F484563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 364 | 1764 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300046692|Ga0495671_0026647|Ga0495671_0026647_633_2003 |
| Length | 456 |
| Sequence | MWERACSERRSDDDGVSVDVNVECSGLIASKLAPTGIGGVSPLSIFKVITMFLVAFLGGILTVLSPCILPVVPFLFAGVKRTRSSILLTLGGMVLTFALISSLAVVSSEWVVHANNTGRHVALIVMVLFALSLISARVGDWLARPFVALGNRLDPDTRKMSGPLSSVMIGVATGLLWAPCAGPILGVILTGAMLQGANAQTSLLLVAYGLGSALSLGTLIFAGRGLVNRLKASIPVTGWLRRGTGVAVLAAAAVISTGADKTLLAGTSSEGVSSIEKGVLETVPKVVDYFVSKVKADSSMDNAQGAMPSLAGAVEWLNSPALSNDSLKGKVVLVDFWTYDCINCQHTLPYVKDWAKKYEKDGLVVIGVHTPEYGFERIIDNVKDQVKKLGITYPVAIDNNYAIWRNFDNQYWPAHYLIDAKGQVRFTHFGEGRYETQEKMIQQLLEEAKADAKASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 19 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 20 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 21 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 22 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 29 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 36 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 38 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 59 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 60 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 61 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 62 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 63 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 64 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 65 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 66 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 67 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 68 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 69 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 70 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 71 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 72 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 73 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 74 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 75 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 76 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 77 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 78 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 79 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 80 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 81 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 82 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 83 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 84 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 85 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 86 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 87 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 88 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 89 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 90 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 91 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 92 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 93 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 94 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 95 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 96 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 97 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 98 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 99 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 100 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 101 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 102 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 184 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 185 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 186 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 187 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 188 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 189 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 190 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 193 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 198 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 199 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 201 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 202 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 203 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 204 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 205 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 206 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 207 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 208 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 209 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 210 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 211 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 212 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 213 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 214 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 215 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 216 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 217 