F484667

General Info

Members Datasets Scaffolds Average Seq Length
885 298 1770 149

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10084938|Ga0265316_100849384
Length 139
Sequence MEVILREDVEKLGSRGDMVRVASGYARNFLLPKRLAVAATDANRKIVEQERQAHLREDLSKLLTGVTVTIMQKAGEQDQLFGSVTSKDVADALAAKNFTIDRRKIQLDEPIKTLGEFKVPVKLHKDVIAEVTVVVAKED

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 28.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10084938 3300031344 Unclassified 2423
2 LJNas_1000260 3300000546 Bacteria 9129
3 JGI24737J22298_10091288 3300001990 Bacteria 903
4 rootL2_10241530 3300003322 Bacteria 1268
5 Ga0058863_10029568 3300004799 Bacteria 2846
6 Ga0065712_10353710 3300005290 Bacteria 784
7 Ga0070658_10047356 3300005327 Bacteria 3480
8 Ga0070658_10426613 3300005327 Unclassified 1141
9 Ga0070658_11086340 3300005327 Unclassified 696
10 Ga0070683_100030293 3300005329 Bacteria 4910
11 Ga0070683_100133717 3300005329 Bacteria 2348
12 Ga0070683_100170304 3300005329 Bacteria 2067
13 Ga0070683_100758586 3300005329 Bacteria 930
14 Ga0070690_100073959 3300005330 Unclassified 2218
15 Ga0070690_100221945 3300005330 Unclassified 1324
16 Ga0070690_100234369 3300005330 Unclassified 1292
17 Ga0070670_100001671 3300005331 Bacteria 18007
18 Ga0068869_100029513 3300005334 Bacteria 3844
19 Ga0068869_100318641 3300005334 Bacteria 1260
20 Ga0068869_100964164 3300005334 Unclassified 741
21 Ga0068869_101312210 3300005334 Unclassified 639
22 Ga0070666_10012008 3300005335 Bacteria 5451
23 Ga0070680_100000603 3300005336 Bacteria 24867
24 Ga0070680_100053548 3300005336 Bacteria 3294
25 Ga0070680_100186234 3300005336 Bacteria 1749
26 Ga0070680_100257035 3300005336 Bacteria 1477
27 Ga0070680_100740923 3300005336 Unclassified 846
28 Ga0070680_100839079 3300005336 Bacteria 792
29 Ga0070682_100224682 3300005337 Bacteria 1339
30 Ga0070682_100274201 3300005337 Bacteria 1227
31 Ga0068868_100002128 3300005338 Bacteria 13662
32 Ga0068868_100026427 3300005338 Bacteria 4424
33 Ga0068868_100727563 3300005338 Bacteria 890
34 Ga0070660_100104824 3300005339 Bacteria 2243
35 Ga0070660_100190960 3300005339 Bacteria 1659
36 Ga0070660_100218661 3300005339 Bacteria 1548
37 Ga0070660_100462584 3300005339 Bacteria 1053
38 Ga0070660_100597898 3300005339 Bacteria 922
39 Ga0070660_100944342 3300005339 Unclassified 728
40 Ga0070689_100085443 3300005340 Bacteria 2481
41 Ga0070689_100211546 3300005340 Unclassified 1587
42 Ga0070691_10136978 3300005341 Bacteria 1245
43 Ga0070691_10175990 3300005341 Bacteria 1111
44 Ga0070691_10447080 3300005341 Bacteria 737
45 Ga0070661_100010828 3300005344 Bacteria 6349
46 Ga0070661_100230274 3300005344 Unclassified 1424
47 Ga0070692_10041886 3300005345 Bacteria 2348
48 Ga0070675_100110258 3300005354 Bacteria 2327
49 Ga0070671_100151886 3300005355 Bacteria 1955
50 Ga0070671_100595585 3300005355 Bacteria 955
51 Ga0070671_101525399 3300005355 Bacteria 592
52 Ga0070673_100152664 3300005364 Bacteria 1957
53 Ga0070673_100896487 3300005364 Unclassified 822
54 Ga0070688_101037073 3300005365 Bacteria 653
55 Ga0070659_100238255 3300005366 Unclassified 1505
56 Ga0070667_101696926 3300005367 Bacteria 594
57 Ga0070709_10009188 3300005434 Bacteria 5441
58 Ga0070714_100022904 3300005435 Bacteria 5125
59 Ga0070714_100048017 3300005435 Unclassified 3629
60 Ga0070714_100067282 3300005435 Bacteria 3088
61 Ga0070714_100238236 3300005435 Unclassified 1679
62 Ga0070713_100108983 3300005436 Bacteria 2412
63 Ga0070713_100210965 3300005436 Bacteria 1758
64 Ga0070713_101568210 3300005436 Bacteria 639
65 Ga0070710_10026888 3300005437 Unclassified 3064
66 Ga0070711_100049597 3300005439 Bacteria 2875
67 Ga0070711_100291837 3300005439 Bacteria 1294
68 Ga0070711_100654909 3300005439 Bacteria 881
69 Ga0070705_100276861 3300005440 Unclassified 1191
70 Ga0070705_100445621 3300005440 Bacteria 970
71 Ga0070705_101343203 3300005440 Unclassified 594
72 Ga0070694_100250825 3300005444 Unclassified 1339
73 Ga0070694_100603521 3300005444 Bacteria 884
74 Ga0070708_100146004 3300005445 Unclassified 2197
75 Ga0070708_102110438 3300005445 Unclassified 521
76 Ga0070663_100360518 3300005455 Bacteria 1179
77 Ga0070678_100137445 3300005456 Unclassified 1951
78 Ga0070662_100036046 3300005457 Bacteria 3497
79 Ga0070662_100154443 3300005457 Unclassified 1790
80 Ga0070681_10008575 3300005458 Bacteria 10016
81 Ga0070681_10015594 3300005458 Bacteria 7568
82 Ga0070681_10046181 3300005458 Bacteria 4355
83 Ga0070681_10186958 3300005458 Bacteria 1992
84 Ga0070681_10235636 3300005458 Unclassified 1744
85 Ga0070681_10288102 3300005458 Bacteria 1553
86 Ga0070681_10299743 3300005458 Bacteria 1517
87 Ga0070681_10800734 3300005458 Unclassified 859
88 Ga0068867_100005572 3300005459 Bacteria 8920
89 Ga0068867_100093076 3300005459 Bacteria 2290
90 Ga0068867_100667512 3300005459 Bacteria 914
91 Ga0068867_100777916 3300005459 Bacteria 852
92 Ga0070706_100064219 3300005467 Unclassified 3393
93 Ga0070706_100152926 3300005467 Unclassified 2154
94 Ga0070707_100658794 3300005468 Bacteria 1009
95 Ga0070707_101057716 3300005468 Bacteria 777
96 Ga0070698_101823791 3300005471 Bacteria 561
97 Ga0070699_100012164 3300005518 Bacteria 7427
98 Ga0070699_100305666 3300005518 Bacteria 1427
99 Ga0070679_100040984 3300005530 Bacteria 4609
100 Ga0070679_100049582 3300005530 Bacteria 4181
101 Ga0070679_100206472 3300005530 Bacteria 1929
102 Ga0070679_100313845 3300005530 Bacteria 1517
103 Ga0070679_100342935 3300005530 Unclassified 1442
104 Ga0070679_100467399 3300005530 Unclassified 1206
105 Ga0070679_101577942 3300005530 Unclassified 604
106 Ga0070684_100072993 3300005535 Bacteria 3022
107 Ga0070684_100202791 3300005535 Bacteria 1807
108 Ga0070684_100217205 3300005535 Unclassified 1744
109 Ga0070684_100245860 3300005535 Unclassified 1635
110 Ga0070684_100284655 3300005535 Bacteria 1515
111 Ga0070684_100439588 3300005535 Bacteria 1205
112 Ga0070684_100862559 3300005535 Bacteria 848
113 Ga0070684_101326550 3300005535 Unclassified 677
114 Ga0070697_100016006 3300005536 Bacteria 5896
115 Ga0070697_100347231 3300005536 Unclassified 1281
116 Ga0070697_100367250 3300005536 Bacteria 1245
117 Ga0070697_100672455 3300005536 Bacteria 912
118 Ga0070697_101280403 3300005536 Unclassified 654
119 Ga0068853_100582451 3300005539 Bacteria 1062
120 Ga0068853_100675777 3300005539 Bacteria 984
121 Ga0068853_101337001 3300005539 Bacteria 693
122 Ga0070686_100201282 3300005544 Unclassified 1428
123 Ga0070686_101488033 3300005544 Unclassified 570
124 Ga0070695_100025319 3300005545 Bacteria 3663
125 Ga0070695_100269446 3300005545 Bacteria 1247
126 Ga0070695_101214386 3300005545 Bacteria 620
127 Ga0070696_100001210 3300005546 Bacteria 16756
128 Ga0070696_100094269 3300005546 Unclassified 2136
129 Ga0070693_100172898 3300005547 Bacteria 1385
130 Ga0070693_101099947 3300005547 Bacteria 606
131 Ga0070665_100409824 3300005548 Bacteria 1364
132 Ga0070665_100427863 3300005548 Bacteria 1333
133 Ga0070665_100446507 3300005548 Bacteria 1303
134 Ga0068855_100000151 3300005563 Bacteria 88133
135 Ga0068855_100010918 3300005563 Bacteria 10963
136 Ga0068855_100017859 3300005563 Bacteria 8526
137 Ga0068855_100025976 3300005563 Bacteria 7005
138 Ga0068855_100042280 3300005563 Bacteria 5399
139 Ga0068855_100065294 3300005563 Bacteria 4243
140 Ga0068855_100072180 3300005563 Bacteria 4013
141 Ga0068855_100087433 3300005563 Bacteria 3602
142 Ga0068855_100100591 3300005563 Bacteria 3328
143 Ga0068855_100472093 3300005563 Unclassified 1366
144 Ga0068855_101680624 3300005563 Unclassified 648
145 Ga0070664_100001009 3300005564 Bacteria 22089
146 Ga0070664_100111532 3300005564 Bacteria 2387
147 Ga0070664_100179827 3300005564 Bacteria 1879
148 Ga0070664_100193668 3300005564 Unclassified 1812
149 Ga0068857_100000121 3300005577 Bacteria 46931
150 Ga0068857_100004298 3300005577 Bacteria 12017
151 Ga0068857_100026488 3300005577 Bacteria 5111
152 Ga0068857_100031584 3300005577 Bacteria 4680
153 Ga0068857_100116933 3300005577 Bacteria 2399
154 Ga0068857_100162622 3300005577 Unclassified 2026
155 Ga0068854_100020450 3300005578 Bacteria 4479
156 Ga0068854_100094766 3300005578 Bacteria 2227
157 Ga0068854_100160717 3300005578 Unclassified 1740
158 Ga0068854_100588422 3300005578 Bacteria 948
159 Ga0068854_100896702 3300005578 Unclassified 779
160 Ga0068854_101069616 3300005578 Unclassified 717
