F484566

General Info

Members Datasets Scaffolds Average Seq Length
882 293 1764 162

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0214390|Ga0501077_0214390_421_966
Length 181
Sequence VSADGADETSPIVVRRSGAQDVRFLRDMLHHAYYWKERAPEDTGPGPVALYVKAWGRPGDTAFVALDRGFPVGAAWYRLFDRERPGYGFVDERTPELAIAVVPNARGKGVGSALLDALLERARADGYPTLSLSVDRANAGAIELYERYGFQRISEDDDSVTMLAQLGTADSEAGKAGTDLS

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
110 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
202 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
206 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
207 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
208 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.11
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 6.24
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0214390 3300049593 Unclassified 1224
2 ARcpr5yngRDRAFT_c005018 3300000043 Bacteria 1232
3 ARSoilOldRDRAFT_c001352 3300000044 Bacteria 2286
4 ARCol0yngRDRAFT_1001892 3300000652 Bacteria 1638
5 JGI24746J21847_1013217 3300001977 Bacteria 1202
6 JGI24743J22301_10009270 3300001991 Bacteria 1740
7 JGI24738J21930_10014706 3300002075 Bacteria 1676
8 JGI24744J21845_10013288 3300002077 Bacteria 1660
9 JGI24033J26618_1021497 3300002155 Bacteria 829
10 JGI24751J29686_10037418 3300002459 Unclassified 1005
11 JGI25406J46586_10027104 3300003203 Bacteria 2201
12 Ga0070658_10158575 3300005327 Bacteria 1898
13 Ga0070658_10844338 3300005327 Unclassified 796
14 Ga0070676_10048048 3300005328 Bacteria 2495
15 Ga0070683_100014338 3300005329 Bacteria 6931
16 Ga0070683_100067023 3300005329 Bacteria 3343
17 Ga0070683_100080820 3300005329 Bacteria 3042
18 Ga0070683_100443926 3300005329 Bacteria 1238
19 Ga0070683_100865914 3300005329 Bacteria 866
20 Ga0070683_101866356 3300005329 Bacteria 578
21 Ga0070670_100099625 3300005331 Bacteria 2501
22 Ga0070670_100099819 3300005331 Unclassified 2498
23 Ga0070670_100198543 3300005331 Bacteria 1743
24 Ga0070670_100999263 3300005331 Bacteria 761
25 Ga0068869_101057902 3300005334 Unclassified 708
26 Ga0068869_101283365 3300005334 Bacteria 645
27 Ga0070680_100080674 3300005336 Bacteria 2683
28 Ga0070682_100002955 3300005337 Bacteria 9441
29 Ga0070682_100029872 3300005337 Bacteria 3285
30 Ga0070682_100299133 3300005337 Bacteria 1180
31 Ga0068868_100292900 3300005338 Bacteria 1380
32 Ga0068868_100592248 3300005338 Bacteria 981
33 Ga0068868_100910454 3300005338 Unclassified 800
34 Ga0068868_100917154 3300005338 Unclassified 797
35 Ga0070660_100004508 3300005339 Bacteria 9626
36 Ga0070660_100318707 3300005339 Bacteria 1277
37 Ga0070660_100550137 3300005339 Bacteria 963
38 Ga0070660_100595024 3300005339 Bacteria 924
39 Ga0070689_100003268 3300005340 Bacteria 10756
40 Ga0070689_100013139 3300005340 Bacteria 5984
41 Ga0070691_10020769 3300005341 Bacteria 3035
42 Ga0070691_10035413 3300005341 Bacteria 2350
43 Ga0070691_10281697 3300005341 Unclassified 902
44 Ga0070691_10496590 3300005341 Unclassified 705
45 Ga0070687_100415551 3300005343 Bacteria 886
46 Ga0070661_100164146 3300005344 Bacteria 1683
47 Ga0070661_100378316 3300005344 Bacteria 1116
48 Ga0070692_10027766 3300005345 Bacteria 2808
49 Ga0070692_10042579 3300005345 Bacteria 2332
50 Ga0070692_10212205 3300005345 Bacteria 1140
51 Ga0070692_10288182 3300005345 Bacteria 998
52 Ga0070692_10328705 3300005345 Unclassified 943
53 Ga0070668_100147535 3300005347 Bacteria 1899
54 Ga0070668_100215135 3300005347 Bacteria 1582
55 Ga0070668_100295249 3300005347 Bacteria 1358
56 Ga0070668_100377960 3300005347 Bacteria 1205
57 Ga0070668_100809529 3300005347 Bacteria 833
58 Ga0070669_100048593 3300005353 Bacteria 3097
59 Ga0070669_100592296 3300005353 Bacteria 928
60 Ga0070669_101238655 3300005353 Unclassified 645
61 Ga0070675_100030703 3300005354 Bacteria 4339
62 Ga0070675_100149606 3300005354 Bacteria 2001
63 Ga0070675_100507263 3300005354 Unclassified 1087
64 Ga0070671_100092764 3300005355 Bacteria 2530
65 Ga0070671_100189130 3300005355 Bacteria 1745
66 Ga0070674_100005773 3300005356 Bacteria 7181
67 Ga0070674_100083164 3300005356 Bacteria 2291
68 Ga0070674_100473040 3300005356 Bacteria 1038
69 Ga0070674_100920729 3300005356 Unclassified 763
70 Ga0070674_101244250 3300005356 Unclassified 662
71 Ga0070674_101357953 3300005356 Unclassified 635
72 Ga0070673_100085840 3300005364 Bacteria 2563
73 Ga0070673_100396342 3300005364 Bacteria 1233
74 Ga0070688_100013927 3300005365 Bacteria 4548
75 Ga0070688_100280190 3300005365 Unclassified 1197
76 Ga0070659_100028257 3300005366 Bacteria 4329
77 Ga0070659_100158733 3300005366 Bacteria 1848
78 Ga0070659_100162825 3300005366 Bacteria 1825
79 Ga0070667_100303834 3300005367 Unclassified 1437
80 Ga0070667_100337285 3300005367 Bacteria 1363
81 Ga0070667_100346255 3300005367 Bacteria 1345
82 Ga0070713_100111414 3300005436 Bacteria 2387
83 Ga0070701_10005472 3300005438 Bacteria 5252
84 Ga0070705_100052770 3300005440 Unclassified 2377
85 Ga0070705_100131077 3300005440 Bacteria 1635
86 Ga0070700_100036523 3300005441 Bacteria 2981
87 Ga0070700_100198843 3300005441 Bacteria 1407
88 Ga0070700_100302442 3300005441 Unclassified 1168
89 Ga0070700_100334931 3300005441 Bacteria 1116
90 Ga0070694_100960393 3300005444 Unclassified 708
91 Ga0070694_101222792 3300005444 Bacteria 630
92 Ga0070708_100232621 3300005445 Bacteria 1729
93 Ga0070708_101410230 3300005445 Bacteria 650
94 Ga0070663_100307192 3300005455 Bacteria 1271
95 Ga0070663_100585575 3300005455 Bacteria 936
96 Ga0070678_100029915 3300005456 Bacteria 3736
97 Ga0070678_100322347 3300005456 Unclassified 1320
98 Ga0070678_100343647 3300005456 Bacteria 1281
99 Ga0070678_100681471 3300005456 Bacteria 925
100 Ga0070678_100777680 3300005456 Unclassified 868
101 Ga0070678_101188099 3300005456 Bacteria 707
102 Ga0070678_101233867 3300005456 Bacteria 694
103 Ga0070662_100043493 3300005457 Bacteria 3214
104 Ga0070662_100206113 3300005457 Bacteria 1562
105 Ga0070662_100568096 3300005457 Bacteria 952
106 Ga0070681_10087248 3300005458 Bacteria 3073
107 Ga0070681_10146142 3300005458 Bacteria 2293
108 Ga0070681_10234818 3300005458 Bacteria 1748
109 Ga0068867_100157036 3300005459 Bacteria 1791
110 Ga0068867_100170140 3300005459 Bacteria 1725
111 Ga0068867_100213039 3300005459 Bacteria 1553
112 Ga0068867_100264384 3300005459 Bacteria 1404
113 Ga0068867_100356169 3300005459 Unclassified 1223
114 Ga0070685_10001814 3300005466 Bacteria 11125
115 Ga0070685_10101780 3300005466 Bacteria 1755
116 Ga0070685_10136313 3300005466 Unclassified 1540
117 Ga0070685_10729933 3300005466 Bacteria 725
118 Ga0070706_100467197 3300005467 Bacteria 1174
119 Ga0070679_100016201 3300005530 Bacteria 7180
120 Ga0070679_100157362 3300005530 Bacteria 2247
121 Ga0070684_100012482 3300005535 Bacteria 6811
122 Ga0070684_100044320 3300005535 Bacteria 3847
123 Ga0070684_100052498 3300005535 Bacteria 3546
124 Ga0070684_100265539 3300005535 Unclassified 1570
125 Ga0070684_100277563 3300005535 Bacteria 1535
126 Ga0070684_100335978 3300005535 Bacteria 1388
127 Ga0068853_100012062 3300005539 Bacteria 7032
128 Ga0068853_100206077 3300005539 Bacteria 1791
129 Ga0068853_100910416 3300005539 Unclassified 845
130 Ga0070672_100127249 3300005543 Bacteria 2090
131 Ga0070672_100142824 3300005543 Unclassified 1976
132 Ga0070672_100157034 3300005543 Bacteria 1885
133 Ga0070672_101039204 3300005543 Bacteria 727
134 Ga0070686_100096141 3300005544 Bacteria 1991
135 Ga0070686_100256627 3300005544 Bacteria 1279
136 Ga0070695_100347747 3300005545 Bacteria 1110
137 Ga0070695_100373740 3300005545 Bacteria 1074
138 Ga0070696_100089054 3300005546 Bacteria 2194
139 Ga0070696_100398958 3300005546 Bacteria 1076
140 Ga0070693_100122649 3300005547 Bacteria 1614
141 Ga0070665_100009113 3300005548 Bacteria 10052
142 Ga0070665_100043729 3300005548 Bacteria 4500
143 Ga0070665_100367312 3300005548 Bacteria 1445
144 Ga0070704_100159448 3300005549 Unclassified 1783
145 Ga0070704_100201049 3300005549 Bacteria 1608
146 Ga0070704_100323659 3300005549 Bacteria 1293
147 Ga0070704_100584666 3300005549 Bacteria 980
148 Ga0068855_100510298 3300005563 Bacteria 1306
149 Ga0070664_100038772 3300005564 Bacteria 4012
150 Ga0070664_100039753 3300005564 Bacteria 3964
151 Ga0070664_100084164 3300005564 Bacteria 2745
152 Ga0070664_100136314 3300005564 Bacteria 2159
153 Ga0070664_100161106 3300005564 Bacteria 1985
154 Ga0068857_100073251 3300005577 Bacteria 3052
155 Ga0068857_100105311 3300005577 Bacteria 2533
156 Ga0068857_100142944 3300005577 Bacteria 2164
157 Ga0068857_100849296 3300005577 Bacteria 874
158 Ga0068854_100000733 3300005578 Bacteria 19454
159 Ga0068854_100561477 3300005578 Bacteria 970
160 Ga0068854_100807885 3300005578 Bacteria 818
161 Ga0068856_100027626 3300005614 Bacteria 5536
162 Ga0068856_100314761 3300005614 Bacteria 1583
163 Ga0070702_100016951 3300005615 Bacteria 3749
164 Ga0070702_100018802 3300005615 Bacteria 3591
165 Ga0070702_100092106 3300005615 Bacteria 1840
166 Ga0070702_100361310 3300005615 Bacteria 1026
167 Ga0070702_100428950 3300005615 Bacteria 953
168 Ga0068852_100015804 3300005616 Bacteria 5868
169 Ga0068852_100336571 3300005616 Bacteria 1470
170 Ga0068852_100373748 3300005616 Bacteria 1397
171 Ga0068852_100396359 3300005616 Bacteria 1357
172 Ga0068859_100019963 3300005617 Bacteria 6727
173 Ga0068864_100068183 3300005618 Bacteria 3090
174 Ga0068864_100086793 3300005618 Bacteria 2753
175 Ga0068864_100884089 3300005618 Bacteria 882
176 Ga0068864_102007088 3300005618 Unclassified 585
177 Ga0068866_10145709 3300005718 Unclassified 1365
178 Ga0068866_10180826 3300005718 Bacteria 1245
179 Ga0068866_10206856 3300005718 Unclassified 1176
180 Ga0068861_100022669 3300005719 Bacteria 4527
181 Ga0068861_100109160 3300005719 Bacteria 2214
182 Ga0068861_100571811 3300005719 Unclassified 1033
183 Ga0068851_10059139 3300005834 Bacteria 1960
184 Ga0068851_10131435 3300005834 Bacteria 1354
185 Ga0068870_10010973 3300005840 Bacteria 4185
186 Ga0068870_10171041 3300005840 Bacteria 1297
187 Ga0068870_10207457 3300005840 Bacteria 1191
188 Ga0068870_10220932 3300005840 Unclassified 1160
189 Ga0068863_100822475 3300005841 Unclassified 927
190 Ga0068863_100885265 3300005841 Bacteria 893
191 Ga0068858_100055946 3300005842 Bacteria 3646
192 Ga0068860_100055188 3300005843 Bacteria 3776
193 Ga0068860_100060241 3300005843 Bacteria 3608
194 Ga0068862_100281668 3300005844 Bacteria 1524
195 Ga0068862_100362983 3300005844 Bacteria 1346
196 Ga0068862_100743037 3300005844 Unclassified 954
197 Ga0081455_10059370 3300005937 Bacteria 3230
198 Ga0081455_10110317 3300005937 Bacteria 2187
199 Ga0081455_10147820 3300005937 Bacteria 1815
200 Ga0081455_10239880 3300005937 Archaea 1333
201 Ga0081455_10285172 3300005937 Bacteria 1191
202 Ga0081538_10096014 3300005981 Bacteria 1512
203 Ga0081539_10001668 3300005985 Bacteria 35937
204 Ga0081539_10163107 3300005985 Unclassified 1060
205 Ga0070717_10135591 3300006028 Bacteria 2120
206 Ga0075365_10305614 3300006038 Bacteria 1120
207 Ga0075364_10338952 3300006051 Bacteria 1024
208 Ga0075432_10003705 3300006058 Bacteria 5204
209 Ga0075432_10006589 3300006058 Bacteria 3954
210 Ga0075432_10199018 3300006058 Bacteria 792
211 Ga0075367_10035025 3300006178 Bacteria 2903
212 Ga0097621_100027230 3300006237 Bacteria 4493
213 Ga0097621_101115426 3300006237 Bacteria 741
214 Ga0075370_10115385 3300006353 Bacteria 1561
215 Ga0068871_100072115 3300006358 Bacteria 2843
216 Ga0068871_100072172 3300006358 Bacteria 2842
217 Ga0068871_100198568 3300006358 Bacteria 1731
218 Ga0068871_101106631 3300006358 Unclassified 741
219 Ga0075428_100005456 3300006844 Bacteria 14141
220 Ga0075428_100025085 3300006844 Bacteria 6596
221 Ga0075428_100075303 3300006844 Unclassified 3686
222 Ga0075430_100008652 3300006846 Bacteria 8586
223 Ga0075430_100304582 3300006846 Bacteria 1318
224 Ga0075431_100007107 3300006847 Bacteria 11121
225 Ga0075433_10009902 3300006852 Bacteria 7644
226 Ga0075433_10151165 3300006852 Bacteria 2065
227 Ga0075433_10354261 3300006852 Bacteria 1297
228 Ga0075433_10455106 3300006852 Bacteria 1128
229 Ga0075433_10502656 3300006852 Bacteria 1067
230 Ga0075434_100009715 3300006871 Bacteria 8989
231 Ga0075434_100460253 3300006871 Bacteria 1293
232 Ga0075434_100690988 3300006871 Bacteria 1038
233 Ga0075434_101435783 3300006871 Bacteria 700
234 Ga0075429_100048042 3300006880 Bacteria 3712
235 Ga0075429_100114773 3300006880 Bacteria 2355
236 Ga0068865_100027255 3300006881 Bacteria 3772
237 Ga0068865_100107288 3300006881 Bacteria 2054
238 Ga0068865_100331915 3300006881 Unclassified 1226
239 Ga0075436_100112305 3300006914 Bacteria 1903
240 Ga0075436_100197299 3300006914 Bacteria 1425
241 Ga0097620_100019965 3300006931 Bacteria 6727
242 Ga0075435_100228304 3300007076 Bacteria 1581
243 Ga0105240_10582900 3300009093 Bacteria 1234
244 Ga0111539_10004926 3300009094 Bacteria 17376
245 Ga0111539_10032849 3300009094 Bacteria 6302
246 Ga0111539_10075810 3300009094 Bacteria 3961
247 Ga0111539_10185772 3300009094 Bacteria 2427
248 Ga0111539_11243392 3300009094 Bacteria 864
249 Ga0111539_13498994 3300009094 Unclassified 504
250 Ga0105245_10018022 3300009098 Bacteria 6167
251 Ga0105245_10025179 3300009098 Bacteria 5232
252 Ga0105245_10300692 3300009098 Bacteria 1574
253 Ga0105245_10312498 3300009098 Bacteria 1546
254 Ga0105247_10022525 3300009101 Bacteria 3794
255 Ga0114129_10033398 3300009147 Bacteria 7271
256 Ga0114129_10034656 3300009147 Bacteria 7130
257 Ga0114129_10050237 3300009147 Bacteria 5858
258 Ga0114129_10783633 3300009147 Bacteria 1218
259 Ga0114129_10931103 3300009147 Bacteria 1099
260 Ga0114129_11024972 3300009147 Bacteria 1038
261 Ga0114129_11045822 3300009147 Unclassified 1025
262 Ga0114129_11397754 3300009147 Bacteria 864
263 Ga0105243_10003687 3300009148 Bacteria 12317
264 Ga0105243_10046271 3300009148 Bacteria 3422
265 Ga0105243_10051072 3300009148 Bacteria 3269
266 Ga0105243_10129934 3300009148 Unclassified 2135
267 Ga0105243_10188044 3300009148 Bacteria 1801
268 Ga0105243_11024068 3300009148 Bacteria 830
269 Ga0105243_11040867 3300009148 Bacteria 823
270 Ga0105243_12540004 3300009148 Unclassified 552
271 Ga0105241_10443426 3300009174 Bacteria 1147
272 Ga0105241_10449603 3300009174 Bacteria 1139
273 Ga0105242_10055142 3300009176 Bacteria 3252
274 Ga0105242_10061082 3300009176 Unclassified 3099
275 Ga0105242_10086218 3300009176 Bacteria 2635
276 Ga0105242_10099562 3300009176 Bacteria 2461
277 Ga0105248_10079530 3300009177 Bacteria 3685
278 Ga0105248_10152339 3300009177 Unclassified 2609
279 Ga0105248_10161761 3300009177 Bacteria 2525
280 Ga0105248_10763938 3300009177 Bacteria 1091
281 Ga0105238_10054647 3300009551 Bacteria 4009
282 Ga0105238_10458426 3300009551 Bacteria 1272
283 Ga0105238_10528912 3300009551 Unclassified 1182
284 Ga0105249_10173156 3300009553 Unclassified 2094
285 Ga0105249_10548222 3300009553 Bacteria 1207
286 Ga0105239_10042798 3300010375 Bacteria 4962
287 Ga0105239_10057264 3300010375 Bacteria 4275
288 Ga0105239_10064888 3300010375 Bacteria 4009
289 Ga0105239_10150408 3300010375 Bacteria 2598
290 Ga0105239_10769590 3300010375 Bacteria 1102
291 Ga0105246_10009345 3300011119 Bacteria 6041
292 Ga0105246_10018955 3300011119 Bacteria 4389
293 Ga0105246_10042363 3300011119 Unclassified 3083
294 Ga0105246_10130894 3300011119 Bacteria 1874
295 Ga0105246_10234386 3300011119 Bacteria 1447
296 Ga0157320_1003077 3300012481 Bacteria 990
297 Ga0157343_1012390 3300012488 Unclassified 674
298 Ga0157373_10564470 3300013100 Bacteria 826
299 Ga0157371_10018835 3300013102 Bacteria 5099
300 Ga0157371_10139580 3300013102 Bacteria 1726
301 Ga0157369_10076861 3300013105 Bacteria 3579
302 Ga0157369_10095079 3300013105 Bacteria 3180
303 Ga0157374_10167627 3300013296 Bacteria 2141
304 Ga0157374_10354160 3300013296 Unclassified 1459
305 Ga0157374_10571524 3300013296 Bacteria 1139
306 Ga0157374_11066579 3300013296 Bacteria 828
307 Ga0157378_10699787 3300013297 Bacteria 1033
308 Ga0157378_10855962 3300013297 Unclassified 938
309 Ga0163162_10137707 3300013306 Bacteria 2553
310 Ga0163162_10327464 3300013306 Bacteria 1664
311 Ga0157372_10180470 3300013307 Bacteria 2444
312 Ga0157372_10238730 3300013307 Unclassified 2109
313 Ga0157372_10460794 3300013307 Bacteria 1482
314 Ga0157372_10824332 3300013307 Bacteria 1077
315 Ga0157375_10015281 3300013308 Bacteria 6870
316 Ga0157375_10156139 3300013308 Unclassified 2421
317 Ga0157375_10212095 3300013308 Bacteria 2094
318 Ga0157375_10304954 3300013308 Bacteria 1756
319 Ga0157375_11475020 3300013308 Unclassified 802
320 Ga0163163_10131791 3300014325 Unclassified 2540
321 Ga0163163_10202453 3300014325 Unclassified 2034
322 Ga0163163_10321156 3300014325 Bacteria 1602
323 Ga0163163_10455165 3300014325 Bacteria 1340
324 Ga0163163_10510744 3300014325 Bacteria 1264
325 Ga0157380_10045029 3300014326 Bacteria 3460
326 Ga0157380_10228053 3300014326 Bacteria 1671
327 Ga0157380_10708197 3300014326 Bacteria 1013
328 Ga0157380_11766161 3300014326 Unclassified 677
329 Ga0157377_10032230 3300014745 Bacteria 2852
330 Ga0157377_10076686 3300014745 Bacteria 1944
331 Ga0157377_10095813 3300014745 Bacteria 1760
332 Ga0157377_10118232 3300014745 Bacteria 1603
333 Ga0157377_10691686 3300014745 Bacteria 739
334 Ga0157379_10050323 3300014968 Bacteria 3719
335 Ga0157376_10169324 3300014969 Bacteria 1987
336 Ga0157376_10399425 3300014969 Unclassified 1329
337 Ga0157376_10538827 3300014969 Unclassified 1153
338 Ga0157376_10867031 3300014969 Unclassified 919
339 Ga0163161_10197907 3300017792 Bacteria 1547
340 Ga0163161_10296950 3300017792 Unclassified 1271
341 Ga0163161_10935049 3300017792 Unclassified 736
342 Ga0206356_11798710 3300020070 Bacteria 1033
343 Ga0207656_10021960 3300025321 Bacteria 2556
344 Ga0207656_10094864 3300025321 Bacteria 1360
345 Ga0207642_10277838 3300025899 Bacteria 962
346 Ga0207642_10475433 3300025899 Bacteria 761
347 Ga0207642_10581250 3300025899 Unclassified 695
348 Ga0207642_10742156 3300025899 Bacteria 621
349 Ga0207688_10002457 3300025901 Bacteria 9965
350 Ga0207688_10010697 3300025901 Bacteria 4992
351 Ga0207688_10015530 3300025901 Bacteria 4130
352 Ga0207688_10023099 3300025901 Bacteria 3403
353 Ga0207688_10053859 3300025901 Bacteria 2256
354 Ga0207680_10151839 3300025903 Bacteria 1545
355 Ga0207645_10022205 3300025907 Bacteria 4131
356 Ga0207645_10041880 3300025907 Bacteria 2930
357 Ga0207643_10004905 3300025908 Bacteria 7162
358 Ga0207643_10022336 3300025908 Bacteria 3482
359 Ga0207643_10042105 3300025908 Bacteria 2574
360 Ga0207643_10063949 3300025908 Bacteria 2105
361 Ga0207643_10074109 3300025908 Bacteria 1963
362 Ga0207705_10074417 3300025909 Bacteria 2465
363 Ga0207684_10368013 3300025910 Bacteria 1237
364 Ga0207707_10798666 3300025912 Unclassified 786
365 Ga0207695_10786648 3300025913 Bacteria 831
366 Ga0207693_10110009 3300025915 Bacteria 2161
367 Ga0207660_10054917 3300025917 Bacteria 2844
368 Ga0207660_10135890 3300025917 Bacteria 1876
369 Ga0207660_10209699 3300025917 Bacteria 1525
370 Ga0207660_10282238 3300025917 Bacteria 1318
371 Ga0207662_10050876 3300025918 Bacteria 2463
372 Ga0207657_10003231 3300025919 Bacteria 17441
373 Ga0207657_10167102 3300025919 Bacteria 1784
374 Ga0207657_10313599 3300025919 Bacteria 1241
375 Ga0207657_10394964 3300025919 Bacteria 1088
376 Ga0207649_10011072 3300025920 Bacteria 4964
377 Ga0207649_10096500 3300025920 Bacteria 1948
378 Ga0207649_10141207 3300025920 Bacteria 1648
379 Ga0207649_10696631 3300025920 Bacteria 788
380 Ga0207652_10020767 3300025921 Bacteria 5412
381 Ga0207652_10107753 3300025921 Bacteria 2468
382 Ga0207652_10209922 3300025921 Bacteria 1753
383 Ga0207652_10726164 3300025921 Bacteria 885
384 Ga0207681_10490839 3300025923 Bacteria 1004
385 Ga0207681_11287510 3300025923 Unclassified 614
386 Ga0207694_10167893 3300025924 Bacteria 1775
387 Ga0207694_10279326 3300025924 Bacteria 1371
388 Ga0207650_10053248 3300025925 Bacteria 2999
389 Ga0207650_10066591 3300025925 Bacteria 2701
390 Ga0207650_10079173 3300025925 Bacteria 2488
391 Ga0207659_10242273 3300025926 Bacteria 1459
392 Ga0207659_10432551 3300025926 Bacteria 1105
393 Ga0207659_11646914 3300025926 Unclassified 547
394 Ga0207687_10083931 3300025927 Bacteria 2308
395 Ga0207687_10242184 3300025927 Bacteria 1430
396 Ga0207700_10160554 3300025928 Bacteria 1866
397 Ga0207664_10643095 3300025929 Bacteria 953
398 Ga0207644_10153066 3300025931 Bacteria 1786
399 Ga0207644_10593401 3300025931 Bacteria 919
400 Ga0207690_10016727 3300025932 Bacteria 4468
401 Ga0207690_10104565 3300025932 Bacteria 2029
402 Ga0207690_10588138 3300025932 Bacteria 908
403 Ga0207706_10076066 3300025933 Bacteria 2953
404 Ga0207706_10146675 3300025933 Bacteria 2076
405 Ga0207706_10486327 3300025933 Bacteria 1066
406 Ga0207686_10043549 3300025934 Unclassified 2751
407 Ga0207686_10305124 3300025934 Bacteria 1184
408 Ga0207686_10305698 3300025934 Bacteria 1183
409 Ga0207686_10549491 3300025934 Bacteria 903
410 Ga0207709_10032106 3300025935 Bacteria 3073
411 Ga0207709_10167732 3300025935 Unclassified 1538
412 Ga0207709_10416500 3300025935 Bacteria 1031
413 Ga0207709_11047307 3300025935 Bacteria 668
414 Ga0207670_10127731 3300025936 Bacteria 1857
415 Ga0207669_10004221 3300025937 Bacteria 6302
416 Ga0207669_10008206 3300025937 Bacteria 4892
417 Ga0207669_10097072 3300025937 Bacteria 1936
418 Ga0207669_10103751 3300025937 Unclassified 1887
419 Ga0207669_10718933 3300025937 Bacteria 822
420 Ga0207704_10002934 3300025938 Bacteria 7699
421 Ga0207704_10080985 3300025938 Bacteria 2098
422 Ga0207704_10087048 3300025938 Bacteria 2039
423 Ga0207704_10418379 3300025938 Bacteria 1062
424 Ga0207704_10635995 3300025938 Unclassified 877
425 Ga0207704_11202475 3300025938 Unclassified 646
426 Ga0207691_10014129 3300025940 Bacteria 7617
427 Ga0207691_10082563 3300025940 Bacteria 2886
428 Ga0207691_10083272 3300025940 Bacteria 2872
429 Ga0207691_11058283 3300025940 Bacteria 676
430 Ga0207711_10141137 3300025941 Bacteria 2168
431 Ga0207711_10465986 3300025941 Bacteria 1177
432 Ga0207711_10613444 3300025941 Bacteria 1015
433 Ga0207711_10614988 3300025941 Unclassified 1014
434 Ga0207661_10002999 3300025944 Bacteria 11675
435 Ga0207661_10022183 3300025944 Bacteria 4775
436 Ga0207661_10040515 3300025944 Bacteria 3662
437 Ga0207661_10065551 3300025944 Bacteria 2949
438 Ga0207661_10100891 3300025944 Bacteria 2423
439 Ga0207661_10231259 3300025944 Bacteria 1637
440 Ga0207679_10288768 3300025945 Bacteria 1409
441 Ga0207679_10333562 3300025945 Bacteria 1317
442 Ga0207679_10846511 3300025945 Unclassified 835
443 Ga0207667_10067979 3300025949 Bacteria 3711
444 Ga0207667_10620819 3300025949 Bacteria 1089
445 Ga0207651_10064789 3300025960 Bacteria 2559
446 Ga0207651_11969605 3300025960 Unclassified 525
447 Ga0207712_10060574 3300025961 Bacteria 2684
448 Ga0207712_10385069 3300025961 Unclassified 1175
449 Ga0207668_10147531 3300025972 Unclassified 1817
450 Ga0207668_10874101 3300025972 Unclassified 799
451 Ga0207668_11396214 3300025972 Unclassified 631
452 Ga0207640_10090902 3300025981 Bacteria 2113
453 Ga0207640_10161678 3300025981 Bacteria 1658
454 Ga0207658_10485972 3300025986 Unclassified 1098
455 Ga0207677_10009728 3300026023 Bacteria 5415
456 Ga0207703_10312242 3300026035 Bacteria 1437
457 Ga0207639_10020860 3300026041 Bacteria 4698
458 Ga0207639_10109579 3300026041 Bacteria 2247
459 Ga0207639_11305115 3300026041 Bacteria 681
460 Ga0207678_10078443 3300026067 Bacteria 2828
461 Ga0207678_10231275 3300026067 Unclassified 1583
462 Ga0207678_10272101 3300026067 Bacteria 1453
463 Ga0207708_10009052 3300026075 Bacteria 7366
464 Ga0207708_10016792 3300026075 Bacteria 5510
465 Ga0207708_10115045 3300026075 Bacteria 2091
466 Ga0207708_10154278 3300026075 Bacteria 1810
467 Ga0207708_10309352 3300026075 Bacteria 1287
468 Ga0207702_10403521 3300026078 Bacteria 1319
469 Ga0207702_10470775 3300026078 Bacteria 1221
470 Ga0207641_10024962 3300026088 Bacteria 4929
471 Ga0207648_10031419 3300026089 Bacteria 4696
472 Ga0207648_10074501 3300026089 Bacteria 2958
473 Ga0207648_10086712 3300026089 Unclassified 2731
474 Ga0207648_10098880 3300026089 Bacteria 2555
475 Ga0207648_10308984 3300026089 Unclassified 1419
476 Ga0207648_10339669 3300026089 Bacteria 1352
477 Ga0207676_10457957 3300026095 Bacteria 1204
478 Ga0207676_11201889 3300026095 Unclassified 751
479 Ga0207676_11285140 3300026095 Bacteria 726
480 Ga0207676_11353858 3300026095 Bacteria 707
481 Ga0207674_10008436 3300026116 Bacteria 11903
482 Ga0207674_10089108 3300026116 Bacteria 3078
483 Ga0207674_10124602 3300026116 Bacteria 2542
484 Ga0207674_10731906 3300026116 Bacteria 955
485 Ga0207674_11170921 3300026116 Bacteria 738
486 Ga0207675_100012138 3300026118 Bacteria 8048
487 Ga0207675_100281132 3300026118 Bacteria 1617
488 Ga0207675_100354315 3300026118 Unclassified 1439
489 Ga0207683_10041737 3300026121 Bacteria 4006
490 Ga0207683_10052061 3300026121 Bacteria 3587
491 Ga0207683_10083122 3300026121 Bacteria 2845
492 Ga0207683_10088859 3300026121 Bacteria 2750
493 Ga0207683_10207753 3300026121 Bacteria 1781
494 Ga0207683_10372139 3300026121 Bacteria 1313
495 Ga0207698_10012965 3300026142 Bacteria 5481
496 Ga0207698_10211724 3300026142 Bacteria 1744
497 Ga0207698_10392084 3300026142 Bacteria 1324
498 Ga0207698_10475765 3300026142 Unclassified 1211
499 Ga0209966_1009539 3300027695 Bacteria 1735
500 Ga0207428_10000182 3300027907 Bacteria 88012
501 Ga0207428_10004674 3300027907 Bacteria 12977
502 Ga0207428_10043802 3300027907 Bacteria 3613
503 Ga0207428_10145146 3300027907 Bacteria 1809
504 Ga0207428_10372210 3300027907 Bacteria 1049
505 Ga0268266_10159286 3300028379 Bacteria 2041
506 Ga0268266_10609917 3300028379 Unclassified 1049
507 Ga0268266_10871562 3300028379 Bacteria 870
508 Ga0268265_10824422 3300028380 Bacteria 906
509 Ga0268264_10552574 3300028381 Unclassified 1129
510 Ga0268264_10859629 3300028381 Bacteria 909
511 Ga0373958_0107076 3300034819 Bacteria 662
512 Ga0373959_0024319 3300034820 Bacteria 1183
513 Ga0373938_0025163 3300034957 Bacteria 1237
514 Ga0373949_0149390 3300035090 Bacteria 675
515 Ga0373951_0024993 3300035091 Bacteria 1386
516 Ga0373941_0109965 3300035115 Bacteria 970
517 Ga0373960_0118726 3300035121 Bacteria 875
518 Ga0373962_0033954 3300035242 Bacteria 1411
519 Ga0373931_0036572 3300035691 Bacteria 2560
520 Ga0373931_0083390 3300035691 Bacteria 1768
521 Ga0395900_0107916 3300037418 Unclassified 2860
522 Ga0395898_0678540 3300037466 Bacteria 972
523 Ga0395905_0653979 3300037471 Bacteria 953
524 Ga0451798_0487803 3300041458 Bacteria 736
525 Ga0451802_1952470 3300041460 Unclassified 537
526 Ga0451807_0983106 3300041486 Bacteria 629
527 Ga0451837_1632252 3300041494 Unclassified 641
528 Ga0451841_0648400 3300041498 Unclassified 556
529 Ga0451851_0941692 3300041507 Bacteria 1267
530 Ga0451853_3647003 3300041512 Unclassified 584
531 Ga0439450_059020 3300042008 Bacteria 924
532 Ga0439456_039475 3300042013 Bacteria 1022
533 Ga0450920_139966 3300042122 Unclassified 512
534 Ga0450923_113710 3300042125 Bacteria 634
535 Ga0450910_011237 3300042147 Bacteria 1283
536 Ga0450908_013527 3300042184 Bacteria 1472
537 Ga0450909_022596 3300042185 Bacteria 942
538 Ga0439460_0044232 3300042461 Bacteria 1318
539 Ga0495603_0004241 3300046455 Bacteria 8537
540 Ga0495603_0263388 3300046455 Archaea 992
541 Ga0495603_0292927 3300046455 Bacteria 935
542 Ga0495629_0771018 3300046459 Bacteria 636
543 Ga0495641_0217091 3300046461 Bacteria 858
544 Ga0495584_0460577 3300046491 Bacteria 647
545 Ga0495596_0310477 3300046500 Bacteria 613
546 Ga0495608_0279095 3300046511 Bacteria 1037
547 Ga0495630_0180864 3300046517 Bacteria 1608
548 Ga0495656_0093347 3300046615 Bacteria 1380
549 Ga0495656_0098586 3300046615 Bacteria 1348
550 Ga0495656_0119501 3300046615 Bacteria 1242
551 Ga0495656_0236891 3300046615 Bacteria 918
552 Ga0495611_0259371 3300046648 Bacteria 805
553 Ga0495659_0124509 3300046664 Bacteria 1018
554 Ga0495613_0580137 3300046689 Bacteria 748
555 Ga0495671_0192281 3300046692 Bacteria 991
556 Ga0495600_0169641 3300046809 Bacteria 1409
557 Ga0495676_0662003 3300047321 Bacteria 677
558 Ga0495680_0188120 3300047322 Bacteria 1486
559 Ga0496100_0207300 3300048903 Bacteria 1432
560 Ga0496100_0222726 3300048903 Bacteria 1385
561 Ga0496100_0362995 3300048903 Bacteria 1096
562 Ga0496100_0560276 3300048903 Unclassified 885
563 Ga0496100_1065885 3300048903 Bacteria 637
564 Ga0496101_0121798 3300048904 Bacteria 1973
565 Ga0496101_0197020 3300048904 Bacteria 1556
566 Ga0496101_0266367 3300048904 Bacteria 1337
567 Ga0496101_0657160 3300048904 Bacteria 828
568 Ga0496101_1263006 3300048904 Bacteria 578
569 Ga0496102_0402343 3300048905 Bacteria 1287
570 Ga0496102_0412187 3300048905 Bacteria 1269
571 Ga0496102_0609312 3300048905 Bacteria 1015
572 Ga0496102_0640894 3300048905 Bacteria 986
573 Ga0496102_0681435 3300048905 Bacteria 951
574 Ga0496104_0137647 3300048907 Bacteria 2346
575 Ga0496104_0294866 3300048907 Bacteria 1534
576 Ga0496104_0354260 3300048907 Unclassified 1380
577 Ga0496104_0874484 3300048907 Unclassified 804
578 Ga0496105_0021535 3300048908 Bacteria 5216
579 Ga0496105_0405140 3300048908 Unclassified 1082
580 Ga0496105_0812217 3300048908 Bacteria 710
581 Ga0496105_1352609 3300048908 Bacteria 518
582 Ga0496106_0057354 3300048909 Bacteria 2945
583 Ga0496106_0126575 3300048909 Bacteria 2001
584 Ga0496106_0346597 3300048909 Bacteria 1193
585 Ga0496106_0493334 3300048909 Unclassified 984
586 Ga0496107_0107876 3300048910 Bacteria 2045
587 Ga0496107_0606428 3300048910 Bacteria 809
588 Ga0496108_0112814 3300048911 Bacteria 2326
589 Ga0496108_0149620 3300048911 Bacteria 2014
590 Ga0496108_0214356 3300048911 Bacteria 1672
591 Ga0496109_0014131 3300048912 Bacteria 6939
592 Ga0496109_0054583 3300048912 Bacteria 3645
593 Ga0496109_0287585 3300048912 Bacteria 1549
594 Ga0496109_0423088 3300048912 Bacteria 1258
595 Ga0496109_0791467 3300048912 Unclassified 886
596 Ga0496110_0002723 3300048913 Bacteria 13347
597 Ga0496110_0111277 3300048913 Bacteria 2461
598 Ga0496110_0371875 3300048913 Bacteria 1302
599 Ga0496111_0004700 3300048914 Bacteria 8657
600 Ga0496111_0054273 3300048914 Bacteria 2896
601 Ga0496112_0033565 3300048915 Bacteria 4990
602 Ga0496112_0225146 3300048915 Bacteria 1831
603 Ga0496113_0146803 3300048916 Bacteria 1859
604 Ga0496113_0205511 3300048916 Bacteria 1566
605 Ga0496113_0818136 3300048916 Bacteria 740
606 Ga0496113_1392695 3300048916 Bacteria 543
607 Ga0496114_0004264 3300048917 Bacteria 11066
608 Ga0496114_0092774 3300048917 Unclassified 2566
609 Ga0496114_0186901 3300048917 Bacteria 1811
610 Ga0496114_0635317 3300048917 Bacteria 940
611 Ga0501031_0028752 3300049568 Bacteria 3623
612 Ga0501031_0053839 3300049568 Bacteria 2623
613 Ga0501031_0074166 3300049568 Bacteria 2216
614 Ga0501031_0115393 3300049568 Bacteria 1754
615 Ga0501031_0165564 3300049568 Bacteria 1445
616 Ga0501031_0174717 3300049568 Bacteria 1403
617 Ga0501032_0091900 3300049569 Bacteria 2013
618 Ga0501033_0375815 3300049570 Bacteria 993
619 Ga0501033_0851516 3300049570 Bacteria 614
620 Ga0501034_0531603 3300049571 Bacteria 1087
621 Ga0501036_0043798 3300049572 Bacteria 3790
622 Ga0501036_0078821 3300049572 Bacteria 2786
623 Ga0501036_0148608 3300049572 Unclassified 1976
624 Ga0501036_0163752 3300049572 Bacteria 1875
625 Ga0501036_1147213 3300049572 Bacteria 634
626 Ga0501036_1178229 3300049572 Bacteria 625
627 Ga0501037_0050415 3300049573 Bacteria 3046
628 Ga0501037_0129685 3300049573 Bacteria 1809
629 Ga0501037_0363424 3300049573 Bacteria 997
630 Ga0501038_0124336 3300049574 Bacteria 2124
631 Ga0501038_0220075 3300049574 Bacteria 1515
632 Ga0501038_0676190 3300049574 Bacteria 775
633 Ga0501039_0002309 3300049575 Bacteria 14159
634 Ga0501039_0037345 3300049575 Bacteria 3748
635 Ga0501039_0061283 3300049575 Bacteria 2914
636 Ga0501039_0099926 3300049575 Bacteria 2264
637 Ga0501039_0211451 3300049575 Bacteria 1525
638 Ga0501039_0429560 3300049575 Bacteria 1037
639 Ga0501039_0639441 3300049575 Bacteria 833
640 Ga0501039_1446790 3300049575 Unclassified 529
641 Ga0501040_0016519 3300049576 Bacteria 4887
642 Ga0501040_0023610 3300049576 Bacteria 4123
643 Ga0501040_0076474 3300049576 Bacteria 2315
644 Ga0501040_0130947 3300049576 Bacteria 1764
645 Ga0501040_0157732 3300049576 Bacteria 1603
646 Ga0501040_0164859 3300049576 Bacteria 1567
647 Ga0501040_0250434 3300049576 Unclassified 1263
648 Ga0501040_0836382 3300049576 Unclassified 666
649 Ga0501040_1192663 3300049576 Bacteria 552
650 Ga0501041_0011087 3300049577 Bacteria 5321
651 Ga0501041_0054253 3300049577 Bacteria 2445
652 Ga0501041_0072499 3300049577 Bacteria 2116
653 Ga0501041_0102300 3300049577 Bacteria 1774
654 Ga0501041_0671791 3300049577 Bacteria 662
655 Ga0501042_0053464 3300049578 Bacteria 2881
656 Ga0501042_0074499 3300049578 Bacteria 2429
657 Ga0501042_0084269 3300049578 Bacteria 2279
658 Ga0501042_0159529 3300049578 Bacteria 1627
659 Ga0501042_0218085 3300049578 Bacteria 1376
660 Ga0501042_0766233 3300049578 Unclassified 702
661 Ga0501042_0773202 3300049578 Bacteria 699
662 Ga0501042_1021243 3300049578 Bacteria 603
663 Ga0501042_1031060 3300049578 Unclassified 600
664 Ga0501043_0037569 3300049579 Bacteria 3809
665 Ga0501043_0188755 3300049579 Bacteria 1603
666 Ga0501043_0191363 3300049579 Unclassified 1591
667 Ga0501046_0107241 3300049580 Bacteria 2137
668 Ga0501048_0023789 3300049582 Bacteria 4474
669 Ga0501048_0289855 3300049582 Unclassified 1164
670 Ga0501048_0447915 3300049582 Bacteria 924
671 Ga0501048_0777893 3300049582 Bacteria 687
672 Ga0501048_1291979 3300049582 Unclassified 525
673 Ga0501067_0004455 3300049583 Bacteria 7723
674 Ga0501067_0007376 3300049583 Bacteria 6108
675 Ga0501067_0068298 3300049583 Bacteria 1967
676 Ga0501067_0068733 3300049583 Bacteria 1961
677 Ga0501067_0075871 3300049583 Bacteria 1862
678 Ga0501067_0102125 3300049583 Bacteria 1593
679 Ga0501067_0248630 3300049583 Unclassified 990
680 Ga0501067_0402327 3300049583 Bacteria 764
681 Ga0501068_0011770 3300049584 Bacteria 4945
682 Ga0501068_0036794 3300049584 Bacteria 2929
683 Ga0501068_0129164 3300049584 Unclassified 1580
684 Ga0501068_0139167 3300049584 Unclassified 1521
685 Ga0501068_0193954 3300049584 Unclassified 1287
686 Ga0501068_0232862 3300049584 Unclassified 1171
687 Ga0501068_0271604 3300049584 Bacteria 1082
688 Ga0501068_0387208 3300049584 Bacteria 901
689 Ga0501068_0409412 3300049584 Bacteria 875
690 Ga0501069_0031116 3300049585 Bacteria 2933
691 Ga0501069_0051877 3300049585 Bacteria 2283
692 Ga0501069_0132156 3300049585 Bacteria 1429
693 Ga0501069_0147133 3300049585 Bacteria 1352
694 Ga0501069_0167943 3300049585 Bacteria 1265
695 Ga0501069_0250368 3300049585 Bacteria 1033
696 Ga0501069_0297073 3300049585 Bacteria 947
697 Ga0501070_0051405 3300049586 Bacteria 3421
698 Ga0501070_0149068 3300049586 Bacteria 1930
699 Ga0501070_0247246 3300049586 Bacteria 1459
700 Ga0501070_0255232 3300049586 Bacteria 1434
701 Ga0501071_0002245 3300049587 Bacteria 11626
702 Ga0501071_0004277 3300049587 Bacteria 9045
703 Ga0501071_0009436 3300049587 Bacteria 6499
704 Ga0501071_0012338 3300049587 Bacteria 5794
705 Ga0501071_0036256 3300049587 Bacteria 3516
706 Ga0501071_0045371 3300049587 Bacteria 3155
707 Ga0501071_0057286 3300049587 Unclassified 2816
708 Ga0501071_0071598 3300049587 Bacteria 2528
709 Ga0501071_0161216 3300049587 Bacteria 1676
710 Ga0501071_0171946 3300049587 Bacteria 1622
711 Ga0501071_0227603 3300049587 Bacteria 1404
712 Ga0501071_0335825 3300049587 Bacteria 1149
713 Ga0501072_0003837 3300049588 Bacteria 11355
714 Ga0501072_0012115 3300049588 Bacteria 6587
715 Ga0501072_0054325 3300049588 Bacteria 3155
716 Ga0501072_0068466 3300049588 Bacteria 2802
717 Ga0501072_0068527 3300049588 Unclassified 2801
718 Ga0501072_0157059 3300049588 Bacteria 1814
719 Ga0501072_0180572 3300049588 Bacteria 1683
720 Ga0501072_0218104 3300049588 Bacteria 1520
721 Ga0501072_0402258 3300049588 Bacteria 1086
722 Ga0501072_0424921 3300049588 Bacteria 1053
723 Ga0501072_0599534 3300049588 Bacteria 868
724 Ga0501072_1188680 3300049588 Bacteria 592
725 Ga0501073_0139618 3300049589 Bacteria 1679
726 Ga0501073_0191679 3300049589 Bacteria 1414
727 Ga0501074_0033356 3300049590 Bacteria 3731
728 Ga0501074_0081168 3300049590 Bacteria 2326
729 Ga0501074_0094337 3300049590 Bacteria 2143
730 Ga0501074_0113865 3300049590 Bacteria 1935
731 Ga0501075_0005248 3300049591 Bacteria 8861
732 Ga0501075_0009806 3300049591 Bacteria 6712
733 Ga0501075_0010765 3300049591 Bacteria 6442
734 Ga0501075_0017260 3300049591 Bacteria 5212
735 Ga0501075_0040849 3300049591 Bacteria 3475
736 Ga0501075_0322965 3300049591 Bacteria 1176
737 Ga0501075_0400161 3300049591 Bacteria 1047
738 Ga0501075_0606772 3300049591 Bacteria 835
739 Ga0501075_0757650 3300049591 Bacteria 739
740 Ga0501076_0002314 3300049592 Bacteria 13049
741 Ga0501076_0007959 3300049592 Bacteria 7734
742 Ga0501076_0066641 3300049592 Bacteria 2874
743 Ga0501076_0075178 3300049592 Bacteria 2707
744 Ga0501076_0125720 3300049592 Unclassified 2077
745 Ga0501076_0127648 3300049592 Unclassified 2061
746 Ga0501076_0138656 3300049592 Bacteria 1975
747 Ga0501076_0251274 3300049592 Bacteria 1447
748 Ga0501076_0256895 3300049592 Bacteria 1430
749 Ga0501076_0396696 3300049592 Bacteria 1134
750 Ga0501076_0411384 3300049592 Unclassified 1112
751 Ga0501076_0639464 3300049592 Bacteria 878
752 Ga0501076_0782803 3300049592 Bacteria 787
753 Ga0501077_0004356 3300049593 Bacteria 8582
754 Ga0501077_0007601 3300049593 Bacteria 6688
755 Ga0501077_0016850 3300049593 Bacteria 4608
756 Ga0501077_0042247 3300049593 Bacteria 2899
757 Ga0501077_0054423 3300049593 Bacteria 2542
758 Ga0501077_0090297 3300049593 Bacteria 1941
759 Ga0501077_0135808 3300049593 Unclassified 1560
760 Ga0501077_0401938 3300049593 Bacteria 876
761 Ga0501077_0492103 3300049593 Bacteria 786
762 Ga0501077_0563172 3300049593 Bacteria 731
763 Ga0501079_0031365 3300049741 Bacteria 4084
764 Ga0501079_0062495 3300049741 Bacteria 2872
765 Ga0501079_0159071 3300049741 Bacteria 1761
766 Ga0501079_0276533 3300049741 Bacteria 1313
767 Ga0501079_0323360 3300049741 Bacteria 1208
768 Ga0501079_0337058 3300049741 Bacteria 1181
769 Ga0501079_0391290 3300049741 Bacteria 1090
770 Ga0501079_0429164 3300049741 Unclassified 1037
771 Ga0501080_0075119 3300049742 Bacteria 3144
772 Ga0501080_0113570 3300049742 Bacteria 2511
773 Ga0501080_0140384 3300049742 Bacteria 2234
774 Ga0501080_0229878 3300049742 Bacteria 1695
775 Ga0501080_0290364 3300049742 Unclassified 1485
776 Ga0501080_0308136 3300049742 Bacteria 1435
777 Ga0501080_1130600 3300049742 Bacteria 675
778 Ga0501081_0036523 3300049743 Bacteria 3350
779 Ga0501081_0053463 3300049743 Bacteria 2788
780 Ga0501081_0203370 3300049743 Bacteria 1437
781 Ga0501081_0362734 3300049743 Bacteria 1069
782 Ga0501081_0407918 3300049743 Bacteria 1006
783 Ga0501081_0480117 3300049743 Bacteria 925
784 Ga0501081_0804385 3300049743 Unclassified 707
785 Ga0501081_1090825 3300049743 Bacteria 604
786 Ga0501081_1448850 3300049743 Bacteria 521
787 Ga0501083_0050416 3300049744 Bacteria 2801
788 Ga0501083_0068002 3300049744 Bacteria 2371
789 Ga0501083_0143873 3300049744 Bacteria 1561
790 Ga0501083_0298502 3300049744 Bacteria 1048
791 Ga0501083_0318562 3300049744 Bacteria 1011
792 Ga0501083_0526051 3300049744 Bacteria 770
793 Ga0501035_0103918 3300049822 Unclassified 2491
794 Ga0501035_0320261 3300049822 Bacteria 1303
795 Ga0501035_0417041 3300049822 Bacteria 1115
796 Ga0501035_1186043 3300049822 Unclassified 593
797 Ga0501044_0337845 3300049823 Bacteria 1428
798 Ga0501044_0354209 3300049823 Bacteria 1387
799 Ga0501044_0740295 3300049823 Bacteria 866
800 Ga0501044_1228718 3300049823 Unclassified 617
801 Ga0501045_0034525 3300049824 Bacteria 3672
802 Ga0501045_0038764 3300049824 Bacteria 3466
803 Ga0501045_0107527 3300049824 Bacteria 2067
804 Ga0501045_0137945 3300049824 Bacteria 1814
805 Ga0501045_0289309 3300049824 Bacteria 1219
806 Ga0501045_0377291 3300049824 Bacteria 1055
807 Ga0501045_0510550 3300049824 Bacteria 893
808 Ga0501045_0816313 3300049824 Unclassified 686
809 Ga0501045_1269484 3300049824 Unclassified 536
810 nmdc:mga00v17_461210_c1 3300050491 Bacteria 825
811 nmdc:mga00v17_730000_c1 3300050491 Bacteria 634
812 nmdc:mga0yw44_23334_c1 3300050492 Bacteria 3484
813 nmdc:mga0yw44_345972_c1 3300050492 Bacteria 1000
814 nmdc:mga06z11_47365_c1 3300050494 Bacteria 2183
815 nmdc:mga07m45_151811_c1 3300050496 Bacteria 1343
816 nmdc:mga05p37_1062534_c1 3300050507 Unclassified 852
817 nmdc:mga05p37_1282851_c1 3300050507 Bacteria 748
818 nmdc:mga05p37_382499_c1 3300050507 Bacteria 1649
819 nmdc:mga05p37_4869_c1 3300050507 Bacteria 15712
820 nmdc:mga05p37_51398_c1 3300050507 Bacteria 5068
821 nmdc:mga05p37_883951_c1 3300050507 Bacteria 966
822 nmdc:mga09592_15473_c1 3300050508 Bacteria 6235
823 nmdc:mga09592_244227_c1 3300050508 Bacteria 1556
824 nmdc:mga09592_50568_c1 3300050508 Bacteria 3506
825 nmdc:mga0qj67_1379508_c1 3300050509 Bacteria 544
826 nmdc:mga0qj67_42033_c1 3300050509 Bacteria 3598
827 nmdc:mga06r32_1018877_c1 3300050510 Unclassified 780
828 nmdc:mga06r32_914339_c1 3300050510 Unclassified 833
829 nmdc:mga08y16_101601_c1 3300050511 Bacteria 2994
830 nmdc:mga08y16_1126199_c1 3300050511 Unclassified 759
831 nmdc:mga08y16_1389656_c1 3300050511 Bacteria 666
832 nmdc:mga08y16_208207_c1 3300050511 Bacteria 2026
833 nmdc:mga08y16_263214_c1 3300050511 Bacteria 1781
834 nmdc:mga08y16_35472_c1 3300050511 Bacteria 5238
835 nmdc:mga08y16_46389_c1 3300050511 Bacteria 4549
836 nmdc:mga0n895_204572_c1 3300050512 Bacteria 2005
837 nmdc:mga0rr50_211747_c1 3300050513 Bacteria 1597
838 nmdc:mga08x19_37145_c1 3300050514 Bacteria 3089
839 nmdc:mga08x19_401802_c1 3300050514 Unclassified 961
840 nmdc:mga0a205_238646_c1 3300050515 Bacteria 1699
841 nmdc:mga0a205_262793_c1 3300050515 Bacteria 1603
842 nmdc:mga0a205_32876_c1 3300050515 Bacteria 4974
843 nmdc:mga0a205_45334_c1 3300050515 Bacteria 4239
844 Ga0495612_0231312 3300053078 Bacteria 820
845 Ga0495655_0009286 3300053083 Bacteria 1901
846 Ga0495655_0232803 3300053083 Unclassified 614
847 Ga0495595_0123091 3300053084 Bacteria 1264
848 Ga0495619_0028835 3300053085 Bacteria 3582
849 Ga0495619_0030610 3300053085 Unclassified 3484
850 Ga0501084_0003923 3300054114 Bacteria 12110
851 Ga0501084_0022824 3300054114 Bacteria 5221
852 Ga0501084_0042241 3300054114 Bacteria 3813
853 Ga0501084_0052046 3300054114 Unclassified 3426
854 Ga0501084_0127882 3300054114 Unclassified 2138
855 Ga0501084_0155313 3300054114 Bacteria 1929
856 Ga0501084_0225520 3300054114 Bacteria 1581
857 Ga0501084_0247342 3300054114 Bacteria 1505
858 Ga0501084_1282324 3300054114 Unclassified 614
859 Ga0590077_015646 3300059426 Bacteria 1588
860 Ga0501082_0010767 3300060353 Bacteria 7874
861 Ga0501082_0036270 3300060353 Bacteria 4248
862 Ga0501082_0169270 3300060353 Bacteria 1899
863 Ga0501082_0317566 3300060353 Bacteria 1357
864 Ga0501082_0344613 3300060353 Unclassified 1298
865 Ga0501082_0484496 3300060353 Bacteria 1081
866 Ga0501082_0527377 3300060353 Bacteria 1032
867 Ga0501082_1240888 3300060353 Unclassified 651
868 Ga0530510_0011403 3300061734 Bacteria 6235
869 Ga0530510_0065167 3300061734 Bacteria 2639
870 Ga0530510_0069701 3300061734 Bacteria 2552
871 Ga0530510_0114401 3300061734 Unclassified 1977
872 Ga0530510_0157134 3300061734 Bacteria 1681
873 Ga0530510_0179991 3300061734 Bacteria 1567
874 Ga0530510_0278901 3300061734 Unclassified 1248
875 Ga0530510_0307144 3300061734 Bacteria 1187
876 Ga0530510_0312505 3300061734 Bacteria 1177
877 Ga0530510_0357698 3300061734 Bacteria 1097
878 Ga0530510_0423004 3300061734 Unclassified 1005
879 Ga0530510_0493630 3300061734 Bacteria 928
880 Ga0530510_0498064 3300061734 Unclassified 923
881 Ga0530510_0543095 3300061734 Bacteria 882
882 2512736769 2512564039 Bacteria 8739048
883 Ga0501077_0214390
884 ARcpr5yngRDRAFT_c005018
885 ARSoilOldRDRAFT_c001352
886 ARCol0yngRDRAFT_1001892
887 JGI24746J21847_1013217
888 JGI24743J22301_10009270
889 JGI24738J21930_10014706
890 JGI24744J21845_10013288
891 JGI24033J26618_1021497
892 JGI24751J29686_10037418
893 JGI25406J46586_10027104
894 Ga0070658_10158575
895 Ga0070658_10844338
896 Ga0070676_10048048
897 Ga0070683_100014338
898 Ga0070683_100067023
899 Ga0070683_100080820
900 Ga0070683_100443926
901 Ga0070683_100865914
902 Ga0070683_101866356
903 Ga0070670_100099625
904 Ga0070670_100099819
905 Ga0070670_100198543
906 Ga0070670_100999263
907 Ga0068869_101057902
908 Ga0068869_101283365
909 Ga0070680_100080674
910 Ga0070682_100002955
911 Ga0070682_100029872
912 Ga0070682_100299133
913 Ga0068868_100292900
914 Ga0068868_100592248
915 Ga0068868_100910454
916 Ga0068868_100917154
917 Ga0070660_100004508
918 Ga0070660_100318707
919 Ga0070660_100550137
920 Ga0070660_100595024
921 Ga0070689_100003268
922 Ga0070689_100013139
923 Ga0070691_10020769
924 Ga0070691_10035413
925 Ga0070691_10281697
926 Ga0070691_10496590
927 Ga0070687_100415551
928 Ga0070661_100164146
929 Ga0070661_100378316
930 Ga0070692_10027766
931 Ga0070692_10042579
932 Ga0070692_10212205
933 Ga0070692_10288182
934 Ga0070692_10328705
935 Ga0070668_100147535
936 Ga0070668_100215135
937 Ga0070668_100295249
938 Ga0070668_100377960
939 Ga0070668_100809529
940 Ga0070669_100048593
941 Ga0070669_100592296
942 Ga0070669_101238655
943 Ga0070675_100030703
944 Ga0070675_100149606
945 Ga0070675_100507263
946 Ga0070671_100092764
947 Ga0070671_100189130
948 Ga0070674_100005773
949 Ga0070674_100083164
950 Ga0070674_100473040
951 Ga0070674_100920729
952 Ga0070674_101244250
953 Ga0070674_101357953
954 Ga0070673_100085840
955 Ga0070673_100396342
956 Ga0070688_100013927
957 Ga0070688_100280190
958 Ga0070659_100028257
959 Ga0070659_100158733
960 Ga0070659_100162825
961 Ga0070667_100303834
962 Ga0070667_100337285
963 Ga0070667_100346255
964 Ga0070713_100111414
965 Ga0070701_10005472
966 Ga0070705_100052770
967 Ga0070705_100131077
968 Ga0070700_100036523
969 Ga0070700_100198843
970 Ga0070700_100302442
971 Ga0070700_100334931
972 Ga0070694_100960393
973 Ga0070694_101222792
974 Ga0070708_100232621
975 Ga0070708_101410230
976 Ga0070663_100307192
977 Ga0070663_100585575
978 Ga0070678_100029915
979 Ga0070678_100322347
980 Ga0070678_100343647
981 Ga0070678_100681471
982 Ga0070678_100777680
983 Ga0070678_101188099
984 Ga0070678_101233867
985 Ga0070662_100043493
986 Ga0070662_100206113
987 Ga0070662_100568096
988 Ga0070681_10087248
989 Ga0070681_10146142
990 Ga0070681_10234818
991 Ga0068867_100157036
992 Ga0068867_100170140
993 Ga0068867_100213039
994 Ga0068867_100264384
995 Ga0068867_100356169
996 Ga0070685_10001814
997 Ga0070685_10101780
998 Ga0070685_10136313
999 Ga0070685_10729933
1000 Ga0070706_100467197
1001 Ga0070679_100016201
1002 Ga0070679_100157362
1003 Ga0070684_100012482
1004 Ga0070684_100044320
1005 Ga0070684_100052498
1006 Ga0070684_100265539
1007 Ga0070684_100277563
1008 Ga0070684_100335978
1009 Ga0068853_100012062
1010 Ga0068853_100206077
1011 Ga0068853_100910416
1012 Ga0070672_100127249
1013 Ga0070672_100142824
1014 Ga0070672_100157034
1015 Ga0070672_101039204
1016 Ga0070686_100096141
1017 Ga0070686_100256627
1018 Ga0070695_100347747
1019 Ga0070695_100373740
1020 Ga0070696_100089054
1021 Ga0070696_100398958
1022 Ga0070693_100122649
1023 Ga0070665_100009113
1024 Ga0070665_100043729
1025 Ga0070665_100367312
1026 Ga0070704_100159448
1027 Ga0070704_100201049
1028 Ga0070704_100323659
1029 Ga0070704_100584666
1030 Ga0068855_100510298
1031 Ga0070664_100038772
1032 Ga0070664_100039753
1033 Ga0070664_100084164
1034 Ga0070664_100136314
1035 Ga0070664_100161106
1036 Ga0068857_100073251
1037 Ga0068857_100105311
1038 Ga0068857_100142944
1039 Ga0068857_100849296
1040 Ga0068854_100000733
1041 Ga0068854_100561477
1042 Ga0068854_100807885
1043 Ga0068856_100027626
1044 Ga0068856_100314761
1045 Ga0070702_100016951
1046 Ga0070702_100018802
1047 Ga0070702_100092106
1048 Ga0070702_100361310
1049 Ga0070702_100428950
1050 Ga0068852_100015804
1051 Ga0068852_100336571
1052 Ga0068852_100373748
1053 Ga0068852_100396359
1054 Ga0068859_100019963
1055 Ga0068864_100068183
1056 Ga0068864_100086793
1057 Ga0068864_100884089
1058 Ga0068864_102007088
1059 Ga0068866_10145709
1060 Ga0068866_10180826
1061 Ga0068866_10206856
1062 Ga0068861_100022669
1063 Ga0068861_100109160
1064 Ga0068861_100571811
1065 Ga0068851_10059139
1066 Ga0068851_10131435
1067 Ga0068870_10010973
1068 Ga0068870_10171041
1069 Ga0068870_10207457
1070 Ga0068870_10220932
1071 Ga0068863_100822475
1072 Ga0068863_100885265
1073 Ga0068858_100055946
1074 Ga0068860_100055188
1075 Ga0068860_100060241
1076 Ga0068862_100281668
1077 Ga0068862_100362983
1078 Ga0068862_100743037
1079 Ga0081455_10059370
1080 Ga0081455_10110317
1081 Ga0081455_10147820
1082 Ga0081455_10239880
1083 Ga0081455_10285172
1084 Ga0081538_10096014
1085 Ga0081539_10001668
1086 Ga0081539_10163107
1087 Ga0070717_10135591
1088 Ga0075365_10305614
1089 Ga0075364_10338952
1090 Ga0075432_10003705
1091 Ga0075432_10006589
1092 Ga0075432_10199018
1093 Ga0075367_10035025
1094 Ga0097621_100027230
1095 Ga0097621_101115426
1096 Ga0075370_10115385
1097 Ga0068871_100072115
1098 Ga0068871_100072172
1099 Ga0068871_100198568
1100 Ga0068871_101106631
1101 Ga0075428_100005456
1102 Ga0075428_100025085
1103 Ga0075428_100075303
1104 Ga0075430_100008652
1105 Ga0075430_100304582
1106 Ga0075431_100007107
1107 Ga0075433_10009902
1108 Ga0075433_10151165
1109 Ga0075433_10354261
1110 Ga0075433_10455106
1111 Ga0075433_10502656
1112 Ga0075434_100009715
1113 Ga0075434_100460253
1114 Ga0075434_100690988
1115 Ga0075434_101435783
1116 Ga0075429_100048042
1117 Ga0075429_100114773
1118 Ga0068865_100027255
1119 Ga0068865_100107288
1120 Ga0068865_100331915
1121 Ga0075436_100112305
1122 Ga0075436_100197299
1123 Ga0097620_100019965
1124 Ga0075435_100228304
1125 Ga0105240_10582900
1126 Ga0111539_10004926
1127 Ga0111539_10032849
1128 Ga0111539_10075810
1129 Ga0111539_10185772
1130 Ga0111539_11243392
1131 Ga0111539_13498994
1132 Ga0105245_10018022
1133 Ga0105245_10025179
1134 Ga0105245_10300692
1135 Ga0105245_10312498
1136 Ga0105247_10022525
1137 Ga0114129_10033398
1138 Ga0114129_10034656
1139 Ga0114129_10050237
1140 Ga0114129_10783633
1141 Ga0114129_10931103
1142 Ga0114129_11024972
1143 Ga0114129_11045822
1144 Ga0114129_11397754
1145 Ga0105243_10003687
1146 Ga0105243_10046271
1147 Ga0105243_10051072
1148 Ga0105243_10129934
1149 Ga0105243_10188044
1150 Ga0105243_11024068
1151 Ga0105243_11040867
1152 Ga0105243_12540004
1153 Ga0105241_10443426
1154 Ga0105241_10449603
1155 Ga0105242_10055142
1156 Ga0105242_10061082
1157 Ga0105242_10086218
1158 Ga0105242_10099562
1159 Ga0105248_10079530
1160 Ga0105248_10152339
1161 Ga0105248_10161761
1162 Ga0105248_10763938
1163 Ga0105238_10054647
1164 Ga0105238_10458426
1165 Ga0105238_10528912
1166 Ga0105249_10173156
1167 Ga0105249_10548222
1168 Ga0105239_10042798
1169 Ga0105239_10057264
1170 Ga0105239_10064888
1171 Ga0105239_10150408
1172 Ga0105239_10769590
1173 Ga0105246_10009345
1174 Ga0105246_10018955
1175 Ga0105246_10042363
1176 Ga0105246_10130894
1177 Ga0105246_10234386
1178 Ga0157320_1003077
1179 Ga0157343_1012390
1180 Ga0157373_10564470
1181 Ga0157371_10018835
1182 Ga0157371_10139580
1183 Ga0157369_10076861
1184 Ga0157369_10095079
1185 Ga0157374_10167627
1186 Ga0157374_10354160
1187 Ga0157374_10571524
1188 Ga0157374_11066579
1189 Ga0157378_10699787
1190 Ga0157378_10855962
1191 Ga0163162_10137707
1192 Ga0163162_10327464
1193 Ga0157372_10180470
1194 Ga0157372_10238730
1195 Ga0157372_10460794
1196 Ga0157372_10824332
1197 Ga0157375_10015281
1198 Ga0157375_10156139
1199 Ga0157375_10212095
1200 Ga0157375_10304954
1201 Ga0157375_11475020
1202 Ga0163163_10131791
1203 Ga0163163_10202453
1204 Ga0163163_10321156
1205 Ga0163163_10455165
1206 Ga0163163_10510744
1207 Ga0157380_10045029
1208 Ga0157380_10228053
1209 Ga0157380_10708197
1210 Ga0157380_11766161
1211 Ga0157377_10032230
1212 Ga0157377_10076686
1213 Ga0157377_10095813
1214 Ga0157377_10118232
1215 Ga0157377_10691686
1216 Ga0157379_10050323
1217 Ga0157376_10169324
1218 Ga0157376_10399425
1219 Ga0157376_10538827
1220 Ga0157376_10867031
1221 Ga0163161_10197907
1222 Ga0163161_10296950
1223 Ga0163161_10935049
1224 Ga0206356_11798710
1225 Ga0207656_10021960
1226 Ga0207656_10094864
1227 Ga0207642_10277838
1228 Ga0207642_10475433
1229 Ga0207642_10581250
1230 Ga0207642_10742156
1231 Ga0207688_10002457
1232 Ga0207688_10010697
1233 Ga0207688_10015530
1234 Ga0207688_10023099
1235 Ga0207688_10053859
1236 Ga0207680_10151839
1237 Ga0207645_10022205
1238 Ga0207645_10041880
1239 Ga0207643_10004905
1240 Ga0207643_10022336
1241 Ga0207643_10042105
1242 Ga0207643_10063949
1243 Ga0207643_10074109
1244 Ga0207705_10074417
1245 Ga0207684_10368013
1246 Ga0207707_10798666
1247 Ga0207695_10786648
1248 Ga0207693_10110009
1249 Ga0207660_10054917
1250 Ga0207660_10135890
1251 Ga0207660_10209699
1252 Ga0207660_10282238
1253 Ga0207662_10050876
1254 Ga0207657_10003231
1255 Ga0207657_10167102
1256 Ga0207657_10313599
1257 Ga0207657_10394964
1258 Ga0207649_10011072
1259 Ga0207649_10096500
1260 Ga0207649_10141207
1261 Ga0207649_10696631
1262 Ga0207652_10020767
1263 Ga0207652_10107753
1264 Ga0207652_10209922
1265 Ga0207652_10726164
1266 Ga0207681_10490839
1267 Ga0207681_11287510
1268 Ga0207694_10167893
1269 Ga0207694_10279326
1270 Ga0207650_10053248
1271 Ga0207650_10066591
1272 Ga0207650_10079173
1273 Ga0207659_10242273
1274 Ga0207659_10432551
1275 Ga0207659_11646914
1276 Ga0207687_10083931
1277 Ga0207687_10242184
1278 Ga0207700_10160554
1279 Ga0207664_10643095
1280 Ga0207644_10153066
1281 Ga0207644_10593401
1282 Ga0207690_10016727
1283 Ga0207690_10104565
1284 Ga0207690_10588138
1285 Ga0207706_10076066
1286 Ga0207706_10146675
1287 Ga0207706_10486327
1288 Ga0207686_10043549
1289 Ga0207686_10305124
1290 Ga0207686_10305698
1291 Ga0207686_10549491
1292 Ga0207709_10032106
1293 Ga0207709_10167732
1294 Ga0207709_10416500
1295 Ga0207709_11047307
1296 Ga0207670_10127731
1297 Ga0207669_10004221
1298 Ga0207669_10008206
1299 Ga0207669_10097072
1300 Ga0207669_10103751
1301 Ga0207669_10718933
1302 Ga0207704_10002934
1303 Ga0207704_10080985
1304 Ga0207704_10087048
1305 Ga0207704_10418379
1306 Ga0207704_10635995
1307 Ga0207704_11202475
1308 Ga0207691_10014129
1309 Ga0207691_10082563
1310 Ga0207691_10083272
1311 Ga0207691_11058283
1312 Ga0207711_10141137
1313 Ga0207711_10465986
1314 Ga0207711_10613444
1315 Ga0207711_10614988
1316 Ga0207661_10002999
1317 Ga0207661_10022183
1318 Ga0207661_10040515
1319 Ga0207661_10065551
1320 Ga0207661_10100891
1321 Ga0207661_10231259
1322 Ga0207679_10288768
1323 Ga0207679_10333562
1324 Ga0207679_10846511
1325 Ga0207667_10067979
1326 Ga0207667_10620819
1327 Ga0207651_10064789
1328 Ga0207651_11969605
1329 Ga0207712_10060574
1330 Ga0207712_10385069
1331 Ga0207668_10147531
1332 Ga0207668_10874101
1333 Ga0207668_11396214
1334 Ga0207640_10090902
1335 Ga0207640_10161678
1336 Ga0207658_10485972
1337 Ga0207677_10009728
1338 Ga0207703_10312242
1339 Ga0207639_10020860
1340 Ga0207639_10109579
1341 Ga0207639_11305115
1342 Ga0207678_10078443
1343 Ga0207678_10231275
1344 Ga0207678_10272101
1345 Ga0207708_10009052
1346 Ga0207708_10016792
1347 Ga0207708_10115045
1348 Ga0207708_10154278
1349 Ga0207708_10309352
1350 Ga0207702_10403521
1351 Ga0207702_10470775
1352 Ga0207641_10024962
1353 Ga0207648_10031419
1354 Ga0207648_10074501
1355 Ga0207648_10086712
1356 Ga0207648_10098880
1357 Ga0207648_10308984
1358 Ga0207648_10339669
1359 Ga0207676_10457957
1360 Ga0207676_11201889
1361 Ga0207676_11285140
1362 Ga0207676_11353858
1363 Ga0207674_10008436
1364 Ga0207674_10089108
1365 Ga0207674_10124602
1366 Ga0207674_10731906
1367 Ga0207674_11170921
1368 Ga0207675_100012138
1369 Ga0207675_100281132
1370 Ga0207675_100354315
1371 Ga0207683_10041737
1372 Ga0207683_10052061
1373 Ga0207683_10083122
1374 Ga0207683_10088859
1375 Ga0207683_10207753
1376 Ga0207683_10372139
1377 Ga0207698_10012965
1378 Ga0207698_10211724
1379 Ga0207698_10392084
1380 Ga0207698_10475765
1381 Ga0209966_1009539
1382 Ga0207428_10000182
1383 Ga0207428_10004674
1384 Ga0207428_10043802
1385 Ga0207428_10145146
1386 Ga0207428_10372210
1387 Ga0268266_10159286
1388 Ga0268266_10609917
1389 Ga0268266_10871562
1390 Ga0268265_10824422
1391 Ga0268264_10552574
1392 Ga0268264_10859629
1393 Ga0373958_0107076
1394 Ga0373959_0024319
1395 Ga0373938_0025163
1396 Ga0373949_0149390
1397 Ga0373951_0024993
1398 Ga0373941_0109965
1399 Ga0373960_0118726
1400 Ga0373962_0033954
1401 Ga0373931_0036572
1402 Ga0373931_0083390
1403 Ga0395900_0107916
1404 Ga0395898_0678540
1405 Ga0395905_0653979
1406 Ga0451798_0487803
1407 Ga0451802_1952470
1408 Ga0451807_0983106
1409 Ga0451837_1632252
1410 Ga0451841_0648400
1411 Ga0451851_0941692
1412 Ga0451853_3647003
1413 Ga0439450_059020
1414 Ga0439456_039475
1415 Ga0450920_139966
1416 Ga0450923_113710
1417 Ga0450910_011237
1418 Ga0450908_013527
1419 Ga0450909_022596
1420 Ga0439460_0044232
1421 Ga0495603_0004241
1422 Ga0495603_0263388
1423 Ga0495603_0292927
1424 Ga0495629_0771018
1425 Ga0495641_0217091
1426 Ga0495584_0460577
1427 Ga0495596_0310477
1428 Ga0495608_0279095
1429 Ga0495630_0180864
1430 Ga0495656_0093347
1431 Ga0495656_0098586
1432 Ga0495656_0119501
1433 Ga0495656_0236891
1434 Ga0495611_0259371
1435 Ga0495659_0124509
1436 Ga0495613_0580137
1437 Ga0495671_0192281
1438 Ga0495600_0169641
1439 Ga0495676_0662003
1440 Ga0495680_0188120
1441 Ga0496100_0207300
1442 Ga0496100_0222726
1443 Ga0496100_0362995
1444 Ga0496100_0560276
1445 Ga0496100_1065885
1446 Ga0496101_0121798
1447 Ga0496101_0197020
1448 Ga0496101_0266367
1449 Ga0496101_0657160
1450 Ga0496101_1263006
1451 Ga0496102_0402343
1452 Ga0496102_0412187
1453 Ga0496102_0609312
1454 Ga0496102_0640894
1455 Ga0496102_0681435
1456 Ga0496104_0137647
1457 Ga0496104_0294866
1458 Ga0496104_0354260
1459 Ga0496104_0874484
1460 Ga0496105_0021535
1461 Ga0496105_0405140
1462 Ga0496105_0812217
1463 Ga0496105_1352609
1464 Ga0496106_0057354
1465 Ga0496106_0126575
1466 Ga0496106_0346597
1467 Ga0496106_0493334
1468 Ga0496107_0107876
1469 Ga0496107_0606428
1470 Ga0496108_0112814
1471 Ga0496108_0149620
1472 Ga0496108_0214356
1473 Ga0496109_0014131
1474 Ga0496109_0054583
1475 Ga0496109_0287585
1476 Ga0496109_0423088
1477 Ga0496109_0791467
1478 Ga0496110_0002723
1479 Ga0496110_0111277
1480 Ga0496110_0371875
1481 Ga0496111_0004700
1482 Ga0496111_0054273
1483 Ga0496112_0033565
1484 Ga0496112_0225146
1485 Ga0496113_0146803
1486 Ga0496113_0205511
1487 Ga0496113_0818136
1488 Ga0496113_1392695
1489 Ga0496114_0004264
1490 Ga0496114_0092774
1491 Ga0496114_0186901
1492 Ga0496114_0635317
1493 Ga0501031_0028752
1494 Ga0501031_0053839
1495 Ga0501031_0074166
1496 Ga0501031_0115393
1497 Ga0501031_0165564
1498 Ga0501031_0174717
1499 Ga0501032_0091900
1500 Ga0501033_0375815
1501 Ga0501033_0851516
1502 Ga0501034_0531603
1503 Ga0501036_0043798
1504 Ga0501036_0078821
1505 Ga0501036_0148608
1506 Ga0501036_0163752
1507 Ga0501036_1147213
1508 Ga0501036_1178229
1509 Ga0501037_0050415
1510 Ga0501037_0129685
1511 Ga0501037_0363424
1512 Ga0501038_0124336
1513 Ga0501038_0220075
1514 Ga0501038_0676190
1515 Ga0501039_0002309
1516 Ga0501039_0037345
1517 Ga0501039_0061283
1518 Ga0501039_0099926
1519 Ga0501039_0211451
1520 Ga0501039_0429560
1521 Ga0501039_0639441
1522 Ga0501039_1446790
1523 Ga0501040_0016519
1524 Ga0501040_0023610
1525 Ga0501040_0076474
1526 Ga0501040_0130947
1527 Ga0501040_0157732
1528 Ga0501040_0164859
1529 Ga0501040_0250434
1530 Ga0501040_0836382
1531 Ga0501040_1192663
1532 Ga0501041_0011087
1533 Ga0501041_0054253
1534 Ga0501041_0072499
1535 Ga0501041_0102300
1536 Ga0501041_0671791
1537 Ga0501042_0053464
1538 Ga0501042_0074499
1539 Ga0501042_0084269
1540 Ga0501042_0159529
1541 Ga0501042_0218085
1542 Ga0501042_0766233
1543 Ga0501042_0773202
1544 Ga0501042_1021243
1545 Ga0501042_1031060
1546 Ga0501043_0037569
1547 Ga0501043_0188755
1548 Ga0501043_0191363
1549 Ga0501046_0107241
1550 Ga0501048_0023789
1551 Ga0501048_0289855
1552 Ga0501048_0447915
1553 Ga0501048_0777893
1554 Ga0501048_1291979
1555 Ga0501067_0004455
1556 Ga0501067_0007376
1557 Ga0501067_0068298
1558 Ga0501067_0068733
1559 Ga0501067_0075871
1560 Ga0501067_0102125
1561 Ga0501067_0248630
1562 Ga0501067_0402327
1563 Ga0501068_0011770
1564 Ga0501068_0036794
1565 Ga0501068_0129164
1566 Ga0501068_0139167
1567 Ga0501068_0193954
1568 Ga0501068_0232862
1569 Ga0501068_0271604
1570 Ga0501068_0387208
1571 Ga0501068_0409412
1572 Ga0501069_0031116
1573 Ga0501069_0051877
1574 Ga0501069_0132156
1575 Ga0501069_0147133
1576 Ga0501069_0167943
1577 Ga0501069_0250368
1578 Ga0501069_0297073
1579 Ga0501070_0051405
1580 Ga0501070_0149068
1581 Ga0501070_0247246
1582 Ga0501070_0255232
1583 Ga0501071_0002245
1584 Ga0501071_0004277
1585 Ga0501071_0009436
1586 Ga0501071_0012338
1587 Ga0501071_0036256
1588 Ga0501071_0045371
1589 Ga0501071_0057286
1590 Ga0501071_0071598
1591 Ga0501071_0161216
1592 Ga0501071_0171946
1593 Ga0501071_0227603
1594 Ga0501071_0335825
1595 Ga0501072_0003837
1596 Ga0501072_0012115
1597 Ga0501072_0054325
1598 Ga0501072_0068466
1599 Ga0501072_0068527
1600 Ga0501072_0157059
1601 Ga0501072_0180572
1602 Ga0501072_0218104
1603 Ga0501072_0402258
1604 Ga0501072_0424921
1605 Ga0501072_0599534
1606 Ga0501072_1188680
1607 Ga0501073_0139618
1608 Ga0501073_0191679
1609 Ga0501074_0033356
1610 Ga0501074_0081168
1611 Ga0501074_0094337
1612 Ga0501074_0113865
1613 Ga0501075_0005248
1614 Ga0501075_0009806
1615 Ga0501075_0010765
1616 Ga0501075_0017260
1617 Ga0501075_0040849
1618 Ga0501075_0322965
1619 Ga0501075_0400161
1620 Ga0501075_0606772
1621 Ga0501075_0757650
1622 Ga0501076_0002314
1623 Ga0501076_0007959
1624 Ga0501076_0066641
1625 Ga0501076_0075178
1626 Ga0501076_0125720
1627 Ga0501076_0127648
1628 Ga0501076_0138656
1629 Ga0501076_0251274
1630 Ga0501076_0256895
1631 Ga0501076_0396696
1632 Ga0501076_0411384
1633 Ga0501076_0639464
1634 Ga0501076_0782803
1635 Ga0501077_0004356
1636 Ga0501077_0007601
1637 Ga0501077_0016850
1638 Ga0501077_0042247
1639 Ga0501077_0054423
1640 Ga0501077_0090297
1641 Ga0501077_0135808
1642 Ga0501077_0401938
1643 Ga0501077_0492103
1644 Ga0501077_0563172
1645 Ga0501079_0031365
1646 Ga0501079_0062495
1647 Ga0501079_0159071
1648 Ga0501079_0276533
1649 Ga0501079_0323360
1650 Ga0501079_0337058
1651 Ga0501079_0391290
1652 Ga0501079_0429164
1653 Ga0501080_0075119
1654 Ga0501080_0113570
1655 Ga0501080_0140384
1656 Ga0501080_0229878
1657 Ga0501080_0290364
1658 Ga0501080_0308136
1659 Ga0501080_1130600
1660 Ga0501081_0036523
1661 Ga0501081_0053463
1662 Ga0501081_0203370
1663 Ga0501081_0362734
1664 Ga0501081_0407918
1665 Ga0501081_0480117
1666 Ga0501081_0804385
1667 Ga0501081_1090825
1668 Ga0501081_1448850
1669 Ga0501083_0050416
1670 Ga0501083_0068002
1671 Ga0501083_0143873
1672 Ga0501083_0298502
1673 Ga0501083_0318562
1674 Ga0501083_0526051
1675 Ga0501035_0103918
1676 Ga0501035_0320261
1677 Ga0501035_0417041
1678 Ga0501035_1186043
1679 Ga0501044_0337845
1680 Ga0501044_0354209
1681 Ga0501044_0740295
1682 Ga0501044_1228718
1683 Ga0501045_0034525
1684 Ga0501045_0038764
1685 Ga0501045_0107527
1686 Ga0501045_0137945
1687 Ga0501045_0289309
1688 Ga0501045_0377291
1689 Ga0501045_0510550
1690 Ga0501045_0816313
1691 Ga0501045_1269484
1692 nmdc:mga00v17_461210_c1
1693 nmdc:mga00v17_730000_c1
1694 nmdc:mga0yw44_23334_c1
1695 nmdc:mga0yw44_345972_c1
1696 nmdc:mga06z11_47365_c1
1697 nmdc:mga07m45_151811_c1
1698 nmdc:mga05p37_1062534_c1
1699 nmdc:mga05p37_1282851_c1
1700 nmdc:mga05p37_382499_c1
1701 nmdc:mga05p37_4869_c1
1702 nmdc:mga05p37_51398_c1
1703 nmdc:mga05p37_883951_c1
1704 nmdc:mga09592_15473_c1
1705 nmdc:mga09592_244227_c1
1706 nmdc:mga09592_50568_c1
1707 nmdc:mga0qj67_1379508_c1
1708 nmdc:mga0qj67_42033_c1
1709 nmdc:mga06r32_1018877_c1
1710 nmdc:mga06r32_914339_c1
1711 nmdc:mga08y16_101601_c1
1712 nmdc:mga08y16_1126199_c1
1713 nmdc:mga08y16_1389656_c1
1714 nmdc:mga08y16_208207_c1
1715 nmdc:mga08y16_263214_c1
1716 nmdc:mga08y16_35472_c1
1717 nmdc:mga08y16_46389_c1
1718 nmdc:mga0n895_204572_c1
1719 nmdc:mga0rr50_211747_c1
1720 nmdc:mga08x19_37145_c1
1721 nmdc:mga08x19_401802_c1
1722 nmdc:mga0a205_238646_c1
1723 nmdc:mga0a205_262793_c1
1724 nmdc:mga0a205_32876_c1
1725 nmdc:mga0a205_45334_c1
1726 Ga0495612_0231312
1727 Ga0495655_0009286
1728 Ga0495655_0232803
1729 Ga0495595_0123091
1730 Ga0495619_0028835
1731 Ga0495619_0030610
1732 Ga0501084_0003923
1733 Ga0501084_0022824
1734 Ga0501084_0042241
1735 Ga0501084_0052046
1736 Ga0501084_0127882
1737 Ga0501084_0155313
1738 Ga0501084_0225520
1739 Ga0501084_0247342
1740 Ga0501084_1282324
1741 Ga0590077_015646
1742 Ga0501082_0010767
1743 Ga0501082_0036270
1744 Ga0501082_0169270
1745 Ga0501082_0317566
1746 Ga0501082_0344613
1747 Ga0501082_0484496
1748 Ga0501082_0527377
1749 Ga0501082_1240888
1750 Ga0530510_0011403
1751 Ga0530510_0065167
1752 Ga0530510_0069701
1753 Ga0530510_0114401
1754 Ga0530510_0157134
1755 Ga0530510_0179991
1756 Ga0530510_0278901
1757 Ga0530510_0307144
1758 Ga0530510_0312505
1759 Ga0530510_0357698
1760 Ga0530510_0423004
1761 Ga0530510_0493630
1762 Ga0530510_0498064
1763 Ga0530510_0543095
1764 2512736769

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

91

160

0.92

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

81

162

0.92

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

16

151

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

150

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

58

152

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.9133 109 162
4zbp-assembly2.cif.gz_C-2 crystal structure of the ampcpr-bound atnudt7 0.9053 109 163
4zb3-assembly1.cif.gz_A-2 crystal structure of the apo atnudt7 0.9041 111 163
4zbp-assembly1.cif.gz_A crystal structure of the ampcpr-bound atnudt7 0.9015 109 161
4ava-assembly1.cif.gz_A crystal structure of protein lysine acetyltransferase rv0998 from mycobacterium tuberculosis 0.8637 55 162
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9365 109 161 3.40.630.30
af_K7M4C3_11_92_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9262 109 163 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9216 56 152 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.901 125 161 3.30.572.10
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8683 96 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1H0YEJ1-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9844 60 163 GO:0016747
AF-A0A7W2UQ04-F1-model_v4 GNAT family N-acetyltransferase 0.98 44 163 GO:0016747
AF-A0A537THW4-F1-model_v4 GNAT family N-acetyltransferase 0.9742 49 161 GO:0016747
AF-A0A6G7EQY8-F1-model_v4 deleted 0.9733 56 161
AF-A0A7U9X1B9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9704 60 161 GO:0007064
GO:0016747
GO:0031415

Map