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 218 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 219 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 220 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 221 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 222 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 223 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 224 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 225 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 226 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 227 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 228 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 229 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 230 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 231 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 232 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 233 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 234 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 235 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 236 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 237 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 238 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 239 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 240 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 241 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 242 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 243 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 244 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 245 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 246 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 247 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 248 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 249 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 250 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 251 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 252 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 253 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 254 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 255 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 256 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 257 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 258 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 259 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 260 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 261 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 262 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 263 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 264 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 265 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 266 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 267 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 268 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 269 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 270 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 271 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 272 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 273 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 274 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 275 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 276 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 277 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 278 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 279 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 280 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 281 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 282 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 283 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 284 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 285 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 286 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 287 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 288 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 289 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 290 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 291 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 292 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 293 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 294 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 295 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 296 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 297 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 298 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 299 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 300 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 301 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 302 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 303 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 304 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 305 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 306 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 307 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 308 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 309 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 310 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 311 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 312 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 313 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 314 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 315 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 316 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 317 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 318 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 319 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 320 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 321 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 322 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 323 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 324 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 325 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 326 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 327 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 328 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 329 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 330 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 331 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 332 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 333 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 334 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 335 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 336 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 337 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 338 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 339 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 340 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 341 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 342 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 343 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 344 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 345 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 346 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 347 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 348 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 349 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 350 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 351 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 352 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 353 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 354 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 355 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 356 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 357 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 358 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 359 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 360 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 361 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 362 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 363 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 364 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.63 |
| Metatranscriptomes | 0 |
| Isolates | 18.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 3.17 |
| Rhizoplane | 6.35 |
| Rhizosphere | 77.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495671_0026647 | 3300046692 | Bacteria | 2994 |
| 2 | MRS2a_Contig_163 | 2124908027 | Bacteria | 31412 |
| 3 | JGI25162J39368_1000060 | 3300002737 | Bacteria | 137745 |
| 4 | JGI25163J39215_1000017 | 3300002771 | Bacteria | 79704 |
| 5 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 6 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 7 | rootH2_10037663 | 3300003320 | Bacteria | 1938 |
| 8 | Ga0055536_1000032 | 3300003781 | Bacteria | 150527 |
| 9 | Ga0055536_1000182 | 3300003781 | Bacteria | 52228 |
| 10 | Ga0055530_10000029 | 3300003791 | Bacteria | 127049 |
| 11 | Ga0055530_10000062 | 3300003791 | Bacteria | 94942 |
| 12 | Ga0055530_10002137 | 3300003791 | Bacteria | 13116 |
| 13 | Ga0055540_1000122 | 3300003792 | Bacteria | 81293 |
| 14 | Ga0055540_1000166 | 3300003792 | Bacteria | 65613 |
| 15 | Ga0055531_10000146 | 3300003794 | Bacteria | 81289 |
| 16 | Ga0065714_10002675 | 3300005288 | Bacteria | 20025 |
| 17 | Ga0065714_10002743 | 3300005288 | Bacteria | 21142 |
| 18 | Ga0065714_10008147 | 3300005288 | Bacteria | 3727 |
| 19 | Ga0065714_10064705 | 3300005288 | Bacteria | 22413 |
| 20 | Ga0065714_10065862 | 3300005288 | Bacteria | 8257 |
| 21 | Ga0065714_10075963 | 3300005288 | Bacteria | 2843 |
| 22 | Ga0065714_10107313 | 3300005288 | Bacteria | 1534 |
| 23 | Ga0065704_10000613 | 3300005289 | Bacteria | 24717 |
| 24 | Ga0065704_10084120 | 3300005289 | Bacteria | 3375 |
| 25 | Ga0070670_100002666 | 3300005331 | Bacteria | 14737 |
| 26 | Ga0070669_100006030 | 3300005353 | Bacteria | 8743 |
| 27 | Ga0070662_100000940 | 3300005457 | Bacteria | 17827 |
| 28 | Ga0068853_100004871 | 3300005539 | Bacteria | 10439 |
| 29 | Ga0068851_10000273 | 3300005834 | Bacteria | 23911 |
| 30 | Ga0075432_10004590 | 3300006058 | Bacteria | 4699 |
| 31 | Ga0075432_10007110 | 3300006058 | Bacteria | 3812 |
| 32 | Ga0075432_10028791 | 3300006058 | Bacteria | 1917 |
| 33 | Ga0075369_10014769 | 3300006186 | Bacteria | 3125 |
| 34 | Ga0079104_1000253 | 3300006946 | Bacteria | 71204 |
| 35 | Ga0079104_1000265 | 3300006946 | Bacteria | 69419 |
| 36 | Ga0079104_1001496 | 3300006946 | Bacteria | 15558 |
| 37 | Ga0079104_1023714 | 3300006946 | Bacteria | 1627 |
| 38 | Ga0099826_10001473 | 3300006948 | Bacteria | 14162 |
| 39 | Ga0105251_10000031 | 3300009011 | Bacteria | 124114 |
| 40 | Ga0105251_10000148 | 3300009011 | Bacteria | 71598 |
| 41 | Ga0105251_10038636 | 3300009011 | Bacteria | 2338 |
| 42 | Ga0105251_10048924 | 3300009011 | Bacteria | 2026 |
| 43 | Ga0105244_10000075 | 3300009036 | Bacteria | 111242 |
| 44 | Ga0105244_10001126 | 3300009036 | Bacteria | 22218 |
| 45 | Ga0105244_10069110 | 3300009036 | Bacteria | 1764 |
| 46 | Ga0105250_10000015 | 3300009092 | Bacteria | 262683 |
| 47 | Ga0105250_10019760 | 3300009092 | Bacteria | 2724 |
| 48 | Ga0105250_10035637 | 3300009092 | Bacteria | 1996 |
| 49 | Ga0105243_10000203 | 3300009148 | Bacteria | 69484 |
| 50 | Ga0105246_10000088 | 3300011119 | Bacteria | 39136 |
| 51 | Ga0105246_10116979 | 3300011119 | Bacteria | 1969 |
| 52 | Ga0157345_1000054 | 3300012498 | Bacteria | 24518 |
| 53 | Ga0157373_10000543 | 3300013100 | Bacteria | 29559 |
| 54 | Ga0157373_10001645 | 3300013100 | Bacteria | 17067 |
| 55 | Ga0157373_10002746 | 3300013100 | Bacteria | 13331 |
| 56 | Ga0157373_10007160 | 3300013100 | Bacteria | 8321 |
| 57 | Ga0157373_10009292 | 3300013100 | Bacteria | 7269 |
| 58 | Ga0157373_10009738 | 3300013100 | Bacteria | 7091 |
| 59 | Ga0157373_10013060 | 3300013100 | Bacteria | 6094 |
| 60 | Ga0157373_10020408 | 3300013100 | Bacteria | 4816 |
| 61 | Ga0157373_10095835 | 3300013100 | Bacteria | 2089 |
| 62 | Ga0157371_10001236 | 3300013102 | Bacteria | 27120 |
| 63 | Ga0157371_10018773 | 3300013102 | Bacteria | 5109 |
| 64 | Ga0157370_10000070 | 3300013104 | Bacteria | 112014 |
| 65 | Ga0157370_10118146 | 3300013104 | Bacteria | 2477 |
| 66 | Ga0157370_10226135 | 3300013104 | Bacteria | 1732 |
| 67 | Ga0157369_10002026 | 3300013105 | Bacteria | 24433 |
| 68 | Ga0157369_10009867 | 3300013105 | Bacteria | 10910 |
| 69 | Ga0157369_10011176 | 3300013105 | Bacteria | 10203 |
| 70 | Ga0157369_10029232 | 3300013105 | Bacteria | 6092 |
| 71 | Ga0157369_10220195 | 3300013105 | Bacteria | 1987 |
| 72 | Ga0163162_10007127 | 3300013306 | Bacteria | 10850 |
| 73 | Ga0163162_10030640 | 3300013306 | Bacteria | 5330 |
| 74 | Ga0157375_10204795 | 3300013308 | Bacteria | 2129 |
| 75 | Ga0157375_10266000 | 3300013308 | Bacteria | 1876 |
| 76 | Ga0182008_10001566 | 3300014497 | Bacteria | 15229 |
| 77 | Ga0182008_10009736 | 3300014497 | Bacteria | 5174 |
| 78 | Ga0182008_10011994 | 3300014497 | Bacteria | 4589 |
| 79 | Ga0182008_10012285 | 3300014497 | Bacteria | 4521 |
| 80 | Ga0182008_10018524 | 3300014497 | Bacteria | 3605 |
| 81 | Ga0182008_10046199 | 3300014497 | Bacteria | 2164 |
| 82 | Ga0182006_1000106 | 3300015261 | Bacteria | 90963 |
| 83 | Ga0182006_1000342 | 3300015261 | Bacteria | 39675 |
| 84 | Ga0182006_1001530 | 3300015261 | Bacteria | 13837 |
| 85 | Ga0182006_1014709 | 3300015261 | Bacteria | 3369 |
| 86 | Ga0182006_1033027 | 3300015261 | Bacteria | 2076 |
| 87 | Ga0182007_10000177 | 3300015262 | Bacteria | 43427 |
| 88 | Ga0182007_10000991 | 3300015262 | Bacteria | 15586 |
| 89 | Ga0182007_10036854 | 3300015262 | Bacteria | 1644 |
| 90 | Ga0182005_1000395 | 3300015265 | Bacteria | 23774 |
| 91 | Ga0182005_1004507 | 3300015265 | Bacteria | 4490 |
| 92 | Ga0182005_1004850 | 3300015265 | Bacteria | 4278 |
| 93 | Ga0163161_10000623 | 3300017792 | Bacteria | 28364 |
| 94 | Ga0163161_10003654 | 3300017792 | Bacteria | 10793 |
| 95 | Ga0163161_10020540 | 3300017792 | Bacteria | 4636 |
| 96 | Ga0163161_10061918 | 3300017792 | Bacteria | 2725 |
| 97 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 98 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 99 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 100 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 101 | Ga0209675_1005017 | 3300025291 | Bacteria | 5674 |
| 102 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 103 | Ga0209676_1000102 | 3300025292 | Bacteria | 227372 |
| 104 | Ga0209676_1000154 | 3300025292 | Bacteria | 166013 |
| 105 | Ga0209676_1003385 | 3300025292 | Bacteria | 9900 |
| 106 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 107 | Ga0209050_1000105 | 3300025298 | Bacteria | 227285 |
| 108 | Ga0209050_1000920 | 3300025298 | Bacteria | 38750 |
| 109 | Ga0209051_1000052 | 3300025303 | Bacteria | 283346 |
| 110 | Ga0209051_1000066 | 3300025303 | Bacteria | 227369 |
| 111 | Ga0209051_1004054 | 3300025303 | Bacteria | 9241 |
| 112 | Ga0209257_1000124 | 3300025304 | Bacteria | 218195 |
| 113 | Ga0209257_1031639 | 3300025304 | Bacteria | 1689 |