161 Ga0068856_100000119 3300005614 Bacteria 78324
162 Ga0068856_100000735 3300005614 Bacteria 35512
163 Ga0068856_100003101 3300005614 Bacteria 16968
164 Ga0068856_100005370 3300005614 Bacteria 12631
165 Ga0068856_100104896 3300005614 Bacteria 2821
166 Ga0068856_100152066 3300005614 Bacteria 2324
167 Ga0068856_100176386 3300005614 Bacteria 2149
168 Ga0068856_100188191 3300005614 Bacteria 2078
169 Ga0068856_100213106 3300005614 Unclassified 1947
170 Ga0068856_100473431 3300005614 Bacteria 1273
171 Ga0068856_100704711 3300005614 Unclassified 1030
172 Ga0070702_100096426 3300005615 Bacteria 1805
173 Ga0070702_100519309 3300005615 Unclassified 878
174 Ga0070702_101096792 3300005615 Bacteria 636
175 Ga0068852_100655159 3300005616 Bacteria 1058
176 Ga0068852_100760022 3300005616 Bacteria 982
177 Ga0068852_100818414 3300005616 Bacteria 946
178 Ga0068859_100000415 3300005617 Bacteria 42515
179 Ga0068859_100172739 3300005617 Bacteria 2243
180 Ga0068859_100254457 3300005617 Bacteria 1847
181 Ga0068859_100531129 3300005617 Unclassified 1271
182 Ga0068859_100732096 3300005617 Unclassified 1079
183 Ga0068859_100835072 3300005617 Bacteria 1008
184 Ga0068864_100001353 3300005618 Bacteria 20389
185 Ga0068864_100045482 3300005618 Bacteria 3766
186 Ga0068864_100066790 3300005618 Bacteria 3122
187 Ga0068864_100373628 3300005618 Unclassified 1350
188 Ga0068864_101214695 3300005618 Bacteria 753
189 Ga0068866_10001235 3300005718 Bacteria 11081
190 Ga0068866_10051523 3300005718 Bacteria 2096
191 Ga0068866_10465404 3300005718 Bacteria 830
192 Ga0068861_100826992 3300005719 Bacteria 871
193 Ga0068861_101732483 3300005719 Bacteria 618
194 Ga0068870_10122968 3300005840 Bacteria 1497
195 Ga0068863_100012184 3300005841 Bacteria 8305
196 Ga0068863_100244731 3300005841 Bacteria 1732
197 Ga0068863_100853159 3300005841 Bacteria 910
198 Ga0068863_100947889 3300005841 Bacteria 862
199 Ga0068858_100001756 3300005842 Bacteria 22108
200 Ga0068858_100002944 3300005842 Bacteria 17125
201 Ga0068858_100029443 3300005842 Bacteria 5099
202 Ga0068858_100030314 3300005842 Bacteria 5022
203 Ga0068858_100066403 3300005842 Unclassified 3339
204 Ga0068858_100193802 3300005842 Unclassified 1920
205 Ga0068858_100538773 3300005842 Bacteria 1130
206 Ga0068858_100571175 3300005842 Unclassified 1096
207 Ga0068860_100040407 3300005843 Bacteria 4458
208 Ga0068860_100047838 3300005843 Bacteria 4076
209 Ga0068860_100064485 3300005843 Bacteria 3479
210 Ga0068860_100324231 3300005843 Unclassified 1512
211 Ga0068860_101168585 3300005843 Unclassified 790
212 Ga0068862_101190671 3300005844 Unclassified 760
213 Ga0081540_1025365 3300005983 Bacteria 3412
214 Ga0070717_10000964 3300006028 Bacteria 19200
215 Ga0070717_10031513 3300006028 Bacteria 4266
216 Ga0070717_10038841 3300006028 Bacteria 3870
217 Ga0070717_10225872 3300006028 Bacteria 1647
218 Ga0070717_12110205 3300006028 Unclassified 507
219 Ga0070715_10030273 3300006163 Bacteria 2187
220 Ga0070715_10756531 3300006163 Unclassified 586
221 Ga0070716_100013191 3300006173 Bacteria 4208
222 Ga0070716_100679363 3300006173 Bacteria 784
223 Ga0070716_100794311 3300006173 Unclassified 732
224 Ga0097621_100000073 3300006237 Bacteria 52012
225 Ga0097621_100001536 3300006237 Bacteria 15817
226 Ga0097621_100045384 3300006237 Bacteria 3549
227 Ga0097621_100053414 3300006237 Bacteria 3294
228 Ga0097621_100053609 3300006237 Bacteria 3287
229 Ga0097621_100744980 3300006237 Unclassified 905
230 Ga0097621_100947316 3300006237 Unclassified 803
231 Ga0097621_101364691 3300006237 Bacteria 671
232 Ga0068871_100000258 3300006358 Bacteria 36543
233 Ga0068871_100000932 3300006358 Bacteria 19540
234 Ga0068871_100131493 3300006358 Unclassified 2122
235 Ga0068871_100235455 3300006358 Unclassified 1590
236 Ga0068871_100263619 3300006358 Bacteria 1504
237 Ga0068871_100286378 3300006358 Unclassified 1442
238 Ga0068871_100332643 3300006358 Unclassified 1340
239 Ga0068871_100395697 3300006358 Bacteria 1230
240 Ga0068871_100480215 3300006358 Unclassified 1118
241 Ga0068871_100784342 3300006358 Unclassified 877
242 Ga0075431_101128561 3300006847 Unclassified 748
243 Ga0075433_10000203 3300006852 Bacteria 33282
244 Ga0075434_100000016 3300006871 Bacteria 75294
245 Ga0075434_100779867 3300006871 Bacteria 972
246 Ga0068865_100010820 3300006881 Bacteria 5692
247 Ga0068865_100061318 3300006881 Bacteria 2636
248 Ga0068865_100135800 3300006881 Bacteria 1848
249 Ga0068865_100140494 3300006881 Unclassified 1820
250 Ga0075436_100000459 3300006914 Bacteria 26338
251 Ga0075436_100001267 3300006914 Bacteria 17156
252 Ga0075436_100002867 3300006914 Bacteria 11813
253 Ga0075436_100707132 3300006914 Bacteria 747
254 Ga0075436_100754662 3300006914 Unclassified 723
255 Ga0097620_100000415 3300006931 Bacteria 42515
256 Ga0097620_100172739 3300006931 Bacteria 2243
257 Ga0097620_100254442 3300006931 Bacteria 1847
258 Ga0097620_100531146 3300006931 Unclassified 1271
259 Ga0097620_100732077 3300006931 Unclassified 1079
260 Ga0097620_100835014 3300006931 Bacteria 1008
261 Ga0075435_100000506 3300007076 Bacteria 23788
262 Ga0075435_100055926 3300007076 Unclassified 3189
263 Ga0075435_100218484 3300007076 Unclassified 1618
264 Ga0075435_100694859 3300007076 Unclassified 884
265 Ga0105240_10002859 3300009093 Bacteria 27290
266 Ga0105240_10011668 3300009093 Bacteria 12212
267 Ga0105240_10055622 3300009093 Bacteria 4954
268 Ga0105240_10074432 3300009093 Bacteria 4192
269 Ga0105240_10126413 3300009093 Unclassified 3072
270 Ga0105240_10149958 3300009093 Bacteria 2778
271 Ga0105240_10152022 3300009093 Bacteria 2756
272 Ga0105240_10163889 3300009093 Unclassified 2638
273 Ga0105240_10225186 3300009093 Bacteria 2182
274 Ga0105240_10266938 3300009093 Bacteria 1972
275 Ga0105240_10505847 3300009093 Bacteria 1343
276 Ga0105240_10963439 3300009093 Unclassified 914
277 Ga0105240_11080391 3300009093 Unclassified 855
278 Ga0105240_11111378 3300009093 Unclassified 840
279 Ga0105240_11896834 3300009093 Unclassified 620
280 Ga0111539_11336227 3300009094 Bacteria 832
281 Ga0105245_10018588 3300009098 Bacteria 6079
282 Ga0105245_10138886 3300009098 Bacteria 2287
283 Ga0105245_10447635 3300009098 Bacteria 1299
284 Ga0105245_10607340 3300009098 Unclassified 1121
285 Ga0105245_10675867 3300009098 Bacteria 1064
286 Ga0105245_10800632 3300009098 Unclassified 980
287 Ga0105245_10954363 3300009098 Bacteria 901
288 Ga0105245_11327280 3300009098 Unclassified 769
289 Ga0105245_11467994 3300009098 Bacteria 732
290 Ga0105245_11684623 3300009098 Bacteria 686
291 Ga0105245_11730465 3300009098 Unclassified 678
292 Ga0105245_11799322 3300009098 Unclassified 665
293 Ga0105247_10455044 3300009101 Unclassified 924
294 Ga0114129_10759829 3300009147 Bacteria 1240
295 Ga0105243_10137707 3300009148 Unclassified 2079
296 Ga0105243_10915486 3300009148 Unclassified 873
297 Ga0105241_10024522 3300009174 Bacteria 4479
298 Ga0105241_10051100 3300009174 Bacteria 3151
299 Ga0105241_10096184 3300009174 Bacteria 2345
300 Ga0105241_10280535 3300009174 Bacteria 1423
301 Ga0105241_10349158 3300009174 Bacteria 1284
302 Ga0105241_10451776 3300009174 Bacteria 1137
303 Ga0105241_10636674 3300009174 Unclassified 967
304 Ga0105241_10653210 3300009174 Unclassified 955
305 Ga0105241_10697188 3300009174 Unclassified 927
306 Ga0105241_11337663 3300009174 Unclassified 684
307 Ga0105241_11378370 3300009174 Bacteria 674
308 Ga0105242_10051667 3300009176 Bacteria 3350
309 Ga0105242_10128723 3300009176 Unclassified 2182
310 Ga0105242_10180895 3300009176 Bacteria 1860
311 Ga0105242_10265127 3300009176 Unclassified 1553
312 Ga0105242_10358027 3300009176 Bacteria 1350
313 Ga0105242_10458144 3300009176 Unclassified 1204
314 Ga0105242_10583780 3300009176 Bacteria 1077
315 Ga0105242_10786875 3300009176 Bacteria 940
316 Ga0105242_10908710 3300009176 Bacteria 881
317 Ga0105248_10003718 3300009177 Bacteria 16919
318 Ga0105248_10022851 3300009177 Bacteria 6943
319 Ga0105248_10050489 3300009177 Bacteria 4665
320 Ga0105248_10069163 3300009177 Bacteria 3964
321 Ga0105248_10082903 3300009177 Bacteria 3607
322 Ga0105248_10316600 3300009177 Unclassified 1757
323 Ga0105248_10359047 3300009177 Bacteria 1640
324 Ga0105248_11443114 3300009177 Unclassified 779
325 Ga0105237_10030803 3300009545 Bacteria 5445
326 Ga0105237_10059246 3300009545 Bacteria 3831
327 Ga0105237_10192802 3300009545 Unclassified 2037
