Ga0496109_0507547 | |||
| 1735 | Ga0496109_1577145 | |||
| 1736 | Ga0496110_0842663 | |||
| 1737 | Ga0496111_0316450 | |||
| 1738 | Ga0496112_0006449 | |||
| 1739 | Ga0496112_0100051 | |||
| 1740 | Ga0496112_0461037 | |||
| 1741 | Ga0496112_0924573 | |||
| 1742 | Ga0496112_1578382 | |||
| 1743 | Ga0496113_0464732 | |||
| 1744 | Ga0496115_0122639 | |||
| 1745 | Ga0496115_0155535 | |||
| 1746 | Ga0496115_0513016 | |||
| 1747 | Ga0501047_0667679 | |||
| 1748 | Ga0501073_0599093 | |||
| 1749 | Ga0501075_0498456 | |||
| 1750 | Ga0501044_0061261 | |||
| 1751 | Ga0501044_0470085 | |||
| 1752 | Ga0501045_1287931 | |||
| 1753 | nmdc:mga05p37_764514_c1 | |||
| 1754 | nmdc:mga08y16_1758137_c1 | |||
| 1755 | nmdc:mga08y16_498733_c1 | |||
| 1756 | nmdc:mga0n895_164043_c1 | |||
| 1757 | nmdc:mga0n895_825817_c1 | |||
| 1758 | nmdc:mga0rr50_1105429_c1 | |||
| 1759 | nmdc:mga0rr50_182698_c1 | |||
| 1760 | nmdc:mga0rr50_1847_c1 | |||
| 1761 | nmdc:mga0rr50_25385_c1 | |||
| 1762 | nmdc:mga08x19_1063_c1 | |||
| 1763 | nmdc:mga08x19_142149_c1 | |||
| 1764 | nmdc:mga08x19_32527_c1 | |||
| 1765 | nmdc:mga08x19_9104_c1 | |||
| 1766 | nmdc:mga0a205_225_c1 | |||
| 1767 | Ga0495612_0370210 | |||
| 1768 | Ga0495619_1000452 | |||
| 1769 | Ga0587088_145161 | |||
| 1770 | Ga0501082_0000163 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fto-assembly1.cif.gz_h | e. coli 70s ribosome with an improved ms2 tag inserted in h98 | 0.9819 | 1 | 41 |
| 8cgd-assembly1.cif.gz_h | clindamycin bound to the 50s subunit | 0.9811 | 1 | 41 |
| 8aye-assembly1.cif.gz_h | e. coli 70s ribosome bound to thermorubin and fmet-trna | 0.9805 | 1 | 41 |
| 8ceu-assembly1.cif.gz_h | retapamulin and capreomycin bound to the 50s subunit | 0.9745 | 1 | 41 |
| 7y7e-assembly1.cif.gz_h | structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) | 0.9738 | 1 | 41 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2T3_1_54_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9696 | 1 | 51 | 3.40.5.10 |
| 3i9eK01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9586 | 1 | 57 | 3.40.5.10 |
| af_Q2G2T3_62_150_3.10.430.100 | Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain | 0.9552 | 61 | 147 | 3.10.430.100 |
| af_A0A1D6HNM4_48_91_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.953 | 3 | 42 | 3.40.5.10 |
| 4l6lI01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9513 | 1 | 57 | 3.40.5.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9ICB5-F1-model_v4 | deleted | 0.9834 | 1 | 148 |
|
| AF-A0A7T9ICB5-F1-model_v4 | deleted | 0.9704 | 1 | 148 |
|
| AF-A0A2D9HBR2-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9697 | 1 | 151 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-B3EKG2-F1-model_v4 | Large ribosomal subunit protein bL9 (50S ribosomal protein L9) | 0.9679 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6A0IEP8-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9663 | 1 | 147 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |