F484566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 293 | 1764 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300049593|Ga0501077_0214390|Ga0501077_0214390_421_966 |
| Length | 181 |
| Sequence | VSADGADETSPIVVRRSGAQDVRFLRDMLHHAYYWKERAPEDTGPGPVALYVKAWGRPGDTAFVALDRGFPVGAAWYRLFDRERPGYGFVDERTPELAIAVVPNARGKGVGSALLDALLERARADGYPTLSLSVDRANAGAIELYERYGFQRISEDDDSVTMLAQLGTADSEAGKAGTDLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 201 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 202 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 205 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 206 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 207 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 208 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 209 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 210 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 293 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 6.24 |
| Rhizosphere | 92.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501077_0214390 | 3300049593 | Unclassified | 1224 |
| 2 | ARcpr5yngRDRAFT_c005018 | 3300000043 | Bacteria | 1232 |
| 3 | ARSoilOldRDRAFT_c001352 | 3300000044 | Bacteria | 2286 |
| 4 | ARCol0yngRDRAFT_1001892 | 3300000652 | Bacteria | 1638 |
| 5 | JGI24746J21847_1013217 | 3300001977 | Bacteria | 1202 |
| 6 | JGI24743J22301_10009270 | 3300001991 | Bacteria | 1740 |
| 7 | JGI24738J21930_10014706 | 3300002075 | Bacteria | 1676 |
| 8 | JGI24744J21845_10013288 | 3300002077 | Bacteria | 1660 |
| 9 | JGI24033J26618_1021497 | 3300002155 | Bacteria | 829 |
| 10 | JGI24751J29686_10037418 | 3300002459 | Unclassified | 1005 |
| 11 | JGI25406J46586_10027104 | 3300003203 | Bacteria | 2201 |
| 12 | Ga0070658_10158575 | 3300005327 | Bacteria | 1898 |
| 13 | Ga0070658_10844338 | 3300005327 | Unclassified | 796 |
| 14 | Ga0070676_10048048 | 3300005328 | Bacteria | 2495 |
| 15 | Ga0070683_100014338 | 3300005329 | Bacteria | 6931 |
| 16 | Ga0070683_100067023 | 3300005329 | Bacteria | 3343 |
| 17 | Ga0070683_100080820 | 3300005329 | Bacteria | 3042 |
| 18 | Ga0070683_100443926 | 3300005329 | Bacteria | 1238 |
| 19 | Ga0070683_100865914 | 3300005329 | Bacteria | 866 |
| 20 | Ga0070683_101866356 | 3300005329 | Bacteria | 578 |
| 21 | Ga0070670_100099625 | 3300005331 | Bacteria | 2501 |
| 22 | Ga0070670_100099819 | 3300005331 | Unclassified | 2498 |
| 23 | Ga0070670_100198543 | 3300005331 | Bacteria | 1743 |
| 24 | Ga0070670_100999263 | 3300005331 | Bacteria | 761 |
| 25 | Ga0068869_101057902 | 3300005334 | Unclassified | 708 |
| 26 | Ga0068869_101283365 | 3300005334 | Bacteria | 645 |
| 27 | Ga0070680_100080674 | 3300005336 | Bacteria | 2683 |
| 28 | Ga0070682_100002955 | 3300005337 | Bacteria | 9441 |
| 29 | Ga0070682_100029872 | 3300005337 | Bacteria | 3285 |
| 30 | Ga0070682_100299133 | 3300005337 | Bacteria | 1180 |
| 31 | Ga0068868_100292900 | 3300005338 | Bacteria | 1380 |
| 32 | Ga0068868_100592248 | 3300005338 | Bacteria | 981 |
| 33 | Ga0068868_100910454 | 3300005338 | Unclassified | 800 |
| 34 | Ga0068868_100917154 | 3300005338 | Unclassified | 797 |
| 35 | Ga0070660_100004508 | 3300005339 | Bacteria | 9626 |
| 36 | Ga0070660_100318707 | 3300005339 | Bacteria | 1277 |
| 37 | Ga0070660_100550137 | 3300005339 | Bacteria | 963 |
| 38 | Ga0070660_100595024 | 3300005339 | Bacteria | 924 |
| 39 | Ga0070689_100003268 | 3300005340 | Bacteria | 10756 |
| 40 | Ga0070689_100013139 | 3300005340 | Bacteria | 5984 |
| 41 | Ga0070691_10020769 | 3300005341 | Bacteria | 3035 |
| 42 | Ga0070691_10035413 | 3300005341 | Bacteria | 2350 |
| 43 | Ga0070691_10281697 | 3300005341 | Unclassified | 902 |
| 44 | Ga0070691_10496590 | 3300005341 | Unclassified | 705 |
| 45 | Ga0070687_100415551 | 3300005343 | Bacteria | 886 |
| 46 | Ga0070661_100164146 | 3300005344 | Bacteria | 1683 |
| 47 | Ga0070661_100378316 | 3300005344 | Bacteria | 1116 |
| 48 | Ga0070692_10027766 | 3300005345 | Bacteria | 2808 |
| 49 | Ga0070692_10042579 | 3300005345 | Bacteria | 2332 |
| 50 | Ga0070692_10212205 | 3300005345 | Bacteria | 1140 |
| 51 | Ga0070692_10288182 | 3300005345 | Bacteria | 998 |
| 52 | Ga0070692_10328705 | 3300005345 | Unclassified | 943 |
| 53 | Ga0070668_100147535 | 3300005347 | Bacteria | 1899 |
| 54 | Ga0070668_100215135 | 3300005347 | Bacteria | 1582 |
| 55 | Ga0070668_100295249 | 3300005347 | Bacteria | 1358 |
| 56 | Ga0070668_100377960 | 3300005347 | Bacteria | 1205 |
| 57 | Ga0070668_100809529 | 3300005347 | Bacteria | 833 |
| 58 | Ga0070669_100048593 | 3300005353 | Bacteria | 3097 |
| 59 | Ga0070669_100592296 | 3300005353 | Bacteria | 928 |
| 60 | Ga0070669_101238655 | 3300005353 | Unclassified | 645 |
| 61 | Ga0070675_100030703 | 3300005354 | Bacteria | 4339 |
| 62 | Ga0070675_100149606 | 3300005354 | Bacteria | 2001 |
| 63 | Ga0070675_100507263 | 3300005354 | Unclassified | 1087 |
| 64 | Ga0070671_100092764 | 3300005355 | Bacteria | 2530 |
| 65 | Ga0070671_100189130 | 3300005355 | Bacteria | 1745 |
| 66 | Ga0070674_100005773 | 3300005356 | Bacteria | 7181 |
| 67 | Ga0070674_100083164 | 3300005356 | Bacteria | 2291 |
| 68 | Ga0070674_100473040 | 3300005356 | Bacteria | 1038 |
| 69 | Ga0070674_100920729 | 3300005356 | Unclassified | 763 |
| 70 | Ga0070674_101244250 | 3300005356 | Unclassified | 662 |
| 71 | Ga0070674_101357953 | 3300005356 | Unclassified | 635 |
| 72 | Ga0070673_100085840 | 3300005364 | Bacteria | 2563 |
| 73 | Ga0070673_100396342 | 3300005364 | Bacteria | 1233 |
| 74 | Ga0070688_100013927 | 3300005365 | Bacteria | 4548 |
| 75 | Ga0070688_100280190 | 3300005365 | Unclassified | 1197 |
| 76 | Ga0070659_100028257 | 3300005366 | Bacteria | 4329 |
| 77 | Ga0070659_100158733 | 3300005366 | Bacteria | 1848 |
| 78 | Ga0070659_100162825 | 3300005366 | Bacteria | 1825 |
| 79 | Ga0070667_100303834 | 3300005367 | Unclassified | 1437 |
| 80 | Ga0070667_100337285 | 3300005367 | Bacteria | 1363 |
| 81 | Ga0070667_100346255 | 3300005367 | Bacteria | 1345 |
| 82 | Ga0070713_100111414 | 3300005436 | Bacteria | 2387 |
| 83 | Ga0070701_10005472 | 3300005438 | Bacteria | 5252 |
| 84 | Ga0070705_100052770 | 3300005440 | Unclassified | 2377 |
| 85 | Ga0070705_100131077 | 3300005440 | Bacteria | 1635 |
| 86 | Ga0070700_100036523 | 3300005441 | Bacteria | 2981 |
| 87 | Ga0070700_100198843 | 3300005441 | Bacteria | 1407 |
| 88 | Ga0070700_100302442 | 3300005441 | Unclassified | 1168 |
| 89 | Ga0070700_100334931 | 3300005441 | Bacteria | 1116 |
| 90 | Ga0070694_100960393 | 3300005444 | Unclassified | 708 |
| 91 | Ga0070694_101222792 | 3300005444 | Bacteria | 630 |
| 92 | Ga0070708_100232621 | 3300005445 | Bacteria | 1729 |
| 93 | Ga0070708_101410230 | 3300005445 | Bacteria | 650 |
| 94 | Ga0070663_100307192 | 3300005455 | Bacteria | 1271 |
| 95 | Ga0070663_100585575 | 3300005455 | Bacteria | 936 |
| 96 | Ga0070678_100029915 | 3300005456 | Bacteria | 3736 |
| 97 | Ga0070678_100322347 | 3300005456 | Unclassified | 1320 |
| 98 | Ga0070678_100343647 | 3300005456 | Bacteria | 1281 |
| 99 | Ga0070678_100681471 | 3300005456 | Bacteria | 925 |
| 100 | Ga0070678_100777680 | 3300005456 | Unclassified | 868 |
| 101 | Ga0070678_101188099 | 3300005456 | Bacteria | 707 |
| 102 | Ga0070678_101233867 | 3300005456 | Bacteria | 694 |
| 103 | Ga0070662_100043493 | 3300005457 | Bacteria | 3214 |
| 104 | Ga0070662_100206113 | 3300005457 | Bacteria | 1562 |
| 105 | Ga0070662_100568096 | 3300005457 | Bacteria | 952 |
| 106 | Ga0070681_10087248 | 3300005458 | Bacteria | 3073 |
| 107 | Ga0070681_10146142 | 3300005458 | Bacteria | 2293 |
| 108 | Ga0070681_10234818 | 3300005458 | Bacteria | 1748 |
| 109 | Ga0068867_100157036 | 3300005459 | Bacteria | 1791 |
| 110 | Ga0068867_100170140 | 3300005459 | Bacteria | 1725 |
| 111 | Ga0068867_100213039 | 3300005459 | Bacteria | 1553 |
| 112 | Ga0068867_100264384 | 3300005459 | Bacteria | 1404 |
| 113 | Ga0068867_100356169 | 3300005459 | Unclassified | 1223 |
| 114 | Ga0070685_10001814 | 3300005466 | Bacteria | 11125 |
| 115 | Ga0070685_10101780 | 3300005466 | Bacteria | 1755 |
| 116 | Ga0070685_10136313 | 3300005466 | Unclassified | 1540 |
| 117 | Ga0070685_10729933 | 3300005466 | Bacteria | 725 |
| 118 | Ga0070706_100467197 | 3300005467 | Bacteria | 1174 |
| 119 | Ga0070679_100016201 | 3300005530 | Bacteria | 7180 |
| 120 | Ga0070679_100157362 | 3300005530 | Bacteria | 2247 |
| 121 | Ga0070684_100012482 | 3300005535 | Bacteria | 6811 |
| 122 | Ga0070684_100044320 | 3300005535 | Bacteria | 3847 |
| 123 | Ga0070684_100052498 | 3300005535 | Bacteria | 3546 |
| 124 | Ga0070684_100265539 | 3300005535 | Unclassified | 1570 |
| 125 | Ga0070684_100277563 | 3300005535 | Bacteria | 1535 |
| 126 | Ga0070684_100335978 | 3300005535 | Bacteria | 1388 |
| 127 | Ga0068853_100012062 | 3300005539 | Bacteria | 7032 |
| 128 | Ga0068853_100206077 | 3300005539 | Bacteria | 1791 |
| 129 | Ga0068853_100910416 | 3300005539 | Unclassified | 845 |
| 130 | Ga0070672_100127249 | 3300005543 | Bacteria | 2090 |
| 131 | Ga0070672_100142824 | 3300005543 | Unclassified | 1976 |
| 132 | Ga0070672_100157034 | 3300005543 | Bacteria | 1885 |
| 133 | Ga0070672_101039204 | 3300005543 | Bacteria | 727 |
| 134 | Ga0070686_100096141 | 3300005544 | Bacteria | 1991 |
| 135 | Ga0070686_100256627 | 3300005544 | Bacteria | 1279 |
| 136 | Ga0070695_100347747 | 3300005545 | Bacteria | 1110 |
| 137 | Ga0070695_100373740 | 3300005545 | Bacteria | 1074 |
| 138 | Ga0070696_100089054 | 3300005546 | Bacteria | 2194 |
| 139 | Ga0070696_100398958 | 3300005546 | Bacteria | 1076 |
| 140 | Ga0070693_100122649 | 3300005547 | Bacteria | 1614 |
| 141 | Ga0070665_100009113 | 3300005548 | Bacteria | 10052 |
| 142 | Ga0070665_100043729 | 3300005548 | Bacteria | 4500 |
| 143 | Ga0070665_100367312 | 3300005548 | Bacteria | 1445 |
| 144 | Ga0070704_100159448 | 3300005549 | Unclassified | 1783 |
| 145 | Ga0070704_100201049 | 3300005549 | Bacteria | 1608 |
| 146 | Ga0070704_100323659 | 3300005549 | Bacteria | 1293 |
| 147 | Ga0070704_100584666 | 3300005549 | Bacteria | 980 |
| 148 | Ga0068855_100510298 | 3300005563 | Bacteria | 1306 |
| 149 | Ga0070664_100038772 | 3300005564 | Bacteria | 4012 |
| 150 | Ga0070664_100039753 | 3300005564 | Bacteria | 3964 |
| 151 | Ga0070664_100084164 | 3300005564 | Bacteria | 2745 |
| 152 | Ga0070664_100136314 | 3300005564 | Bacteria | 2159 |
| 153 | Ga0070664_100161106 | 3300005564 | Bacteria | 1985 |
| 154 | Ga0068857_100073251 | 3300005577 | Bacteria | 3052 |
| 155 | Ga0068857_100105311 | 3300005577 | Bacteria | 2533 |
| 156 | Ga0068857_100142944 | 3300005577 | Bacteria | 2164 |
| 157 | Ga0068857_100849296 | 3300005577 | Bacteria | 874 |
| 158 | Ga0068854_100000733 | 3300005578 | Bacteria | 19454 |
| 159 | Ga0068854_100561477 | 3300005578 | Bacteria | 970 |
| 160 | Ga0068854_100807885 | 3300005578 | Bacteria | 818 |
| 161 | Ga0068856_100027626 | 3300005614 | Bacteria | 5536 |
| 162 | Ga0068856_100314761 | 3300005614 | Bacteria | 1583 |
| 163 | Ga0070702_100016951 | 3300005615 | Bacteria | 3749 |
| 164 | Ga0070702_100018802 | 3300005615 | Bacteria | 3591 |
| 165 | Ga0070702_100092106 | 3300005615 | Bacteria | 1840 |
| 166 | Ga0070702_100361310 | 3300005615 | Bacteria | 1026 |
| 167 | Ga0070702_100428950 | 3300005615 | Bacteria | 953 |
| 168 | Ga0068852_100015804 | 3300005616 | Bacteria | 5868 |
| 169 | Ga0068852_100336571 | 3300005616 | Bacteria | 1470 |
| 170 | Ga0068852_100373748 | 3300005616 | Bacteria | 1397 |
| 171 | Ga0068852_100396359 | 3300005616 | Bacteria | 1357 |
| 172 | Ga0068859_100019963 | 3300005617 | Bacteria | 6727 |
| 173 | Ga0068864_100068183 | 3300005618 | Bacteria | 3090 |
| 174 | Ga0068864_100086793 | 3300005618 | Bacteria | 2753 |
| 175 | Ga0068864_100884089 | 3300005618 | Bacteria | 882 |
| 176 | Ga0068864_102007088 | 3300005618 | Unclassified | 585 |
| 177 | Ga0068866_10145709 | 3300005718 | Unclassified | 1365 |
| 178 | Ga0068866_10180826 | 3300005718 | Bacteria | 1245 |
| 179 | Ga0068866_10206856 | 3300005718 | Unclassified | 1176 |
| 180 | Ga0068861_100022669 | 3300005719 | Bacteria | 4527 |
| 181 | Ga0068861_100109160 | 3300005719 | Bacteria | 2214 |
| 182 | Ga0068861_100571811 | 3300005719 | Unclassified | 1033 |
| 183 | Ga0068851_10059139 | 3300005834 | Bacteria | 1960 |
| 184 | Ga0068851_10131435 | 3300005834 | Bacteria | 1354 |
| 185 | Ga0068870_10010973 | 3300005840 | Bacteria | 4185 |
| 186 | Ga0068870_10171041 | 3300005840 | Bacteria | 1297 |
| 187 | Ga0068870_10207457 | 3300005840 | Bacteria | 1191 |
| 188 | Ga0068870_10220932 | 3300005840 | Unclassified | 1160 |
| 189 | Ga0068863_100822475 | 3300005841 | Unclassified | 927 |
| 190 | Ga0068863_100885265 | 3300005841 | Bacteria | 893 |
| 191 | Ga0068858_100055946 | 3300005842 | Bacteria | 3646 |
| 192 | Ga0068860_100055188 | 3300005843 | Bacteria | 3776 |
| 193 | Ga0068860_100060241 | 3300005843 | Bacteria | 3608 |
| 194 | Ga0068862_100281668 | 3300005844 | Bacteria | 1524 |
| 195 | Ga0068862_100362983 | 3300005844 | Bacteria | 1346 |
| 196 | Ga0068862_100743037 | 3300005844 | Unclassified | 954 |
| 197 | Ga0081455_10059370 | 3300005937 | Bacteria | 3230 |
| 198 | Ga0081455_10110317 | 3300005937 | Bacteria | 2187 |
| 199 | Ga0081455_10147820 | 3300005937 | Bacteria | 1815 |
| 200 | Ga0081455_10239880 | 3300005937 | Archaea | 1333 |
| 201 | Ga0081455_10285172 | 3300005937 | Bacteria | 1191 |
| 202 | Ga0081538_10096014 | 3300005981 | Bacteria | 1512 |
| 203 | Ga0081539_10001668 | 3300005985 | Bacteria | 35937 |
| 204 | Ga0081539_10163107 | 3300005985 | Unclassified | 1060 |
| 205 | Ga0070717_10135591 | 3300006028 | Bacteria | 2120 |
| 206 | Ga0075365_10305614 | 3300006038 | Bacteria | 1120 |
| 207 | Ga0075364_10338952 | 3300006051 | Bacteria | 1024 |
| 208 | Ga0075432_10003705 | 3300006058 | Bacteria | 5204 |
| 209 | Ga0075432_10006589 | 3300006058 | Bacteria | 3954 |
| 210 | Ga0075432_10199018 | 3300006058 | Bacteria | 792 |
| 211 | Ga0075367_10035025 | 3300006178 | Bacteria | 2903 |
| 212 | Ga0097621_100027230 | 3300006237 | Bacteria | 4493 |
| 213 | Ga0097621_101115426 | 3300006237 | Bacteria | 741 |
| 214 | Ga0075370_10115385 | 3300006353 | Bacteria | 1561 |
| 215 | Ga0068871_100072115 | 3300006358 | Bacteria | 2843 |
| 216 | Ga0068871_100072172 | 3300006358 | Bacteria | 2842 |
| 217 | Ga0068871_100198568 | 3300006358 | Bacteria | 1731 |
| 218 | Ga0068871_101106631 | 3300006358 | Unclassified | 741 |
| 219 | Ga0075428_100005456 | 3300006844 | Bacteria | 14141 |
| 220 | Ga0075428_100025085 | 3300006844 | Bacteria | 6596 |
| 221 | Ga0075428_100075303 | 3300006844 | Unclassified | 3686 |
| 222 | Ga0075430_100008652 | 3300006846 | Bacteria | 8586 |
| 223 | Ga0075430_100304582 | 3300006846 | Bacteria | 1318 |
| 224 | Ga0075431_100007107 | 3300006847 | Bacteria | 11121 |
| 225 | Ga0075433_10009902 | 3300006852 | Bacteria | 7644 |
| 226 | Ga0075433_10151165 | 3300006852 | Bacteria | 2065 |
| 227 | Ga0075433_10354261 | 3300006852 | Bacteria | 1297 |
| 228 | Ga0075433_10455106 | 3300006852 | Bacteria | 1128 |
| 229 | Ga0075433_10502656 | 3300006852 | Bacteria | 1067 |
| 230 | Ga0075434_100009715 | 3300006871 | Bacteria | 8989 |
| 231 | Ga0075434_100460253 | 3300006871 | Bacteria | 1293 |
| 232 | Ga0075434_100690988 | 3300006871 | Bacteria | 1038 |
| 233 | Ga0075434_101435783 | 3300006871 | Bacteria | 700 |
| 234 | Ga0075429_100048042 | 3300006880 | Bacteria | 3712 |
| 235 | Ga0075429_100114773 | 3300006880 | Bacteria | 2355 |
| 236 | Ga0068865_100027255 | 3300006881 | Bacteria | 3772 |
| 237 | Ga0068865_100107288 | 3300006881 | Bacteria | 2054 |
| 238 | Ga0068865_100331915 | 3300006881 | Unclassified | 1226 |
| 239 | Ga0075436_100112305 | 3300006914 | Bacteria | 1903 |
| 240 | Ga0075436_100197299 | 3300006914 | Bacteria | 1425 |
| 241 | Ga0097620_100019965 | 3300006931 | Bacteria | 6727 |
| 242 | Ga0075435_100228304 | 3300007076 | Bacteria | 1581 |
| 243 | Ga0105240_10582900 | 3300009093 | Bacteria | 1234 |
| 244 | Ga0111539_10004926 | 3300009094 | Bacteria | 17376 |
| 245 | Ga0111539_10032849 | 3300009094 | Bacteria | 6302 |
| 246 | Ga0111539_10075810 | 3300009094 | Bacteria | 3961 |
| 247 | Ga0111539_10185772 | 3300009094 | Bacteria | 2427 |
| 248 | Ga0111539_11243392 | 3300009094 | Bacteria | 864 |
| 249 | Ga0111539_13498994 | 3300009094 | Unclassified | 504 |
| 250 | Ga0105245_10018022 | 3300009098 | Bacteria | 6167 |
| 251 | Ga0105245_10025179 | 3300009098 | Bacteria | 5232 |
| 252 | Ga0105245_10300692 | 3300009098 | Bacteria | 1574 |
| 253 | Ga0105245_10312498 | 3300009098 | Bacteria | 1546 |
| 254 | Ga0105247_10022525 | 3300009101 | Bacteria | 3794 |
| 255 | Ga0114129_10033398 | 3300009147 | Bacteria | 7271 |
| 256 | Ga0114129_10034656 | 3300009147 | Bacteria | 7130 |
| 257 | Ga0114129_10050237 | 3300009147 | Bacteria | 5858 |
| 258 | Ga0114129_10783633 | 3300009147 | Bacteria | 1218 |
| 259 | Ga0114129_10931103 | 3300009147 | Bacteria | 1099 |
| 260 | Ga0114129_11024972 | 3300009147 | Bacteria | 1038 |
| 261 | Ga0114129_11045822 | 3300009147 | Unclassified | 1025 |
| 262 | Ga0114129_11397754 | 3300009147 | Bacteria | 864 |
| 263 | Ga0105243_10003687 | 3300009148 | Bacteria | 12317 |
| 264 | Ga0105243_10046271 | 3300009148 | Bacteria | 3422 |
| 265 | Ga0105243_10051072 | 3300009148 | Bacteria | 3269 |
| 266 | Ga0105243_10129934 | 3300009148 | Unclassified | 2135 |
| 267 | Ga0105243_10188044 | 3300009148 | Bacteria | 1801 |
| 268 | Ga0105243_11024068 | 3300009148 | Bacteria | 830 |
| 269 | Ga0105243_11040867 | 3300009148 | Bacteria | 823 |
| 270 | Ga0105243_12540004 | 3300009148 | Unclassified | 552 |
| 271 | Ga0105241_10443426 | 3300009174 | Bacteria | 1147 |
| 272 | Ga0105241_10449603 | 3300009174 | Bacteria | 1139 |
| 273 | Ga0105242_10055142 | 3300009176 | Bacteria | 3252 |
| 274 | Ga0105242_10061082 | 3300009176 | Unclassified | 3099 |
| 275 | Ga0105242_10086218 | 3300009176 | Bacteria | 2635 |
| 276 | Ga0105242_10099562 | 3300009176 | Bacteria | 2461 |
| 277 | Ga0105248_10079530 | 3300009177 | Bacteria | 3685 |
| 278 | Ga0105248_10152339 | 3300009177 | Unclassified | 2609 |
| 279 | Ga0105248_10161761 | 3300009177 | Bacteria | 2525 |
| 280 | Ga0105248_10763938 | 3300009177 | Bacteria | 1091 |
| 281 | Ga0105238_10054647 | 3300009551 | Bacteria | 4009 |
| 282 | Ga0105238_10458426 | 3300009551 | Bacteria | 1272 |
| 283 | Ga0105238_10528912 | 3300009551 | Unclassified | 1182 |
| 284 | Ga0105249_10173156 | 3300009553 | Unclassified | 2094 |
| 285 | Ga0105249_10548222 | 3300009553 | Bacteria | 1207 |
| 286 | Ga0105239_10042798 | 3300010375 | Bacteria | 4962 |
| 287 | Ga0105239_10057264 | 3300010375 | Bacteria | 4275 |
| 288 | Ga0105239_10064888 | 3300010375 | Bacteria | 4009 |
| 289 | Ga0105239_10150408 | 3300010375 | Bacteria | 2598 |
| 290 | Ga0105239_10769590 | 3300010375 | Bacteria | 1102 |
| 291 | Ga0105246_10009345 | 3300011119 | Bacteria | 6041 |
| 292 | Ga0105246_10018955 | 3300011119 | Bacteria | 4389 |
| 293 | Ga0105246_10042363 | 3300011119 | Unclassified | 3083 |
| 294 | Ga0105246_10130894 | 3300011119 | Bacteria | 1874 |
| 295 | Ga0105246_10234386 | 3300011119 | Bacteria | 1447 |
| 296 | Ga0157320_1003077 | 3300012481 | Bacteria | 990 |
| 297 | Ga0157343_1012390 | 3300012488 | Unclassified | 674 |
| 298 | Ga0157373_10564470 | 3300013100 | Bacteria | 826 |
| 299 | Ga0157371_10018835 | 3300013102 | Bacteria | 5099 |
| 300 | Ga0157371_10139580 | 3300013102 | Bacteria | 1726 |
| 301 | Ga0157369_10076861 | 3300013105 | Bacteria | 3579 |
| 302 | Ga0157369_10095079 | 3300013105 | Bacteria | 3180 |
| 303 | Ga0157374_10167627 | 3300013296 | Bacteria | 2141 |
| 304 | Ga0157374_10354160 | 3300013296 | Unclassified | 1459 |
| 305 | Ga0157374_10571524 | 3300013296 | Bacteria | 1139 |
| 306 | Ga0157374_11066579 | 3300013296 | Bacteria | 828 |
| 307 | Ga0157378_10699787 | 3300013297 | Bacteria | 1033 |
| 308 | Ga0157378_10855962 | 3300013297 | Unclassified | 938 |
| 309 | Ga0163162_10137707 | 3300013306 | Bacteria | 2553 |
| 310 | Ga0163162_10327464 | 3300013306 | Bacteria | 1664 |
| 311 | Ga0157372_10180470 | 3300013307 | Bacteria | 2444 |
| 312 | Ga0157372_10238730 | 3300013307 | Unclassified | 2109 |
| 313 | Ga0157372_10460794 | 3300013307 | Bacteria | 1482 |
| 314 | Ga0157372_10824332 | 3300013307 | Bacteria | 1077 |
| 315 | Ga0157375_10015281 | 3300013308 | Bacteria | 6870 |
| 316 | Ga0157375_10156139 | 3300013308 | Unclassified | 2421 |
| 317 | Ga0157375_10212095 | 3300013308 | Bacteria | 2094 |
| 318 | Ga0157375_10304954 | 3300013308 | Bacteria | 1756 |
| 319 | Ga0157375_11475020 | 3300013308 | Unclassified | 802 |
| 320 | Ga0163163_10131791 | 3300014325 | Unclassified | 2540 |
| 321 | Ga0163163_10202453 | 3300014325 | Unclassified | 2034 |
| 322 | Ga0163163_10321156 | 3300014325 | Bacteria | 1602 |
| 323 | Ga0163163_10455165 | 3300014325 | Bacteria | 1340 |
| 324 | Ga0163163_10510744 | 3300014325 | Bacteria | 1264 |
| 325 | Ga0157380_10045029 | 3300014326 | Bacteria | 3460 |
| 326 | Ga0157380_10228053 | 3300014326 | Bacteria | 1671 |
| 327 | Ga0157380_10708197 | 3300014326 | Bacteria | 1013 |
| 328 | Ga0157380_11766161 | 3300014326 | Unclassified | 677 |
| 329 | Ga0157377_10032230 | 3300014745 | Bacteria | 2852 |
| 330 | Ga0157377_10076686 | 3300014745 | Bacteria | 1944 |
| 331 | Ga0157377_10095813 | 3300014745 | Bacteria | 1760 |
| 332 | Ga0157377_10118232 | 3300014745 | Bacteria | 1603 |
| 333 | Ga0157377_10691686 | 3300014745 | Bacteria | 739 |
| 334 | Ga0157379_10050323 | 3300014968 | Bacteria | 3719 |
| 335 | Ga0157376_10169324 | 3300014969 | Bacteria | 1987 |
| 336 | Ga0157376_10399425 | 3300014969 | Unclassified | 1329 |
| 337 | Ga0157376_10538827 | 3300014969 | Unclassified | 1153 |
| 338 | Ga0157376_10867031 | 3300014969 | Unclassified | 919 |
| 339 | Ga0163161_10197907 | 3300017792 | Bacteria | 1547 |
| 340 | Ga0163161_10296950 | 3300017792 | Unclassified | 1271 |
| 341 | Ga0163161_10935049 | 3300017792 | Unclassified | 736 |
| 342 | Ga0206356_11798710 | 3300020070 | Bacteria | 1033 |
| 343 | Ga0207656_10021960 | 3300025321 | Bacteria | 2556 |
| 344 | Ga0207656_10094864 | 3300025321 | Bacteria | 1360 |
| 345 | Ga0207642_10277838 | 3300025899 | Bacteria | 962 |
| 346 | Ga0207642_10475433 | 3300025899 | Bacteria | 761 |
| 347 | Ga0207642_10581250 | 3300025899 | Unclassified | 695 |
| 348 | Ga0207642_10742156 | 3300025899 | Bacteria | 621 |
| 349 | Ga0207688_10002457 | 3300025901 | Bacteria | 9965 |
| 350 | Ga0207688_10010697 | 3300025901 | Bacteria | 4992 |
| 351 | Ga0207688_10015530 | 3300025901 | Bacteria | 4130 |
| 352 | Ga0207688_10023099 | 3300025901 | Bacteria | 3403 |
| 353 | Ga0207688_10053859 | 3300025901 | Bacteria | 2256 |
| 354 | Ga0207680_10151839 | 3300025903 | Bacteria | 1545 |
| 355 | Ga0207645_10022205 | 3300025907 | Bacteria | 4131 |
| 356 | Ga0207645_10041880 | 3300025907 | Bacteria | 2930 |
| 357 | Ga0207643_10004905 | 3300025908 | Bacteria | 7162 |
| 358 | Ga0207643_10022336 | 3300025908 | Bacteria | 3482 |
| 359 | Ga0207643_10042105 | 3300025908 | Bacteria | 2574 |
| 360 | Ga0207643_10063949 | 3300025908 | Bacteria | 2105 |
| 361 | Ga0207643_10074109 | 3300025908 | Bacteria | 1963 |
| 362 | Ga0207705_10074417 | 3300025909 | Bacteria | 2465 |
| 363 | Ga0207684_10368013 | 3300025910 | Bacteria | 1237 |
| 364 | Ga0207707_10798666 | 3300025912 | Unclassified | 786 |
| 365 | Ga0207695_10786648 | 3300025913 | Bacteria | 831 |
| 366 | Ga0207693_10110009 | 3300025915 | Bacteria | 2161 |
| 367 | Ga0207660_10054917 | 3300025917 | Bacteria | 2844 |
| 368 | Ga0207660_10135890 | 3300025917 | Bacteria | 1876 |
| 369 | Ga0207660_10209699 | 3300025917 | Bacteria | 1525 |
| 370 | Ga0207660_10282238 | 3300025917 | Bacteria | 1318 |
| 371 | Ga0207662_10050876 | 3300025918 | Bacteria | 2463 |
| 372 | Ga0207657_10003231 | 3300025919 | Bacteria | 17441 |
| 373 | Ga0207657_10167102 | 3300025919 | Bacteria | 1784 |
| 374 | Ga0207657_10313599 | 3300025919 | Bacteria | 1241 |
| 375 | Ga0207657_10394964 | 3300025919 | Bacteria | 1088 |
| 376 | Ga0207649_10011072 | 3300025920 | Bacteria | 4964 |
| 377 | Ga0207649_10096500 | 3300025920 | Bacteria | 1948 |
| 378 | Ga0207649_10141207 | 3300025920 | Bacteria | 1648 |
| 379 | Ga0207649_10696631 | 3300025920 | Bacteria | 788 |
| 380 | Ga0207652_10020767 | 3300025921 | Bacteria | 5412 |
| 381 | Ga0207652_10107753 | 3300025921 | Bacteria | 2468 |
| 382 | Ga0207652_10209922 | 3300025921 | Bacteria | 1753 |
| 383 | Ga0207652_10726164 | 3300025921 | Bacteria | 885 |
| 384 | Ga0207681_10490839 | 3300025923 | Bacteria | 1004 |
| 385 | Ga0207681_11287510 | 3300025923 | Unclassified | 614 |
| 386 | Ga0207694_10167893 | 3300025924 | Bacteria | 1775 |
| 387 | Ga0207694_10279326 | 3300025924 | Bacteria | 1371 |
| 388 | Ga0207650_10053248 | 3300025925 | Bacteria | 2999 |
| 389 | Ga0207650_10066591 | 3300025925 | Bacteria | 2701 |
| 390 | Ga0207650_10079173 | 3300025925 | Bacteria | 2488 |
| 391 | Ga0207659_10242273 | 3300025926 | Bacteria | 1459 |
| 392 | Ga0207659_10432551 | 3300025926 | Bacteria | 1105 |
| 393 | Ga0207659_11646914 | 3300025926 | Unclassified | 547 |
| 394 | Ga0207687_10083931 | 3300025927 | Bacteria | 2308 |
| 395 | Ga0207687_10242184 | 3300025927 | Bacteria | 1430 |
| 396 | Ga0207700_10160554 | 3300025928 | Bacteria | 1866 |
| 397 | Ga0207664_10643095 | 3300025929 | Bacteria | 953 |
| 398 | Ga0207644_10153066 | 3300025931 | Bacteria | 1786 |
| 399 | Ga0207644_10593401 | 3300025931 | Bacteria | 919 |
| 400 | Ga0207690_10016727 | 3300025932 | Bacteria | 4468 |
| 401 | Ga0207690_10104565 | 3300025932 | Bacteria | 2029 |
| 402 | Ga0207690_10588138 | 3300025932 | Bacteria | 908 |
| 403 | Ga0207706_10076066 | 3300025933 | Bacteria | 2953 |
| 404 | Ga0207706_10146675 | 3300025933 | Bacteria | 2076 |
| 405 | Ga0207706_10486327 | 3300025933 | Bacteria | 1066 |
| 406 | Ga0207686_10043549 | 3300025934 | Unclassified | 2751 |
| 407 | Ga0207686_10305124 | 3300025934 | Bacteria | 1184 |
| 408 | Ga0207686_10305698 | 3300025934 | Bacteria | 1183 |
| 409 | Ga0207686_10549491 | 3300025934 | Bacteria | 903 |
| 410 | Ga0207709_10032106 | 3300025935 | Bacteria | 3073 |
| 411 | Ga0207709_10167732 | 3300025935 | Unclassified | 1538 |
| 412 | Ga0207709_10416500 | 3300025935 | Bacteria | 1031 |
| 413 | Ga0207709_11047307 | 3300025935 | Bacteria | 668 |
| 414 | Ga0207670_10127731 | 3300025936 | Bacteria | 1857 |
| 415 | Ga0207669_10004221 | 3300025937 | Bacteria | 6302 |
| 416 | Ga0207669_10008206 | 3300025937 | Bacteria | 4892 |
| 417 | Ga0207669_10097072 | 3300025937 | Bacteria | 1936 |
| 418 | Ga0207669_10103751 | 3300025937 | Unclassified | 1887 |
| 419 | Ga0207669_10718933 | 3300025937 | Bacteria | 822 |
| 420 | Ga0207704_10002934 | 3300025938 | Bacteria | 7699 |
| 421 | Ga0207704_10080985 | 3300025938 | Bacteria | 2098 |
| 422 | Ga0207704_10087048 | 3300025938 | Bacteria | 2039 |
| 423 | Ga0207704_10418379 | 3300025938 | Bacteria | 1062 |
| 424 | Ga0207704_10635995 | 3300025938 | Unclassified | 877 |
| 425 | Ga0207704_11202475 | 3300025938 | Unclassified | 646 |
| 426 | Ga0207691_10014129 | 3300025940 | Bacteria | 7617 |
| 427 | Ga0207691_10082563 | 3300025940 | Bacteria | 2886 |
| 428 | Ga0207691_10083272 | 3300025940 | Bacteria | 2872 |
| 429 | Ga0207691_11058283 | 3300025940 | Bacteria | 676 |
| 430 | Ga0207711_10141137 | 3300025941 | Bacteria | 2168 |
| 431 | Ga0207711_10465986 | 3300025941 | Bacteria | 1177 |
| 432 | Ga0207711_10613444 | 3300025941 | Bacteria | 1015 |
| 433 | Ga0207711_10614988 | 3300025941 | Unclassified | 1014 |
| 434 | Ga0207661_10002999 | 3300025944 | Bacteria | 11675 |
| 435 | Ga0207661_10022183 | 3300025944 | Bacteria | 4775 |
| 436 | Ga0207661_10040515 | 3300025944 | Bacteria | 3662 |
| 437 | Ga0207661_10065551 | 3300025944 | Bacteria | 2949 |
| 438 | Ga0207661_10100891 | 3300025944 | Bacteria | 2423 |
| 439 | Ga0207661_10231259 | 3300025944 | Bacteria | 1637 |
| 440 | Ga0207679_10288768 | 3300025945 | Bacteria | 1409 |
| 441 | Ga0207679_10333562 | 3300025945 | Bacteria | 1317 |
| 442 | Ga0207679_10846511 | 3300025945 | Unclassified | 835 |
| 443 | Ga0207667_10067979 | 3300025949 | Bacteria | 3711 |
| 444 | Ga0207667_10620819 | 3300025949 | Bacteria | 1089 |
| 445 | Ga0207651_10064789 | 3300025960 | Bacteria | 2559 |
| 446 | Ga0207651_11969605 | 3300025960 | Unclassified | 525 |
| 447 | Ga0207712_10060574 | 3300025961 | Bacteria | 2684 |
| 448 | Ga0207712_10385069 | 3300025961 | Unclassified | 1175 |
| 449 | Ga0207668_10147531 | 3300025972 | Unclassified | 1817 |
| 450 | Ga0207668_10874101 | 3300025972 | Unclassified | 799 |
| 451 | Ga0207668_11396214 | 3300025972 | Unclassified | 631 |
| 452 | Ga0207640_10090902 | 3300025981 | Bacteria | 2113 |
| 453 | Ga0207640_10161678 | 3300025981 | Bacteria | 1658 |
| 454 | Ga0207658_10485972 | 3300025986 | Unclassified | 1098 |
| 455 | Ga0207677_10009728 | 3300026023 | Bacteria | 5415 |
| 456 | Ga0207703_10312242 | 3300026035 | Bacteria | 1437 |
| 457 | Ga0207639_10020860 | 3300026041 | Bacteria | 4698 |
| 458 | Ga0207639_10109579 | 3300026041 | Bacteria | 2247 |
| 459 | Ga0207639_11305115 | 3300026041 | Bacteria | 681 |
| 460 | Ga0207678_10078443 | 3300026067 | Bacteria | 2828 |
| 461 | Ga0207678_10231275 | 3300026067 | Unclassified | 1583 |
| 462 | Ga0207678_10272101 | 3300026067 | Bacteria | 1453 |
| 463 | Ga0207708_10009052 | 3300026075 | Bacteria | 7366 |
| 464 | Ga0207708_10016792 | 3300026075 | Bacteria | 5510 |
| 465 | Ga0207708_10115045 | 3300026075 | Bacteria | 2091 |
| 466 | Ga0207708_10154278 | 3300026075 | Bacteria | 1810 |
| 467 | Ga0207708_10309352 | 3300026075 | Bacteria | 1287 |
| 468 | Ga0207702_10403521 | 3300026078 | Bacteria | 1319 |
| 469 | Ga0207702_10470775 | 3300026078 | Bacteria | 1221 |
| 470 | Ga0207641_10024962 | 3300026088 | Bacteria | 4929 |
| 471 | Ga0207648_10031419 | 3300026089 | Bacteria | 4696 |
| 472 | Ga0207648_10074501 | 3300026089 | Bacteria | 2958 |
| 473 | Ga0207648_10086712 | 3300026089 | Unclassified | 2731 |
| 474 | Ga0207648_10098880 | 3300026089 | Bacteria | 2555 |
| 475 | Ga0207648_10308984 | 3300026089 | Unclassified | 1419 |
| 476 | Ga0207648_10339669 | 3300026089 | Bacteria | 1352 |
| 477 | Ga0207676_10457957 | 3300026095 | Bacteria | 1204 |
| 478 | Ga0207676_11201889 | 3300026095 | Unclassified | 751 |
| 479 | Ga0207676_11285140 | 3300026095 | Bacteria | 726 |
| 480 | Ga0207676_11353858 | 3300026095 | Bacteria | 707 |
| 481 | Ga0207674_10008436 | 3300026116 | Bacteria | 11903 |
| 482 | Ga0207674_10089108 | 3300026116 | Bacteria | 3078 |
| 483 | Ga0207674_10124602 | 3300026116 | Bacteria | 2542 |
| 484 | Ga0207674_10731906 | 3300026116 | Bacteria | 955 |
| 485 | Ga0207674_11170921 | 3300026116 | Bacteria | 738 |
| 486 | Ga0207675_100012138 | 3300026118 | Bacteria | 8048 |
| 487 | Ga0207675_100281132 | 3300026118 | Bacteria | 1617 |
| 488 | Ga0207675_100354315 | 3300026118 | Unclassified | 1439 |
| 489 | Ga0207683_10041737 | 3300026121 | Bacteria | 4006 |
| 490 | Ga0207683_10052061 | 3300026121 | Bacteria | 3587 |
| 491 | Ga0207683_10083122 | 3300026121 | Bacteria | 2845 |
| 492 | Ga0207683_10088859 | 3300026121 | Bacteria | 2750 |
| 493 | Ga0207683_10207753 | 3300026121 | Bacteria | 1781 |
| 494 | Ga0207683_10372139 | 3300026121 | Bacteria | 1313 |
| 495 | Ga0207698_10012965 | 3300026142 | Bacteria | 5481 |
| 496 | Ga0207698_10211724 | 3300026142 | Bacteria | 1744 |
| 497 | Ga0207698_10392084 | 3300026142 | Bacteria | 1324 |
| 498 | Ga0207698_10475765 | 3300026142 | Unclassified | 1211 |
| 499 | Ga0209966_1009539 | 3300027695 | Bacteria | 1735 |
| 500 | Ga0207428_10000182 | 3300027907 | Bacteria | 88012 |
| 501 | Ga0207428_10004674 | 3300027907 | Bacteria | 12977 |
| 502 | Ga0207428_10043802 | 3300027907 | Bacteria | 3613 |
| 503 | Ga0207428_10145146 | 3300027907 | Bacteria | 1809 |
| 504 | Ga0207428_10372210 | 3300027907 | Bacteria | 1049 |
| 505 | Ga0268266_10159286 | 3300028379 | Bacteria | 2041 |
| 506 | Ga0268266_10609917 | 3300028379 | Unclassified | 1049 |
| 507 | Ga0268266_10871562 | 3300028379 | Bacteria | 870 |
| 508 | Ga0268265_10824422 | 3300028380 | Bacteria | 906 |
| 509 | Ga0268264_10552574 | 3300028381 | Unclassified | 1129 |
| 510 | Ga0268264_10859629 | 3300028381 | Bacteria | 909 |
| 511 | Ga0373958_0107076 | 3300034819 | Bacteria | 662 |
| 512 | Ga0373959_0024319 | 3300034820 | Bacteria | 1183 |
| 513 | Ga0373938_0025163 | 3300034957 | Bacteria | 1237 |
| 514 | Ga0373949_0149390 | 3300035090 | Bacteria | 675 |
| 515 | Ga0373951_0024993 | 3300035091 | Bacteria | 1386 |
| 516 | Ga0373941_0109965 | 3300035115 | Bacteria | 970 |
| 517 | Ga0373960_0118726 | 3300035121 | Bacteria | 875 |
| 518 | Ga0373962_0033954 | 3300035242 | Bacteria | 1411 |
| 519 | Ga0373931_0036572 | 3300035691 | Bacteria | 2560 |
| 520 | Ga0373931_0083390 | 3300035691 | Bacteria | 1768 |
| 521 | Ga0395900_0107916 | 3300037418 | Unclassified | 2860 |
| 522 | Ga0395898_0678540 | 3300037466 | Bacteria | 972 |
| 523 | Ga0395905_0653979 | 3300037471 | Bacteria | 953 |
| 524 | Ga0451798_0487803 | 3300041458 | Bacteria | 736 |
| 525 | Ga0451802_1952470 | 3300041460 | Unclassified | 537 |
| 526 | Ga0451807_0983106 | 3300041486 | Bacteria | 629 |
| 527 | Ga0451837_1632252 | 3300041494 | Unclassified | 641 |
| 528 | Ga0451841_0648400 | 3300041498 | Unclassified | 556 |
| 529 | Ga0451851_0941692 | 3300041507 | Bacteria | 1267 |
| 530 | Ga0451853_3647003 | 3300041512 | Unclassified | 584 |
| 531 | Ga0439450_059020 | 3300042008 | Bacteria | 924 |
| 532 | Ga0439456_039475 | 3300042013 | Bacteria | 1022 |
| 533 | Ga0450920_139966 | 3300042122 | Unclassified | 512 |
| 534 | Ga0450923_113710 | 3300042125 | Bacteria | 634 |
| 535 | Ga0450910_011237 | 3300042147 | Bacteria | 1283 |
| 536 | Ga0450908_013527 | 3300042184 | Bacteria | 1472 |
| 537 | Ga0450909_022596 | 3300042185 | Bacteria | 942 |
| 538 | Ga0439460_0044232 | 3300042461 | Bacteria | 1318 |
| 539 | Ga0495603_0004241 | 3300046455 | Bacteria | 8537 |
| 540 | Ga0495603_0263388 | 3300046455 | Archaea | 992 |
| 541 | Ga0495603_0292927 | 3300046455 | Bacteria | 935 |
| 542 | Ga0495629_0771018 | 3300046459 | Bacteria | 636 |
| 543 | Ga0495641_0217091 | 3300046461 | Bacteria | 858 |
| 544 | Ga0495584_0460577 | 3300046491 | Bacteria | 647 |
| 545 | Ga0495596_0310477 | 3300046500 | Bacteria | 613 |
| 546 | Ga0495608_0279095 | 3300046511 | Bacteria | 1037 |
| 547 | Ga0495630_0180864 | 3300046517 | Bacteria | 1608 |
| 548 | Ga0495656_0093347 | 3300046615 | Bacteria | 1380 |
| 549 | Ga0495656_0098586 | 3300046615 | Bacteria | 1348 |
| 550 | Ga0495656_0119501 | 3300046615 | Bacteria | 1242 |
| 551 | Ga0495656_0236891 | 3300046615 | Bacteria | 918 |
| 552 | Ga0495611_0259371 | 3300046648 | Bacteria | 805 |
| 553 | Ga0495659_0124509 | 3300046664 | Bacteria | 1018 |
| 554 | Ga0495613_0580137 | 3300046689 | Bacteria | 748 |
| 555 | Ga0495671_0192281 | 3300046692 | Bacteria | 991 |
| 556 | Ga0495600_0169641 | 3300046809 | Bacteria | 1409 |
| 557 | Ga0495676_0662003 | 3300047321 | Bacteria | 677 |
| 558 | Ga0495680_0188120 | 3300047322 | Bacteria | 1486 |
| 559 | Ga0496100_0207300 | 3300048903 | Bacteria | 1432 |
| 560 | Ga0496100_0222726 | 3300048903 | Bacteria | 1385 |
| 561 | Ga0496100_0362995 | 3300048903 | Bacteria | 1096 |
| 562 | Ga0496100_0560276 | 3300048903 | Unclassified | 885 |
| 563 | Ga0496100_1065885 | 3300048903 | Bacteria | 637 |
| 564 | Ga0496101_0121798 | 3300048904 | Bacteria | 1973 |
| 565 | Ga0496101_0197020 | 3300048904 | Bacteria | 1556 |
| 566 | Ga0496101_0266367 | 3300048904 | Bacteria | 1337 |
| 567 | Ga0496101_0657160 | 3300048904 | Bacteria | 828 |
| 568 | Ga0496101_1263006 | 3300048904 | Bacteria | 578 |
| 569 | Ga0496102_0402343 | 3300048905 | Bacteria | 1287 |
| 570 | Ga0496102_0412187 | 3300048905 | Bacteria | 1269 |
| 571 | Ga0496102_0609312 | 3300048905 | Bacteria | 1015 |
| 572 | Ga0496102_0640894 | 3300048905 | Bacteria | 986 |
| 573 | Ga0496102_0681435 | 3300048905 | Bacteria | 951 |
| 574 | Ga0496104_0137647 | 3300048907 | Bacteria | 2346 |
| 575 | Ga0496104_0294866 | 3300048907 | Bacteria | 1534 |
| 576 | Ga0496104_0354260 | 3300048907 | Unclassified | 1380 |
| 577 | Ga0496104_0874484 | 3300048907 | Unclassified | 804 |
| 578 | Ga0496105_0021535 | 3300048908 | Bacteria | 5216 |
| 579 | Ga0496105_0405140 | 3300048908 | Unclassified | 1082 |
| 580 | Ga0496105_0812217 | 3300048908 | Bacteria | 710 |
| 581 | Ga0496105_1352609 | 3300048908 | Bacteria | 518 |
| 582 | Ga0496106_0057354 | 3300048909 | Bacteria | 2945 |
| 583 | Ga0496106_0126575 | 3300048909 | Bacteria | 2001 |
| 584 | Ga0496106_0346597 | 3300048909 | Bacteria | 1193 |
| 585 | Ga0496106_0493334 | 3300048909 | Unclassified | 984 |
| 586 | Ga0496107_0107876 | 3300048910 | Bacteria | 2045 |
| 587 | Ga0496107_0606428 | 3300048910 | Bacteria | 809 |
| 588 | Ga0496108_0112814 | 3300048911 | Bacteria | 2326 |
| 589 | Ga0496108_0149620 | 3300048911 | Bacteria | 2014 |
| 590 | Ga0496108_0214356 | 3300048911 | Bacteria | 1672 |
| 591 | Ga0496109_0014131 | 3300048912 | Bacteria | 6939 |
| 592 | Ga0496109_0054583 | 3300048912 | Bacteria | 3645 |
| 593 | Ga0496109_0287585 | 3300048912 | Bacteria | 1549 |
| 594 | Ga0496109_0423088 | 3300048912 | Bacteria | 1258 |
| 595 | Ga0496109_0791467 | 3300048912 | Unclassified | 886 |
| 596 | Ga0496110_0002723 | 3300048913 | Bacteria | 13347 |
| 597 | Ga0496110_0111277 | 3300048913 | Bacteria | 2461 |
| 598 | Ga0496110_0371875 | 3300048913 | Bacteria | 1302 |
| 599 | Ga0496111_0004700 | 3300048914 | Bacteria | 8657 |
| 600 | Ga0496111_0054273 | 3300048914 | Bacteria | 2896 |
| 601 | Ga0496112_0033565 | 3300048915 | Bacteria | 4990 |
| 602 | Ga0496112_0225146 | 3300048915 | Bacteria | 1831 |
| 603 | Ga0496113_0146803 | 3300048916 | Bacteria | 1859 |
| 604 | Ga0496113_0205511 | 3300048916 | Bacteria | 1566 |
| 605 | Ga0496113_0818136 | 3300048916 | Bacteria | 740 |
| 606 | Ga0496113_1392695 | 3300048916 | Bacteria | 543 |
| 607 | Ga0496114_0004264 | 3300048917 | Bacteria | 11066 |
| 608 | Ga0496114_0092774 | 3300048917 | Unclassified | 2566 |
| 609 | Ga0496114_0186901 | 3300048917 | Bacteria | 1811 |
| 610 | Ga0496114_0635317 | 3300048917 | Bacteria | 940 |
| 611 | Ga0501031_0028752 | 3300049568 | Bacteria | 3623 |
| 612 | Ga0501031_0053839 | 3300049568 | Bacteria | 2623 |
| 613 | Ga0501031_0074166 | 3300049568 | Bacteria | 2216 |
| 614 | Ga0501031_0115393 | 3300049568 | Bacteria | 1754 |
| 615 | Ga0501031_0165564 | 3300049568 | Bacteria | 1445 |
| 616 | Ga0501031_0174717 | 3300049568 | Bacteria | 1403 |
| 617 | Ga0501032_0091900 | 3300049569 | Bacteria | 2013 |
| 618 | Ga0501033_0375815 | 3300049570 | Bacteria | 993 |
| 619 | Ga0501033_0851516 | 3300049570 | Bacteria | 614 |
| 620 | Ga0501034_0531603 | 3300049571 | Bacteria | 1087 |
| 621 | Ga0501036_0043798 | 3300049572 | Bacteria | 3790 |
| 622 | Ga0501036_0078821 | 3300049572 | Bacteria | 2786 |
| 623 | Ga0501036_0148608 | 3300049572 | Unclassified | 1976 |
| 624 | Ga0501036_0163752 | 3300049572 | Bacteria | 1875 |
| 625 | Ga0501036_1147213 | 3300049572 | Bacteria | 634 |
| 626 | Ga0501036_1178229 | 3300049572 | Bacteria | 625 |
| 627 | Ga0501037_0050415 | 3300049573 | Bacteria | 3046 |
| 628 | Ga0501037_0129685 | 3300049573 | Bacteria | 1809 |
| 629 | Ga0501037_0363424 | 3300049573 | Bacteria | 997 |
| 630 | Ga0501038_0124336 | 3300049574 | Bacteria | 2124 |
| 631 | Ga0501038_0220075 | 3300049574 | Bacteria | 1515 |
| 632 | Ga0501038_0676190 | 3300049574 | Bacteria | 775 |
| 633 | Ga0501039_0002309 | 3300049575 | Bacteria | 14159 |
| 634 | Ga0501039_0037345 | 3300049575 | Bacteria | 3748 |
| 635 | Ga0501039_0061283 | 3300049575 | Bacteria | 2914 |
| 636 | Ga0501039_0099926 | 3300049575 | Bacteria | 2264 |
| 637 | Ga0501039_0211451 | 3300049575 | Bacteria | 1525 |
| 638 | Ga0501039_0429560 | 3300049575 | Bacteria | 1037 |
| 639 | Ga0501039_0639441 | 3300049575 | Bacteria | 833 |
| 640 | Ga0501039_1446790 | 3300049575 | Unclassified | 529 |
| 641 | Ga0501040_0016519 | 3300049576 | Bacteria | 4887 |
| 642 | Ga0501040_0023610 | 3300049576 | Bacteria | 4123 |
| 643 | Ga0501040_0076474 | 3300049576 | Bacteria | 2315 |
| 644 | Ga0501040_0130947 | 3300049576 | Bacteria | 1764 |
| 645 | Ga0501040_0157732 | 3300049576 | Bacteria | 1603 |
| 646 | Ga0501040_0164859 | 3300049576 | Bacteria | 1567 |
| 647 | Ga0501040_0250434 | 3300049576 | Unclassified | 1263 |
| 648 | Ga0501040_0836382 | 3300049576 | Unclassified | 666 |
| 649 | Ga0501040_1192663 | 3300049576 | Bacteria | 552 |
| 650 | Ga0501041_0011087 | 3300049577 | Bacteria | 5321 |
| 651 | Ga0501041_0054253 | 3300049577 | Bacteria | 2445 |
| 652 | Ga0501041_0072499 | 3300049577 | Bacteria | 2116 |
| 653 | Ga0501041_0102300 | 3300049577 | Bacteria | 1774 |
| 654 | Ga0501041_0671791 | 3300049577 | Bacteria | 662 |
| 655 | Ga0501042_0053464 | 3300049578 | Bacteria | 2881 |
| 656 | Ga0501042_0074499 | 3300049578 | Bacteria | 2429 |
| 657 | Ga0501042_0084269 | 3300049578 | Bacteria | 2279 |
| 658 | Ga0501042_0159529 | 3300049578 | Bacteria | 1627 |
| 659 | Ga0501042_0218085 | 3300049578 | Bacteria | 1376 |
| 660 | Ga0501042_0766233 | 3300049578 | Unclassified | 702 |
| 661 | Ga0501042_0773202 | 3300049578 | Bacteria | 699 |
| 662 | Ga0501042_1021243 | 3300049578 | Bacteria | 603 |
| 663 | Ga0501042_1031060 | 3300049578 | Unclassified | 600 |
| 664 | Ga0501043_0037569 | 3300049579 | Bacteria | 3809 |
| 665 | Ga0501043_0188755 | 3300049579 | Bacteria | 1603 |
| 666 | Ga0501043_0191363 | 3300049579 | Unclassified | 1591 |
| 667 | Ga0501046_0107241 | 3300049580 | Bacteria | 2137 |
| 668 | Ga0501048_0023789 | 3300049582 | Bacteria | 4474 |
| 669 | Ga0501048_0289855 | 3300049582 | Unclassified | 1164 |
| 670 | Ga0501048_0447915 | 3300049582 | Bacteria | 924 |
| 671 | Ga0501048_0777893 | 3300049582 | Bacteria | 687 |
| 672 | Ga0501048_1291979 | 3300049582 | Unclassified | 525 |
| 673 | Ga0501067_0004455 | 3300049583 | Bacteria | 7723 |
| 674 | Ga0501067_0007376 | 3300049583 | Bacteria | 6108 |
| 675 | Ga0501067_0068298 | 3300049583 | Bacteria | 1967 |
| 676 | Ga0501067_0068733 | 3300049583 | Bacteria | 1961 |
| 677 | Ga0501067_0075871 | 3300049583 | Bacteria | 1862 |
| 678 | Ga0501067_0102125 | 3300049583 | Bacteria | 1593 |
| 679 | Ga0501067_0248630 | 3300049583 | Unclassified | 990 |
| 680 | Ga0501067_0402327 | 3300049583 | Bacteria | 764 |
| 681 | Ga0501068_0011770 | 3300049584 | Bacteria | 4945 |
| 682 | Ga0501068_0036794 | 3300049584 | Bacteria | 2929 |
| 683 | Ga0501068_0129164 | 3300049584 | Unclassified | 1580 |
| 684 | Ga0501068_0139167 | 3300049584 | Unclassified | 1521 |
| 685 | Ga0501068_0193954 | 3300049584 | Unclassified | 1287 |
| 686 | Ga0501068_0232862 | 3300049584 | Unclassified | 1171 |
| 687 | Ga0501068_0271604 | 3300049584 | Bacteria | 1082 |
| 688 | Ga0501068_0387208 | 3300049584 | Bacteria | 901 |
| 689 | Ga0501068_0409412 | 3300049584 | Bacteria | 875 |
| 690 | Ga0501069_0031116 | 3300049585 | Bacteria | 2933 |
| 691 | Ga0501069_0051877 | 3300049585 | Bacteria | 2283 |
| 692 | Ga0501069_0132156 | 3300049585 | Bacteria | 1429 |
| 693 | Ga0501069_0147133 | 3300049585 | Bacteria | 1352 |
| 694 | Ga0501069_0167943 | 3300049585 | Bacteria | 1265 |
| 695 | Ga0501069_0250368 | 3300049585 | Bacteria | 1033 |
| 696 | Ga0501069_0297073 | 3300049585 | Bacteria | 947 |
| 697 | Ga0501070_0051405 | 3300049586 | Bacteria | 3421 |
| 698 | Ga0501070_0149068 | 3300049586 | Bacteria | 1930 |
| 699 | Ga0501070_0247246 | 3300049586 | Bacteria | 1459 |
| 700 | Ga0501070_0255232 | 3300049586 | Bacteria | 1434 |
| 701 | Ga0501071_0002245 | 3300049587 | Bacteria | 11626 |
| 702 | Ga0501071_0004277 | 3300049587 | Bacteria | 9045 |
| 703 | Ga0501071_0009436 | 3300049587 | Bacteria | 6499 |
| 704 | Ga0501071_0012338 | 3300049587 | Bacteria | 5794 |
| 705 | Ga0501071_0036256 | 3300049587 | Bacteria | 3516 |
| 706 | Ga0501071_0045371 | 3300049587 | Bacteria | 3155 |
| 707 | Ga0501071_0057286 | 3300049587 | Unclassified | 2816 |
| 708 | Ga0501071_0071598 | 3300049587 | Bacteria | 2528 |
| 709 | Ga0501071_0161216 | 3300049587 | Bacteria | 1676 |
| 710 | Ga0501071_0171946 | 3300049587 | Bacteria | 1622 |
| 711 | Ga0501071_0227603 | 3300049587 | Bacteria | 1404 |
| 712 | Ga0501071_0335825 | 3300049587 | Bacteria | 1149 |
| 713 | Ga0501072_0003837 | 3300049588 | Bacteria | 11355 |
| 714 | Ga0501072_0012115 | 3300049588 | Bacteria | 6587 |
| 715 | Ga0501072_0054325 | 3300049588 | Bacteria | 3155 |
| 716 | Ga0501072_0068466 | 3300049588 | Bacteria | 2802 |
| 717 | Ga0501072_0068527 | 3300049588 | Unclassified | 2801 |
| 718 | Ga0501072_0157059 | 3300049588 | Bacteria | 1814 |
| 719 | Ga0501072_0180572 | 3300049588 | Bacteria | 1683 |
| 720 | Ga0501072_0218104 | 3300049588 | Bacteria | 1520 |
| 721 | Ga0501072_0402258 | 3300049588 | Bacteria | 1086 |
| 722 | Ga0501072_0424921 | 3300049588 | Bacteria | 1053 |
| 723 | Ga0501072_0599534 | 3300049588 | Bacteria | 868 |
| 724 | Ga0501072_1188680 | 3300049588 | Bacteria | 592 |
| 725 | Ga0501073_0139618 | 3300049589 | Bacteria | 1679 |
| 726 | Ga0501073_0191679 | 3300049589 | Bacteria | 1414 |
| 727 | Ga0501074_0033356 | 3300049590 | Bacteria | 3731 |
| 728 | Ga0501074_0081168 | 3300049590 | Bacteria | 2326 |
| 729 | Ga0501074_0094337 | 3300049590 | Bacteria | 2143 |
| 730 | Ga0501074_0113865 | 3300049590 | Bacteria | 1935 |
| 731 | Ga0501075_0005248 | 3300049591 | Bacteria | 8861 |
| 732 | Ga0501075_0009806 | 3300049591 | Bacteria | 6712 |
| 733 | Ga0501075_0010765 | 3300049591 | Bacteria | 6442 |
| 734 | Ga0501075_0017260 | 3300049591 | Bacteria | 5212 |
| 735 | Ga0501075_0040849 | 3300049591 | Bacteria | 3475 |
| 736 | Ga0501075_0322965 | 3300049591 | Bacteria | 1176 |
| 737 | Ga0501075_0400161 | 3300049591 | Bacteria | 1047 |
| 738 | Ga0501075_0606772 | 3300049591 | Bacteria | 835 |
| 739 | Ga0501075_0757650 | 3300049591 | Bacteria | 739 |
| 740 | Ga0501076_0002314 | 3300049592 | Bacteria | 13049 |
| 741 | Ga0501076_0007959 | 3300049592 | Bacteria | 7734 |
| 742 | Ga0501076_0066641 | 3300049592 | Bacteria | 2874 |
| 743 | Ga0501076_0075178 | 3300049592 | Bacteria | 2707 |
| 744 | Ga0501076_0125720 | 3300049592 | Unclassified | 2077 |
| 745 | Ga0501076_0127648 | 3300049592 | Unclassified | 2061 |
| 746 | Ga0501076_0138656 | 3300049592 | Bacteria | 1975 |
| 747 | Ga0501076_0251274 | 3300049592 | Bacteria | 1447 |
| 748 | Ga0501076_0256895 | 3300049592 | Bacteria | 1430 |
| 749 | Ga0501076_0396696 | 3300049592 | Bacteria | 1134 |
| 750 | Ga0501076_0411384 | 3300049592 | Unclassified | 1112 |
| 751 | Ga0501076_0639464 | 3300049592 | Bacteria | 878 |
| 752 | Ga0501076_0782803 | 3300049592 | Bacteria | 787 |
| 753 | Ga0501077_0004356 | 3300049593 | Bacteria | 8582 |
| 754 | Ga0501077_0007601 | 3300049593 | Bacteria | 6688 |
| 755 | Ga0501077_0016850 | 3300049593 | Bacteria | 4608 |
| 756 | Ga0501077_0042247 | 3300049593 | Bacteria | 2899 |
| 757 | Ga0501077_0054423 | 3300049593 | Bacteria | 2542 |
| 758 | Ga0501077_0090297 | 3300049593 | Bacteria | 1941 |
| 759 | Ga0501077_0135808 | 3300049593 | Unclassified | 1560 |
| 760 | Ga0501077_0401938 | 3300049593 | Bacteria | 876 |
| 761 | Ga0501077_0492103 | 3300049593 | Bacteria | 786 |
| 762 | Ga0501077_0563172 | 3300049593 | Bacteria | 731 |
| 763 | Ga0501079_0031365 | 3300049741 | Bacteria | 4084 |
| 764 | Ga0501079_0062495 | 3300049741 | Bacteria | 2872 |
| 765 | Ga0501079_0159071 | 3300049741 | Bacteria | 1761 |
| 766 | Ga0501079_0276533 | 3300049741 | Bacteria | 1313 |
| 767 | Ga0501079_0323360 | 3300049741 | Bacteria | 1208 |
| 768 | Ga0501079_0337058 | 3300049741 | Bacteria | 1181 |
| 769 | Ga0501079_0391290 | 3300049741 | Bacteria | 1090 |
| 770 | Ga0501079_0429164 | 3300049741 | Unclassified | 1037 |
| 771 | Ga0501080_0075119 | 3300049742 | Bacteria | 3144 |
| 772 | Ga0501080_0113570 | 3300049742 | Bacteria | 2511 |
| 773 | Ga0501080_0140384 | 3300049742 | Bacteria | 2234 |
| 774 | Ga0501080_0229878 | 3300049742 | Bacteria | 1695 |
| 775 | Ga0501080_0290364 | 3300049742 | Unclassified | 1485 |
| 776 | Ga0501080_0308136 | 3300049742 | Bacteria | 1435 |
| 777 | Ga0501080_1130600 | 3300049742 | Bacteria | 675 |
| 778 | Ga0501081_0036523 | 3300049743 | Bacteria | 3350 |
| 779 | Ga0501081_0053463 | 3300049743 | Bacteria | 2788 |
| 780 | Ga0501081_0203370 | 3300049743 | Bacteria | 1437 |
| 781 | Ga0501081_0362734 | 3300049743 | Bacteria | 1069 |
| 782 | Ga0501081_0407918 | 3300049743 | Bacteria | 1006 |
| 783 | Ga0501081_0480117 | 3300049743 | Bacteria | 925 |
| 784 | Ga0501081_0804385 | 3300049743 | Unclassified | 707 |
| 785 | Ga0501081_1090825 | 3300049743 | Bacteria | 604 |
| 786 | Ga0501081_1448850 | 3300049743 | Bacteria | 521 |
| 787 | Ga0501083_0050416 | 3300049744 | Bacteria | 2801 |
| 788 | Ga0501083_0068002 | 3300049744 | Bacteria | 2371 |
| 789 | Ga0501083_0143873 | 3300049744 | Bacteria | 1561 |
| 790 | Ga0501083_0298502 | 3300049744 | Bacteria | 1048 |
| 791 | Ga0501083_0318562 | 3300049744 | Bacteria | 1011 |
| 792 | Ga0501083_0526051 | 3300049744 | Bacteria | 770 |
| 793 | Ga0501035_0103918 | 3300049822 | Unclassified | 2491 |
| 794 | Ga0501035_0320261 | 3300049822 | Bacteria | 1303 |
| 795 | Ga0501035_0417041 | 3300049822 | Bacteria | 1115 |
| 796 | Ga0501035_1186043 | 3300049822 | Unclassified | 593 |
| 797 | Ga0501044_0337845 | 3300049823 | Bacteria | 1428 |
| 798 | Ga0501044_0354209 | 3300049823 | Bacteria | 1387 |
| 799 | Ga0501044_0740295 | 3300049823 | Bacteria | 866 |
| 800 | Ga0501044_1228718 | 3300049823 | Unclassified | 617 |
| 801 | Ga0501045_0034525 | 3300049824 | Bacteria | 3672 |
| 802 | Ga0501045_0038764 | 3300049824 | Bacteria | 3466 |
| 803 | Ga0501045_0107527 | 3300049824 | Bacteria | 2067 |
| 804 | Ga0501045_0137945 | 3300049824 | Bacteria | 1814 |
| 805 | Ga0501045_0289309 | 3300049824 | Bacteria | 1219 |
| 806 | Ga0501045_0377291 | 3300049824 | Bacteria | 1055 |
| 807 | Ga0501045_0510550 | 3300049824 | Bacteria | 893 |
| 808 | Ga0501045_0816313 | 3300049824 | Unclassified | 686 |
| 809 | Ga0501045_1269484 | 3300049824 | Unclassified | 536 |
| 810 | nmdc:mga00v17_461210_c1 | 3300050491 | Bacteria | 825 |
| 811 | nmdc:mga00v17_730000_c1 | 3300050491 | Bacteria | 634 |
| 812 | nmdc:mga0yw44_23334_c1 | 3300050492 | Bacteria | 3484 |
| 813 | nmdc:mga0yw44_345972_c1 | 3300050492 | Bacteria | 1000 |
| 814 | nmdc:mga06z11_47365_c1 | 3300050494 | Bacteria | 2183 |
| 815 | nmdc:mga07m45_151811_c1 | 3300050496 | Bacteria | 1343 |
| 816 | nmdc:mga05p37_1062534_c1 | 3300050507 | Unclassified | 852 |
| 817 | nmdc:mga05p37_1282851_c1 | 3300050507 | Bacteria | 748 |
| 818 | nmdc:mga05p37_382499_c1 | 3300050507 | Bacteria | 1649 |
| 819 | nmdc:mga05p37_4869_c1 | 3300050507 | Bacteria | 15712 |
| 820 | nmdc:mga05p37_51398_c1 | 3300050507 | Bacteria | 5068 |
| 821 | nmdc:mga05p37_883951_c1 | 3300050507 | Bacteria | 966 |
| 822 | nmdc:mga09592_15473_c1 | 3300050508 | Bacteria | 6235 |
| 823 | nmdc:mga09592_244227_c1 | 3300050508 | Bacteria | 1556 |
| 824 | nmdc:mga09592_50568_c1 | 3300050508 | Bacteria | 3506 |
| 825 | nmdc:mga0qj67_1379508_c1 | 3300050509 | Bacteria | 544 |
| 826 | nmdc:mga0qj67_42033_c1 | 3300050509 | Bacteria | 3598 |
| 827 | nmdc:mga06r32_1018877_c1 | 3300050510 | Unclassified | 780 |
| 828 | nmdc:mga06r32_914339_c1 | 3300050510 | Unclassified | 833 |
| 829 | nmdc:mga08y16_101601_c1 | 3300050511 | Bacteria | 2994 |
| 830 | nmdc:mga08y16_1126199_c1 | 3300050511 | Unclassified | 759 |
| 831 | nmdc:mga08y16_1389656_c1 | 3300050511 | Bacteria | 666 |
| 832 | nmdc:mga08y16_208207_c1 | 3300050511 | Bacteria | 2026 |
| 833 | nmdc:mga08y16_263214_c1 | 3300050511 | Bacteria | 1781 |
| 834 | nmdc:mga08y16_35472_c1 | 3300050511 | Bacteria | 5238 |
| 835 | nmdc:mga08y16_46389_c1 | 3300050511 | Bacteria | 4549 |
| 836 | nmdc:mga0n895_204572_c1 | 3300050512 | Bacteria | 2005 |
| 837 | nmdc:mga0rr50_211747_c1 | 3300050513 | Bacteria | 1597 |
| 838 | nmdc:mga08x19_37145_c1 | 3300050514 | Bacteria | 3089 |
| 839 | nmdc:mga08x19_401802_c1 | 3300050514 | Unclassified | 961 |
| 840 | nmdc:mga0a205_238646_c1 | 3300050515 | Bacteria | 1699 |
| 841 | nmdc:mga0a205_262793_c1 | 3300050515 | Bacteria | 1603 |
| 842 | nmdc:mga0a205_32876_c1 | 3300050515 | Bacteria | 4974 |
| 843 | nmdc:mga0a205_45334_c1 | 3300050515 | Bacteria | 4239 |
| 844 | Ga0495612_0231312 | 3300053078 | Bacteria | 820 |
| 845 | Ga0495655_0009286 | 3300053083 | Bacteria | 1901 |
| 846 | Ga0495655_0232803 | 3300053083 | Unclassified | 614 |
| 847 | Ga0495595_0123091 | 3300053084 | Bacteria | 1264 |
| 848 | Ga0495619_0028835 | 3300053085 | Bacteria | 3582 |
| 849 | Ga0495619_0030610 | 3300053085 | Unclassified | 3484 |
| 850 | Ga0501084_0003923 | 3300054114 | Bacteria | 12110 |
| 851 | Ga0501084_0022824 | 3300054114 | Bacteria | 5221 |
| 852 | Ga0501084_0042241 | 3300054114 | Bacteria | 3813 |
| 853 | Ga0501084_0052046 | 3300054114 | Unclassified | 3426 |
| 854 | Ga0501084_0127882 | 3300054114 | Unclassified | 2138 |
| 855 | Ga0501084_0155313 | 3300054114 | Bacteria | 1929 |
| 856 | Ga0501084_0225520 | 3300054114 | Bacteria | 1581 |
| 857 | Ga0501084_0247342 | 3300054114 | Bacteria | 1505 |
| 858 | Ga0501084_1282324 | 3300054114 | Unclassified | 614 |
| 859 | Ga0590077_015646 | 3300059426 | Bacteria | 1588 |
| 860 | Ga0501082_0010767 | 3300060353 | Bacteria | 7874 |
| 861 | Ga0501082_0036270 | 3300060353 | Bacteria | 4248 |
| 862 | Ga0501082_0169270 | 3300060353 | Bacteria | 1899 |
| 863 | Ga0501082_0317566 | 3300060353 | Bacteria | 1357 |
| 864 | Ga0501082_0344613 | 3300060353 | Unclassified | 1298 |
| 865 | Ga0501082_0484496 | 3300060353 | Bacteria | 1081 |
| 866 | Ga0501082_0527377 | 3300060353 | Bacteria | 1032 |
| 867 | Ga0501082_1240888 | 3300060353 | Unclassified | 651 |
| 868 | Ga0530510_0011403 | 3300061734 | Bacteria | 6235 |
| 869 | Ga0530510_0065167 | 3300061734 | Bacteria | 2639 |
| 870 | Ga0530510_0069701 | 3300061734 | Bacteria | 2552 |
| 871 | Ga0530510_0114401 | 3300061734 | Unclassified | 1977 |
| 872 | Ga0530510_0157134 | 3300061734 | Bacteria | 1681 |
| 873 | Ga0530510_0179991 | 3300061734 | Bacteria | 1567 |
| 874 | Ga0530510_0278901 | 3300061734 | Unclassified | 1248 |
| 875 | Ga0530510_0307144 | 3300061734 | Bacteria | 1187 |
| 876 | Ga0530510_0312505 | 3300061734 | Bacteria | 1177 |
| 877 | Ga0530510_0357698 | 3300061734 | Bacteria | 1097 |
| 878 | Ga0530510_0423004 | 3300061734 | Unclassified | 1005 |
| 879 | Ga0530510_0493630 | 3300061734 | Bacteria | 928 |
| 880 | Ga0530510_0498064 | 3300061734 | Unclassified | 923 |
| 881 | Ga0530510_0543095 | 3300061734 | Bacteria | 882 |
| 882 | 2512736769 | 2512564039 | Bacteria | 8739048 |
| 883 | Ga0501077_0214390 | |||
| 884 | ARcpr5yngRDRAFT_c005018 | |||
| 885 | ARSoilOldRDRAFT_c001352 | |||
| 886 | ARCol0yngRDRAFT_1001892 | |||
| 887 | JGI24746J21847_1013217 | |||
| 888 | JGI24743J22301_10009270 | |||
| 889 | JGI24738J21930_10014706 | |||
| 890 | JGI24744J21845_10013288 | |||
| 891 | JGI24033J26618_1021497 | |||
| 892 | JGI24751J29686_10037418 | |||
| 893 | JGI25406J46586_10027104 | |||
| 894 | Ga0070658_10158575 | |||
| 895 | Ga0070658_10844338 | |||
| 896 | Ga0070676_10048048 | |||
| 897 | Ga0070683_100014338 | |||
| 898 | Ga0070683_100067023 | |||
| 899 | Ga0070683_100080820 | |||
| 900 | Ga0070683_100443926 | |||
| 901 | Ga0070683_100865914 | |||
| 902 | Ga0070683_101866356 | |||
| 903 | Ga0070670_100099625 | |||
| 904 | Ga0070670_100099819 | |||
| 905 | Ga0070670_100198543 | |||
| 906 | Ga0070670_100999263 | |||
| 907 | Ga0068869_101057902 | |||
| 908 | Ga0068869_101283365 | |||
| 909 | Ga0070680_100080674 | |||
| 910 | Ga0070682_100002955 | |||
| 911 | Ga0070682_100029872 | |||
| 912 | Ga0070682_100299133 | |||
| 913 | Ga0068868_100292900 | |||
| 914 | Ga0068868_100592248 | |||
| 915 | Ga0068868_100910454 | |||
| 916 | Ga0068868_100917154 | |||
| 917 | Ga0070660_100004508 | |||
| 918 | Ga0070660_100318707 | |||
| 919 | Ga0070660_100550137 | |||
| 920 | Ga0070660_100595024 | |||
| 921 | Ga0070689_100003268 | |||
| 922 | Ga0070689_100013139 | |||
| 923 | Ga0070691_10020769 | |||
| 924 | Ga0070691_10035413 | |||
| 925 | Ga0070691_10281697 | |||
| 926 | Ga0070691_10496590 | |||
| 927 | Ga0070687_100415551 | |||
| 928 | Ga0070661_100164146 | |||
| 929 | Ga0070661_100378316 | |||
| 930 | Ga0070692_10027766 | |||
| 931 | Ga0070692_10042579 | |||
| 932 | Ga0070692_10212205 | |||
| 933 | Ga0070692_10288182 | |||
| 934 | Ga0070692_10328705 | |||
| 935 | Ga0070668_100147535 | |||
| 936 | Ga0070668_100215135 | |||
| 937 | Ga0070668_100295249 | |||
| 938 | Ga0070668_100377960 | |||
| 939 | Ga0070668_100809529 | |||
| 940 | Ga0070669_100048593 | |||
| 941 | Ga0070669_100592296 | |||
| 942 | Ga0070669_101238655 | |||
| 943 | Ga0070675_100030703 | |||
| 944 | Ga0070675_100149606 | |||
| 945 | Ga0070675_100507263 | |||
| 946 | Ga0070671_100092764 | |||
| 947 | Ga0070671_100189130 | |||
| 948 | Ga0070674_100005773 | |||
| 949 | Ga0070674_100083164 | |||
| 950 | Ga0070674_100473040 | |||
| 951 | Ga0070674_100920729 | |||
| 952 | Ga0070674_101244250 | |||
| 953 | Ga0070674_101357953 | |||
| 954 | Ga0070673_100085840 | |||
| 955 | Ga0070673_100396342 | |||
| 956 | Ga0070688_100013927 | |||
| 957 | Ga0070688_100280190 | |||
| 958 | Ga0070659_100028257 | |||
| 959 | Ga0070659_100158733 | |||
| 960 | Ga0070659_100162825 | |||
| 961 | Ga0070667_100303834 | |||
| 962 | Ga0070667_100337285 | |||
| 963 | Ga0070667_100346255 | |||
| 964 | Ga0070713_100111414 | |||
| 965 | Ga0070701_10005472 | |||
| 966 | Ga0070705_100052770 | |||
| 967 | Ga0070705_100131077 | |||
| 968 | Ga0070700_100036523 | |||
| 969 | Ga0070700_100198843 | |||
| 970 | Ga0070700_100302442 | |||
| 971 | Ga0070700_100334931 | |||
| 972 | Ga0070694_100960393 | |||
| 973 | Ga0070694_101222792 | |||
| 974 | Ga0070708_100232621 | |||
| 975 | Ga0070708_101410230 | |||
| 976 | Ga0070663_100307192 | |||
| 977 | Ga0070663_100585575 | |||
| 978 | Ga0070678_100029915 | |||
| 979 | Ga0070678_100322347 | |||
| 980 | Ga0070678_100343647 | |||
| 981 | Ga0070678_100681471 | |||
| 982 | Ga0070678_100777680 | |||
| 983 | Ga0070678_101188099 | |||
| 984 | Ga0070678_101233867 | |||
| 985 | Ga0070662_100043493 | |||
| 986 | Ga0070662_100206113 | |||
| 987 | Ga0070662_100568096 | |||
| 988 | Ga0070681_10087248 | |||
| 989 | Ga0070681_10146142 | |||
| 990 | Ga0070681_10234818 | |||
| 991 | Ga0068867_100157036 | |||
| 992 | Ga0068867_100170140 | |||
| 993 | Ga0068867_100213039 | |||
| 994 | Ga0068867_100264384 | |||
| 995 | Ga0068867_100356169 | |||
| 996 | Ga0070685_10001814 | |||
| 997 | Ga0070685_10101780 | |||
| 998 | Ga0070685_10136313 | |||
| 999 | Ga0070685_10729933 | |||
| 1000 | Ga0070706_100467197 | |||
| 1001 | Ga0070679_100016201 | |||
| 1002 | Ga0070679_100157362 | |||
| 1003 | Ga0070684_100012482 | |||
| 1004 | Ga0070684_100044320 | |||
| 1005 | Ga0070684_100052498 | |||
| 1006 | Ga0070684_100265539 | |||
| 1007 | Ga0070684_100277563 | |||
| 1008 | Ga0070684_100335978 | |||
| 1009 | Ga0068853_100012062 | |||
| 1010 | Ga0068853_100206077 | |||
| 1011 | Ga0068853_100910416 | |||
| 1012 | Ga0070672_100127249 | |||
| 1013 | Ga0070672_100142824 | |||
| 1014 | Ga0070672_100157034 | |||
| 1015 | Ga0070672_101039204 | |||
| 1016 | Ga0070686_100096141 | |||
| 1017 | Ga0070686_100256627 | |||
| 1018 | Ga0070695_100347747 | |||
| 1019 | Ga0070695_100373740 | |||
| 1020 | Ga0070696_100089054 | |||
| 1021 | Ga0070696_100398958 | |||
| 1022 | Ga0070693_100122649 | |||
| 1023 | Ga0070665_100009113 | |||
| 1024 | Ga0070665_100043729 | |||
| 1025 | Ga0070665_100367312 | |||
| 1026 | Ga0070704_100159448 | |||
| 1027 | Ga0070704_100201049 | |||
| 1028 | Ga0070704_100323659 | |||
| 1029 | Ga0070704_100584666 | |||
| 1030 | Ga0068855_100510298 | |||
| 1031 | Ga0070664_100038772 | |||
| 1032 | Ga0070664_100039753 | |||
| 1033 | Ga0070664_100084164 | |||
| 1034 | Ga0070664_100136314 | |||
| 1035 | Ga0070664_100161106 | |||
| 1036 | Ga0068857_100073251 | |||
| 1037 | Ga0068857_100105311 | |||
| 1038 | Ga0068857_100142944 | |||
| 1039 | Ga0068857_100849296 | |||
| 1040 | Ga0068854_100000733 | |||
| 1041 | Ga0068854_100561477 | |||
| 1042 | Ga0068854_100807885 | |||
| 1043 | Ga0068856_100027626 | |||
| 1044 | Ga0068856_100314761 | |||
| 1045 | Ga0070702_100016951 | |||
| 1046 | Ga0070702_100018802 | |||
| 1047 | Ga0070702_100092106 | |||
| 1048 | Ga0070702_100361310 | |||
| 1049 | Ga0070702_100428950 | |||
| 1050 | Ga0068852_100015804 | |||
| 1051 | Ga0068852_100336571 | |||
| 1052 | Ga0068852_100373748 | |||
| 1053 | Ga0068852_100396359 | |||
| 1054 | Ga0068859_100019963 | |||
| 1055 | Ga0068864_100068183 | |||
| 1056 | Ga0068864_100086793 | |||
| 1057 | Ga0068864_100884089 | |||
| 1058 | Ga0068864_102007088 | |||
| 1059 | Ga0068866_10145709 | |||
| 1060 | Ga0068866_10180826 | |||
| 1061 | Ga0068866_10206856 | |||
| 1062 | Ga0068861_100022669 | |||
| 1063 | Ga0068861_100109160 | |||
| 1064 | Ga0068861_100571811 | |||
| 1065 | Ga0068851_10059139 | |||
| 1066 | Ga0068851_10131435 | |||
| 1067 | Ga0068870_10010973 | |||
| 1068 | Ga0068870_10171041 | |||
| 1069 | Ga0068870_10207457 | |||
| 1070 | Ga0068870_10220932 | |||
| 1071 | Ga0068863_100822475 | |||
| 1072 | Ga0068863_100885265 | |||
| 1073 | Ga0068858_100055946 | |||
| 1074 | Ga0068860_100055188 | |||
| 1075 | Ga0068860_100060241 | |||
| 1076 | Ga0068862_100281668 | |||
| 1077 | Ga0068862_100362983 | |||
| 1078 | Ga0068862_100743037 | |||
| 1079 | Ga0081455_10059370 | |||
| 1080 | Ga0081455_10110317 | |||
| 1081 | Ga0081455_10147820 | |||
| 1082 | Ga0081455_10239880 | |||
| 1083 | Ga0081455_10285172 | |||
| 1084 | Ga0081538_10096014 | |||
| 1085 | Ga0081539_10001668 | |||
| 1086 | Ga0081539_10163107 | |||
| 1087 | Ga0070717_10135591 | |||
| 1088 | Ga0075365_10305614 | |||
| 1089 | Ga0075364_10338952 | |||
| 1090 | Ga0075432_10003705 | |||
| 1091 | Ga0075432_10006589 | |||
| 1092 | Ga0075432_10199018 | |||
| 1093 | Ga0075367_10035025 | |||
| 1094 | Ga0097621_100027230 | |||
| 1095 | Ga0097621_101115426 | |||
| 1096 | Ga0075370_10115385 | |||
| 1097 | Ga0068871_100072115 | |||
| 1098 | Ga0068871_100072172 | |||
| 1099 | Ga0068871_100198568 | |||
| 1100 | Ga0068871_101106631 | |||
| 1101 | Ga0075428_100005456 | |||
| 1102 | Ga0075428_100025085 | |||
| 1103 | Ga0075428_100075303 | |||
| 1104 | Ga0075430_100008652 | |||
| 1105 | Ga0075430_100304582 | |||
| 1106 | Ga0075431_100007107 | |||
| 1107 | Ga0075433_10009902 | |||
| 1108 | Ga0075433_10151165 | |||
| 1109 | Ga0075433_10354261 | |||
| 1110 | Ga0075433_10455106 | |||
| 1111 | Ga0075433_10502656 | |||
| 1112 | Ga0075434_100009715 | |||
| 1113 | Ga0075434_100460253 | |||
| 1114 | Ga0075434_100690988 | |||
| 1115 | Ga0075434_101435783 | |||
| 1116 | Ga0075429_100048042 | |||
| 1117 | Ga0075429_100114773 | |||
| 1118 | Ga0068865_100027255 | |||
| 1119 | Ga0068865_100107288 | |||
| 1120 | Ga0068865_100331915 | |||
| 1121 | Ga0075436_100112305 | |||
| 1122 | Ga0075436_100197299 | |||
| 1123 | Ga0097620_100019965 | |||
| 1124 | Ga0075435_100228304 | |||
| 1125 | Ga0105240_10582900 | |||
| 1126 | Ga0111539_10004926 | |||
| 1127 | Ga0111539_10032849 | |||
| 1128 | Ga0111539_10075810 | |||
| 1129 | Ga0111539_10185772 | |||
| 1130 | Ga0111539_11243392 | |||
| 1131 | Ga0111539_13498994 | |||
| 1132 | Ga0105245_10018022 | |||
| 1133 | Ga0105245_10025179 | |||
| 1134 | Ga0105245_10300692 | |||
| 1135 | Ga0105245_10312498 | |||
| 1136 | Ga0105247_10022525 | |||
| 1137 | Ga0114129_10033398 | |||
| 1138 | Ga0114129_10034656 | |||
| 1139 | Ga0114129_10050237 | |||
| 1140 | Ga0114129_10783633 | |||
| 1141 | Ga0114129_10931103 | |||
| 1142 | Ga0114129_11024972 | |||
| 1143 | Ga0114129_11045822 | |||
| 1144 | Ga0114129_11397754 | |||
| 1145 | Ga0105243_10003687 | |||
| 1146 | Ga0105243_10046271 | |||
| 1147 | Ga0105243_10051072 | |||
| 1148 | Ga0105243_10129934 | |||
| 1149 | Ga0105243_10188044 | |||
| 1150 | Ga0105243_11024068 | |||
| 1151 | Ga0105243_11040867 | |||
| 1152 | Ga0105243_12540004 | |||
| 1153 | Ga0105241_10443426 | |||
| 1154 | Ga0105241_10449603 | |||
| 1155 | Ga0105242_10055142 | |||
| 1156 | Ga0105242_10061082 | |||
| 1157 | Ga0105242_10086218 | |||
| 1158 | Ga0105242_10099562 | |||
| 1159 | Ga0105248_10079530 | |||
| 1160 | Ga0105248_10152339 | |||
| 1161 | Ga0105248_10161761 | |||
| 1162 | Ga0105248_10763938 | |||
| 1163 | Ga0105238_10054647 | |||
| 1164 | Ga0105238_10458426 | |||
| 1165 | Ga0105238_10528912 | |||
| 1166 | Ga0105249_10173156 | |||
| 1167 | Ga0105249_10548222 | |||
| 1168 | Ga0105239_10042798 | |||
| 1169 | Ga0105239_10057264 | |||
| 1170 | Ga0105239_10064888 | |||
| 1171 | Ga0105239_10150408 | |||
| 1172 | Ga0105239_10769590 | |||
| 1173 | Ga0105246_10009345 | |||
| 1174 | Ga0105246_10018955 | |||
| 1175 | Ga0105246_10042363 | |||
| 1176 | Ga0105246_10130894 | |||
| 1177 | Ga0105246_10234386 | |||
| 1178 | Ga0157320_1003077 | |||
| 1179 | Ga0157343_1012390 | |||
| 1180 | Ga0157373_10564470 | |||
| 1181 | Ga0157371_10018835 | |||
| 1182 | Ga0157371_10139580 | |||
| 1183 | Ga0157369_10076861 | |||
| 1184 | Ga0157369_10095079 | |||
| 1185 | Ga0157374_10167627 | |||
| 1186 | Ga0157374_10354160 | |||
| 1187 | Ga0157374_10571524 | |||
| 1188 | Ga0157374_11066579 | |||
| 1189 | Ga0157378_10699787 | |||
| 1190 | Ga0157378_10855962 | |||
| 1191 | Ga0163162_10137707 | |||
| 1192 | Ga0163162_10327464 | |||
| 1193 | Ga0157372_10180470 | |||
| 1194 | Ga0157372_10238730 | |||
| 1195 | Ga0157372_10460794 | |||
| 1196 | Ga0157372_10824332 | |||
| 1197 | Ga0157375_10015281 | |||
| 1198 | Ga0157375_10156139 | |||
| 1199 | Ga0157375_10212095 | |||
| 1200 | Ga0157375_10304954 | |||
| 1201 | Ga0157375_11475020 | |||
| 1202 | Ga0163163_10131791 | |||
| 1203 | Ga0163163_10202453 | |||
| 1204 | Ga0163163_10321156 | |||
| 1205 | Ga0163163_10455165 | |||
| 1206 | Ga0163163_10510744 | |||
| 1207 | Ga0157380_10045029 | |||
| 1208 | Ga0157380_10228053 | |||
| 1209 | Ga0157380_10708197 | |||
| 1210 | Ga0157380_11766161 | |||
| 1211 | Ga0157377_10032230 | |||
| 1212 | Ga0157377_10076686 | |||
| 1213 | Ga0157377_10095813 | |||
| 1214 | Ga0157377_10118232 | |||
| 1215 | Ga0157377_10691686 | |||
| 1216 | Ga0157379_10050323 | |||
| 1217 | Ga0157376_10169324 | |||
| 1218 | Ga0157376_10399425 | |||
| 1219 | Ga0157376_10538827 | |||
| 1220 | Ga0157376_10867031 | |||
| 1221 | Ga0163161_10197907 | |||
| 1222 | Ga0163161_10296950 | |||
| 1223 | Ga0163161_10935049 | |||
| 1224 | Ga0206356_11798710 | |||
| 1225 | Ga0207656_10021960 | |||
| 1226 | Ga0207656_10094864 | |||
| 1227 | Ga0207642_10277838 | |||
| 1228 | Ga0207642_10475433 | |||
| 1229 | Ga0207642_10581250 | |||
| 1230 | Ga0207642_10742156 | |||
| 1231 | Ga0207688_10002457 | |||
| 1232 | Ga0207688_10010697 | |||
| 1233 | Ga0207688_10015530 | |||
| 1234 | Ga0207688_10023099 | |||
| 1235 | Ga0207688_10053859 | |||
| 1236 | Ga0207680_10151839 | |||
| 1237 | Ga0207645_10022205 | |||
| 1238 | Ga0207645_10041880 | |||
| 1239 | Ga0207643_10004905 | |||
| 1240 | Ga0207643_10022336 | |||
| 1241 | Ga0207643_10042105 | |||
| 1242 | Ga0207643_10063949 | |||
| 1243 | Ga0207643_10074109 | |||
| 1244 | Ga0207705_10074417 | |||
| 1245 | Ga0207684_10368013 | |||
| 1246 | Ga0207707_10798666 | |||
| 1247 | Ga0207695_10786648 | |||
| 1248 | Ga0207693_10110009 | |||
| 1249 | Ga0207660_10054917 | |||
| 1250 | Ga0207660_10135890 | |||
| 1251 | Ga0207660_10209699 | |||
| 1252 | Ga0207660_10282238 | |||
| 1253 | Ga0207662_10050876 | |||
| 1254 | Ga0207657_10003231 | |||
| 1255 | Ga0207657_10167102 | |||
| 1256 | Ga0207657_10313599 | |||
| 1257 | Ga0207657_10394964 | |||
| 1258 | Ga0207649_10011072 | |||
| 1259 | Ga0207649_10096500 | |||
| 1260 | Ga0207649_10141207 | |||
| 1261 | Ga0207649_10696631 | |||
| 1262 | Ga0207652_10020767 | |||
| 1263 | Ga0207652_10107753 | |||
| 1264 | Ga0207652_10209922 | |||
| 1265 | Ga0207652_10726164 | |||
| 1266 | Ga0207681_10490839 | |||
| 1267 | Ga0207681_11287510 | |||
| 1268 | Ga0207694_10167893 | |||
| 1269 | Ga0207694_10279326 | |||
| 1270 | Ga0207650_10053248 | |||
| 1271 | Ga0207650_10066591 | |||
| 1272 | Ga0207650_10079173 | |||
| 1273 | Ga0207659_10242273 | |||
| 1274 | Ga0207659_10432551 | |||
| 1275 | Ga0207659_11646914 | |||
| 1276 | Ga0207687_10083931 | |||
| 1277 | Ga0207687_10242184 | |||
| 1278 | Ga0207700_10160554 | |||
| 1279 | Ga0207664_10643095 | |||
| 1280 | Ga0207644_10153066 | |||
| 1281 | Ga0207644_10593401 | |||
| 1282 | Ga0207690_10016727 | |||
| 1283 | Ga0207690_10104565 | |||
| 1284 | Ga0207690_10588138 | |||
| 1285 | Ga0207706_10076066 | |||
| 1286 | Ga0207706_10146675 | |||
| 1287 | Ga0207706_10486327 | |||
| 1288 | Ga0207686_10043549 | |||
| 1289 | Ga0207686_10305124 | |||
| 1290 | Ga0207686_10305698 | |||
| 1291 | Ga0207686_10549491 | |||
| 1292 | Ga0207709_10032106 | |||
| 1293 | Ga0207709_10167732 | |||
| 1294 | Ga0207709_10416500 | |||
| 1295 | Ga0207709_11047307 | |||
| 1296 | Ga0207670_10127731 | |||
| 1297 | Ga0207669_10004221 | |||
| 1298 | Ga0207669_10008206 | |||
| 1299 | Ga0207669_10097072 | |||
| 1300 | Ga0207669_10103751 | |||
| 1301 | Ga0207669_10718933 | |||
| 1302 | Ga0207704_10002934 | |||
| 1303 | Ga0207704_10080985 | |||
| 1304 | Ga0207704_10087048 | |||
| 1305 | Ga0207704_10418379 | |||
| 1306 | Ga0207704_10635995 | |||
| 1307 | Ga0207704_11202475 | |||
| 1308 | Ga0207691_10014129 | |||
| 1309 | Ga0207691_10082563 | |||
| 1310 | Ga0207691_10083272 | |||
| 1311 | Ga0207691_11058283 | |||
| 1312 | Ga0207711_10141137 | |||
| 1313 | Ga0207711_10465986 | |||
| 1314 | Ga0207711_10613444 | |||
| 1315 | Ga0207711_10614988 | |||
| 1316 | Ga0207661_10002999 | |||
| 1317 | Ga0207661_10022183 | |||
| 1318 | Ga0207661_10040515 | |||
| 1319 | Ga0207661_10065551 | |||
| 1320 | Ga0207661_10100891 | |||
| 1321 | Ga0207661_10231259 | |||
| 1322 | Ga0207679_10288768 | |||
| 1323 | Ga0207679_10333562 | |||
| 1324 | Ga0207679_10846511 | |||
| 1325 | Ga0207667_10067979 | |||
| 1326 | Ga0207667_10620819 | |||
| 1327 | Ga0207651_10064789 | |||
| 1328 | Ga0207651_11969605 | |||
| 1329 | Ga0207712_10060574 | |||
| 1330 | Ga0207712_10385069 | |||
| 1331 | Ga0207668_10147531 | |||
| 1332 | Ga0207668_10874101 | |||
| 1333 | Ga0207668_11396214 | |||
| 1334 | Ga0207640_10090902 | |||
| 1335 | Ga0207640_10161678 | |||
| 1336 | Ga0207658_10485972 | |||
| 1337 | Ga0207677_10009728 | |||
| 1338 | Ga0207703_10312242 | |||
| 1339 | Ga0207639_10020860 | |||
| 1340 | Ga0207639_10109579 | |||
| 1341 | Ga0207639_11305115 | |||
| 1342 | Ga0207678_10078443 | |||
| 1343 | Ga0207678_10231275 | |||
| 1344 | Ga0207678_10272101 | |||
| 1345 | Ga0207708_10009052 | |||
| 1346 | Ga0207708_10016792 | |||
| 1347 | Ga0207708_10115045 | |||
| 1348 | Ga0207708_10154278 | |||
| 1349 | Ga0207708_10309352 | |||
| 1350 | Ga0207702_10403521 | |||
| 1351 | Ga0207702_10470775 | |||
| 1352 | Ga0207641_10024962 | |||
| 1353 | Ga0207648_10031419 | |||
| 1354 | Ga0207648_10074501 | |||
| 1355 | Ga0207648_10086712 | |||
| 1356 | Ga0207648_10098880 | |||
| 1357 | Ga0207648_10308984 | |||
| 1358 | Ga0207648_10339669 | |||
| 1359 | Ga0207676_10457957 | |||
| 1360 | Ga0207676_11201889 | |||
| 1361 | Ga0207676_11285140 | |||
| 1362 | Ga0207676_11353858 | |||
| 1363 | Ga0207674_10008436 | |||
| 1364 | Ga0207674_10089108 | |||
| 1365 | Ga0207674_10124602 | |||
| 1366 | Ga0207674_10731906 | |||
| 1367 | Ga0207674_11170921 | |||
| 1368 | Ga0207675_100012138 | |||
| 1369 | Ga0207675_100281132 | |||
| 1370 | Ga0207675_100354315 | |||
| 1371 | Ga0207683_10041737 | |||
| 1372 | Ga0207683_10052061 | |||
| 1373 | Ga0207683_10083122 | |||
| 1374 | Ga0207683_10088859 | |||
| 1375 | Ga0207683_10207753 | |||
| 1376 | Ga0207683_10372139 | |||
| 1377 | Ga0207698_10012965 | |||
| 1378 | Ga0207698_10211724 | |||
| 1379 | Ga0207698_10392084 | |||
| 1380 | Ga0207698_10475765 | |||
| 1381 | Ga0209966_1009539 | |||
| 1382 | Ga0207428_10000182 | |||
| 1383 | Ga0207428_10004674 | |||
| 1384 | Ga0207428_10043802 | |||
| 1385 | Ga0207428_10145146 | |||
| 1386 | Ga0207428_10372210 | |||
| 1387 | Ga0268266_10159286 | |||
| 1388 | Ga0268266_10609917 | |||
| 1389 | Ga0268266_10871562 | |||
| 1390 | Ga0268265_10824422 | |||
| 1391 | Ga0268264_10552574 | |||
| 1392 | Ga0268264_10859629 | |||
| 1393 | Ga0373958_0107076 | |||
| 1394 | Ga0373959_0024319 | |||
| 1395 | Ga0373938_0025163 | |||
| 1396 | Ga0373949_0149390 | |||
| 1397 | Ga0373951_0024993 | |||
| 1398 | Ga0373941_0109965 | |||
| 1399 | Ga0373960_0118726 | |||
| 1400 | Ga0373962_0033954 | |||
| 1401 | Ga0373931_0036572 | |||
| 1402 | Ga0373931_0083390 | |||
| 1403 | Ga0395900_0107916 | |||
| 1404 | Ga0395898_0678540 | |||
| 1405 | Ga0395905_0653979 | |||
| 1406 | Ga0451798_0487803 | |||
| 1407 | Ga0451802_1952470 | |||
| 1408 | Ga0451807_0983106 | |||
| 1409 | Ga0451837_1632252 | |||
| 1410 | Ga0451841_0648400 | |||
| 1411 | Ga0451851_0941692 | |||
| 1412 | Ga0451853_3647003 | |||
| 1413 | Ga0439450_059020 | |||
| 1414 | Ga0439456_039475 | |||
| 1415 | Ga0450920_139966 | |||
| 1416 | Ga0450923_113710 | |||
| 1417 | Ga0450910_011237 | |||
| 1418 | Ga0450908_013527 | |||
| 1419 | Ga0450909_022596 | |||
| 1420 | Ga0439460_0044232 | |||
| 1421 | Ga0495603_0004241 | |||
| 1422 | Ga0495603_0263388 | |||
| 1423 | Ga0495603_0292927 | |||
| 1424 | Ga0495629_0771018 | |||
| 1425 | Ga0495641_0217091 | |||
| 1426 | Ga0495584_0460577 | |||
| 1427 | Ga0495596_0310477 | |||
| 1428 | Ga0495608_0279095 | |||
| 1429 | Ga0495630_0180864 | |||
| 1430 | Ga0495656_0093347 | |||
| 1431 | Ga0495656_0098586 | |||
| 1432 | Ga0495656_0119501 | |||
| 1433 | Ga0495656_0236891 | |||
| 1434 | Ga0495611_0259371 | |||
| 1435 | Ga0495659_0124509 | |||
| 1436 | Ga0495613_0580137 | |||
| 1437 | Ga0495671_0192281 | |||
| 1438 | Ga0495600_0169641 | |||
| 1439 | Ga0495676_0662003 | |||
| 1440 | Ga0495680_0188120 | |||
| 1441 | Ga0496100_0207300 | |||
| 1442 | Ga0496100_0222726 | |||
| 1443 | Ga0496100_0362995 | |||
| 1444 | Ga0496100_0560276 | |||
| 1445 | Ga0496100_1065885 | |||
| 1446 | Ga0496101_0121798 | |||
| 1447 | Ga0496101_0197020 | |||
| 1448 | Ga0496101_0266367 | |||
| 1449 | Ga0496101_0657160 | |||
| 1450 | Ga0496101_1263006 | |||
| 1451 | Ga0496102_0402343 | |||
| 1452 | Ga0496102_0412187 | |||
| 1453 | Ga0496102_0609312 | |||
| 1454 | Ga0496102_0640894 | |||
| 1455 | Ga0496102_0681435 | |||
| 1456 | Ga0496104_0137647 | |||
| 1457 | Ga0496104_0294866 | |||
| 1458 | Ga0496104_0354260 | |||
| 1459 | Ga0496104_0874484 | |||
| 1460 | Ga0496105_0021535 | |||
| 1461 | Ga0496105_0405140 | |||
| 1462 | Ga0496105_0812217 | |||
| 1463 | Ga0496105_1352609 | |||
| 1464 | Ga0496106_0057354 | |||
| 1465 | Ga0496106_0126575 | |||
| 1466 | Ga0496106_0346597 | |||
| 1467 | Ga0496106_0493334 | |||
| 1468 | Ga0496107_0107876 | |||
| 1469 | Ga0496107_0606428 | |||
| 1470 | Ga0496108_0112814 | |||
| 1471 | Ga0496108_0149620 | |||
| 1472 | Ga0496108_0214356 | |||
| 1473 | Ga0496109_0014131 | |||
| 1474 | Ga0496109_0054583 | |||
| 1475 | Ga0496109_0287585 | |||
| 1476 | Ga0496109_0423088 | |||
| 1477 | Ga0496109_0791467 | |||
| 1478 | Ga0496110_0002723 | |||
| 1479 | Ga0496110_0111277 | |||
| 1480 | Ga0496110_0371875 | |||
| 1481 | Ga0496111_0004700 | |||
| 1482 | Ga0496111_0054273 | |||
| 1483 | Ga0496112_0033565 | |||
| 1484 | Ga0496112_0225146 | |||
| 1485 | Ga0496113_0146803 | |||
| 1486 | Ga0496113_0205511 | |||
| 1487 | Ga0496113_0818136 | |||
| 1488 | Ga0496113_1392695 | |||
| 1489 | Ga0496114_0004264 | |||
| 1490 | Ga0496114_0092774 | |||
| 1491 | Ga0496114_0186901 | |||
| 1492 | Ga0496114_0635317 | |||
| 1493 | Ga0501031_0028752 | |||
| 1494 | Ga0501031_0053839 | |||
| 1495 | Ga0501031_0074166 | |||
| 1496 | Ga0501031_0115393 | |||
| 1497 | Ga0501031_0165564 | |||
| 1498 | Ga0501031_0174717 | |||
| 1499 | Ga0501032_0091900 | |||
| 1500 | Ga0501033_0375815 | |||
| 1501 | Ga0501033_0851516 | |||
| 1502 | Ga0501034_0531603 | |||
| 1503 | Ga0501036_0043798 | |||
| 1504 | Ga0501036_0078821 | |||
| 1505 | Ga0501036_0148608 | |||
| 1506 | Ga0501036_0163752 | |||
| 1507 | Ga0501036_1147213 | |||
| 1508 | Ga0501036_1178229 | |||
| 1509 | Ga0501037_0050415 | |||
| 1510 | Ga0501037_0129685 | |||
| 1511 | Ga0501037_0363424 | |||
| 1512 | Ga0501038_0124336 | |||
| 1513 | Ga0501038_0220075 | |||
| 1514 | Ga0501038_0676190 | |||
| 1515 | Ga0501039_0002309 | |||
| 1516 | Ga0501039_0037345 | |||
| 1517 | Ga0501039_0061283 | |||
| 1518 | Ga0501039_0099926 | |||
| 1519 | Ga0501039_0211451 | |||
| 1520 | Ga0501039_0429560 | |||
| 1521 | Ga0501039_0639441 | |||
| 1522 | Ga0501039_1446790 | |||
| 1523 | Ga0501040_0016519 | |||
| 1524 | Ga0501040_0023610 | |||
| 1525 | Ga0501040_0076474 | |||
| 1526 | Ga0501040_0130947 | |||
| 1527 | Ga0501040_0157732 | |||
| 1528 | Ga0501040_0164859 | |||
| 1529 | Ga0501040_0250434 | |||
| 1530 | Ga0501040_0836382 | |||
| 1531 | Ga0501040_1192663 | |||
| 1532 | Ga0501041_0011087 | |||
| 1533 | Ga0501041_0054253 | |||
| 1534 | Ga0501041_0072499 | |||
| 1535 | Ga0501041_0102300 | |||
| 1536 | Ga0501041_0671791 | |||
| 1537 | Ga0501042_0053464 | |||
| 1538 | Ga0501042_0074499 | |||
| 1539 | Ga0501042_0084269 | |||
| 1540 | Ga0501042_0159529 | |||
| 1541 | Ga0501042_0218085 | |||
| 1542 | Ga0501042_0766233 | |||
| 1543 | Ga0501042_0773202 | |||
| 1544 | Ga0501042_1021243 | |||
| 1545 | Ga0501042_1031060 | |||
| 1546 | Ga0501043_0037569 | |||
| 1547 | Ga0501043_0188755 | |||
| 1548 | Ga0501043_0191363 | |||
| 1549 | Ga0501046_0107241 | |||
| 1550 | Ga0501048_0023789 | |||
| 1551 | Ga0501048_0289855 | |||
| 1552 | Ga0501048_0447915 | |||
| 1553 | Ga0501048_0777893 | |||
| 1554 | Ga0501048_1291979 | |||
| 1555 | Ga0501067_0004455 | |||
| 1556 | Ga0501067_0007376 | |||
| 1557 | Ga0501067_0068298 | |||
| 1558 | Ga0501067_0068733 | |||
| 1559 | Ga0501067_0075871 | |||
| 1560 | Ga0501067_0102125 | |||
| 1561 | Ga0501067_0248630 | |||
| 1562 | Ga0501067_0402327 | |||
| 1563 | Ga0501068_0011770 | |||
| 1564 | Ga0501068_0036794 | |||
| 1565 | Ga0501068_0129164 | |||
| 1566 | Ga0501068_0139167 | |||
| 1567 | Ga0501068_0193954 | |||
| 1568 | Ga0501068_0232862 | |||
| 1569 | Ga0501068_0271604 | |||
| 1570 | Ga0501068_0387208 | |||
| 1571 | Ga0501068_0409412 | |||
| 1572 | Ga0501069_0031116 | |||
| 1573 | Ga0501069_0051877 | |||
| 1574 | Ga0501069_0132156 | |||
| 1575 | Ga0501069_0147133 | |||
| 1576 | Ga0501069_0167943 | |||
| 1577 | Ga0501069_0250368 | |||
| 1578 | Ga0501069_0297073 | |||
| 1579 | Ga0501070_0051405 | |||
| 1580 | Ga0501070_0149068 | |||
| 1581 | Ga0501070_0247246 | |||
| 1582 | Ga0501070_0255232 | |||
| 1583 | Ga0501071_0002245 | |||
| 1584 | Ga0501071_0004277 | |||
| 1585 | Ga0501071_0009436 | |||
| 1586 | Ga0501071_0012338 | |||
| 1587 | Ga0501071_0036256 | |||
| 1588 | Ga0501071_0045371 | |||
| 1589 | Ga0501071_0057286 | |||
| 1590 | Ga0501071_0071598 | |||
| 1591 | Ga0501071_0161216 | |||
| 1592 | Ga0501071_0171946 | |||
| 1593 | Ga0501071_0227603 | |||
| 1594 | Ga0501071_0335825 | |||
| 1595 | Ga0501072_0003837 | |||
| 1596 | Ga0501072_0012115 | |||
| 1597 | Ga0501072_0054325 | |||
| 1598 | Ga0501072_0068466 | |||
| 1599 | Ga0501072_0068527 | |||
| 1600 | Ga0501072_0157059 | |||
| 1601 | Ga0501072_0180572 | |||
| 1602 | Ga0501072_0218104 | |||
| 1603 | Ga0501072_0402258 | |||
| 1604 | Ga0501072_0424921 | |||
| 1605 | Ga0501072_0599534 | |||
| 1606 | Ga0501072_1188680 | |||
| 1607 | Ga0501073_0139618 | |||
| 1608 | Ga0501073_0191679 | |||
| 1609 | Ga0501074_0033356 | |||
| 1610 | Ga0501074_0081168 | |||
| 1611 | Ga0501074_0094337 | |||
| 1612 | Ga0501074_0113865 | |||
| 1613 | Ga0501075_0005248 | |||
| 1614 | Ga0501075_0009806 | |||
| 1615 | Ga0501075_0010765 | |||
| 1616 | Ga0501075_0017260 | |||
| 1617 | Ga0501075_0040849 | |||
| 1618 | Ga0501075_0322965 | |||
| 1619 | Ga0501075_0400161 | |||
| 1620 | Ga0501075_0606772 | |||
| 1621 | Ga0501075_0757650 | |||
| 1622 | Ga0501076_0002314 | |||
| 1623 | Ga0501076_0007959 | |||
| 1624 | Ga0501076_0066641 | |||
| 1625 | Ga0501076_0075178 | |||
| 1626 | Ga0501076_0125720 | |||
| 1627 | Ga0501076_0127648 | |||
| 1628 | Ga0501076_0138656 | |||
| 1629 | Ga0501076_0251274 | |||
| 1630 | Ga0501076_0256895 | |||
| 1631 | Ga0501076_0396696 | |||
| 1632 | Ga0501076_0411384 | |||
| 1633 | Ga0501076_0639464 | |||
| 1634 | Ga0501076_0782803 | |||
| 1635 | Ga0501077_0004356 | |||
| 1636 | Ga0501077_0007601 | |||
| 1637 | Ga0501077_0016850 | |||
| 1638 | Ga0501077_0042247 | |||
| 1639 | Ga0501077_0054423 | |||
| 1640 | Ga0501077_0090297 | |||
| 1641 | Ga0501077_0135808 | |||
| 1642 | Ga0501077_0401938 | |||
| 1643 | Ga0501077_0492103 | |||
| 1644 | Ga0501077_0563172 | |||
| 1645 | Ga0501079_0031365 | |||
| 1646 | Ga0501079_0062495 | |||
| 1647 | Ga0501079_0159071 | |||
| 1648 | Ga0501079_0276533 | |||
| 1649 | Ga0501079_0323360 | |||
| 1650 | Ga0501079_0337058 | |||
| 1651 | Ga0501079_0391290 | |||
| 1652 | Ga0501079_0429164 | |||
| 1653 | Ga0501080_0075119 | |||
| 1654 | Ga0501080_0113570 | |||
| 1655 | Ga0501080_0140384 | |||
| 1656 | Ga0501080_0229878 | |||
| 1657 | Ga0501080_0290364 | |||
| 1658 | Ga0501080_0308136 | |||
| 1659 | Ga0501080_1130600 | |||
| 1660 | Ga0501081_0036523 | |||
| 1661 | Ga0501081_0053463 | |||
| 1662 | Ga0501081_0203370 | |||
| 1663 | Ga0501081_0362734 | |||
| 1664 | Ga0501081_0407918 | |||
| 1665 | Ga0501081_0480117 | |||
| 1666 | Ga0501081_0804385 | |||
| 1667 | Ga0501081_1090825 | |||
| 1668 | Ga0501081_1448850 | |||
| 1669 | Ga0501083_0050416 | |||
| 1670 | Ga0501083_0068002 | |||
| 1671 | Ga0501083_0143873 | |||
| 1672 | Ga0501083_0298502 | |||
| 1673 | Ga0501083_0318562 | |||
| 1674 | Ga0501083_0526051 | |||
| 1675 | Ga0501035_0103918 | |||
| 1676 | Ga0501035_0320261 | |||
| 1677 | Ga0501035_0417041 | |||
| 1678 | Ga0501035_1186043 | |||
| 1679 | Ga0501044_0337845 | |||
| 1680 | Ga0501044_0354209 | |||
| 1681 | Ga0501044_0740295 | |||
| 1682 | Ga0501044_1228718 | |||
| 1683 | Ga0501045_0034525 | |||
| 1684 | Ga0501045_0038764 | |||
| 1685 | Ga0501045_0107527 | |||
| 1686 | Ga0501045_0137945 | |||
| 1687 | Ga0501045_0289309 | |||
| 1688 | Ga0501045_0377291 | |||
| 1689 | Ga0501045_0510550 | |||
| 1690 | Ga0501045_0816313 | |||
| 1691 | Ga0501045_1269484 | |||
| 1692 | nmdc:mga00v17_461210_c1 | |||
| 1693 | nmdc:mga00v17_730000_c1 | |||
| 1694 | nmdc:mga0yw44_23334_c1 | |||
| 1695 | nmdc:mga0yw44_345972_c1 | |||
| 1696 | nmdc:mga06z11_47365_c1 | |||
| 1697 | nmdc:mga07m45_151811_c1 | |||
| 1698 | nmdc:mga05p37_1062534_c1 | |||
| 1699 | nmdc:mga05p37_1282851_c1 | |||
| 1700 | nmdc:mga05p37_382499_c1 | |||
| 1701 | nmdc:mga05p37_4869_c1 | |||
| 1702 | nmdc:mga05p37_51398_c1 | |||
| 1703 | nmdc:mga05p37_883951_c1 | |||
| 1704 | nmdc:mga09592_15473_c1 | |||
| 1705 | nmdc:mga09592_244227_c1 | |||
| 1706 | nmdc:mga09592_50568_c1 | |||
| 1707 | nmdc:mga0qj67_1379508_c1 | |||
| 1708 | nmdc:mga0qj67_42033_c1 | |||
| 1709 | nmdc:mga06r32_1018877_c1 | |||
| 1710 | nmdc:mga06r32_914339_c1 | |||
| 1711 | nmdc:mga08y16_101601_c1 | |||
| 1712 | nmdc:mga08y16_1126199_c1 | |||
| 1713 | nmdc:mga08y16_1389656_c1 | |||
| 1714 | nmdc:mga08y16_208207_c1 | |||
| 1715 | nmdc:mga08y16_263214_c1 | |||
| 1716 | nmdc:mga08y16_35472_c1 | |||
| 1717 | nmdc:mga08y16_46389_c1 | |||
| 1718 | nmdc:mga0n895_204572_c1 | |||
| 1719 | nmdc:mga0rr50_211747_c1 | |||
| 1720 | nmdc:mga08x19_37145_c1 | |||
| 1721 | nmdc:mga08x19_401802_c1 | |||
| 1722 | nmdc:mga0a205_238646_c1 | |||
| 1723 | nmdc:mga0a205_262793_c1 | |||
| 1724 | nmdc:mga0a205_32876_c1 | |||
| 1725 | nmdc:mga0a205_45334_c1 | |||
| 1726 | Ga0495612_0231312 | |||
| 1727 | Ga0495655_0009286 | |||
| 1728 | Ga0495655_0232803 | |||
| 1729 | Ga0495595_0123091 | |||
| 1730 | Ga0495619_0028835 | |||
| 1731 | Ga0495619_0030610 | |||
| 1732 | Ga0501084_0003923 | |||
| 1733 | Ga0501084_0022824 | |||
| 1734 | Ga0501084_0042241 | |||
| 1735 | Ga0501084_0052046 | |||
| 1736 | Ga0501084_0127882 | |||
| 1737 | Ga0501084_0155313 | |||
| 1738 | Ga0501084_0225520 | |||
| 1739 | Ga0501084_0247342 | |||
| 1740 | Ga0501084_1282324 | |||
| 1741 | Ga0590077_015646 | |||
| 1742 | Ga0501082_0010767 | |||
| 1743 | Ga0501082_0036270 | |||
| 1744 | Ga0501082_0169270 | |||
| 1745 | Ga0501082_0317566 | |||
| 1746 | Ga0501082_0344613 | |||
| 1747 | Ga0501082_0484496 | |||
| 1748 | Ga0501082_0527377 | |||
| 1749 | Ga0501082_1240888 | |||
| 1750 | Ga0530510_0011403 | |||
| 1751 | Ga0530510_0065167 | |||
| 1752 | Ga0530510_0069701 | |||
| 1753 | Ga0530510_0114401 | |||
| 1754 | Ga0530510_0157134 | |||
| 1755 | Ga0530510_0179991 | |||
| 1756 | Ga0530510_0278901 | |||
| 1757 | Ga0530510_0307144 | |||
| 1758 | Ga0530510_0312505 | |||
| 1759 | Ga0530510_0357698 | |||
| 1760 | Ga0530510_0423004 | |||
| 1761 | Ga0530510_0493630 | |||
| 1762 | Ga0530510_0498064 | |||
| 1763 | Ga0530510_0543095 | |||
| 1764 | 2512736769 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zbp-assembly1.cif.gz_B | crystal structure of the ampcpr-bound atnudt7 | 0.9133 | 109 | 162 |
| 4zbp-assembly2.cif.gz_C-2 | crystal structure of the ampcpr-bound atnudt7 | 0.9053 | 109 | 163 |
| 4zb3-assembly1.cif.gz_A-2 | crystal structure of the apo atnudt7 | 0.9041 | 111 | 163 |
| 4zbp-assembly1.cif.gz_A | crystal structure of the ampcpr-bound atnudt7 | 0.9015 | 109 | 161 |
| 4ava-assembly1.cif.gz_A | crystal structure of protein lysine acetyltransferase rv0998 from mycobacterium tuberculosis | 0.8637 | 55 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6QIS1_205_278_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9365 | 109 | 161 | 3.40.630.30 |
| af_K7M4C3_11_92_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9262 | 109 | 163 | 3.40.630.30 |
| af_A0A286YBP0_57_178_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9216 | 56 | 152 | 3.40.630.30 |
| 3v8hC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.901 | 125 | 161 | 3.30.572.10 |
| af_A0A0R0LDP2_1_100_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8683 | 96 | 161 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H0YEJ1-F1-model_v4 | Acetyltransferase (GNAT) family protein | 0.9844 | 60 | 163 |
GO:0016747
|
| AF-A0A7W2UQ04-F1-model_v4 | GNAT family N-acetyltransferase | 0.98 | 44 | 163 |
GO:0016747
|
| AF-A0A537THW4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9742 | 49 | 161 |
GO:0016747
|
| AF-A0A6G7EQY8-F1-model_v4 | deleted | 0.9733 | 56 | 161 |
|
| AF-A0A7U9X1B9-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9704 | 60 | 161 |
GO:0007064
GO:0016747 GO:0031415 |