328 Ga0105237_10244406 3300009545 Unclassified 1796
329 Ga0105237_10456339 3300009545 Unclassified 1284
330 Ga0105237_10773254 3300009545 Bacteria 967
331 Ga0105238_10000497 3300009551 Bacteria 41307
332 Ga0105238_10033919 3300009551 Bacteria 5194
333 Ga0105238_10067929 3300009551 Bacteria 3565
334 Ga0105238_10071243 3300009551 Bacteria 3473
335 Ga0105238_10183731 3300009551 Bacteria 2068
336 Ga0105238_10207556 3300009551 Unclassified 1935
337 Ga0105238_10528402 3300009551 Bacteria 1183
338 Ga0105238_11604236 3300009551 Bacteria 681
339 Ga0105249_10218529 3300009553 Bacteria 1874
340 Ga0105249_12043156 3300009553 Bacteria 646
341 Ga0105239_10005844 3300010375 Bacteria 14340
342 Ga0105239_10008299 3300010375 Bacteria 11837
343 Ga0105239_10028421 3300010375 Bacteria 6151
344 Ga0105239_10074153 3300010375 Bacteria 3742
345 Ga0105239_10125966 3300010375 Bacteria 2847
346 Ga0105239_10129667 3300010375 Unclassified 2804
347 Ga0105239_10261588 3300010375 Bacteria 1945
348 Ga0105239_10462414 3300010375 Unclassified 1440
349 Ga0105246_10124900 3300011119 Bacteria 1913
350 Ga0105246_10167946 3300011119 Bacteria 1677
351 Ga0105246_10691381 3300011119 Unclassified 893
352 Ga0105246_11357212 3300011119 Bacteria 661
353 Ga0157373_10101562 3300013100 Bacteria 2023
354 Ga0157373_10136753 3300013100 Bacteria 1723
355 Ga0157373_10646498 3300013100 Bacteria 772
356 Ga0157371_10037166 3300013102 Bacteria 3486
357 Ga0157371_10121215 3300013102 Bacteria 1859
358 Ga0157371_11004229 3300013102 Unclassified 637
359 Ga0157370_10000944 3300013104 Bacteria 36878
360 Ga0157370_10024274 3300013104 Bacteria 6006
361 Ga0157370_10029683 3300013104 Bacteria 5363
362 Ga0157370_10041967 3300013104 Bacteria 4410
363 Ga0157370_10212700 3300013104 Unclassified 1792
364 Ga0157370_11240894 3300013104 Unclassified 672
365 Ga0157369_10000108 3300013105 Bacteria 117027
366 Ga0157369_10000788 3300013105 Bacteria 40686
367 Ga0157369_10025124 3300013105 Bacteria 6616
368 Ga0157369_10028125 3300013105 Bacteria 6224
369 Ga0157369_10068636 3300013105 Bacteria 3809
370 Ga0157369_10255562 3300013105 Bacteria 1828
371 Ga0157369_10353424 3300013105 Unclassified 1526
372 Ga0157374_10001477 3300013296 Bacteria 19860
373 Ga0157374_10007082 3300013296 Bacteria 9549
374 Ga0157374_10034864 3300013296 Unclassified 4601
375 Ga0157374_10107114 3300013296 Bacteria 2686
376 Ga0157374_10889543 3300013296 Bacteria 908
377 Ga0157374_10925980 3300013296 Unclassified 890
378 Ga0157374_12571566 3300013296 Bacteria 537
379 Ga0157378_10000030 3300013297 Bacteria 124811
380 Ga0157378_10000099 3300013297 Bacteria 81561
381 Ga0157378_10027391 3300013297 Bacteria 5029
382 Ga0157378_10033299 3300013297 Bacteria 4555
383 Ga0157378_10821145 3300013297 Bacteria 956
384 Ga0157378_11143870 3300013297 Bacteria 816
385 Ga0157378_11233450 3300013297 Unclassified 788
386 Ga0157378_11559682 3300013297 Bacteria 706
387 Ga0163162_10351169 3300013306 Unclassified 1607
388 Ga0163162_10469492 3300013306 Unclassified 1390
389 Ga0163162_10573224 3300013306 Bacteria 1256
390 Ga0163162_11469449 3300013306 Unclassified 776
391 Ga0163162_11517565 3300013306 Bacteria 763
392 Ga0163162_11718973 3300013306 Bacteria 717
393 Ga0163162_12812770 3300013306 Unclassified 560
394 Ga0157372_10000218 3300013307 Bacteria 63626
395 Ga0157372_10000576 3300013307 Bacteria 40151
396 Ga0157372_10003314 3300013307 Bacteria 17396
397 Ga0157372_10018887 3300013307 Bacteria 7418
398 Ga0157372_10347598 3300013307 Unclassified 1728
399 Ga0157372_11366814 3300013307 Unclassified 817
400 Ga0157372_11543121 3300013307 Bacteria 765
401 Ga0157375_10343291 3300013308 Bacteria 1658
402 Ga0157375_10468911 3300013308 Unclassified 1424
403 Ga0157375_10768762 3300013308 Bacteria 1113
404 Ga0157375_11207331 3300013308 Bacteria 887
405 Ga0157375_11541638 3300013308 Bacteria 785
406 Ga0163163_10003193 3300014325 Bacteria 13888
407 Ga0163163_10126344 3300014325 Bacteria 2595
408 Ga0163163_10296747 3300014325 Bacteria 1668
409 Ga0163163_10414130 3300014325 Bacteria 1406
410 Ga0163163_10820960 3300014325 Bacteria 993
411 Ga0163163_10922272 3300014325 Viruses 937
412 Ga0163163_11588391 3300014325 Unclassified 715
413 Ga0157380_11278834 3300014326 Bacteria 780
414 Ga0182008_10279655 3300014497 Bacteria 868
415 Ga0157377_10522872 3300014745 Bacteria 833
416 Ga0157379_10057957 3300014968 Bacteria 3461
417 Ga0157379_11597250 3300014968 Bacteria 637
418 Ga0157376_10159329 3300014969 Bacteria 2044
419 Ga0157376_10300887 3300014969 Unclassified 1518
420 Ga0157376_10430725 3300014969 Unclassified 1282
421 Ga0157376_10997675 3300014969 Unclassified 860
422 Ga0182006_1009694 3300015261 Bacteria 4307
423 Ga0182007_10035405 3300015262 Bacteria 1682
424 Ga0163161_10908819 3300017792 Bacteria 746
425 Ga0184603_118414 3300019192 Bacteria 515
426 Ga0197907_10817353 3300020069 Bacteria 504
427 Ga0206356_10589427 3300020070 Unclassified 736
428 Ga0213876_10145779 3300021384 Unclassified 1259
429 Ga0213876_10343582 3300021384 Unclassified 794
430 Ga0213875_10000008 3300021388 Bacteria 533344
431 Ga0213875_10003390 3300021388 Bacteria 9075
432 Ga0213875_10230615 3300021388 Unclassified 872
433 Ga0213875_10592503 3300021388 Unclassified 535
434 Ga0224712_10054675 3300022467 Bacteria 1568
435 Ga0207692_10061557 3300025898 Bacteria 1945
436 Ga0207692_10177530 3300025898 Bacteria 1239
437 Ga0207642_10002153 3300025899 Bacteria 6104
438 Ga0207642_10069655 3300025899 Unclassified 1669
439 Ga0207710_10078754 3300025900 Unclassified 1525
440 Ga0207688_10895023 3300025901 Unclassified 562
441 Ga0207680_10004915 3300025903 Bacteria 6363
442 Ga0207680_10305859 3300025903 Bacteria 1109
443 Ga0207680_10598216 3300025903 Unclassified 789
444 Ga0207647_10036752 3300025904 Bacteria 3110
445 Ga0207685_10011090 3300025905 Bacteria 2694
446 Ga0207699_10004846 3300025906 Bacteria 6438
447 Ga0207699_10224593 3300025906 Bacteria 1284
448 Ga0207643_10062713 3300025908 Bacteria 2124
449 Ga0207705_10029996 3300025909 Bacteria 3880
450 Ga0207705_10088826 3300025909 Bacteria 2261
451 Ga0207705_10319983 3300025909 Unclassified 1192
452 Ga0207705_10426277 3300025909 Unclassified 1027
453 Ga0207684_10307436 3300025910 Unclassified 1367
454 Ga0207684_10942292 3300025910 Bacteria 724
455 Ga0207654_10011466 3300025911 Bacteria 4523
456 Ga0207654_10080529 3300025911 Unclassified 1958
457 Ga0207654_10199344 3300025911 Bacteria 1317
458 Ga0207654_10414551 3300025911 Unclassified 939
459 Ga0207654_10474055 3300025911 Unclassified 881
460 Ga0207654_10633397 3300025911 Unclassified 765
461 Ga0207654_10778137 3300025911 Unclassified 690
462 Ga0207707_10001130 3300025912 Bacteria 25296
463 Ga0207707_10003004 3300025912 Bacteria 14996
464 Ga0207707_10013950 3300025912 Bacteria 7005
465 Ga0207707_10051604 3300025912 Bacteria 3582
466 Ga0207707_10058678 3300025912 Bacteria 3349
467 Ga0207707_10065705 3300025912 Bacteria 3159
468 Ga0207707_10110376 3300025912 Bacteria 2404
469 Ga0207707_10305232 3300025912 Bacteria 1376
470 Ga0207707_10420784 3300025912 Bacteria 1145
471 Ga0207707_10672798 3300025912 Bacteria 871
472 Ga0207695_10005972 3300025913 Bacteria 15924
473 Ga0207695_10030294 3300025913 Bacteria 5959
474 Ga0207695_10036038 3300025913 Bacteria 5353
475 Ga0207695_10080344 3300025913 Bacteria 3302
476 Ga0207695_10191675 3300025913 Bacteria 1962
477 Ga0207695_10258296 3300025913 Unclassified 1640
478 Ga0207695_10264046 3300025913 Bacteria 1618
479 Ga0207695_10349043 3300025913 Unclassified 1367
480 Ga0207695_10937945 3300025913 Bacteria 745
481 Ga0207671_10026181 3300025914 Bacteria 4373
482 Ga0207671_10279347 3300025914 Unclassified 1317
483 Ga0207671_10423196 3300025914 Unclassified 1060
484 Ga0207671_10479775 3300025914 Bacteria 991
485 Ga0207693_10031852 3300025915 Unclassified 4166
486 Ga0207693_10351606 3300025915 Bacteria 1153
487 Ga0207693_10941343 3300025915 Unclassified 662
488 Ga0207693_10942109 3300025915 Bacteria 661
489 Ga0207663_10026767 3300025916 Bacteria 3352
490 Ga0207663_10175750 3300025916 Bacteria 1525
491 Ga0207663_10325424 3300025916 Bacteria 1156
492 Ga0207663_10882148 3300025916 Bacteria 715
493 Ga0207660_10031472 3300025917 Bacteria 3655
494 Ga0207660_10145553 3300025917 Bacteria 1816
495 Ga0207660_10325393 3300025917 Bacteria 1228
496 Ga0207660_10346657 3300025917 Bacteria 1190
497 Ga0207657_10001039 3300025919 Bacteria 29386
498 Ga0207657_10211729 3300025919 Bacteria 1555
499 Ga0207657_10324397 3300025919 Unclassified 1217
500 Ga0207657_10931894 3300025919 Bacteria 668
501 Ga0207649_10060976 3300025920 Bacteria 2372
502 Ga0207652_10050077 3300025921 Unclassified 3578
503 Ga0207652_10056104 3300025921 Bacteria 3390
504 Ga0207652_10344626 3300025921 Bacteria 1345
505 Ga0207652_10440044 3300025921 Bacteria 1175
506 Ga0207652_10484184 3300025921 Bacteria 1114
507 Ga0207694_10000864 3300025924 Bacteria 26978
508 Ga0207694_10006080 3300025924 Bacteria 9228
509 Ga0207694_10071633 3300025924 Bacteria 2709
510 Ga0207694_10221607 3300025924 Bacteria 1543
511 Ga0207694_10318201 3300025924 Bacteria 1284
512 Ga0207694_10367811 3300025924 Unclassified 1192
513 Ga0207694_11225399 3300025924 Unclassified 635
514 Ga0207650_10003703 3300025925 Bacteria 10449
515 Ga0207659_10157442 3300025926 Bacteria 1780
516 Ga0207659_10266856 3300025926 Bacteria 1395
517 Ga0207687_10001617 3300025927 Bacteria 15514
518 Ga0207687_10020606 3300025927 Bacteria 4376
519 Ga0207687_10239296 3300025927 Bacteria 1438
520 Ga0207687_10301882 3300025927 Bacteria 1290
521 Ga0207687_10367417 3300025927 Bacteria 1176
522 Ga0207687_10436811 3300025927 Unclassified 1083
523 Ga0207687_11166020 3300025927 Bacteria 662
524 Ga0207700_10010317 3300025928 Bacteria 5886
525 Ga0207700_10065618 3300025928 Unclassified 2770
526 Ga0207700_10118302 3300025928 Bacteria 2144
527 Ga0207700_10256924 3300025928 Bacteria 1494
528 Ga0207700_10261079 3300025928 Bacteria 1483
529 Ga0207700_10692226 3300025928 Bacteria 910
530 Ga0207664_10052997 3300025929 Bacteria 3209
531 Ga0207664_10088924 3300025929 Unclassified 2528
532 Ga0207664_10098070 3300025929 Bacteria 2416
533 Ga0207664_10247446 3300025929 Unclassified 1555
534 Ga0207644_10124014 3300025931 Bacteria 1970
535 Ga0207644_10939082 3300025931 Unclassified 725
536 Ga0207690_10111658 3300025932 Unclassified 1970
537 Ga0207706_10041282 3300025933 Bacteria 4090
538 Ga0207706_10059041 3300025933 Bacteria 3378
539 Ga0207686_10021731 3300025934 Bacteria 3687
540 Ga0207686_10050845 3300025934 Bacteria 2579
541 Ga0207686_10075785 3300025934 Unclassified 2179
542 Ga0207686_10168493 3300025934 Bacteria 1542
543 Ga0207686_10275895 3300025934 Unclassified 1239
544 Ga0207686_10365162 3300025934 Bacteria 1091
545 Ga0207686_11126482 3300025934 Unclassified 640
546 Ga0207709_10033070 3300025935 Bacteria 3033
547 Ga0207709_10816363 3300025935 Unclassified 753
548 Ga0207670_10049345 3300025936 Unclassified 2815
549 Ga0207670_10948948 3300025936 Bacteria 722
550 Ga0207704_10005386 3300025938 Bacteria 5897
551 Ga0207704_10053592 3300025938 Unclassified 2453
552 Ga0207704_11517537 3300025938 Unclassified 575
553 Ga0207665_10005780 3300025939 Bacteria 8227
554 Ga0207665_10078549 3300025939 Unclassified 2267
555 Ga0207665_10372921 3300025939 Bacteria 1081
556 Ga0207665_10471540 3300025939 Unclassified 966
557 Ga0207691_11092354 3300025940 Bacteria 664
558 Ga0207711_10010118 3300025941 Bacteria 7835
559 Ga0207711_10136868 3300025941 Unclassified 2200
560 Ga0207711_10189255 3300025941 Unclassified 1875
561 Ga0207711_10197481 3300025941 Bacteria 1835
562 Ga0207711_11196554 3300025941 Unclassified 701
563 Ga0207689_10042194 3300025942 Bacteria 3775
564 Ga0207689_10221253 3300025942 Bacteria 1564
565 Ga0207689_10277432 3300025942 Bacteria 1388
566 Ga0207689_10523033 3300025942 Bacteria 995
567 Ga0207689_10897352 3300025942 Bacteria 748
568 Ga0207661_10239101 3300025944 Bacteria 1611
569 Ga0207661_10266920 3300025944 Bacteria 1526
570 Ga0207661_10362529 3300025944 Bacteria 1309
571 Ga0207661_10546056 3300025944 Bacteria 1061
572 Ga0207679_10046295 3300025945 Bacteria 3152
573 Ga0207679_10058802 3300025945 Bacteria 2850
574 Ga0207679_10231353 3300025945 Bacteria 1561
575 Ga0207679_10721241 3300025945 Bacteria 906
576 Ga0207679_10957655 3300025945 Unclassified 784
577 Ga0207667_10003037 3300025949 Bacteria 20829
578 Ga0207667_10012644 3300025949 Bacteria 9700
579 Ga0207667_10021676 3300025949 Bacteria 7117
580 Ga0207667_10036366 3300025949 Bacteria 5278
581 Ga0207667_10042110 3300025949 Bacteria 4856
582 Ga0207667_10343965 3300025949 Unclassified 1522
583 Ga0207667_10641230 3300025949 Bacteria 1068
584 Ga0207667_10671437 3300025949 Unclassified 1040
585 Ga0207651_10469943 3300025960 Bacteria 1082
586 Ga0207651_10576241 3300025960 Bacteria 981
587 Ga0207651_10794431 3300025960 Bacteria 839
588 Ga0207712_10231448 3300025961 Bacteria 1484
589 Ga0207640_10002147 3300025981 Bacteria 10603
590 Ga0207640_10088182 3300025981 Bacteria 2141
591 Ga0207640_10232897 3300025981 Bacteria 1418
592 Ga0207640_10370682 3300025981 Unclassified 1157
593 Ga0207658_10669747 3300025986 Unclassified 936
594 Ga0207677_10012343 3300026023 Bacteria 4907
595 Ga0207677_10208523 3300026023 Bacteria 1559
596 Ga0207677_10269512 3300026023 Bacteria 1392
597 Ga0207677_10317495 3300026023 Unclassified 1293
598 Ga0207677_10533689 3300026023 Bacteria 1020
599 Ga0207677_10608972 3300026023 Bacteria 959
600 Ga0207703_10008197 3300026035 Bacteria 8255
601 Ga0207703_10018303 3300026035 Bacteria 5471
602 Ga0207703_10068702 3300026035 Bacteria 2920
603 Ga0207703_10473994 3300026035 Bacteria 1172
604 Ga0207703_10988579 3300026035 Bacteria 807
605 Ga0207703_11632435 3300026035 Unclassified 620
606 Ga0207703_12189417 3300026035 Unclassified 529
607 Ga0207639_10182795 3300026041 Bacteria 1785
608 Ga0207639_10212706 3300026041 Bacteria 1665
609 Ga0207639_10300737 3300026041 Bacteria 1418
610 Ga0207639_10347622 3300026041 Bacteria 1324
611 Ga0207639_10486777 3300026041 Bacteria 1125
612 Ga0207639_10702478 3300026041 Bacteria 938
613 Ga0207702_10000086 3300026078 Bacteria 106199
614 Ga0207702_10000764 3300026078 Bacteria 34175
615 Ga0207702_10001551 3300026078 Bacteria 22731
616 Ga0207702_10060549 3300026078 Bacteria 3227
617 Ga0207702_10076477 3300026078 Unclassified 2894
618 Ga0207702_10126543 3300026078 Bacteria 2295
619 Ga0207702_10137446 3300026078 Bacteria 2207
620 Ga0207702_10260293 3300026078 Bacteria 1633
621 Ga0207702_10354693 3300026078 Unclassified 1404
622 Ga0207641_10044529 3300026088 Bacteria 3733
623 Ga0207641_10096455 3300026088 Bacteria 2597
624 Ga0207641_10977987 3300026088 Bacteria 842
625 Ga0207641_11733735 3300026088 Bacteria 626
626 Ga0207648_10010395 3300026089 Bacteria 8822
627 Ga0207648_10078615 3300026089 Bacteria 2878
628 Ga0207648_10126556 3300026089 Bacteria 2248
629 Ga0207648_10199089 3300026089 Bacteria 1776
630 Ga0207648_10604125 3300026089 Bacteria 1011
631 Ga0207676_10007435 3300026095 Bacteria 7769
632 Ga0207676_10028966 3300026095 Bacteria 4142
633 Ga0207676_10771882 3300026095 Unclassified 936
634 Ga0207676_10845005 3300026095 Bacteria 895
635 Ga0207676_10880594 3300026095 Bacteria 877
636 Ga0207674_10000281 3300026116 Bacteria 64232
637 Ga0207674_10002923 3300026116 Bacteria 21216
638 Ga0207674_10003767 3300026116 Bacteria 18504
639 Ga0207674_10005414 3300026116 Bacteria 15175
640 Ga0207674_10087427 3300026116 Bacteria 3110
641 Ga0207674_10663714 3300026116 Bacteria 1007
642 Ga0207683_10165829 3300026121 Unclassified 1999
643 Ga0207683_10259963 3300026121 Bacteria 1585
644 Ga0207698_10175167 3300026142 Bacteria 1893
645 Ga0207698_10783760 3300026142 Bacteria 954
646 Ga0207428_11225953 3300027907 Unclassified 521
647 Ga0265354_1002668 3300028016 Unclassified 2161
648 Ga0265354_1009161 3300028016 Bacteria 952
649 Ga0268266_10048282 3300028379 Unclassified 3648
650 Ga0268266_10150356 3300028379 Unclassified 2098
651 Ga0268266_10367815 3300028379 Bacteria 1354
652 Ga0268266_11030164 3300028379 Unclassified 796
653 Ga0268265_10715355 3300028380 Bacteria 969
654 Ga0268264_10035203 3300028381 Bacteria 4122
655 Ga0268264_10231403 3300028381 Unclassified 1707
656 Ga0268264_10232076 3300028381 Bacteria 1705
657 Ga0268264_10293396 3300028381 Bacteria 1528
658 Ga0268264_10527066 3300028381 Unclassified 1156
659 Ga0268264_10655158 3300028381 Unclassified 1039
660 Ga0268264_10729019 3300028381 Bacteria 986
661 Ga0265318_10202923 3300028577 Unclassified 725
662 Ga0265336_10034555 3300028666 Bacteria 1562
663 Ga0265338_10012644 3300028800 Bacteria 9610
664 Ga0265338_10079554 3300028800 Unclassified 2758
665 Ga0265338_10127337 3300028800 Unclassified 2018
666 Ga0265338_10908303 3300028800 Unclassified 599
667 Ga0265324_10023178 3300029957 Bacteria 2213
668 Ga0265779_112912 3300031043 Unclassified 533
669 Ga0265760_10000817 3300031090 Bacteria 8977
670 Ga0265760_10007880 3300031090 Bacteria 3043
671 Ga0265760_10045693 3300031090 Archaea 1313
672 Ga0265760_10299426 3300031090 Unclassified 569
673 Ga0265330_10106803 3300031235 Bacteria 1197
674 Ga0265332_10018593 3300031238 Bacteria 3066
675 Ga0265328_10009924 3300031239 Bacteria 3852
676 Ga0265320_10059887 3300031240 Bacteria 1819
677 Ga0265325_10028309 3300031241 Bacteria 3021
678 Ga0265325_10069949 3300031241 Unclassified 1764
679 Ga0265340_10037949 3300031247 Bacteria 2385
680 Ga0265339_10115353 3300031249 Unclassified 1386
681 Ga0265331_10002235 3300031250 Bacteria 13252
682 Ga0265331_10048448 3300031250 Unclassified 2043
683 Ga0265327_10156072 3300031251 Bacteria 1057
684 Ga0265316_10004839 3300031344 Bacteria 13275
685 Ga0265316_10005224 3300031344 Bacteria 12688
686 Ga0265316_10034153 3300031344 Bacteria 4134
687 Ga0265313_10056517 3300031595 Bacteria 1856
688 Ga0265314_10003389 3300031711 Bacteria 15445
689 Ga0265314_10007710 3300031711 Bacteria 9307
690 Ga0265314_10032599 3300031711 Bacteria 3831
691 Ga0265342_10049946 3300031712 Bacteria 2501
692 Ga0265342_10421963 3300031712 Unclassified 687
693 Ga0373930_0045806 3300034816 Bacteria 943
694 Ga0373926_0008935 3300035083 Unclassified 3341
695 Ga0373926_0010008 3300035083 Bacteria 3174
696 Ga0373934_0223481 3300035086 Unclassified 777
697 Ga0373923_0676094 3300035111 Unclassified 512
698 Ga0373932_0335996 3300035112 Unclassified 571
699 Ga0373936_0035404 3300035113 Unclassified 1987
700 Ga0373936_0241510 3300035113 Bacteria 805
701 Ga0373954_0020632 3300035118 Bacteria 2982
702 Ga0373954_0494909 3300035118 Bacteria 606
703 Ga0373954_0561074 3300035118 Unclassified 566
704 Ga0373957_0090127 3300035120 Bacteria 1218
705 Ga0373943_0009063 3300035170 Bacteria 4461
706 Ga0373943_0346304 3300035170 Bacteria 851
707 Ga0373946_0075247 3300035171 Bacteria 1467
708 Ga0373946_0509298 3300035171 Bacteria 618
709 Ga0373955_0284032 3300035172 Bacteria 996
710 Ga0373961_0103573 3300035241 Bacteria 924
711 Ga0373931_0008193 3300035691 Bacteria 4951
712 Ga0373935_0002744 3300035692 Bacteria 10136
713 Ga0373935_0051208 3300035692 Bacteria 2622
714 Ga0373927_0001178 3300035695 Bacteria 19819
715 Ga0373927_0002368 3300035695 Bacteria 13732
716 Ga0373927_0019125 3300035695 Bacteria 4492
717 Ga0373927_0099736 3300035695 Bacteria 1889
718 Ga0373927_0164270 3300035695 Unclassified 1455
719 Ga0373927_0987642 3300035695 Bacteria 555
720 Ga0373933_0108299 3300035724 Bacteria 1731
721 Ga0373933_0289983 3300035724 Bacteria 1058
722 Ga0373933_0290090 3300035724 Unclassified 1058
723 Ga0373947_0000791 3300035725 Bacteria 19015
724 Ga0373947_0010631 3300035725 Bacteria 5280
725 Ga0373947_0011446 3300035725 Bacteria 5090
726 Ga0373937_0050240 3300036401 Bacteria 3819
727 Ga0373937_0064239 3300036401 Bacteria 3376
728 Ga0373937_0162599 3300036401 Bacteria 2093
729 Ga0373937_0274716 3300036401 Bacteria 1591
730 Ga0373937_0300286 3300036401 Unclassified 1518
731 Ga0373937_0342455 3300036401 Bacteria 1416
732 Ga0373925_0001414 3300037068 Bacteria 20838
733 Ga0373925_0006773 3300037068 Bacteria 8398
734 Ga0373925_0097371 3300037068 Bacteria 2256
735 Ga0373925_0317902 3300037068 Bacteria 1259
736 Ga0373925_0673340 3300037068 Bacteria 853
737 Ga0373925_0706349 3300037068 Bacteria 831
738 Ga0373925_0706405 3300037068 Bacteria 831
739 Ga0395905_0927736 3300037471 Bacteria 774
740 Ga0436364_0264121 3300037853 Bacteria 2719
741 Ga0436364_0273915 3300037853 Bacteria 1347
742 Ga0436364_0683917 3300037853 Bacteria 8658
743 Ga0436364_0800017 3300037853 Unclassified 966
744 Ga0436364_0877214 3300037853 Bacteria 3174
745 Ga0436364_1415525 3300037853 Bacteria 425173
746 Ga0436364_1426312 3300037853 Bacteria 3513
747 Ga0436364_1528712 3300037853 Bacteria 1640
748 Ga0395901_0314352 3300038443 Unclassified 1622
749 Ga0395901_1890523 3300038443 Unclassified 545
750 Ga0436365_0277120 3300039437 Unclassified 1360
751 Ga0436365_0447678 3300039437 Unclassified 2718
752 Ga0436365_0655522 3300039437 Bacteria 1586
753 Ga0436365_0879694 3300039437 Unclassified 1755
754 Ga0436365_1203388 3300039437 Unclassified 684
755 Ga0436365_1707053 3300039437 Unclassified 1195
756 Ga0436363_0612734 3300039450 Unclassified 662
757 Ga0436362_0187453 3300039453 Bacteria 756
758 Ga0436362_0413443 3300039453 Bacteria 767
759 Ga0436362_0430208 3300039453 Bacteria 650
760 Ga0436362_0981073 3300039453 Bacteria 2238
761 Ga0439448_0206994 3300042005 Bacteria 688
762 Ga0451577_1800257 3300042876 Unclassified 537
763 Ga0466966_0661164 3300044684 Unclassified 629
764 Ga0466961_0060946 3300044693 Unclassified 2399
765 Ga0466964_0070967 3300044706 Bacteria 1473
766 Ga0466971_0244778 3300044719 Unclassified 853
767 Ga0466968_0202473 3300044735 Bacteria 930
768 Ga0466957_0077705 3300044842 Unclassified 2063
769 Ga0466959_0831934 3300045049 Unclassified 617
770 Ga0451576_1262280 3300045051 Bacteria 771
771 Ga0451576_1630038 3300045051 Bacteria 669
772 Ga0466958_0728219 3300045836 Unclassified 646
773 Ga0466967_0119153 3300045976 Bacteria 2436
774 Ga0466967_0288577 3300045976 Unclassified 1576
775 Ga0495592_0033185 3300046454 Bacteria 3894
776 Ga0495651_0061861 3300046462 Bacteria 2865
777 Ga0495653_0110226 3300046463 Bacteria 1979
778 Ga0495580_0005708 3300046472 Bacteria 10237
779 Ga0495580_0008511 3300046472 Bacteria 8156
780 Ga0495580_0035060 3300046472 Bacteria 3609
781 Ga0495580_0059078 3300046472 Unclassified 2695
782 Ga0495580_0109030 3300046472 Bacteria 1922
783 Ga0495580_0196975 3300046472 Unclassified 1389
784 Ga0495580_0199371 3300046472 Bacteria 1379
785 Ga0495580_0276101 3300046472 Bacteria 1147
786 Ga0495580_0494976 3300046472 Unclassified 816
787 Ga0495582_0001573 3300046473 Bacteria 12875
788 Ga0495582_0021526 3300046473 Bacteria 3529
789 Ga0495582_0101287 3300046473 Bacteria 1613
790 Ga0495639_0601203 3300046475 Unclassified 565
791 Ga0495662_0017566 3300046476 Bacteria 3462
792 Ga0495664_0006701 3300046477 Bacteria 6371
793 Ga0495664_0259746 3300046477 Bacteria 1050
794 Ga0495608_0040514 3300046511 Bacteria 3120
795 Ga0495618_0238947 3300046514 Bacteria 1142
796 Ga0495628_0010921 3300046516 Bacteria 7690
797 Ga0495630_0009909 3300046517 Bacteria 6862
798 Ga0495630_0319430 3300046517 Bacteria 1187
799 Ga0495630_0933209 3300046517 Bacteria 661
800 Ga0495666_0100346 3300046526 Bacteria 1364
801 Ga0495652_0007150 3300046529 Bacteria 10301
802 Ga0495665_0014059 3300046531 Bacteria 4323
803 Ga0495665_0162388 3300046531 Unclassified 1164
804 Ga0495665_0197162 3300046531 Unclassified 1044
805 Ga0495640_0022814 3300046533 Bacteria 4570
806 Ga0495587_0026684 3300046536 Bacteria 3521
807 Ga0495587_0131832 3300046536 Bacteria 1428
808 Ga0495587_0690319 3300046536 Bacteria 560
809 Ga0495645_0003842 3300046543 Bacteria 10223
810 Ga0495645_0257816 3300046543 Bacteria 1156
811 Ga0495667_0042546 3300046559 Bacteria 3012
812 Ga0495634_0008872 3300046642 Bacteria 7455
813 Ga0495635_0029254 3300046663 Bacteria 3830
814 Ga0495635_0452855 3300046663 Unclassified 848
815 Ga0495657_0361740 3300046675 Bacteria 857
816 Ga0495599_0006439 3300046678 Bacteria 7083
817 Ga0495599_0533057 3300046678 Unclassified 689
818 Ga0495623_0058656 3300046679 Unclassified 2420
819 Ga0495623_0135753 3300046679 Unclassified 1468
820 Ga0495646_0207300 3300046680 Bacteria 1065
821 Ga0495647_0452949 3300046681 Bacteria 594
822 Ga0495658_0204434 3300046683 Unclassified 1232
823 Ga0495669_0070932 3300046684 Bacteria 1588
824 Ga0495669_0376496 3300046684 Bacteria 687
825 Ga0495613_0047448 3300046689 Bacteria 3173
826 Ga0495613_0262314 3300046689 Bacteria 1203
827 Ga0495600_0044601 3300046809 Bacteria 2893
828 Ga0495581_0023298 3300047315 Unclassified 3588
829 Ga0495581_0348572 3300047315 Bacteria 864
830 Ga0495581_0567926 3300047315 Bacteria 658
831 Ga0495604_0014207 3300047317 Bacteria 6347
832 Ga0495636_0176896 3300047318 Bacteria 967
833 Ga0495674_0032395 3300047319 Bacteria 4740
834 Ga0495674_0221808 3300047319 Bacteria 1562
835 Ga0495674_0297388 3300047319 Bacteria 1319
836 Ga0495680_0063802 3300047322 Bacteria 2827
837 Ga0495675_0044588 3300047444 Bacteria 2825
838 Ga0495685_278766 3300047447 Unclassified 527
839 Ga0495684_0020315 3300047471 Bacteria 5116
840 Ga0495684_0088444 3300047471 Bacteria 2348
841 Ga0495684_0520988 3300047471 Bacteria 814
842 Ga0495593_0635758 3300047673 Unclassified 536
843 Ga0495602_0082199 3300048088 Bacteria 2704
844 Ga0495602_0088109 3300048088 Unclassified 2585
845 Ga0495602_0327665 3300048088 Bacteria 1112
846 Ga0496102_1046635 3300048905 Unclassified 736
847 Ga0496105_0134025 3300048908 Bacteria 2041
848 Ga0496106_0847972 3300048909 Bacteria 723
849 Ga0496109_0507547 3300048912 Bacteria 1138
850 Ga0496109_1577145 3300048912 Bacteria 591
851 Ga0496110_0842663 3300048913 Unclassified 822
852 Ga0496111_0316450 3300048914 Bacteria 1156
853 Ga0496112_0006449 3300048915 Bacteria 10300
854 Ga0496112_0100051 3300048915 Unclassified 2869
855 Ga0496112_0461037 3300048915 Bacteria 1208
856 Ga0496112_0924573 3300048915 Bacteria 794
857 Ga0496112_1578382 3300048915 Unclassified 570
858 Ga0496113_0464732 3300048916 Bacteria 1017
859 Ga0496115_0122639 3300048918 Bacteria 2139
860 Ga0496115_0155535 3300048918 Bacteria 1889
861 Ga0496115_0513016 3300048918 Bacteria 962
862 Ga0501047_0667679 3300049581 Bacteria 858
863 Ga0501073_0599093 3300049589 Bacteria 761
864 Ga0501075_0498456 3300049591 Bacteria 929
865 Ga0501044_0061261 3300049823 Unclassified 3850
866 Ga0501044_0470085 3300049823 Bacteria 1162
867 Ga0501045_1287931 3300049824 Bacteria 532
868 nmdc:mga05p37_764514_c1 3300050507 Bacteria 1063
869 nmdc:mga08y16_1758137_c1 3300050511 Unclassified 574
870 nmdc:mga08y16_498733_c1 3300050511 Bacteria 1237
871 nmdc:mga0n895_164043_c1 3300050512 Bacteria 2253
872 nmdc:mga0n895_825817_c1 3300050512 Bacteria 916
873 nmdc:mga0rr50_1105429_c1 3300050513 Unclassified 674
874 nmdc:mga0rr50_182698_c1 3300050513 Bacteria 1715
875 nmdc:mga0rr50_1847_c1 3300050513 Unclassified 4141
876 nmdc:mga0rr50_25385_c1 3300050513 Bacteria 4119
877 nmdc:mga08x19_1063_c1 3300050514 Bacteria 17156
878 nmdc:mga08x19_142149_c1 3300050514 Bacteria 1621
879 nmdc:mga08x19_32527_c1 3300050514 Bacteria 3288
880 nmdc:mga08x19_9104_c1 3300050514 Bacteria 5928
881 nmdc:mga0a205_225_c1 3300050515 Bacteria 39886
882 Ga0495612_0370210 3300053078 Bacteria 648
883 Ga0495619_1000452 3300053085 Bacteria 559
884 Ga0587088_145161 3300059508 Bacteria 570
885 Ga0501082_0000163 3300060353 Bacteria 56753
886 Ga0265316_10084938
887 LJNas_1000260
888 JGI24737J22298_10091288
889 rootL2_10241530
890 Ga0058863_10029568
891 Ga0065712_10353710
892 Ga0070658_10047356
893 Ga0070658_10426613
894 Ga0070658_11086340
895 Ga0070683_100030293
896 Ga0070683_100133717
897 Ga0070683_100170304
898 Ga0070683_100758586
899 Ga0070690_100073959
900 Ga0070690_100221945
901 Ga0070690_100234369
902 Ga0070670_100001671
903 Ga0068869_100029513
904 Ga0068869_100318641
905 Ga0068869_100964164
906 Ga0068869_101312210
907 Ga0070666_10012008
908 Ga0070680_100000603
909 Ga0070680_100053548
910 Ga0070680_100186234
911 Ga0070680_100257035
912 Ga0070680_100740923
913 Ga0070680_100839079
914 Ga0070682_100224682
915 Ga0070682_100274201
916 Ga0068868_100002128
917 Ga0068868_100026427
918 Ga0068868_100727563
919 Ga0070660_100104824
920 Ga0070660_100190960
921 Ga0070660_100218661
922 Ga0070660_100462584
923 Ga0070660_100597898
924 Ga0070660_100944342
925 Ga0070689_100085443
926 Ga0070689_100211546
927 Ga0070691_10136978
928 Ga0070691_10175990
929 Ga0070691_10447080
930 Ga0070661_100010828
931 Ga0070661_100230274
932 Ga0070692_10041886
933 Ga0070675_100110258
934 Ga0070671_100151886
935 Ga0070671_100595585
936 Ga0070671_101525399
937 Ga0070673_100152664
938 Ga0070673_100896487
939 Ga0070688_101037073
940 Ga0070659_100238255
941 Ga0070667_101696926
942 Ga0070709_10009188
943 Ga0070714_100022904
944 Ga0070714_100048017
945 Ga0070714_100067282
946 Ga0070714_100238236
947 Ga0070713_100108983
948 Ga0070713_100210965
949 Ga0070713_101568210
950 Ga0070710_10026888
951 Ga0070711_100049597
952 Ga0070711_100291837
953 Ga0070711_100654909
954 Ga0070705_100276861
955 Ga0070705_100445621
956 Ga0070705_101343203
957 Ga0070694_100250825
958 Ga0070694_100603521
959 Ga0070708_100146004
960 Ga0070708_102110438
961 Ga0070663_100360518
962 Ga0070678_100137445
963 Ga0070662_100036046
964 Ga0070662_100154443
965 Ga0070681_10008575
966 Ga0070681_10015594
967 Ga0070681_10046181
968 Ga0070681_10186958
969 Ga0070681_10235636
970 Ga0070681_10288102
971 Ga0070681_10299743
972 Ga0070681_10800734
973 Ga0068867_100005572
974 Ga0068867_100093076
975 Ga0068867_100667512
976 Ga0068867_100777916
977 Ga0070706_100064219
978 Ga0070706_100152926
979 Ga0070707_100658794
980 Ga0070707_101057716
981 Ga0070698_101823791
982 Ga0070699_100012164
983 Ga0070699_100305666
984 Ga0070679_100040984
985 Ga0070679_100049582
986 Ga0070679_100206472
987 Ga0070679_100313845
988 Ga0070679_100342935
989 Ga0070679_100467399
990 Ga0070679_101577942
991 Ga0070684_100072993
992 Ga0070684_100202791
993 Ga0070684_100217205
994 Ga0070684_100245860
995 Ga0070684_100284655
996 Ga0070684_100439588
997 Ga0070684_100862559
998 Ga0070684_101326550
999 Ga0070697_100016006
1000 Ga0070697_100347231
1001 Ga0070697_100367250
1002 Ga0070697_100672455
1003 Ga0070697_101280403
1004 Ga0068853_100582451
1005 Ga0068853_100675777
1006 Ga0068853_101337001
1007 Ga0070686_100201282
1008 Ga0070686_101488033
1009 Ga0070695_100025319
1010 Ga0070695_100269446
1011 Ga0070695_101214386
1012 Ga0070696_100001210
1013 Ga0070696_100094269
1014 Ga0070693_100172898
1015 Ga0070693_101099947
1016 Ga0070665_100409824
1017 Ga0070665_100427863
1018 Ga0070665_100446507
1019 Ga0068855_100000151
1020 Ga0068855_100010918
1021 Ga0068855_100017859
1022 Ga0068855_100025976
1023 Ga0068855_100042280
1024 Ga0068855_100065294
1025 Ga0068855_100072180
1026 Ga0068855_100087433
1027 Ga0068855_100100591
1028 Ga0068855_100472093
1029 Ga0068855_101680624
1030 Ga0070664_100001009
1031 Ga0070664_100111532
1032 Ga0070664_100179827
1033 Ga0070664_100193668
1034 Ga0068857_100000121
1035 Ga0068857_100004298
1036 Ga0068857_100026488
1037 Ga0068857_100031584
1038 Ga0068857_100116933
1039 Ga0068857_100162622
1040 Ga0068854_100020450
1041 Ga0068854_100094766
1042 Ga0068854_100160717
1043 Ga0068854_100588422
1044 Ga0068854_100896702
1045 Ga0068854_101069616
1046 Ga0068856_100000119
1047 Ga0068856_100000735
1048 Ga0068856_100003101
1049 Ga0068856_100005370
1050 Ga0068856_100104896
1051 Ga0068856_100152066
1052 Ga0068856_100176386
1053 Ga0068856_100188191
1054 Ga0068856_100213106
1055 Ga0068856_100473431
1056 Ga0068856_100704711
1057 Ga0070702_100096426
1058 Ga0070702_100519309
1059 Ga0070702_101096792
1060 Ga0068852_100655159
1061 Ga0068852_100760022
1062 Ga0068852_100818414
1063 Ga0068859_100000415
1064 Ga0068859_100172739
1065 Ga0068859_100254457
1066 Ga0068859_100531129
1067 Ga0068859_100732096
1068 Ga0068859_100835072
1069 Ga0068864_100001353
1070 Ga0068864_100045482
1071 Ga0068864_100066790
1072 Ga0068864_100373628
1073 Ga0068864_101214695
1074 Ga0068866_10001235
1075 Ga0068866_10051523
1076 Ga0068866_10465404
1077 Ga0068861_100826992
1078 Ga0068861_101732483
1079 Ga0068870_10122968
1080 Ga0068863_100012184
1081 Ga0068863_100244731
1082 Ga0068863_100853159
1083 Ga0068863_100947889
1084 Ga0068858_100001756
1085 Ga0068858_100002944
1086 Ga0068858_100029443
1087 Ga0068858_100030314
1088 Ga0068858_100066403
1089 Ga0068858_100193802
1090 Ga0068858_100538773
1091 Ga0068858_100571175
1092 Ga0068860_100040407
1093 Ga0068860_100047838
1094 Ga0068860_100064485
1095 Ga0068860_100324231
1096 Ga0068860_101168585
1097 Ga0068862_101190671
1098 Ga0081540_1025365
1099 Ga0070717_10000964
1100 Ga0070717_10031513
1101 Ga0070717_10038841
1102 Ga0070717_10225872
1103 Ga0070717_12110205
1104 Ga0070715_10030273
1105 Ga0070715_10756531
1106 Ga0070716_100013191
1107 Ga0070716_100679363
1108 Ga0070716_100794311
1109 Ga0097621_100000073
1110 Ga0097621_100001536
1111 Ga0097621_100045384
1112 Ga0097621_100053414
1113 Ga0097621_100053609
1114 Ga0097621_100744980
1115 Ga0097621_100947316
1116 Ga0097621_101364691
1117 Ga0068871_100000258
1118 Ga0068871_100000932
1119 Ga0068871_100131493
1120 Ga0068871_100235455
1121 Ga0068871_100263619
1122 Ga0068871_100286378
1123 Ga0068871_100332643
1124 Ga0068871_100395697
1125 Ga0068871_100480215
1126 Ga0068871_100784342
1127 Ga0075431_101128561
1128 Ga0075433_10000203
1129 Ga0075434_100000016
1130 Ga0075434_100779867
1131 Ga0068865_100010820
1132 Ga0068865_100061318
1133 Ga0068865_100135800
1134 Ga0068865_100140494
1135 Ga0075436_100000459
1136 Ga0075436_100001267
1137 Ga0075436_100002867
1138 Ga0075436_100707132
1139 Ga0075436_100754662
1140 Ga0097620_100000415
1141 Ga0097620_100172739
1142 Ga0097620_100254442
1143 Ga0097620_100531146
1144 Ga0097620_100732077
1145 Ga0097620_100835014
1146 Ga0075435_100000506
1147 Ga0075435_100055926
1148 Ga0075435_100218484
1149 Ga0075435_100694859
1150 Ga0105240_10002859
1151 Ga0105240_10011668
1152 Ga0105240_10055622
1153 Ga0105240_10074432
1154 Ga0105240_10126413
1155 Ga0105240_10149958
1156 Ga0105240_10152022
1157 Ga0105240_10163889
1158 Ga0105240_10225186
1159 Ga0105240_10266938
1160 Ga0105240_10505847
1161 Ga0105240_10963439
1162 Ga0105240_11080391
1163 Ga0105240_11111378
1164 Ga0105240_11896834
1165 Ga0111539_11336227
1166 Ga0105245_10018588
1167 Ga0105245_10138886
1168 Ga0105245_10447635
1169 Ga0105245_10607340
1170 Ga0105245_10675867
1171 Ga0105245_10800632
1172 Ga0105245_10954363
1173 Ga0105245_11327280
1174 Ga0105245_11467994
1175 Ga0105245_11684623
1176 Ga0105245_11730465
1177 Ga0105245_11799322
1178 Ga0105247_10455044
1179 Ga0114129_10759829
1180 Ga0105243_10137707
1181 Ga0105243_10915486
1182 Ga0105241_10024522
1183 Ga0105241_10051100
1184 Ga0105241_10096184
1185 Ga0105241_10280535
1186 Ga0105241_10349158
1187 Ga0105241_10451776
1188 Ga0105241_10636674
1189 Ga0105241_10653210
1190 Ga0105241_10697188
1191 Ga0105241_11337663
1192 Ga0105241_11378370
1193 Ga0105242_10051667
1194 Ga0105242_10128723
1195 Ga0105242_10180895
1196 Ga0105242_10265127
1197 Ga0105242_10358027
1198 Ga0105242_10458144
1199 Ga0105242_10583780
1200 Ga0105242_10786875
1201 Ga0105242_10908710
1202 Ga0105248_10003718
1203 Ga0105248_10022851
1204 Ga0105248_10050489
1205 Ga0105248_10069163
1206 Ga0105248_10082903
1207 Ga0105248_10316600
1208 Ga0105248_10359047
1209 Ga0105248_11443114
1210 Ga0105237_10030803
1211 Ga0105237_10059246
1212 Ga0105237_10192802
1213 Ga0105237_10244406
1214 Ga0105237_10456339
1215 Ga0105237_10773254
1216 Ga0105238_10000497
1217 Ga0105238_10033919
1218 Ga0105238_10067929
1219 Ga0105238_10071243
1220 Ga0105238_10183731
1221 Ga0105238_10207556
1222 Ga0105238_10528402
1223 Ga0105238_11604236
1224 Ga0105249_10218529
1225 Ga0105249_12043156
1226 Ga0105239_10005844
1227 Ga0105239_10008299
1228 Ga0105239_10028421
1229 Ga0105239_10074153
1230 Ga0105239_10125966
1231 Ga0105239_10129667
1232 Ga0105239_10261588
1233 Ga0105239_10462414
1234 Ga0105246_10124900
1235 Ga0105246_10167946
1236 Ga0105246_10691381
1237 Ga0105246_11357212
1238 Ga0157373_10101562
1239 Ga0157373_10136753
1240 Ga0157373_10646498
1241 Ga0157371_10037166
1242 Ga0157371_10121215
1243 Ga0157371_11004229
1244 Ga0157370_10000944
1245 Ga0157370_10024274
1246 Ga0157370_10029683
1247 Ga0157370_10041967
1248 Ga0157370_10212700
1249 Ga0157370_11240894
1250 Ga0157369_10000108
1251 Ga0157369_10000788
1252 Ga0157369_10025124
1253 Ga0157369_10028125
1254 Ga0157369_10068636
1255 Ga0157369_10255562
1256 Ga0157369_10353424
1257 Ga0157374_10001477
1258 Ga0157374_10007082
1259 Ga0157374_10034864
1260 Ga0157374_10107114
1261 Ga0157374_10889543
1262 Ga0157374_10925980
1263 Ga0157374_12571566
1264 Ga0157378_10000030
1265 Ga0157378_10000099
1266 Ga0157378_10027391
1267 Ga0157378_10033299
1268 Ga0157378_10821145
1269 Ga0157378_11143870
1270 Ga0157378_11233450
1271 Ga0157378_11559682
1272 Ga0163162_10351169
1273 Ga0163162_10469492
1274 Ga0163162_10573224
1275 Ga0163162_11469449
1276 Ga0163162_11517565
1277 Ga0163162_11718973
1278 Ga0163162_12812770
1279 Ga0157372_10000218
1280 Ga0157372_10000576
1281 Ga0157372_10003314
1282 Ga0157372_10018887
1283 Ga0157372_10347598
1284 Ga0157372_11366814
1285 Ga0157372_11543121
1286 Ga0157375_10343291
1287 Ga0157375_10468911
1288 Ga0157375_10768762
1289 Ga0157375_11207331
1290 Ga0157375_11541638
1291 Ga0163163_10003193
1292 Ga0163163_10126344
1293 Ga0163163_10296747
1294 Ga0163163_10414130
1295 Ga0163163_10820960
1296 Ga0163163_10922272
1297 Ga0163163_11588391
1298 Ga0157380_11278834
1299 Ga0182008_10279655
1300 Ga0157377_10522872
1301 Ga0157379_10057957
1302 Ga0157379_11597250
1303 Ga0157376_10159329
1304 Ga0157376_10300887
1305 Ga0157376_10430725
1306 Ga0157376_10997675
1307 Ga0182006_1009694
1308 Ga0182007_10035405
1309 Ga0163161_10908819
1310 Ga0184603_118414
1311 Ga0197907_10817353
1312 Ga0206356_10589427
1313 Ga0213876_10145779
1314 Ga0213876_10343582
1315 Ga0213875_10000008
1316 Ga0213875_10003390
1317 Ga0213875_10230615
1318 Ga0213875_10592503
1319 Ga0224712_10054675
1320 Ga0207692_10061557
1321 Ga0207692_10177530
1322 Ga0207642_10002153
1323 Ga0207642_10069655
1324 Ga0207710_10078754
1325 Ga0207688_10895023
1326 Ga0207680_10004915
1327 Ga0207680_10305859
1328 Ga0207680_10598216
1329 Ga0207647_10036752
1330 Ga0207685_10011090
1331 Ga0207699_10004846
1332 Ga0207699_10224593
1333 Ga0207643_10062713
1334 Ga0207705_10029996
1335 Ga0207705_10088826
1336 Ga0207705_10319983
1337 Ga0207705_10426277
1338 Ga0207684_10307436
1339 Ga0207684_10942292
1340 Ga0207654_10011466
1341 Ga0207654_10080529
1342 Ga0207654_10199344
1343 Ga0207654_10414551
1344 Ga0207654_10474055
1345 Ga0207654_10633397
1346 Ga0207654_10778137
1347 Ga0207707_10001130
1348 Ga0207707_10003004
1349 Ga0207707_10013950
1350 Ga0207707_10051604
1351 Ga0207707_10058678
1352 Ga0207707_10065705
1353 Ga0207707_10110376
1354 Ga0207707_10305232
1355 Ga0207707_10420784
1356 Ga0207707_10672798
1357 Ga0207695_10005972
1358 Ga0207695_10030294
1359 Ga0207695_10036038
1360 Ga0207695_10080344
1361 Ga0207695_10191675
1362 Ga0207695_10258296
1363 Ga0207695_10264046
1364 Ga0207695_10349043
1365 Ga0207695_10937945
1366 Ga0207671_10026181
1367 Ga0207671_10279347
1368 Ga0207671_10423196
1369 Ga0207671_10479775
1370 Ga0207693_10031852
1371 Ga0207693_10351606
1372 Ga0207693_10941343
1373 Ga0207693_10942109
1374 Ga0207663_10026767
1375 Ga0207663_10175750
1376 Ga0207663_10325424
1377 Ga0207663_10882148
1378 Ga0207660_10031472
1379 Ga0207660_10145553
1380 Ga0207660_10325393
1381 Ga0207660_10346657
1382 Ga0207657_10001039
1383 Ga0207657_10211729
1384 Ga0207657_10324397
1385 Ga0207657_10931894
1386 Ga0207649_10060976
1387 Ga0207652_10050077
1388 Ga0207652_10056104
1389 Ga0207652_10344626
1390 Ga0207652_10440044
1391 Ga0207652_10484184
1392 Ga0207694_10000864
1393 Ga0207694_10006080
1394 Ga0207694_10071633
1395 Ga0207694_10221607
1396 Ga0207694_10318201
1397 Ga0207694_10367811
1398 Ga0207694_11225399
1399 Ga0207650_10003703
1400 Ga0207659_10157442
1401 Ga0207659_10266856
1402 Ga0207687_10001617
1403 Ga0207687_10020606
1404 Ga0207687_10239296
1405 Ga0207687_10301882
1406 Ga0207687_10367417
1407 Ga0207687_10436811
1408 Ga0207687_11166020
1409 Ga0207700_10010317
1410 Ga0207700_10065618
1411 Ga0207700_10118302
1412 Ga0207700_10256924
1413 Ga0207700_10261079
1414 Ga0207700_10692226
1415 Ga0207664_10052997
1416 Ga0207664_10088924
1417 Ga0207664_10098070
1418 Ga0207664_10247446
1419 Ga0207644_10124014
1420 Ga0207644_10939082
1421 Ga0207690_10111658
1422 Ga0207706_10041282
1423 Ga0207706_10059041
1424 Ga0207686_10021731
1425 Ga0207686_10050845
1426 Ga0207686_10075785
1427 Ga0207686_10168493
1428 Ga0207686_10275895
1429 Ga0207686_10365162
1430 Ga0207686_11126482
1431 Ga0207709_10033070
1432 Ga0207709_10816363
1433 Ga0207670_10049345
1434 Ga0207670_10948948
1435 Ga0207704_10005386
1436 Ga0207704_10053592
1437 Ga0207704_11517537
1438 Ga0207665_10005780
1439 Ga0207665_10078549
1440 Ga0207665_10372921
1441 Ga0207665_10471540
1442 Ga0207691_11092354
1443 Ga0207711_10010118
1444 Ga0207711_10136868
1445 Ga0207711_10189255
1446 Ga0207711_10197481
1447 Ga0207711_11196554
1448 Ga0207689_10042194
1449 Ga0207689_10221253
1450 Ga0207689_10277432
1451 Ga0207689_10523033
1452 Ga0207689_10897352
1453 Ga0207661_10239101
1454 Ga0207661_10266920
1455 Ga0207661_10362529
1456 Ga0207661_10546056
1457 Ga0207679_10046295
1458 Ga0207679_10058802
1459 Ga0207679_10231353
1460 Ga0207679_10721241
1461 Ga0207679_10957655
1462 Ga0207667_10003037
1463 Ga0207667_10012644
1464 Ga0207667_10021676
1465 Ga0207667_10036366
1466 Ga0207667_10042110
1467 Ga0207667_10343965
1468 Ga0207667_10641230
1469 Ga0207667_10671437
1470 Ga0207651_10469943
1471 Ga0207651_10576241
1472 Ga0207651_10794431
1473 Ga0207712_10231448
1474 Ga0207640_10002147
1475 Ga0207640_10088182
1476 Ga0207640_10232897
1477 Ga0207640_10370682
1478 Ga0207658_10669747
1479 Ga0207677_10012343
1480 Ga0207677_10208523
1481 Ga0207677_10269512
