F484580

General Info

Members Datasets Scaffolds Average Seq Length
883 735 1766 456

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10023758|Ga0075364_100237582
Length 450
Sequence MIDPKVLATRFPGDFLFGVATASFQIEGASKADGRKPSIWDAFCNMPGHVYGRHNGDVACDHYNRLDADLDLIKNMGVEAYRFSIAWPRIIPDGTGPVNERGLDFYDRLVDGCKARGIKTYATLYHWDLPLTLMGDGGWTARSTAYAFQRYARTVMERLGDRLDAVATFNEPWCSVWLSHLYGIHAPGEHNMDAALAAMHYTNLAHGLGVQTCRDVAPNVPVGLVLNAHSVIAASDSAFQFHNGVFFGPVFKGEYPSDFVEALGDRMPVVEEGDLTIINQKLDWWGLNYYTPMRVAADTDPSAEFPATVEAPFVNDVTTDIGWEVYSPALHSLVEELYRRYELPDCYITENGACYNMGVENGEVDDQPRLDYYADHLSVVADLIKDGYPMRGYFAWSLMDNFEWAQGYRMRFGLVHVDYDTQVRTIKKSGKWYSSLAAEFPKGNHKKAAL

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
57 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
58 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
59 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
60 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
98 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
99 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
110 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
111 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
161 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
173 2509276019 Ensifer aridi TW10 Isolate Nodule
174 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
175 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
176 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
177 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
178 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
179 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
180 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
181 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
182 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
183 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
184 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
185 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
186 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
187 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
188 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
189 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
190 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
191 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
192 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
193 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
194 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
195 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
196 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
197 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
198 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
199 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
200 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
201 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
202 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
203 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
204 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
205 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
206 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
207 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
208 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
209 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
210 2516143018 Ensifer sp. BR816 Isolate Nodule
211 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
212 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
213 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
214 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
215 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
216 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
217 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
218 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
219 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
220 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
221 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
222 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
223 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
224 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
225 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
226 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
227 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
228 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
229 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
230 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
231 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
232 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
233 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
234 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
235 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
236 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
237 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
238 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
239 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
240 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
241 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
242 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
243 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
244 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
245 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
246 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
247 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
248 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
249 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
250 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
251 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
252 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
253 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
254 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
255 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
256 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
257 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
258 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
259 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
260 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
261 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
262 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
263 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
264 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
265 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
266 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
267 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
268 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
269 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
270 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
271 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
272 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
273 2643221557 Ensifer sp. Root558 Isolate Unclassified
274 2643221558 Rhizobium sp. Root149 Isolate Unclassified
275 2643221582 Rhizobium sp. Root651 Isolate Unclassified
276 2643221599 Rhizobium sp. Root708 Isolate Unclassified
277 2643221607 Rhizobium sp. Root73 Isolate Unclassified
278 2643221610 Ensifer sp. Root74 Isolate Unclassified
279 2643221618 Ensifer sp. Root231 Isolate Unclassified
280 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
281 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
282 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
283 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
284 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
285 2643221655 Ensifer sp. Root1252 Isolate Unclassified
286 2643221659 Ensifer sp. Root127 Isolate Unclassified
287 2643221668 Ensifer sp. Root423 Isolate Unclassified
288 2643221675 Ensifer sp. Root1298 Isolate Unclassified
289 2643221680 Ensifer sp. Root1312 Isolate Unclassified
290 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
291 2643221688 Rhizobium sp. Root482 Isolate Unclassified
292 2643221693 Rhizobium sp. Root491 Isolate Unclassified
293 2643221698 Ensifer sp. Root142 Isolate Unclassified
294 2643221712 Ensifer sp. Root258 Isolate Unclassified
295 2643221718 Rhizobium sp. Root268 Isolate Unclassified
296 2643221719 Rhizobium sp. Root274 Isolate Unclassified
297 2643221723 Ensifer sp. Root278 Isolate Unclassified
298 2643221726 Ensifer sp. Root954 Isolate Unclassified
299 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
300 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
301 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
302 2718217882 Rhizobium sp. N741 Isolate Nodule
303 2718217927 Rhizobium sp. N324 Isolate Nodule
304 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
305 2718218009 Rhizobium sp. N561 Isolate Nodule
306 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
307 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
308 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
309 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
310 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
311 2718218363 Rhizobium sp. N113 Isolate Nodule
312 2718218365 Rhizobium sp. N731 Isolate Nodule
313 2718218366 Rhizobium sp. N621 Isolate Nodule
314 2718218423 Rhizobium sp. N941 Isolate Nodule
315 2721755514 Rhizobium sp. N6212 Isolate Nodule
316 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
317 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
318 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
319 2721755809 Rhizobium sp. N541 Isolate Nodule
320 2721755810 Rhizobium sp. N871 Isolate Nodule
321 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
322 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
323 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
324 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
325 2728369365 Rhizobium sp. N1341 Isolate Nodule
326 2728369397 Rhizobium sp. N1314 Isolate Nodule
327 2738541293 Rhizobium sp. GV031 Isolate Unclassified
328 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
329 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
330 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
331 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
332 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
333 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
334 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
335 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
336 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
337 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
338 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
339 2791355256 Rhizobium sp. M10 Isolate Nodule
340 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
341 2791355260 Rhizobium sp. L9 Isolate Nodule
342 2791355261 Rhizobium sp. J15 Isolate Nodule
343 2791355262 Rhizobium sp. M1 Isolate Nodule
344 2791355263 Rhizobium chutanense C5 Isolate Nodule
345 2791355264 Rhizobium sp. S9 Isolate Nodule
346 2791355265 Rhizobium sp. H4 Isolate Nodule
347 2791355266 Rhizobium sp. L43 Isolate Nodule
348 2791355267 Rhizobium sp. L18 Isolate Nodule
349 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
350 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
351 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
352 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
353 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
354 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
355 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
356 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
357 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
358 2802429633 Rhizobium anhuiense J3 Isolate Nodule
359 2802429634 Rhizobium anhuiense S10 Isolate Nodule
360 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
361 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
362 2802429637 Rhizobium anhuiense C15 Isolate Nodule
363 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
364 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
365 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
366 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
367 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
368 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
369 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
370 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
371 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
372 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
373 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
374 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
375 2838061910 Rhizobium phaseoli L15 Isolate Nodule
376 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
377 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
378 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
379 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
380 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
381 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
382 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
383 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
384 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
385 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
386 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
387 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
388 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
389 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
390 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
391 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
392 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
393 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
394 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
395 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
396 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
397 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
398 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
399 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
400 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
401 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
402 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
403 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
404 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
405 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
406 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
407 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
408 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
409 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
410 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
411 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
412 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
413 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
414 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
415 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
416 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
417 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
418 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
419 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
420 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
421 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
422 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
423 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
424 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
425 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
426 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
427 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
428 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
429 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
430 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
431 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
432 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
433 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
434 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
435 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
436 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
437 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
438 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
439 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
440 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
441 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
442 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
443 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
444 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
445 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
446 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
447 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
448 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
449 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
450 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
451 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
452 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
453 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
454 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
455 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
456 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
457 2844163670 Ensifer sp. 1H6 Isolate Unclassified
458 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
459 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
460 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
461 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
462 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
463 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
464 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
465 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
466 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
467 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
468 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
469 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
470 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
471 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
472 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
473 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
474 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
475 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
476 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
477 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
478 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
479 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
480 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
481 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
482 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
483 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
484 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
485 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
486 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
487 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
488 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
489 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
490 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
491 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
492 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
493 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
494 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
495 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
496 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
497 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
498 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
499 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
500 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
501 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
502 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
503 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
504 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
505 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
506 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
507 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
508 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
509 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
510 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
511 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
512 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
513 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
514 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
515 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
516 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
517 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
518 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
519 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
520 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
521 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
522 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
523 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
524 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
525 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
526 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
527 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
528 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
529 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
530 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
531 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
532 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
533 2933599457 Rhizobium phaseoli M3 Isolate Nodule
534 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
535 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
536 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
537 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
538 2936381700 Rhizobium chutanense C16 Isolate Unclassified
539 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
540 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
541 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
542 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
543 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
544 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
545 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
546 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
547 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
548 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
549 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
550 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