1482 Ga0207677_10317495
1483 Ga0207677_10533689
1484 Ga0207677_10608972
1485 Ga0207703_10008197
1486 Ga0207703_10018303
1487 Ga0207703_10068702
1488 Ga0207703_10473994
1489 Ga0207703_10988579
1490 Ga0207703_11632435
1491 Ga0207703_12189417
1492 Ga0207639_10182795
1493 Ga0207639_10212706
1494 Ga0207639_10300737
1495 Ga0207639_10347622
1496 Ga0207639_10486777
1497 Ga0207639_10702478
1498 Ga0207702_10000086
1499 Ga0207702_10000764
1500 Ga0207702_10001551
1501 Ga0207702_10060549
1502 Ga0207702_10076477
1503 Ga0207702_10126543
1504 Ga0207702_10137446
1505 Ga0207702_10260293
1506 Ga0207702_10354693
1507 Ga0207641_10044529
1508 Ga0207641_10096455
1509 Ga0207641_10977987
1510 Ga0207641_11733735
1511 Ga0207648_10010395
1512 Ga0207648_10078615
1513 Ga0207648_10126556
1514 Ga0207648_10199089
1515 Ga0207648_10604125
1516 Ga0207676_10007435
1517 Ga0207676_10028966
1518 Ga0207676_10771882
1519 Ga0207676_10845005
1520 Ga0207676_10880594
1521 Ga0207674_10000281
1522 Ga0207674_10002923
1523 Ga0207674_10003767
1524 Ga0207674_10005414
1525 Ga0207674_10087427
1526 Ga0207674_10663714
1527 Ga0207683_10165829
1528 Ga0207683_10259963
1529 Ga0207698_10175167
1530 Ga0207698_10783760
1531 Ga0207428_11225953
1532 Ga0265354_1002668
1533 Ga0265354_1009161
1534 Ga0268266_10048282
1535 Ga0268266_10150356
1536 Ga0268266_10367815
1537 Ga0268266_11030164
1538 Ga0268265_10715355
1539 Ga0268264_10035203
1540 Ga0268264_10231403
1541 Ga0268264_10232076
1542 Ga0268264_10293396
1543 Ga0268264_10527066
1544 Ga0268264_10655158
1545 Ga0268264_10729019
1546 Ga0265318_10202923
1547 Ga0265336_10034555
1548 Ga0265338_10012644
1549 Ga0265338_10079554
1550 Ga0265338_10127337
1551 Ga0265338_10908303
1552 Ga0265324_10023178
1553 Ga0265779_112912
1554 Ga0265760_10000817
1555 Ga0265760_10007880
1556 Ga0265760_10045693
1557 Ga0265760_10299426
1558 Ga0265330_10106803
1559 Ga0265332_10018593
1560 Ga0265328_10009924
1561 Ga0265320_10059887
1562 Ga0265325_10028309
1563 Ga0265325_10069949
1564 Ga0265340_10037949
1565 Ga0265339_10115353
1566 Ga0265331_10002235
1567 Ga0265331_10048448
1568 Ga0265327_10156072
1569 Ga0265316_10004839
1570 Ga0265316_10005224
1571 Ga0265316_10034153
1572 Ga0265313_10056517
1573 Ga0265314_10003389
1574 Ga0265314_10007710
1575 Ga0265314_10032599
1576 Ga0265342_10049946
1577 Ga0265342_10421963
1578 Ga0373930_0045806
1579 Ga0373926_0008935
1580 Ga0373926_0010008
1581 Ga0373934_0223481
1582 Ga0373923_0676094
1583 Ga0373932_0335996
1584 Ga0373936_0035404
1585 Ga0373936_0241510
1586 Ga0373954_0020632
1587 Ga0373954_0494909
1588 Ga0373954_0561074
1589 Ga0373957_0090127
1590 Ga0373943_0009063
1591 Ga0373943_0346304
1592 Ga0373946_0075247
1593 Ga0373946_0509298
1594 Ga0373955_0284032
1595 Ga0373961_0103573
1596 Ga0373931_0008193
1597 Ga0373935_0002744
1598 Ga0373935_0051208
1599 Ga0373927_0001178
1600 Ga0373927_0002368
1601 Ga0373927_0019125
1602 Ga0373927_0099736
1603 Ga0373927_0164270
1604 Ga0373927_0987642
1605 Ga0373933_0108299
1606 Ga0373933_0289983
1607 Ga0373933_0290090
1608 Ga0373947_0000791
1609 Ga0373947_0010631
1610 Ga0373947_0011446
1611 Ga0373937_0050240
1612 Ga0373937_0064239
1613 Ga0373937_0162599
1614 Ga0373937_0274716
1615 Ga0373937_0300286
1616 Ga0373937_0342455
1617 Ga0373925_0001414
1618 Ga0373925_0006773
1619 Ga0373925_0097371
1620 Ga0373925_0317902
1621 Ga0373925_0673340
1622 Ga0373925_0706349
1623 Ga0373925_0706405
1624 Ga0395905_0927736
1625 Ga0436364_0264121
1626 Ga0436364_0273915
1627 Ga0436364_0683917
1628 Ga0436364_0800017
1629 Ga0436364_0877214
1630 Ga0436364_1415525
1631 Ga0436364_1426312
1632 Ga0436364_1528712
1633 Ga0395901_0314352
1634 Ga0395901_1890523
1635 Ga0436365_0277120
1636 Ga0436365_0447678
1637 Ga0436365_0655522
1638 Ga0436365_0879694
1639 Ga0436365_1203388
1640 Ga0436365_1707053
1641 Ga0436363_0612734
1642 Ga0436362_0187453
1643 Ga0436362_0413443
1644 Ga0436362_0430208
1645 Ga0436362_0981073
1646 Ga0439448_0206994
1647 Ga0451577_1800257
1648 Ga0466966_0661164
1649 Ga0466961_0060946
1650 Ga0466964_0070967
1651 Ga0466971_0244778
1652 Ga0466968_0202473
1653 Ga0466957_0077705
1654 Ga0466959_0831934
1655 Ga0451576_1262280
1656 Ga0451576_1630038
1657 Ga0466958_0728219
1658 Ga0466967_0119153
1659 Ga0466967_0288577
1660 Ga0495592_0033185
1661 Ga0495651_0061861
1662 Ga0495653_0110226
1663 Ga0495580_0005708
1664 Ga0495580_0008511
1665 Ga0495580_0035060
1666 Ga0495580_0059078
1667 Ga0495580_0109030
1668 Ga0495580_0196975
1669 Ga0495580_0199371
1670 Ga0495580_0276101
1671 Ga0495580_0494976
1672 Ga0495582_0001573
1673 Ga0495582_0021526
1674 Ga0495582_0101287
1675 Ga0495639_0601203
1676 Ga0495662_0017566
1677 Ga0495664_0006701
1678 Ga0495664_0259746
1679 Ga0495608_0040514
1680 Ga0495618_0238947
1681 Ga0495628_0010921
1682 Ga0495630_0009909
1683 Ga0495630_0319430
1684 Ga0495630_0933209
1685 Ga0495666_0100346
1686 Ga0495652_0007150
1687 Ga0495665_0014059
1688 Ga0495665_0162388
1689 Ga0495665_0197162
1690 Ga0495640_0022814
1691 Ga0495587_0026684
1692 Ga0495587_0131832
1693 Ga0495587_0690319
1694 Ga0495645_0003842
1695 Ga0495645_0257816
1696 Ga0495667_0042546
1697 Ga0495634_0008872
1698 Ga0495635_0029254
1699 Ga0495635_0452855
1700 Ga0495657_0361740
1701 Ga0495599_0006439
1702 Ga0495599_0533057
1703 Ga0495623_0058656
1704 Ga0495623_0135753
1705 Ga0495646_0207300
1706 Ga0495647_0452949
1707 Ga0495658_0204434
1708 Ga0495669_0070932
1709 Ga0495669_0376496
1710 Ga0495613_0047448
1711 Ga0495613_0262314
1712 Ga0495600_0044601
1713 Ga0495581_0023298
1714 Ga0495581_0348572
1715 Ga0495581_0567926
1716 Ga0495604_0014207
1717 Ga0495636_0176896
1718 Ga0495674_0032395
1719 Ga0495674_0221808
1720 Ga0495674_0297388
1721 Ga0495680_0063802
1722 Ga0495675_0044588
1723 Ga0495685_278766
1724 Ga0495684_0020315
1725 Ga0495684_0088444
1726 Ga0495684_0520988
1727 Ga0495593_0635758
1728 Ga0495602_0082199
1729 Ga0495602_0088109
1730 Ga0495602_0327665
1731 Ga0496102_1046635
1732 Ga0496105_0134025
1733 Ga0496106_0847972
1734 Ga0496109_0507547
1735 Ga0496109_1577145
1736 Ga0496110_0842663
1737 Ga0496111_0316450
1738 Ga0496112_0006449
1739 Ga0496112_0100051
1740 Ga0496112_0461037
1741 Ga0496112_0924573
1742 Ga0496112_1578382
1743 Ga0496113_0464732
1744 Ga0496115_0122639
1745 Ga0496115_0155535
1746 Ga0496115_0513016
1747 Ga0501047_0667679
1748 Ga0501073_0599093
1749 Ga0501075_0498456
1750 Ga0501044_0061261
1751 Ga0501044_0470085
1752 Ga0501045_1287931
1753 nmdc:mga05p37_764514_c1
1754 nmdc:mga08y16_1758137_c1
1755 nmdc:mga08y16_498733_c1
1756 nmdc:mga0n895_164043_c1
1757 nmdc:mga0n895_825817_c1
1758 nmdc:mga0rr50_1105429_c1
1759 nmdc:mga0rr50_182698_c1
1760 nmdc:mga0rr50_1847_c1
1761 nmdc:mga0rr50_25385_c1
1762 nmdc:mga08x19_1063_c1
1763 nmdc:mga08x19_142149_c1
1764 nmdc:mga08x19_32527_c1
1765 nmdc:mga08x19_9104_c1
1766 nmdc:mga0a205_225_c1
1767 Ga0495612_0370210
1768 Ga0495619_1000452
1769 Ga0587088_145161
1770 Ga0501082_0000163

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.98

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

53

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9819 1 41
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.9811 1 41
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 0.9805 1 41
8ceu-assembly1.cif.gz_h retapamulin and capreomycin bound to the 50s subunit 0.9745 1 41
7y7e-assembly1.cif.gz_h structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) 0.9738 1 41
ID Description Score Start End Superfamily
af_Q2G2T3_1_54_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9696 1 51 3.40.5.10
3i9eK01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9586 1 57 3.40.5.10
af_Q2G2T3_62_150_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9552 61 147 3.10.430.100
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.953 3 42 3.40.5.10
4l6lI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9513 1 57 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A7T9ICB5-F1-model_v4 deleted 0.9834 1 148
AF-A0A7T9ICB5-F1-model_v4 deleted 0.9704 1 148
AF-A0A2D9HBR2-F1-model_v4 Large ribosomal subunit protein bL9 0.9697 1 151 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B3EKG2-F1-model_v4 Large ribosomal subunit protein bL9 (50S ribosomal protein L9) 0.9679 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6A0IEP8-F1-model_v4 Large ribosomal subunit protein bL9 0.9663 1 147 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map