551 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
552 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
553 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
554 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
555 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
556 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
557 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
558 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
559 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
560 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
561 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
562 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
563 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
564 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
565 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
566 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
567 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
568 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
569 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
570 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
571 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
572 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
573 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
574 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
575 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
576 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
577 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
578 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
579 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
580 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
581 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
582 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
583 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
584 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
585 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
586 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
587 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
588 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
589 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
590 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
591 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
592 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
593 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
594 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
595 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
596 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
597 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
598 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
599 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
600 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
601 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
602 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
603 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
604 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
605 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
606 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
607 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
608 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
609 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
610 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
611 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
612 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
613 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
614 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
615 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
616 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
617 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
618 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
619 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
620 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
621 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
622 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
623 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
624 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
625 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
626 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
627 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
628 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
629 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
630 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
631 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
632 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
633 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
634 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
635 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
636 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
637 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
638 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
639 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
640 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
641 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
642 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
643 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
644 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
645 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
646 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
647 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
648 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
649 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
650 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
651 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
652 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
653 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
654 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
655 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
656 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
657 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
658 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
659 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
660 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
661 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
662 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
663 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
664 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
665 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
666 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
667 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
668 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
669 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
670 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
671 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
672 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
673 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
674 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
675 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
676 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
677 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
678 2996887358 Rhizobium sp. R711 Isolate Nodule
679 2996893221 Rhizobium sp. R635 Isolate Nodule
680 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
681 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
682 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
683 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
684 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
685 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
686 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
687 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
688 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
689 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
690 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
691 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
692 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
693 8005258706 Rhizobium sp. R693 Isolate Nodule
694 8005275841 Rhizobium sp. N4311 Isolate Nodule
695 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
696 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
697 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
698 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
699 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
700 8005321885 Rhizobium sp. R72 Isolate Nodule
701 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
702 8005382845 Rhizobium sp. R634 Isolate Nodule
703 8005395548 Rhizobium sp. R339 Isolate Nodule
704 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
705 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
706 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
707 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
708 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
709 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
710 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
711 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
712 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
713 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
714 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
715 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
716 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
717 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
718 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
719 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
720 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
721 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
722 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
723 8018176218 Rhizobium sp. N122 Isolate Nodule
724 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
725 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
726 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
727 8024501048 Rhizobium sp. H4 Isolate Nodule
728 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
729 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
730 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
731 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
732 8056382006 Rhizobium croatiense 13T Isolate Nodule
733 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
734 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
735 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.13
Metatranscriptomes 0
Isolates 63.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 17.89
Nodule 48.81
Rhizoplane 1.47
Rhizosphere 15.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10023758 3300006051 Bacteria 3884
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1000036 3300002705 Bacteria 110527
4 JGI25162J39368_1000146 3300002737 Bacteria 76858
5 JGI25162J39368_1000616 3300002737 Bacteria 25562
6 JGI25162J39368_1000674 3300002737 Bacteria 23983
7 JGI25154J39366_1000033 3300002738 Bacteria 184379
8 JGI25158J39367_1000162 3300002739 Bacteria 15940
9 JGI25158J39367_1002448 3300002739 Bacteria 3013
10 JGI25157J39369_1000457 3300002741 Bacteria 25863
11 JGI25152J39213_1001072 3300002773 Bacteria 12904
12 JGI25152J39213_1001517 3300002773 Bacteria 9873
13 JGI25152J39213_1004183 3300002773 Bacteria 4645
14 JGI25152J39213_1004784 3300002773 Bacteria 4154
15 JGI25150J39212_1000063 3300002774 Bacteria 64558
16 JGI25150J39212_1004572 3300002774 Bacteria 3057
17 JGI25159J45721_1000032 3300002987 Bacteria 90158
18 JGI25159J45721_1000464 3300002987 Bacteria 18764
19 JGI25159J45721_1000747 3300002987 Bacteria 14158
20 JGI25151J46595_10000140 3300003187 Bacteria 95958
21 JGI25151J46595_10001521 3300003187 Bacteria 15511
22 JGI25151J46595_10018048 3300003187 Bacteria 3042
23 JGI25151J46595_10023356 3300003187 Bacteria 2548
24 JGI25151J46595_10028844 3300003187 Bacteria 2206
25 JGI25165J46597_1000653 3300003214 Bacteria 28392
26 JGI25165J46597_1000719 3300003214 Bacteria 25974
27 JGI25165J46597_1002384 3300003214 Bacteria 6223
28 JGI25153J46596_10003714 3300003215 Bacteria 8427
29 JGI25153J46596_10007115 3300003215 Bacteria 5552
30 JGI25153J46596_10013467 3300003215 Bacteria 3453
31 rootL2_10030145 3300003322 Bacteria 7050
32 JGI25160J50197_1000006 3300003354 Bacteria 316247
33 JGI25160J50197_1000009 3300003354 Bacteria 282862
34 JGI25160J50197_1001914 3300003354 Bacteria 9964
35 JGI25161J50226_1000004 3300003374 Bacteria 316212
36 JGI25161J50226_1000103 3300003374 Bacteria 67942
37 JGI25161J50226_1004289 3300003374 Bacteria 3017
38 Ga0055526_1004064 3300003771 Bacteria 8973
39 Ga0055526_1004185 3300003771 Bacteria 8775
40 Ga0055526_1006594 3300003771 Bacteria 6257
41 Ga0055526_1009137 3300003771 Bacteria 4822
42 Ga0055526_1021513 3300003771 Bacteria 2240
43 Ga0055524_1000790 3300003775 Bacteria 21100
44 Ga0055524_1002131 3300003775 Bacteria 10421
45 Ga0055524_1016292 3300003775 Bacteria 2673
46 Ga0055536_1011333 3300003781 Bacteria 3428
47 Ga0055528_1001555 3300003790 Bacteria 13819
48 Ga0055528_1001883 3300003790 Bacteria 11960
49 Ga0055528_1003098 3300003790 Bacteria 8536
50 Ga0055528_1003346 3300003790 Bacteria 8116
51 Ga0055528_1023919 3300003790 Bacteria 1847
52 Ga0055530_10008712 3300003791 Bacteria 4014
53 Ga0055540_1000548 3300003792 Bacteria 28000
54 Ga0055540_1004887 3300003792 Bacteria 5861
55 Ga0055531_10004263 3300003794 Bacteria 8787
56 Ga0058692_1004564 3300003856 Bacteria 4086
57 Ga0055543_1000002 3300004625 Bacteria 390020
58 Ga0055543_1000029 3300004625 Bacteria 131452
59 Ga0055543_1000055 3300004625 Bacteria 103837
60 Ga0065165_1002222 3300005262 Bacteria 17329
61 Ga0065165_1003368 3300005262 Bacteria 11342
62 Ga0065165_1008981 3300005262 Bacteria 4569
63 Ga0065165_1012704 3300005262 Bacteria 3409
64 Ga0065165_1017867 3300005262 Bacteria 2594
65 Ga0070668_100085110 3300005347 Bacteria 2485
66 Ga0070669_100014500 3300005353 Bacteria 5607
67 Ga0070671_100004488 3300005355 Bacteria 11047
68 Ga0070665_100009396 3300005548 Bacteria 9896
69 Ga0075365_10002538 3300006038 Bacteria 9001
70 Ga0075365_10009104 3300006038 Bacteria 5684
71 Ga0075368_10005337 3300006042 Bacteria 4416
72 Ga0075368_10007357 3300006042 Bacteria 3882
73 Ga0075363_100071781 3300006048 Bacteria 1882
74 Ga0075364_10001733 3300006051 Bacteria 12006
75 Ga0075362_10000714 3300006177 Bacteria 9811
76 Ga0075362_10049516 3300006177 Bacteria 1877
77 Ga0075367_10000580 3300006178 Bacteria 13996
78 Ga0075367_10002675 3300006178 Bacteria 8212
79 Ga0075369_10003349 3300006186 Bacteria 5825
80 Ga0075366_10003819 3300006195 Bacteria 8017
81 Ga0075370_10011985 3300006353 Bacteria 4569
82 Ga0075370_10017223 3300006353 Bacteria 3902
83 Ga0079104_1000042 3300006946 Bacteria 185991
84 Ga0099826_10003152 3300006948 Bacteria 11065
85 Ga0105251_10002518 3300009011 Bacteria 14301
86 Ga0105240_10000019 3300009093 Bacteria 406211
87 Ga0105237_10004254 3300009545 Bacteria 16661
88 Ga0123341_1000015 3300009765 Bacteria 86184
89 Ga0123342_1018576 3300009766 Bacteria 5498
90 Ga0105239_10073296 3300010375 Bacteria 3764
91 Ga0105246_10078812 3300011119 Bacteria 2341
92 Ga0157373_10023046 3300013100 Bacteria 4515
93 Ga0157371_10000005 3300013102 Bacteria 416456
94 Ga0157370_10000036 3300013104 Bacteria 136933
95 Ga0157370_10029162 3300013104 Bacteria 5420
96 Ga0157369_10043416 3300013105 Bacteria 4901
97 Ga0171463_1006 3300013249 Bacteria 336402
98 Ga0182007_10002354 3300015262 Bacteria 9464
99 Ga0182005_1004256 3300015265 Bacteria 4665
100 Ga0183363_1052 3300015690 Bacteria 37103
101 Ga0214544_1000063 3300021320 Bacteria 129929
102 Ga0214542_1000095 3300021321 Bacteria 116012
103 Ga0214543_1000008 3300021327 Bacteria 385680
104 Ga0214543_1000026 3300021327 Bacteria 220652
105 Ga0228711_1000003 3300022739 Bacteria 258118
106 Ga0228710_1000003 3300022740 Bacteria 262981
107 Ga0209435_100005 3300025206 Bacteria 573745
108 Ga0209436_100041 3300025208 Bacteria 74018
109 Ga0209436_101584 3300025208 Bacteria 7656
110 Ga0209563_104530 3300025230 Bacteria 2642
111 Ga0209437_100078 3300025233 Bacteria 278088
112 Ga0209437_100174 3300025233 Bacteria 138811
113 Ga0207425_1000080 3300025245 Bacteria 100578
114 Ga0209646_1000011 3300025246 Bacteria 573745
115 Ga0209026_1000008 3300025250 Bacteria 573745
116 Ga0209677_100841 3300025253 Bacteria 15210
117 Ga0209148_1006254 3300025254 Bacteria 2602
118 Ga0209759_1000004 3300025256 Bacteria 573745
119 Ga0209129_1000195 3300025258 Bacteria 80791
120 Ga0209129_1000199 3300025258 Bacteria 77091
121 Ga0209129_1000975 3300025258 Bacteria 17204
122 Ga0209129_1002043 3300025258 Bacteria 10426
123 Ga0209129_1002157 3300025258 Bacteria 9956
124 Ga0209233_1000163 3300025261 Bacteria 152912
125 Ga0209233_1000299 3300025261 Bacteria 60375
126 Ga0209233_1000305 3300025261 Bacteria 58381
127 Ga0209673_1000037 3300025273 Bacteria 313804
128 Ga0209673_1000320 3300025273 Bacteria 88073
129 Ga0209673_1000880 3300025273 Bacteria 38918
130 Ga0209673_1000924 3300025273 Bacteria 37119
131 Ga0209673_1009050 3300025273 Bacteria 4360
132 Ga0209673_1013148 3300025273 Bacteria 3287
133 Ga0209130_1000030 3300025284 Bacteria 323323
134 Ga0209130_1000032 3300025284 Bacteria 316240
135 Ga0209130_1000037 3300025284 Bacteria 284019
136 Ga0209676_1007404 3300025292 Bacteria 5159
137 Ga0209676_1008180 3300025292 Bacteria 4721
138 Ga0209025_1000052 3300025294 Bacteria 324648
139 Ga0209025_1000332 3300025294 Bacteria 104326
140 Ga0209025_1000339 3300025294 Bacteria 103239
141 Ga0209025_1000354 3300025294 Bacteria 98665
142 Ga0209025_1000566 3300025294 Bacteria 67702
143 Ga0209025_1014960 3300025294 Bacteria 4723
144 Ga0209564_1000086 3300025295 Bacteria 251385
145 Ga0209564_1000207 3300025295 Bacteria 135313
146 Ga0209564_1000345 3300025295 Bacteria 88073
147 Ga0209564_1001903 3300025295 Bacteria 18682
148 Ga0209758_1000105 3300025297 Bacteria 221415
149 Ga0209758_1000263 3300025297 Bacteria 104297
150 Ga0209758_1000561 3300025297 Bacteria 58483
151 Ga0209758_1001323 3300025297 Bacteria 30082
152 Ga0209758_1001789 3300025297 Bacteria 23722
153 Ga0209758_1019770 3300025297 Bacteria 3227
154 Ga0209050_1003645 3300025298 Bacteria 11129
155 Ga0209050_1007451 3300025298 Bacteria 6130
156 Ga0209050_1007579 3300025298 Bacteria 6039
157 Ga0209256_1000348 3300025299 Bacteria 75070
158 Ga0209256_1000368 3300025299 Bacteria 72598
159 Ga0209256_1002386 3300025299 Bacteria 15481
160 Ga0209256_1002530 3300025299 Bacteria 14662
161 Ga0209256_1003669 3300025299 Bacteria 10473
162 Ga0209256_1005717 3300025299 Bacteria 6974
163 Ga0209256_1006429 3300025299 Bacteria 6227
164 Ga0209256_1008857 3300025299 Bacteria 4549
165 Ga0207426_1000047 3300025302 Bacteria 417011
166 Ga0207426_1000048 3300025302 Bacteria 409127
167 Ga0207426_1000077 3300025302 Bacteria 316246
168 Ga0207426_1000296 3300025302 Bacteria 98032
169 Ga0207426_1007526 3300025302 Bacteria 4544
170 Ga0209051_1000236 3300025303 Bacteria 92738
171 Ga0209051_1000517 3300025303 Bacteria 48573
172 Ga0209051_1002615 3300025303 Bacteria 12651
173 Ga0209051_1003118 3300025303 Bacteria 11174
174 Ga0209051_1005137 3300025303 Bacteria 7767
175 Ga0209051_1012902 3300025303 Bacteria 4011
176 Ga0209257_1004486 3300025304 Bacteria 10777
177 Ga0207695_10000049 3300025913 Bacteria 406233
178 Ga0207671_10000107 3300025914 Bacteria 128950
179 Ga0207681_10019495 3300025923 Bacteria 4286
180 Ga0209281_1000081 3300027111 Bacteria 258084
181 Ga0209281_1000141 3300027111 Bacteria 175634
182 Ga0209281_1000194 3300027111 Bacteria 139318
183 Ga0209371_1000003 3300027312 Bacteria 1122971
184 Ga0209371_1004684 3300027312 Bacteria 5811
185 Ga0209282_1000036 3300027666 Bacteria 130242
186 Ga0209282_1000245 3300027666 Bacteria 27454
187 Ga0268266_10011741 3300028379 Bacteria 7599
188 Ga0307515_10000263 3300028794 Bacteria 130303
189 Ga0307515_10003195 3300028794 Bacteria 34661
190 Ga0307515_10015420 3300028794 Bacteria 14080
191 Ga0307515_10028957 3300028794 Bacteria 9385
192 Ga0268256_1000004 3300030500 Bacteria 1122967
193 Ga0268256_1000985 3300030500 Bacteria 19309
194 Ga0268256_1025192 3300030500 Bacteria 1515
195 Ga0307513_10003471 3300031456 Bacteria 21323
196 Ga0307513_10018153 3300031456 Bacteria 8417
197 Ga0307405_10005255 3300031731 Bacteria 6224
198 Ga0307406_10002153 3300031901 Bacteria 10724
199 Ga0307412_10011964 3300031911 Bacteria 5040
200 Ga0315914_1000002 3300031967 Bacteria 365357
201 Ga0315913_1000009 3300033430 Bacteria 149770
202 Ga0315915_1000005 3300033464 Bacteria 397591
203 Ga0373927_0000047 3300035695 Bacteria 87289
204 Ga0395905_0001828 3300037471 Bacteria 24574
205 Ga0395905_0006179 3300037471 Bacteria 12087
206 Ga0395905_0081414 3300037471 Bacteria 3034
207 Ga0439436_0030948 3300041404 Bacteria 1554
208 Ga0439439_0003881 3300041406 Bacteria 3328
209 Ga0439465_0004349 3300041413 Bacteria 4592
210 Ga0439465_0012872 3300041413 Bacteria 2615
211 Ga0451787_185132 3300041441 Bacteria 2360
212 Ga0451847_0100075 3300041503 Bacteria 2153
213 Ga0451853_1143250 3300041512 Bacteria 2338
214 Ga0439449_0020754 3300042007 Bacteria 2461
215 Ga0439462_0014648 3300042015 Bacteria 2017
216 Ga0450906_001859 3300042145 Bacteria 4619
217 Ga0450918_003132 3300042531 Bacteria 3090
218 Ga0495638_0000591 3300046460 Bacteria 40915
219 Ga0495638_0039664 3300046460 Bacteria 2988
220 Ga0495638_0040338 3300046460 Bacteria 2958
221 Ga0495651_0040692 3300046462 Bacteria 3613
222 Ga0495605_0010248 3300046474 Bacteria 5248
223 Ga0495662_0016992 3300046476 Bacteria 3521
224 Ga0495585_0016731 3300046492 Bacteria 4248
225 Ga0495585_0067310 3300046492 Bacteria 1959
226 Ga0495606_0003939 3300046507 Bacteria 15274
227 Ga0495610_0001811 3300046512 Bacteria 18572
228 Ga0495610_0052076 3300046512 Bacteria 1988
229 Ga0495620_0052878 3300046515 Bacteria 1722
230 Ga0495631_0054108 3300046518 Bacteria 1751
231 Ga0495632_0001545 3300046519 Bacteria 19004
232 Ga0495632_0027939 3300046519 Bacteria 2948
233 Ga0495643_0022456 3300046522 Bacteria 3600
234 Ga0495648_0019173 3300046524 Bacteria 4821
235 Ga0495648_0026636 3300046524 Bacteria 3889
236 Ga0495654_0000648 3300046530 Bacteria 27431
237 Ga0495633_0015371 3300046558 Bacteria 3972
238 Ga0495668_0034373 3300046616 Bacteria 2844
239 Ga0495625_0014252 3300046660 Bacteria 6355
240 Ga0495588_0019017 3300046674 Bacteria 3359
241 Ga0495657_0100259 3300046675 Bacteria 1846
242 Ga0495660_0033520 3300046810 Bacteria 2879
243 Ga0495604_0020104 3300047317 Bacteria 5336
244 Ga0495681_0011244 3300047470 Bacteria 5348
245 Ga0495686_0021750 3300047472 Bacteria 4253
246 Ga0495686_0039242 3300047472 Bacteria 3025
247 Ga0495686_0087900 3300047472 Bacteria 1890
248 Ga0496104_0067040 3300048907 Bacteria 3409
249 Ga0496106_0011811 3300048909 Bacteria 6447
250 Ga0496110_0046534 3300048913 Bacteria 3796
251 Ga0496116_0002495 3300048919 Bacteria 19279
252 Ga0496116_0007497 3300048919 Bacteria 9659
253 Ga0496116_0017558 3300048919 Bacteria 5547
254 Ga0496117_0000030 3300048920 Bacteria 389141
255 Ga0496117_0004557 3300048920 Bacteria 15179
256 Ga0496117_0069610 3300048920 Bacteria 2368
257 Ga0496118_0006549 3300048921 Bacteria 12738
258 Ga0496118_0038444 3300048921 Bacteria 3835
259 Ga0496119_0009213 3300048922 Bacteria 8518
260 Ga0496119_0057253 3300048922 Bacteria 2356
261 Ga0496119_0074266 3300048922 Bacteria 1980
262 Ga0496120_0000148 3300048923 Bacteria 116605
263 Ga0496120_0006073 3300048923 Bacteria 9378
264 Ga0496121_0000003 3300048924 Bacteria 1191431
265 Ga0496121_0002286 3300048924 Bacteria 29803
266 Ga0496121_0005619 3300048924 Bacteria 15980
267 Ga0496121_0008946 3300048924 Bacteria 11621
268 Ga0496121_0034108 3300048924 Bacteria 4587
269 Ga0496121_0060185 3300048924 Bacteria 3125
270 Ga0496122_0000024 3300048925 Bacteria 372400
271 Ga0496122_0000050 3300048925 Bacteria 267874
272 Ga0496122_0000107 3300048925 Bacteria 193163
273 Ga0496122_0025362 3300048925 Bacteria 5150
274 Ga0496122_0058187 3300048925 Bacteria 2863
275 Ga0496123_0000023 3300048926 Bacteria 346894
276 Ga0496123_0000063 3300048926 Bacteria 216072
277 Ga0496123_0000086 3300048926 Bacteria 183266
278 Ga0496124_0000239 3300048927 Bacteria 106633
279 Ga0496124_0001850 3300048927 Bacteria 29217
280 Ga0496124_0008295 3300048927 Bacteria 10880
281 Ga0496124_0009023 3300048927 Bacteria 10317
282 Ga0496124_0013288 3300048927 Bacteria 8045
283 Ga0496124_0017246 3300048927 Bacteria 6812
284 Ga0496124_0030974 3300048927 Bacteria 4738
285 Ga0496124_0080129 3300048927 Bacteria 2687
286 Ga0496125_0000833 3300048928 Bacteria 49770
287 Ga0496125_0000963 3300048928 Bacteria 45208
288 Ga0496126_0000434 3300048929 Bacteria 83949
289 Ga0496126_0005874 3300048929 Bacteria 13845
290 Ga0496126_0122326 3300048929 Bacteria 2255
291 Ga0501033_0000361 3300049570 Bacteria 43373
292 Ga0501034_0102887 3300049571 Bacteria 2850
293 Ga0501034_0297747 3300049571 Bacteria 1550
294 Ga0501037_0069588 3300049573 Bacteria 2562
295 Ga0501043_0080448 3300049579 Bacteria 2560
296 Ga0501083_0060840 3300049744 Bacteria 2522
297 Ga0501035_0000348 3300049822 Bacteria 53279
298 Ga0501044_0038826 3300049823 Bacteria 4972
299 nmdc:mga00v17_2647_c1 3300050491 Bacteria 9183
300 nmdc:mga00v17_337_c1 3300050491 Bacteria 26383
301 nmdc:mga0yw44_119600_c1 3300050492 Bacteria 1696
302 nmdc:mga0yw44_9940_c1 3300050492 Bacteria 4836
303 nmdc:mga0k408_16647_c1 3300050493 Bacteria 4084
304 nmdc:mga07m45_7731_c1 3300050496 Bacteria 5500
305 nmdc:mga0sz30_74_c2 3300050516 Bacteria 23106
306 Ga0500560_000303 3300053107 Bacteria 6267
307 Ga0500569_004053 3300053109 Bacteria 3050
308 Ga0500618_000109 3300053125 Bacteria 66318
309 Ga0500618_000855 3300053125 Bacteria 16375
310 Ga0500658_0003019 3300053134 Bacteria 6454
311 Ga0500559_0004751 3300053136 Bacteria 6373
312 Ga0500561_0000118 3300053137 Bacteria 15316
313 Ga0500568_0005361 3300053139 Bacteria 6642
314 Ga0500590_000118 3300053148 Bacteria 21518
315 Ga0500616_0001217 3300053153 Bacteria 26006
316 Ga0500616_0026796 3300053153 Bacteria 3186
317 Ga0500622_0000101 3300053156 Bacteria 86856
318 Ga0500634_0019203 3300053161 Bacteria 3679
319 Ga0501082_0152288 3300060353 Bacteria 2009
320 2509110215 2508501122 Bacteria 6292184
321 2509378949 2509276019 Bacteria 6802256
322 2509389789 2509276021 Bacteria 7634384
323 2509447957 2509276033 Bacteria 7180565
324 2510134895 2510065019 Bacteria 6903379
325 2510303741 2510065057 Bacteria 6649661
326 2510842342 2510461069 Bacteria 5505000
327 2510896306 2510461076 Bacteria 8618824
328 2511136515 2510917022 Bacteria 6504556
329 2511173674 2510917026 Bacteria 7046020
330 2511187330 2510917028 Bacteria 6185411
331 2511195936 2510917030 Bacteria 7460662
332 2511503038 2511231052 Bacteria 6974333
333 2512534302 2512047086 Bacteria 6850303
334 2512973877 2512875026 Bacteria 6861065
335 2513572658 2513237084 Bacteria 7231967
336 2513580110 2513237085 Bacteria 7695351
337 2513585989 2513237086 Bacteria 7265287
338 2513597229 2513237088 Bacteria 6927906
339 2513602406 2513237089 Bacteria 6553624
340 2513617207 2513237091 Bacteria 6900273
341 2513631266 2513237093 Bacteria 7545552
342 2513710839 2513237103 Bacteria 7647401
343 2513867002 2513237138 Bacteria 7368160
344 2513882948 2513237140 Bacteria 7076289
345 2513902977 2513237143 Bacteria 6664116
346 2513908131 2513237144 Bacteria 7530820
347 2513926999 2513237146 Bacteria 7166346
348 2513985722 2513237156 Bacteria 6402557
349 2513998135 2513237159 Bacteria 6810126
350 2514004049 2513237160 Bacteria 6650282
351 2514023196 2513237162 Bacteria 7468464
352 2515113978 2515075009 Bacteria 7288508
353 2515610278 2515154107 Bacteria 6795637
354 2515639187 2515154113 Bacteria 7807172
355 2515642975 2515154114 Bacteria 7848616
356 2515656721 2515154116 Bacteria 7552979
357 2515743664 2515154134 Bacteria 7220242
358 2516205302 2516143018 Bacteria 6951533
359 2516894442 2516653046 Bacteria 6989037
360 2517037610 2516653077 Bacteria 7555578
361 2517077897 2516653085 Bacteria 7346596
362 2517096693 2517093000 Bacteria 7412387
363 2517410408 2517287029 Bacteria 6905599
364 2517571061 2517487022 Bacteria 7227575
365 2524451925 2524023207 Bacteria 6813453
366 2524460026 2524023209 Bacteria 6679728
367 2530647005 2529292951 Bacteria 6916614
368 2535519377 2534681796 Bacteria 7146037
369 2537876145 2537561587 Bacteria 5425293
370 2551679853 2551306084 Bacteria 8942552
371 2551689723 2551306085 Bacteria 7347181
372 2551692524 2551306086 Bacteria 6843938
373 2551703965 2551306087 Bacteria 7351905
374 2551708893 2551306089 Bacteria 7162724
375 2551717121 2551306090 Bacteria 7953713
376 2551735184 2551306092 Bacteria 6992595
377 2551741138 2551306093 Bacteria 7064773
378 2554244535 2554235003 Bacteria 5877155
379 2558860455 2558860100 Bacteria 8458965
380 2559297623 2558860242 Bacteria 5568029
381 2561468038 2558860983 Bacteria 4133860
382 2585168082 2582581283 Bacteria 6030556
383 2585202417 2582581294 Bacteria 6626667
384 2585224727 2582581298 Bacteria 7315509
385 2585227884 2582581299 Bacteria 6518058
386 2585257903 2582581304 Bacteria 5831370
387 2585269711 2582581306 Bacteria 6450535
388 2585274326 2582581307 Bacteria 6597605
389 2585280261 2582581308 Bacteria 7413247
390 2585322538 2582581315 Bacteria 7318924
391 2585335152 2582581316 Bacteria 7774528
392 2585388627 2582581865 Bacteria 6644329
393 2585392475 2582581866 Bacteria 6859583
394 2585402275 2582581867 Bacteria 7184437
395 2585529025 2585427526 Bacteria 7258840
396 2585532490 2585427527 Bacteria 7273426
397 2585540966 2585427528 Bacteria 6842387
398 2585547283 2585427529 Bacteria 7395659
399 2585554493 2585427530 Bacteria 7383882
400 2585560775 2585427531 Bacteria 6992870
401 2585822425 2585427590 Bacteria 6824633
402 2585839728 2585427593 Bacteria 7141551
403 2585845438 2585427594 Bacteria 6180594
404 2585898977 2585427608 Bacteria 6544331
405 2585903430 2585427609 Bacteria 6667127
406 2585997212 2585427633 Bacteria 6413184
407 2586001814 2585427634 Bacteria 6455027
408 2587981451 2585428125 Bacteria 6662905
409 2599334706 2599185156 Bacteria 5403036
410 2599420507 2599185170 Bacteria 7295545
411 2599606208 2599185210 Bacteria 5624189
412 2599720065 2599185236 Bacteria 6875203
413 2600194142 2599185352 Bacteria 7228948
414 2600373597 2600254933 Bacteria 4750527
415 2601612418 2600255279 Bacteria 5605316
416 2601748959 2600255308 Bacteria 5611129
417 2616295613 2615840624 Bacteria 6557588
418 2616307439 2615840626 Bacteria 7921970
419 2616554983 2615840698 Bacteria 7319877
420 2617383438 2617270742 Bacteria 6808054
421 2643809716 2643221557 Bacteria 7184309
422 2643813292 2643221558 Bacteria 5460675
423 2643922214 2643221582 Bacteria 5804683
424 2644006508 2643221599 Bacteria 6292121
425 2644048359 2643221607 Bacteria 6314006
426 2644063896 2643221610 Bacteria 7480339
427 2644108425 2643221618 Bacteria 7717186
428 2644195956 2643221634 Bacteria 6705461
429 2644201721 2643221636 Bacteria 6583769
430 2644209826 2643221637 Bacteria 5345260
431 2644241926 2643221643 Bacteria 5749658
432 2644299293 2643221653 Bacteria 4569637
433 2644312452 2643221655 Bacteria 7722067
434 2644336080 2643221659 Bacteria 7890716
435 2644381418 2643221668 Bacteria 7306521
436 2644415729 2643221675 Bacteria 7473456
437 2644448769 2643221680 Bacteria 7473610
438 2644481161 2643221686 Bacteria 6310811
439 2644496417 2643221688 Bacteria 5260751
440 2644522723 2643221693 Bacteria 5513853
441 2644546937 2643221698 Bacteria 7756764
442 2644618135 2643221712 Bacteria 7729434
443 2644653377 2643221718 Bacteria 5345506
444 2644657521 2643221719 Bacteria 4568197
445 2644676689 2643221723 Bacteria 7095460
446 2644686837 2643221726 Bacteria 7455827
447 2657684460 2657244999 Bacteria 5946535
448 2671112231 2667528174 Bacteria 6435400
449 2692314450 2690316117 Bacteria 6800650
450 2719182647 2718217882 Bacteria 6556348
451 2719387318 2718217927 Bacteria 6972593
452 2719666963 2718217997 Bacteria 6740740
453 2719733365 2718218009 Bacteria 6478651
454 2720493383 2718218199 Bacteria 6740745
455 2720614854 2718218232 Bacteria 6720332
456 2720621627 2718218233 Bacteria 6662049
457 2720632955 2718218235 Bacteria 6630699
458 2720776679 2718218269 Bacteria 6906114
459 2721148760 2718218363 Bacteria 6524337
460 2721160144 2718218365 Bacteria 6274507
461 2721165573 2718218366 Bacteria 6425255
462 2721400953 2718218423 Bacteria 6438183
463 2722841743 2721755514 Bacteria 6424414
464 2723028267 2721755556 Bacteria 6745503
465 2723561895 2721755684 Bacteria 6859907
466 2723568527 2721755685 Bacteria 6704835
467 2724039766 2721755809 Bacteria 6438790
468 2724046121 2721755810 Bacteria 6479005
469 2724091286 2721755819 Bacteria 6906405
470 2724105792 2721755822 Bacteria 6726041
471 2725945414 2724679232 Bacteria 7646494
472 2730109203 2728369352 Bacteria 6745171
473 2730165882 2728369365 Bacteria 6555560
474 2730299776 2728369397 Bacteria 6274511
475 2738800370 2738541293 Bacteria 7065685
476 2738944551 2738541317 Bacteria 5340176
477 2739035523 2738541333 Bacteria 7106503
478 2753461034 2751185821 Bacteria 6189929
479 2766065270 2765235942 Bacteria 7445910
480 2776914617 2775507049 Bacteria 6284736
481 2778176050 2775507266 Bacteria 7392367
482 2792582508 2791355082 Bacteria 5973319
483 2792624328 2791355091 Bacteria 6135441
484 2792625670 2791355092 Bacteria 6248105
485 2792642774 2791355094 Bacteria 7011481
486 2793281585 2791355253 Bacteria 5171699
487 2793293583 2791355256 Bacteria 6798008
488 2793313025 2791355259 Bacteria 7254731
489 2793319672 2791355260 Bacteria 6598818
490 2793327822 2791355261 Bacteria 6661293
491 2793333432 2791355262 Bacteria 6774204
492 2793342035 2791355263 Bacteria 6872478
493 2793347420 2791355264 Bacteria 6429314
494 2793353752 2791355265 Bacteria 6539969
495 2793359648 2791355266 Bacteria 7116587
496 2793369398 2791355267 Bacteria 7222458
497 2802717849 2802428858 Bacteria 6636079
498 2802725300 2802428859 Bacteria 6667919
499 2802730576 2802428860 Bacteria 6525526
500 2802737923 2802428861 Bacteria 6534206
501 2802744207 2802428862 Bacteria 6633353
502 2802753108 2802428863 Bacteria 6410669
503 2804753363 2802429268 Bacteria 6094027
504 2805929457 2802429605 Bacteria 6875453
505 2805935362 2802429606 Bacteria 6346811
506 2806044509 2802429633 Bacteria 7341974
507 2806052710 2802429634 Bacteria 7083200
508 2806059010 2802429635 Bacteria 7650140
509 2806068327 2802429636 Bacteria 7597525
510 2806074447 2802429637 Bacteria 7067217
511 2808989132 2808606387 Bacteria 5697198
512 2819243860 2818991272 Bacteria 4622173
513 2819557671 2818991439 Bacteria 6907412
514 2819609562 2818991448 Bacteria 6772224
515 2819639660 2818991453 Bacteria 7181617
516 2819686483 2818991461 Bacteria 7026071
517 2821126208 2821123053 Bacteria 7836056
518 2838019159 2838016132 Bacteria 6577831
519 2838024250 2838022645 Bacteria 6494267
520 2838033171 2838029111 Bacteria 6603031
521 2838040821 2838035591 Bacteria 7166484
522 2838047410 2838042994 Bacteria 6046894
523 2838063899 2838061910 Bacteria 6794874
524 2838073384 2838068647 Bacteria 6208656
525 2838077486 2838074704 Bacteria 6785777
526 2838664788 2838661181 Bacteria 7385261
527 2838671083 2838668709 Bacteria 6671819
528 2838679945 2838675328 Bacteria 4909118
529 2838684904 2838680041 Bacteria 6545511
530 2838691267 2838686498 Bacteria 7807632
531 2838699259 2838694306 Bacteria 6853137
532 2838703738 2838701080 Bacteria 6669771
533 2838712740 2838707686 Bacteria 6619912
534 2838717742 2838714209 Bacteria 5525906
535 2838724516 2838719591 Bacteria 5523910
536 2838729542 2838724970 Bacteria 4908691
537 2838735750 2838729681 Bacteria 7400765
538 2838737317 2838736955 Bacteria 5760694
539 2838748652 2838742623 Bacteria 7396178
540 2841842314 2841840854 Bacteria 5761912
541 2841849980 2841846520 Bacteria 5345850
542 2841853913 2841851746 Bacteria 7532261
543 2841864255 2841859092 Bacteria 5436171
544 2841868119 2841864319 Bacteria 6742987
545 2842082217 2842077413 Bacteria 6508645
546 2842113382 2842110456 Bacteria 7656360
547 2842123142 2842118031 Bacteria 7033875
548 2842128452 2842124991 Bacteria 5346824
549 2842134627 2842130223 Bacteria 4909145
550 2842142093 2842140634 Bacteria 5759631
551 2842151247 2842146304 Bacteria 5957337
552 2842156541 2842152218 Bacteria 4908957
553 2842162569 2842156927 Bacteria 6894975
554 2842170003 2842163707 Bacteria 6916235
555 2842173987 2842170452 Bacteria 5525737
556 2842180162 2842175837 Bacteria 4908771
557 2842185006 2842180545 Bacteria 6888678
558 2842192161 2842187318 Bacteria 5524014
559 2842198209 2842192696 Bacteria 6147454
560 2842199792 2842198810 Bacteria 6608673
561 2842208359 2842205361 Bacteria 6340321
562 2842216559 2842211629 Bacteria 5523832
563 2842220024 2842217011 Bacteria 7497767
564 2842229197 2842224351 Bacteria 5524473
565 2842235621 2842229732 Bacteria 7475766
566 2842241958 2842237096 Bacteria 6620661
567 2842249345 2842243621 Bacteria 7421798
568 2842256303 2842250916 Bacteria 6579627
569 2842263518 2842257432 Bacteria 7401195
570 2842266659 2842264693 Bacteria 6472963
571 2842275742 2842271015 Bacteria 7807131
572 2842281632 2842278818 Bacteria 6340002
573 2842288746 2842285085 Bacteria 6011953
574 2842296218 2842291075 Bacteria 7076806
575 2842298750 2842298080 Bacteria 6123127
576 2842308274 2842304105 Bacteria 7023636
577 2842316445 2842311132 Bacteria 6616990
578 2842321333 2842317721 Bacteria 6793725
579 2842345061 2842341865 Bacteria 7003929
580 2842359382 2842357229 Bacteria 6485165
581 2842369177 2842363717 Bacteria 6844742
582 2842375580 2842370503 Bacteria 7038661
583 2842382618 2842377471 Bacteria 7140707
584 2842390019 2842384541 Bacteria 7057858
585 2842398457 2842395702 Bacteria 6780583
586 2842406587 2842402390 Bacteria 6681310
587 2842412986 2842409023 Bacteria 6687331
588 2842419629 2842415677 Bacteria 6596907
589 2842427019 2842422224 Bacteria 6239196
590 2842429978 2842428310 Bacteria 6767288
591 2842436362 2842434925 Bacteria 6502746
592 2842444065 2842441272 Bacteria 6769273
593 2842451082 2842447887 Bacteria 6754142
594 2842464399 2842462802 Bacteria 6588055
595 2842470691 2842469257 Bacteria 6752936
596 2842479904 2842475841 Bacteria 6603183
597 2842483349 2842482326 Bacteria 7212537
598 2842493330 2842489311 Bacteria 6620893
599 2842499099 2842495871 Bacteria 6820686
600 2842507080 2842502639 Bacteria 6604161
601 2842510778 2842509118 Bacteria 6850950
602 2842520998 2842515876 Bacteria 5436280
603 2842523240 2842521101 Bacteria 6569494
604 2842925829 2842922631 Bacteria 5824079
605 2844169310 2844163670 Bacteria 7266046
606 2844457441 2844454524 Bacteria 7952546
607 2847420497 2847417321 Bacteria 6913799
608 2848995369 2848992105 Bacteria 6810864
609 2850082354 2850079185 Bacteria 6848280
610 2852391265 2852387548 Bacteria 8025568
611 2854897330 2854896431 Bacteria 5869725
612 2854921533 2854916844 Bacteria 5725939
613 2855827078 2855825444 Bacteria 6785811
614 2855842475 2855839649 Bacteria 7135830
615 2855878376 2855872281 Bacteria 6964271
616 2857518850 2857516855 Bacteria 7787325
617 2857532769 2857531043 Bacteria 6754041
618 2858803291 2858800743 Bacteria 6603254
619 2891050113 2891048133 Bacteria 4447501
620 2891377476 2891373044 Bacteria 5202277
621 2896387668 2896384573 Bacteria 7700774
622 2899793138 2899792073 Bacteria 4926588
623 2899806313 2899803654 Bacteria 5577784
624 2899849658 2899845264 Bacteria 5672268
625 2913299880 2913295892 Bacteria 6333755
626 2913309171 2913308742 Bacteria 5350706
627 2915980610 2915980308 Bacteria 6624279
628 2915988861 2915986958 Bacteria 6739310
629 2915994896 2915993759 Bacteria 7016183
630 2916006968 2916000859 Bacteria 6865702
631 2916012205 2916007675 Bacteria 6898660
632 2916016870 2916014648 Bacteria 6946486
633 2916027733 2916021584 Bacteria 6854472
634 2916030254 2916028427 Bacteria 6748433
635 2916036811 2916035215 Bacteria 6755766
636 2916044668 2916041962 Bacteria 6820487
637 2916052622 2916048683 Bacteria 6543552
638 2916058380 2916055098 Bacteria 6758838
639 2916065571 2916061851 Bacteria 6737736
640 2916071478 2916068649 Bacteria 6943657
641 2916080118 2916076590 Bacteria 6596108
642 2919104620 2919100787 Bacteria 7710546
643 2919118023 2919114240 Bacteria 5700270
644 2919173507 2919171160 Bacteria 6499771
645 2919410718 2919408235 Bacteria 6149349
646 2920760706 2920760137 Bacteria 7427611
647 2920828434 2920822456 Bacteria 6897201
648 2921201468 2921201388 Bacteria 6926299
649 2921209625 2921208531 Bacteria 6745326
650 2921237551 2921237296 Bacteria 6876710
651 2921244266 2921244191 Bacteria 6568419
652 2921252550 2921250672 Bacteria 6677771
653 2921260694 2921257292 Bacteria 6808382
654 2921265953 2921263974 Bacteria 6864552
655 2921287719 2921282425 Bacteria 6826397
656 2921295724 2921289301 Bacteria 7316391
657 2921302825 2921296804 Bacteria 7176999
658 2923558730 2923556063 Bacteria 6793593
659 2924148771 2924144063 Bacteria 6883928
660 2924152186 2924150972 Bacteria 7169444
661 2924164122 2924158325 Bacteria 7188855
662 2924166621 2924165586 Bacteria 7260590
663 2924174410 2924172951 Bacteria 6749356
664 2924183980 2924179722 Bacteria 6843264
665 2924188477 2924186466 Bacteria 6876637
666 2924193822 2924193448 Bacteria 6955718
667 2924206651 2924200457 Bacteria 6757188
668 2924213083 2924207177 Bacteria 6917007
669 2924217159 2924214083 Bacteria 7080103
670 2924224029 2924221636 Bacteria 7113495
671 2924232034 2924228884 Bacteria 6633132
672 2926757790 2926754445 Bacteria 5964435
673 2926764584 2926760298 Bacteria 5505990
674 2929141419 2929138655 Bacteria 5810547
675 2933010405 2933006813 Bacteria 4912075
676 2933011590 2933011516 Bacteria 5439334
677 2933019921 2933016740 Bacteria 6355406
678 2933574723 2933570622 Bacteria 7023390
679 2933589328 2933586486 Bacteria 7667493
680 2933597273 2933594066 Bacteria 5594265
681 2933603486 2933599457 Bacteria 5858799
682 2935901229 2935894831 Bacteria 6620579
683 2935907502 2935901341 Bacteria 7341747
684 2936374818 2936367885 Bacteria 7324495
685 2936380510 2936375103 Bacteria 6652732
686 2936382323 2936381700 Bacteria 7006523
687 2937000110 2936996657 Bacteria 6298727
688 2937006941 2937002841 Bacteria 6934057
689 2937015411 2937009748 Bacteria 6746052
690 2937018130 2937016420 Bacteria 6782579
691 2937024334 2937023124 Bacteria 6815156
692 2937032947 2937029754 Bacteria 6424026
693 2937042271 2937036028 Bacteria 6846469
694 2937046681 2937042894 Bacteria 6741576
695 2937052297 2937049772 Bacteria 6757901
696 2937063106 2937056579 Bacteria 7107896
697 2937067541 2937063883 Bacteria 7199456
698 2937071355 2937071275 Bacteria 6984483
699 2937078677 2937078374 Bacteria 6610289
700 2937090052 2937084907 Bacteria 6618516
701 2937092938 2937091812 Bacteria 6979387
702 2937104760 2937098957 Bacteria 7249374
703 2937109921 2937106411 Bacteria 6947143
704 2937114528 2937113482 Bacteria 6505872
705 2937123744 2937119839 Bacteria 6597547
706 2937129278 2937126314 Bacteria 6771275
707 2941501640 2941499720 Bacteria 7599444
708 2957376885 2957375807 Bacteria 6425588
709 2957386039 2957382221 Bacteria 6737050
710 2957390123 2957388812 Bacteria 6778072
711 2957396813 2957395598 Bacteria 6822399
712 2957406220 2957402308 Bacteria 6741770
713 2957408973 2957408893 Bacteria 6558585
714 2957422014 2957415311 Bacteria 6991633
715 2957425568 2957422303 Bacteria 7172205
716 2957430577 2957430029 Bacteria 7022557
717 2957443175 2957437181 Bacteria 6568994
718 2957444391 2957443900 Bacteria 6869977
719 2957452734 2957450854 Bacteria 6765715
720 2957463115 2957457609 Bacteria 6967680
721 2957468241 2957464669 Bacteria 6568877
722 2957471913 2957471148 Bacteria 6797643
723 2957480974 2957478035 Bacteria 6756658
724 2957486573 2957484790 Bacteria 6703082
725 2957495227 2957491536 Bacteria 6695180
726 2957501923 2957498199 Bacteria 7126688
727 2957507010 2957505466 Bacteria 7253085
728 2960584747 2960584000 Bacteria 6864594
729 2960591325 2960591022 Bacteria 6622873
730 2960598732 2960597568 Bacteria 6550735
731 2960610170 2960603979 Bacteria 6898737
732 2960617295 2960610863 Bacteria 6691244
733 2960618713 2960617483 Bacteria 6727748
734 2960629570 2960624210 Bacteria 6875384
735 2960632577 2960631154 Bacteria 6732508
736 2960639594 2960637947 Bacteria 7296468
737 2960646702 2960645483 Bacteria 7211087
738 2960653072 2960652885 Bacteria 7083688
739 2960662910 2960660292 Bacteria 7041660
740 2960671452 2960667422 Bacteria 6763020
741 2960674530 2960674078 Bacteria 6609048
742 2960681407 2960680706 Bacteria 6624464
743 2960687888 2960687367 Bacteria 6535474
744 2960695160 2960693952 Bacteria 6749742
745 2964612399 2964607997 Bacteria 7101408
746 2964620358 2964615318 Bacteria 6809089
747 2964625963 2964621998 Bacteria 6834995
748 2964632509 2964628898 Bacteria 7083044
749 2964640484 2964636051 Bacteria 7091832
750 2964647197 2964643177 Bacteria 6820887
751 2964650906 2964649959 Bacteria 6675118
752 2964659018 2964656573 Bacteria 7100150
753 2964668813 2964663802 Bacteria 7019362
754 2964674561 2964670856 Bacteria 6851364
755 2964681747 2964678106 Bacteria 6792020
756 2964688686 2964685014 Bacteria 6839111
757 2964693244 2964691889 Bacteria 6802758
758 2964705148 2964698721 Bacteria 6765331
759 2964706238 2964705432 Bacteria 7114648
760 2964719071 2964712639 Bacteria 6695970
761 2964726748 2964719344 Bacteria 7286602
762 2967666666 2967664464 Bacteria 6948836
763 2967676624 2967671571 Bacteria 7021409
764 2967683035 2967678726 Bacteria 7264382
765 2967686556 2967686174 Bacteria 6678622
766 2967696115 2967693043 Bacteria 6804451
767 2967700480 2967699805 Bacteria 6854538
768 2967708428 2967706974 Bacteria 7186053
769 2967715825 2967714385 Bacteria 7000047
770 2967722014 2967721400 Bacteria 7073753
771 2967732439 2967728569 Bacteria 6641507
772 2967735431 2967735183 Bacteria 6827012
773 2967742341 2967742019 Bacteria 6794534
774 2967750138 2967748971 Bacteria 6733771
775 2967758999 2967755722 Bacteria 6814706
776 2967769068 2967762386 Bacteria 6923502
777 2967774543 2967769361 Bacteria 6587838
778 2967781320 2967775926 Bacteria 6738189
779 2970024979 2970019648 Bacteria 7072033
780 2970029358 2970026789 Bacteria 6785236
781 2970040661 2970033650 Bacteria 7118744
782 2970041770 2970040964 Bacteria 6731123
783 2970052743 2970047711 Bacteria 7088379
784 2970061048 2970054988 Bacteria 6611507
785 2970068139 2970061556 Bacteria 7099761
786 2970069437 2970068827 Bacteria 7123112
787 2970079072 2970076120 Bacteria 6697332
788 2970084245 2970082768 Bacteria 6183754
789 2970095493 2970088815 Bacteria 6933825
790 2970099076 2970095765 Bacteria 6936963
791 2970108821 2970102677 Bacteria 6812532
792 2970115248 2970109326 Bacteria 6863976
793 2970119550 2970116247 Bacteria 6501857
794 2970126417 2970122695 Bacteria 6625855
795 2970134290 2970129317 Bacteria 6806560
796 2970140665 2970136068 Bacteria 7207982
797 2970144590 2970143518 Bacteria 6446480
798 2970155655 2970149975 Bacteria 6779706
799 2970160311 2970156795 Bacteria 7168044
800 2970165900 2970164137 Bacteria 6861252
801 2970173338 2970170962 Bacteria 6876229
802 2970179831 2970177841 Bacteria 6768001
803 2970186614 2970184632 Bacteria 7054431
804 2970194501 2970191845 Bacteria 7032787
805 2977520775 2977516862 Bacteria 6940108
806 2977530093 2977523885 Bacteria 6960446
807 2977532429 2977530762 Bacteria 6951399
808 2977540960 2977537788 Bacteria 6929320
809 2977551132 2977544691 Bacteria 6875412
810 2977556840 2977551784 Bacteria 7125765
811 2977565589 2977558990 Bacteria 6863948
812 2977569102 2977565890 Bacteria 6901543
813 2977578019 2977572785 Bacteria 6763888
814 2977579703 2977579622 Bacteria 6772100
815 2979090306 2979089926 Bacteria 5670289
816 2979095835 2979095461 Bacteria 5669583
817 2979102711 2979100975 Bacteria 5423623
818 2984509401 2984509177 Bacteria 5274802
819 2984519900 2984518228 Bacteria 5277463
820 2984537733 2984537506 Bacteria 5277481
821 2984604478 2984601300 Bacteria 5455244
822 2989354596 2989349275 Bacteria 6349068
823 2989775201 2989771324 Bacteria 5605128
824 2989780398 2989776772 Bacteria 4843317
825 2995394072 2995392953 Bacteria 4539380
826 2996889257 2996887358 Bacteria 5795980
827 2996894681 2996893221 Bacteria 5823108
828 3003930560 3003930520 Bacteria 5667563
829 3005415434 3005409236 Bacteria 7188837
830 3005418445 3005416602 Bacteria 7064308
831 3005449327 3005445848 Bacteria 6906074
832 3005455625 3005452660 Bacteria 5889319
833 639650047 639633055 Bacteria 7751309
834 643827133 643692032 Bacteria 6891900
835 648735800 648276728 Bacteria 6968865
836 650844065 650716007 Bacteria 5573770
837 8003574420 8003570095 Bacteria 5747666
838 8003995016 8003992118 Bacteria 7266902
839 8004002778 8003999396 Bacteria 7063185
840 8005249514 8005246636 Bacteria 4933972
841 8005264165 8005258706 Bacteria 6184835
842 8005282065 8005275841 Bacteria 6929066
843 8005285119 8005282627 Bacteria 6675747
844 8005294214 8005289223 Bacteria 6634003
845 8005306627 8005301065 Bacteria 6614431
846 8005309439 8005307578 Bacteria 7395396
847 8005318663 8005314921 Bacteria 7072929
848 8005323784 8005321885 Bacteria 5795980
849 8005382735 8005376324 Bacteria 6590079
850 8005383792 8005382845 Bacteria 6732062
851 8005401118 8005395548 Bacteria 6806915
852 8005434072 8005430974 Bacteria 6689030
853 8005464666 8005460587 Bacteria 7157962
854 8005488453 8005484373 Bacteria 6297373
855 8005501715 8005497431 Bacteria 6477605
856 8005547064 8005542996 Bacteria 7077758
857 8005559114 8005556819 Bacteria 6908598
858 8005566827 8005563573 Bacteria 7153261
859 8005574895 8005570704 Bacteria 6957481
860 8005623069 8005619151 Bacteria 7030230
861 8005631623 8005626139 Bacteria 6534237
862 8005648922 8005645114 Bacteria 6950293
863 8005661718 8005658619 Bacteria 4500593
864 8005673137 8005668836 Bacteria 6953162
865 8005682161 8005682033 Bacteria 6726518
866 8005693677 8005688590 Bacteria 6610080
867 8005700917 8005695170 Bacteria 6912330
868 8018133566 8018127388 Bacteria 7351159
869 8018152093 8018150411 Bacteria 5549903
870 8018170270 8018163183 Bacteria 7277977
871 8018178415 8018176218 Bacteria 6896178
872 8023687496 8023680758 Bacteria 7729763
873 8024482002 8024479707 Bacteria 6954785
874 8024486971 8024486573 Bacteria 6540512
875 8024505886 8024501048 Bacteria 6427847
876 8046773179 8046767195 Bacteria 7547379
877 8049295980 8049293176 Bacteria 6128433
878 8054563038 8054558443 Bacteria 5204801
879 8056381638 8056375014 Bacteria 7006639
880 8056387075 8056382006 Bacteria 6408074
881 8056876218 8056875544 Bacteria 4355797
882 8057581084 8057575449 Bacteria 7367519
883 8057877042 8057874678 Bacteria 7494653
884 Ga0075364_10023758
885 JGI25155J39150_1000012
886 JGI25156J39149_1000036
887 JGI25162J39368_1000146
888 JGI25162J39368_1000616
889 JGI25162J39368_1000674
890 JGI25154J39366_1000033
891 JGI25158J39367_1000162
892 JGI25158J39367_1002448
893 JGI25157J39369_1000457
894 JGI25152J39213_1001072
895 JGI25152J39213_1001517
896 JGI25152J39213_1004183
897 JGI25152J39213_1004784
898 JGI25150J39212_1000063
899 JGI25150J39212_1004572
900 JGI25159J45721_1000032
901 JGI25159J45721_1000464
902 JGI25159J45721_1000747
903 JGI25151J46595_10000140
904 JGI25151J46595_10001521
905 JGI25151J46595_10018048
906 JGI25151J46595_10023356
907 JGI25151J46595_10028844
908 JGI25165J46597_1000653
909 JGI25165J46597_1000719
910 JGI25165J46597_1002384
911 JGI25153J46596_10003714
912 JGI25153J46596_10007115
913 JGI25153J46596_10013467
914 rootL2_10030145
915 JGI25160J50197_1000006
916 JGI25160J50197_1000009
917 JGI25160J50197_1001914
918 JGI25161J50226_1000004
919 JGI25161J50226_1000103
920 JGI25161J50226_1004289
921 Ga0055526_1004064
922 Ga0055526_1004185
923 Ga0055526_1006594
924 Ga0055526_1009137
925 Ga0055526_1021513
926 Ga0055524_1000790
927 Ga0055524_1002131
928 Ga0055524_1016292
929 Ga0055536_1011333
930 Ga0055528_1001555
931 Ga0055528_1001883
932 Ga0055528_1003098
933 Ga0055528_1003346
934 Ga0055528_1023919
935 Ga0055530_10008712
936 Ga0055540_1000548
937 Ga0055540_1004887
938 Ga0055531_10004263
939 Ga0058692_1004564
940 Ga0055543_1000002
941 Ga0055543_1000029
942 Ga0055543_1000055
943 Ga0065165_1002222
944 Ga0065165_1003368
945 Ga0065165_1008981
946 Ga0065165_1012704
947 Ga0065165_1017867
948 Ga0070668_100085110
949 Ga0070669_100014500
950 Ga0070671_100004488
951 Ga0070665_100009396
952 Ga0075365_10002538
953 Ga0075365_10009104
954 Ga0075368_10005337
955 Ga0075368_10007357
956 Ga0075363_100071781
957 Ga0075364_10001733
958 Ga0075362_10000714
959 Ga0075362_10049516
960 Ga0075367_10000580
961 Ga0075367_10002675
962 Ga0075369_10003349
963 Ga0075366_10003819
964 Ga0075370_10011985
965 Ga0075370_10017223
966 Ga0079104_1000042
967 Ga0099826_10003152
968 Ga0105251_10002518
969 Ga0105240_10000019
970 Ga0105237_10004254
971 Ga0123341_1000015
972 Ga0123342_1018576
973 Ga0105239_10073296
974 Ga0105246_10078812
975 Ga0157373_10023046
976 Ga0157371_10000005
977 Ga0157370_10000036
978 Ga0157370_10029162
979 Ga0157369_10043416
980 Ga0171463_1006
981 Ga0182007_10002354
982 Ga0182005_1004256
983 Ga0183363_1052
984 Ga0214544_1000063
985 Ga0214542_1000095
986 Ga0214543_1000008
987 Ga0214543_1000026
988 Ga0228711_1000003
989 Ga0228710_1000003
990 Ga0209435_100005
991 Ga0209436_100041
992 Ga0209436_101584
993 Ga0209563_104530
994 Ga0209437_100078
995 Ga0209437_100174
996 Ga0207425_1000080
997 Ga0209646_1000011
998 Ga0209026_1000008
999 Ga0209677_100841
1000 Ga0209148_1006254
1001 Ga0209759_1000004
1002 Ga0209129_1000195
1003 Ga0209129_1000199
1004 Ga0209129_1000975
1005 Ga0209129_1002043
1006 Ga0209129_1002157
1007 Ga0209233_1000163
1008 Ga0209233_1000299
1009 Ga0209233_1000305
1010 Ga0209673_1000037
1011 Ga0209673_1000320
1012 Ga0209673_1000880
1013 Ga0209673_1000924
1014 Ga0209673_1009050
1015 Ga0209673_1013148
1016 Ga0209130_1000030
1017 Ga0209130_1000032
1018 Ga0209130_1000037
1019 Ga0209676_1007404
1020 Ga0209676_1008180
1021 Ga0209025_1000052
1022 Ga0209025_1000332
1023 Ga0209025_1000339
1024 Ga0209025_1000354
1025 Ga0209025_1000566
1026 Ga0209025_1014960
1027 Ga0209564_1000086
1028 Ga0209564_1000207
1029 Ga0209564_1000345
1030 Ga0209564_1001903
1031 Ga0209758_1000105
1032 Ga0209758_1000263
1033 Ga0209758_1000561
1034 Ga0209758_1001323
1035 Ga0209758_1001789
1036 Ga0209758_1019770
1037 Ga0209050_1003645
1038 Ga0209050_1007451
1039 Ga0209050_1007579
1040 Ga0209256_1000348
1041 Ga0209256_1000368
1042 Ga0209256_1002386
1043 Ga0209256_1002530
1044 Ga0209256_1003669
1045 Ga0209256_1005717
1046 Ga0209256_1006429
1047 Ga0209256_1008857
1048 Ga0207426_1000047
1049 Ga0207426_1000048
1050 Ga0207426_1000077
1051 Ga0207426_1000296
1052 Ga0207426_1007526
1053 Ga0209051_1000236
1054 Ga0209051_1000517
1055 Ga0209051_1002615
1056 Ga0209051_1003118
1057 Ga0209051_1005137
1058 Ga0209051_1012902
1059 Ga0209257_1004486
1060 Ga0207695_10000049
1061 Ga0207671_10000107
1062 Ga0207681_10019495
1063 Ga0209281_1000081
1064 Ga0209281_1000141
1065 Ga0209281_1000194
1066 Ga0209371_1000003
1067 Ga0209371_1004684
1068 Ga0209282_1000036
1069 Ga0209282_1000245
1070 Ga0268266_10011741
1071 Ga0307515_10000263
1072 Ga0307515_10003195
1073 Ga0307515_10015420
1074 Ga0307515_10028957
1075 Ga0268256_1000004
1076 Ga0268256_1000985
1077 Ga0268256_1025192
1078 Ga0307513_10003471
1079 Ga0307513_10018153
1080 Ga0307405_10005255
1081 Ga0307406_10002153
1082 Ga0307412_10011964
1083 Ga0315914_1000002
1084 Ga0315913_1000009
1085 Ga0315915_1000005
1086 Ga0373927_0000047
1087 Ga0395905_0001828
1088 Ga0395905_0006179
1089 Ga0395905_0081414
1090 Ga0439436_0030948
1091 Ga0439439_0003881
1092 Ga0439465_0004349
1093 Ga0439465_0012872
1094 Ga0451787_185132
1095 Ga0451847_0100075
1096 Ga0451853_1143250
1097 Ga0439449_0020754
1098 Ga0439462_0014648
1099 Ga0450906_001859
1100 Ga0450918_003132
1101 Ga0495638_0000591
1102 Ga0495638_0039664
1103 Ga0495638_0040338
1104 Ga0495651_0040692
1105 Ga0495605_0010248
1106 Ga0495662_0016992
1107 Ga0495585_0016731
1108 Ga0495585_0067310
1109 Ga0495606_0003939
1110 Ga0495610_0001811
1111 Ga0495610_0052076
1112 Ga0495620_0052878
1113 Ga0495631_0054108
1114 Ga0495632_0001545
1115 Ga0495632_0027939
1116 Ga0495643_0022456
1117 Ga0495648_0019173
1118 Ga0495648_0026636
1119 Ga0495654_0000648
1120 Ga0495633_0015371
1121 Ga0495668_0034373
1122 Ga0495625_0014252
1123 Ga0495588_0019017
1124 Ga0495657_0100259
1125 Ga0495660_0033520
1126 Ga0495604_0020104
1127 Ga0495681_0011244
1128 Ga0495686_0021750
1129 Ga0495686_0039242
1130 Ga0495686_0087900
1131 Ga0496104_0067040
1132 Ga0496106_0011811
1133 Ga0496110_0046534
1134 Ga0496116_0002495
1135 Ga0496116_0007497
1136 Ga0496116_0017558
1137 Ga0496117_0000030
1138 Ga0496117_0004557
1139 Ga0496117_0069610
1140 Ga0496118_0006549
1141 Ga0496118_0038444
1142 Ga0496119_0009213
1143 Ga0496119_0057253
1144 Ga0496119_0074266
1145 Ga0496120_0000148
1146 Ga0496120_0006073
1147 Ga0496121_0000003
1148 Ga0496121_0002286
1149 Ga0496121_0005619
1150 Ga0496121_0008946
1151 Ga0496121_0034108
1152 Ga0496121_0060185
1153 Ga0496122_0000024
1154 Ga0496122_0000050
1155 Ga0496122_0000107
1156 Ga0496122_0025362
1157 Ga0496122_0058187
1158 Ga0496123_0000023
1159 Ga0496123_0000063
1160 Ga0496123_0000086
1161 Ga0496124_0000239
1162 Ga0496124_0001850
1163 Ga0496124_0008295
1164 Ga0496124_0009023
1165 Ga0496124_0013288
1166 Ga0496124_0017246
1167 Ga0496124_0030974
1168 Ga0496124_0080129
1169 Ga0496125_0000833
1170 Ga0496125_0000963
1171 Ga0496126_0000434
1172 Ga0496126_0005874
1173 Ga0496126_0122326
1174 Ga0501033_0000361
1175 Ga0501034_0102887
1176 Ga0501034_0297747
1177 Ga0501037_0069588
1178 Ga0501043_0080448
1179 Ga0501083_0060840
1180 Ga0501035_0000348
1181 Ga0501044_0038826
1182 nmdc:mga00v17_2647_c1
1183 nmdc:mga00v17_337_c1
1184 nmdc:mga0yw44_119600_c1
1185 nmdc:mga0yw44_9940_c1
1186 nmdc:mga0k408_16647_c1
1187 nmdc:mga07m45_7731_c1
1188 nmdc:mga0sz30_74_c2
1189 Ga0500560_000303
1190 Ga0500569_004053
1191 Ga0500618_000109
1192 Ga0500618_000855
1193 Ga0500658_0003019
1194 Ga0500559_0004751
1195 Ga0500561_0000118
1196 Ga0500568_0005361
1197 Ga0500590_000118
1198 Ga0500616_0001217
1199 Ga0500616_0026796
1200 Ga0500622_0000101
1201 Ga0500634_0019203
1202 Ga0501082_0152288
1203 2509110215
1204 2509378949
1205 2509389789
1206 2509447957
1207 2510134895
1208 2510303741
1209 2510842342
1210 2510896306
1211 2511136515
1212 2511173674
1213 2511187330
1214 2511195936
1215 2511503038
1216 2512534302
1217 2512973877
1218 2513572658
1219 2513580110
1220 2513585989
1221 2513597229
1222 2513602406
1223 2513617207
1224 2513631266
1225 2513710839
1226 2513867002
1227 2513882948
1228 2513902977
1229 2513908131
1230 2513926999
1231 2513985722
1232 2513998135
1233 2514004049
1234 2514023196
1235 2515113978
1236 2515610278
1237 2515639187
1238 2515642975
1239 2515656721
1240 2515743664
1241 2516205302
1242 2516894442
1243 2517037610
1244 2517077897
1245 2517096693
1246 2517410408
1247 2517571061
1248 2524451925
1249 2524460026
1250 2530647005
1251 2535519377
1252 2537876145
1253 2551679853
1254 2551689723
1255 2551692524
1256 2551703965
1257 2551708893
1258 2551717121
1259 2551735184
1260 2551741138
1261 2554244535
1262 2558860455
1263 2559297623
1264 2561468038
1265 2585168082
1266 2585202417
1267 2585224727
1268 2585227884
1269 2585257903
1270 2585269711
1271 2585274326
1272 2585280261
1273 2585322538
1274 2585335152
1275 2585388627
1276 2585392475
1277 2585402275
1278 2585529025
1279 2585532490
1280 2585540966
1281 2585547283
1282 2585554493
1283 2585560775
1284 2585822425
1285 2585839728
1286 2585845438
1287 2585898977
1288 2585903430
1289 2585997212
1290 2586001814
1291 2587981451
1292 2599334706
1293 2599420507
1294 2599606208
1295 2599720065
1296 2600194142
1297 2600373597
1298 2601612418
1299 2601748959
1300 2616295613
1301 2616307439
1302 2616554983
1303 2617383438
1304 2643809716
1305 2643813292
1306 2643922214
1307 2644006508
1308 2644048359
1309 2644063896
1310 2644108425
1311 2644195956
1312 2644201721
1313 2644209826
1314 2644241926
1315 2644299293
1316 2644312452
1317 2644336080
1318 2644381418
1319 2644415729
1320 2644448769
1321 2644481161
1322 2644496417
1323 2644522723
1324 2644546937
1325 2644618135
1326 2644653377
1327 2644657521
1328 2644676689
1329 2644686837
1330 2657684460
1331 2671112231
1332 2692314450
1333 2719182647
1334 2719387318
1335 2719666963
1336 2719733365
1337 2720493383
1338 2720614854
1339 2720621627
1340 2720632955
1341 2720776679
1342 2721148760
1343 2721160144
1344 2721165573
1345 2721400953
1346 2722841743
1347 2723028267
1348 2723561895
1349 2723568527
1350 2724039766
1351 2724046121
1352 2724091286
1353 2724105792
1354 2725945414
1355 2730109203
1356 2730165882
1357 2730299776
1358 2738800370
1359 2738944551
1360 2739035523
1361 2753461034
1362 2766065270
1363 2776914617
1364 2778176050
1365 2792582508
1366 2792624328
1367 2792625670
1368 2792642774
1369 2793281585
1370 2793293583
1371 2793313025
1372 2793319672
1373 2793327822
1374 2793333432
1375 2793342035
1376 2793347420
1377 2793353752
1378 2793359648
1379 2793369398
1380 2802717849
1381 2802725300
1382 2802730576
1383 2802737923
1384 2802744207
1385 2802753108
1386 2804753363
1387 2805929457
1388 2805935362
1389 2806044509
1390 2806052710
1391 2806059010
1392 2806068327
1393 2806074447
1394 2808989132
1395 2819243860
1396 2819557671
1397 2819609562
1398 2819639660
1399 2819686483
1400 2821126208
1401 2838019159
1402 2838024250
1403 2838033171
1404 2838040821
1405 2838047410
1406 2838063899
1407 2838073384
1408 2838077486
1409 2838664788
1410 2838671083
1411 2838679945
1412 2838684904
1413 2838691267
1414 2838699259
1415 2838703738
1416 2838712740
1417 2838717742
1418 2838724516
1419 2838729542
1420 2838735750
1421 2838737317
1422 2838748652
1423 2841842314
1424 2841849980
1425 2841853913
1426 2841864255
1427 2841868119
1428 2842082217
1429 2842113382
1430 2842123142
1431 2842128452
1432 2842134627
1433 2842142093
1434 2842151247
1435 2842156541
1436 2842162569
1437 2842170003
1438 2842173987
1439 2842180162
1440 2842185006
1441 2842192161
1442 2842198209
1443 2842199792
1444 2842208359
1445 2842216559
1446 2842220024
1447 2842229197
1448 2842235621
1449 2842241958
1450 2842249345
1451 2842256303
1452 2842263518
1453 2842266659
1454 2842275742
1455 2842281632
1456 2842288746
1457 2842296218
1458 2842298750
1459 2842308274
1460 2842316445
1461 2842321333
1462 2842345061
1463 2842359382
1464 2842369177
1465 2842375580
1466 2842382618
1467 2842390019
1468 2842398457
1469 2842406587
1470 2842412986
1471 2842419629
1472 2842427019
1473 2842429978
1474 2842436362
1475 2842444065
1476 2842451082
1477 2842464399
1478 2842470691
1479 2842479904
1480 2842483349
1481 2842493330
1482 2842499099
1483 2842507080
1484 2842510778
1485 2842520998
1486 2842523240
1487 2842925829
1488 2844169310
1489 2844457441
1490 2847420497
1491 2848995369
1492 2850082354
1493 2852391265
1494 2854897330
1495 2854921533
1496 2855827078
1497 2855842475
1498 2855878376
1499 2857518850
1500 2857532769
1501 2858803291
1502 2891050113
1503 2891377476
1504 2896387668
1505 2899793138
1506 2899806313
1507 2899849658
1508 2913299880
1509 2913309171
1510 2915980610
1511 2915988861
1512 2915994896
1513 2916006968
1514 2916012205
1515 2916016870
1516 2916027733
1517 2916030254
1518 2916036811
1519 2916044668
1520 2916052622
1521 2916058380
1522 2916065571
1523 2916071478
1524 2916080118
1525 2919104620
1526 2919118023
1527 2919173507
1528 2919410718
1529 2920760706
1530 2920828434
1531 2921201468
1532 2921209625
1533 2921237551
1534 2921244266
1535 2921252550
1536 2921260694
1537 2921265953
1538 2921287719
1539 2921295724
1540 2921302825
1541 2923558730
1542 2924148771
1543 2924152186
1544 2924164122
1545 2924166621
1546 2924174410
1547 2924183980
1548 2924188477
1549 2924193822
1550 2924206651
1551 2924213083
1552 2924217159
1553 2924224029
1554 2924232034
1555 2926757790
1556 2926764584
1557 2929141419
1558 2933010405
1559 2933011590
1560 2933019921
1561 2933574723
1562 2933589328
1563 2933597273
1564 2933603486
1565 2935901229
1566 2935907502
1567 2936374818
1568 2936380510
1569 2936382323
1570 2937000110
1571 2937006941
1572 2937015411
1573 2937018130
1574 2937024334
1575 2937032947
1576 2937042271
1577 2937046681
1578 2937052297
1579 2937063106
1580 2937067541
1581 2937071355
1582 2937078677
1583 2937090052
1584 2937092938
1585 2937104760
1586 2937109921
1587 2937114528
1588 2937123744
1589 2937129278
1590 2941501640
1591 2957376885
1592 2957386039
1593 2957390123
1594 2957396813
1595 2957406220
1596 2957408973
1597 2957422014
1598 2957425568
1599 2957430577
1600 2957443175
1601 2957444391
1602 2957452734
1603 2957463115
1604 2957468241
1605 2957471913
1606 2957480974
1607 2957486573
1608 2957495227
1609 2957501923
1610 2957507010
1611 2960584747
1612 2960591325
1613 2960598732
1614 2960610170
1615 2960617295
1616 2960618713
1617 2960629570
1618 2960632577
1619 2960639594
1620 2960646702
1621 2960653072
1622 2960662910
1623 2960671452
1624 2960674530
1625 2960681407
1626 2960687888
1627 2960695160
1628 2964612399
1629 2964620358
1630 2964625963
1631 2964632509
1632 2964640484
1633 2964647197
1634 2964650906
1635 2964659018
1636 2964668813
1637 2964674561
1638 2964681747
1639 2964688686
1640 2964693244
1641 2964705148
1642 2964706238
1643 2964719071
1644 2964726748
1645 2967666666
1646 2967676624
1647 2967683035
1648 2967686556
1649 2967696115
1650 2967700480
1651 2967708428
1652 2967715825
1653 2967722014
1654 2967732439
1655 2967735431
1656 2967742341
1657 2967750138
1658 2967758999
1659 2967769068
1660 2967774543
1661 2967781320
1662 2970024979
1663 2970029358
1664 2970040661
1665 2970041770
1666 2970052743
1667 2970061048
1668 2970068139
1669 2970069437
1670 2970079072
1671 2970084245
1672 2970095493
1673 2970099076
1674 2970108821
1675 2970115248
1676 2970119550
1677 2970126417
1678 2970134290
1679 2970140665
1680 2970144590
1681 2970155655
1682 2970160311
1683 2970165900
1684 2970173338
1685 2970179831
1686 2970186614
1687 2970194501
1688 2977520775
1689 2977530093
1690 2977532429
1691 2977540960
1692 2977551132
1693 2977556840
1694 2977565589
1695 2977569102
1696 2977578019
1697 2977579703
1698 2979090306
1699 2979095835
1700 2979102711
1701 2984509401
1702 2984519900
1703 2984537733
1704 2984604478
1705 2989354596
1706 2989775201
1707 2989780398
1708 2995394072
1709 2996889257
1710 2996894681
1711 3003930560
1712 3005415434
1713 3005418445
1714 3005449327
1715 3005455625
1716 639650047
1717 643827133
1718 648735800
1719 650844065
1720 8003574420
1721 8003995016
1722 8004002778
1723 8005249514
1724 8005264165
1725 8005282065
1726 8005285119
1727 8005294214
1728 8005306627
1729 8005309439
1730 8005318663
1731 8005323784
1732 8005382735
1733 8005383792
1734 8005401118
1735 8005434072
1736 8005464666
1737 8005488453
1738 8005501715
1739 8005547064
1740 8005559114
1741 8005566827
1742 8005574895
1743 8005623069
1744 8005631623
1745 8005648922
1746 8005661718
1747 8005673137
1748 8005682161
1749 8005693677
1750 8005700917
1751 8018133566
1752 8018152093
1753 8018170270
1754 8018178415
1755 8023687496
1756 8024482002
1757 8024486971
1758 8024505886
1759 8046773179
1760 8049295980
1761 8054563038
1762 8056381638
1763 8056387075
1764 8056876218
1765 8057581084
1766 8057877042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00232

Glyco_hydro_1

Glycosyl hydrolase family 1

7

440

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rjk-assembly1.cif.gz_B structure of virulence factor sgha from agrobacterium tumefaciens 0.9161 3 451
6rk2-assembly1.cif.gz_B complex structure of virulence factor sgha mutant with its substrate sag 0.9158 1 451
6rjk-assembly1.cif.gz_B structure of virulence factor sgha from agrobacterium tumefaciens 0.9141 3 451
6rk2-assembly1.cif.gz_B complex structure of virulence factor sgha mutant with its substrate sag 0.9139 1 451
6ziv-assembly4.cif.gz_DDD crystal structure of a beta-glucosidase from alicyclobacillus acidiphilus 0.8937 11 446
ID Description Score Start End Superfamily
af_A0A0R0HB92_1_410_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9121 74 446 3.20.20.80
5ns7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8906 15 444 3.20.20.80
3ta9B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8864 11 448 3.20.20.80
5aybA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8843 11 444 3.20.20.80
5dt5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8837 11 445 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A6B3IHB8-F1-model_v4 Family 1 glycosylhydrolase 0.9482 101 295 GO:0005829
GO:0008422
GO:0016052
AF-B9TA98-F1-model_v4 Beta-glucosidase, putative (EC 3.2.1.21) 0.9473 74 439 GO:0008422
GO:0016020
GO:0022857
GO:0030245
AF-A0A7K2X3S7-F1-model_v4 Family 1 glycosylhydrolase 0.9467 159 445 GO:0005829
GO:0008422
GO:0016052
AF-A0A4Q3H7P1-F1-model_v4 beta-glucosidase (EC 3.2.1.21) 0.944 141 424 GO:0005829
GO:0008422
GO:0016052
AF-A0A2R7T1G7-F1-model_v4 beta-glucosidase (EC 3.2.1.21) 0.9406 103 444 GO:0005829
GO:0008422
GO:0016052

Map