| 114 | Ga0207656_10000028 | 3300025321 | Bacteria | 76155 |
| 115 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 116 | Ga0207696_1002423 | 3300025711 | Bacteria | 9153 |
| 117 | Ga0207696_1008729 | 3300025711 | Bacteria | 3843 |
| 118 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 119 | Ga0207655_1001420 | 3300025728 | Bacteria | 22226 |
| 120 | Ga0207655_1003953 | 3300025728 | Bacteria | 10748 |
| 121 | Ga0207713_1000042 | 3300025735 | Bacteria | 242199 |
| 122 | Ga0207713_1000343 | 3300025735 | Bacteria | 51067 |
| 123 | Ga0207713_1001128 | 3300025735 | Bacteria | 22686 |
| 124 | Ga0207713_1001443 | 3300025735 | Bacteria | 18981 |
| 125 | Ga0207681_10001339 | 3300025923 | Bacteria | 15898 |
| 126 | Ga0207650_10000086 | 3300025925 | Bacteria | 123722 |
| 127 | Ga0207706_10000172 | 3300025933 | Bacteria | 72049 |
| 128 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 129 | Ga0207639_10016680 | 3300026041 | Bacteria | 5201 |
| 130 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 131 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 132 | Ga0209281_1000320 | 3300027111 | Bacteria | 84410 |
| 133 | Ga0209281_1002991 | 3300027111 | Bacteria | 6004 |
| 134 | Ga0209281_1015114 | 3300027111 | Bacteria | 1616 |
| 135 | Ga0209282_1016288 | 3300027666 | Bacteria | 4729 |
| 136 | Ga0207428_10012604 | 3300027907 | Bacteria | 7415 |
| 137 | Ga0207428_10041396 | 3300027907 | Bacteria | 3730 |
| 138 | Ga0268256_1015414 | 3300030500 | Bacteria | 2231 |
| 139 | Ga0307511_10067735 | 3300030521 | Bacteria | 2645 |
| 140 | Ga0316181_1143202 | 3300030744 | Bacteria | 1308 |
| 141 | Ga0307408_100000085 | 3300031548 | Bacteria | 104335 |
| 142 | Ga0307408_100025423 | 3300031548 | Bacteria | 4056 |
| 143 | Ga0307408_100034066 | 3300031548 | Bacteria | 3563 |
| 144 | Ga0307408_100048131 | 3300031548 | Bacteria | 3056 |
| 145 | Ga0307405_10029949 | 3300031731 | Bacteria | 3186 |
| 146 | Ga0307405_10032592 | 3300031731 | Bacteria | 3081 |
| 147 | Ga0307413_10006385 | 3300031824 | Bacteria | 5375 |
| 148 | Ga0307412_10002693 | 3300031911 | Bacteria | 9861 |
| 149 | Ga0307412_10038023 | 3300031911 | Bacteria | 3095 |
| 150 | Ga0307412_10048992 | 3300031911 | Bacteria | 2781 |
| 151 | Ga0307414_10012782 | 3300032004 | Bacteria | 4980 |
| 152 | Ga0307411_10037319 | 3300032005 | Bacteria | 3054 |
| 153 | Ga0307510_10006150 | 3300033180 | Bacteria | 14304 |
| 154 | Ga0237819_01159 | 3300038705 | Bacteria | 7512 |
| 155 | Ga0439436_0006496 | 3300041404 | Bacteria | 3589 |
| 156 | Ga0439438_000214 | 3300041405 | Bacteria | 26608 |
| 157 | Ga0439438_001114 | 3300041405 | Bacteria | 11961 |
| 158 | Ga0439438_002049 | 3300041405 | Bacteria | 8776 |
| 159 | Ga0439438_003659 | 3300041405 | Bacteria | 6138 |
| 160 | Ga0439438_004207 | 3300041405 | Bacteria | 5593 |
| 161 | Ga0439438_005130 | 3300041405 | Bacteria | 4874 |
| 162 | Ga0439438_005211 | 3300041405 | Bacteria | 4825 |
| 163 | Ga0439447_000351 | 3300041407 | Bacteria | 16674 |
| 164 | Ga0439447_001046 | 3300041407 | Bacteria | 10068 |
| 165 | Ga0439447_001996 | 3300041407 | Bacteria | 7495 |
| 166 | Ga0439447_006193 | 3300041407 | Bacteria | 3904 |
| 167 | Ga0439447_011108 | 3300041407 | Bacteria | 2642 |
| 168 | Ga0439466_0001949 | 3300041411 | Bacteria | 8093 |
| 169 | Ga0439466_0005954 | 3300041411 | Bacteria | 4641 |
| 170 | Ga0439466_0010724 | 3300041411 | Bacteria | 3402 |
| 171 | Ga0439466_0012774 | 3300041411 | Bacteria | 3084 |
| 172 | Ga0439466_0023164 | 3300041411 | Bacteria | 2186 |
| 173 | Ga0439431_0002570 | 3300041997 | Bacteria | 4007 |
| 174 | Ga0439443_002108 | 3300042003 | Bacteria | 2333 |
| 175 | Ga0439432_002458 | 3300042006 | Bacteria | 6979 |
| 176 | Ga0439432_006706 | 3300042006 | Bacteria | 4102 |
| 177 | Ga0439432_006954 | 3300042006 | Bacteria | 4025 |
| 178 | Ga0439432_009196 | 3300042006 | Bacteria | 3449 |
| 179 | Ga0439432_019084 | 3300042006 | Bacteria | 2287 |
| 180 | Ga0439432_054437 | 3300042006 | Bacteria | 1243 |
| 181 | Ga0439451_001285 | 3300042009 | Bacteria | 4950 |
| 182 | Ga0439451_001310 | 3300042009 | Bacteria | 4914 |
| 183 | Ga0439451_006637 | 3300042009 | Bacteria | 2364 |
| 184 | Ga0439451_009342 | 3300042009 | Bacteria | 1984 |
| 185 | Ga0439452_000093 | 3300042010 | Bacteria | 77343 |
| 186 | Ga0439452_000113 | 3300042010 | Bacteria | 64730 |
| 187 | Ga0439452_000265 | 3300042010 | Bacteria | 34799 |
| 188 | Ga0439452_001383 | 3300042010 | Bacteria | 9977 |
| 189 | Ga0439452_005668 | 3300042010 | Bacteria | 3997 |
| 190 | Ga0439452_010625 | 3300042010 | Bacteria | 2669 |
| 191 | Ga0439452_014016 | 3300042010 | Bacteria | 2236 |
| 192 | Ga0439455_0015143 | 3300042012 | Bacteria | 1770 |
| 193 | Ga0439456_000701 | 3300042013 | Bacteria | 6877 |
| 194 | Ga0439456_004322 | 3300042013 | Bacteria | 2877 |
| 195 | Ga0439463_000586 | 3300042016 | Bacteria | 10157 |
| 196 | Ga0439463_006858 | 3300042016 | Bacteria | 2812 |
| 197 | Ga0450911_000015 | 3300042115 | Bacteria | 109635 |
| 198 | Ga0450911_000115 | 3300042115 | Bacteria | 33100 |
| 199 | Ga0450911_000310 | 3300042115 | Bacteria | 17597 |
| 200 | Ga0450911_000518 | 3300042115 | Bacteria | 12171 |
| 201 | Ga0450911_002299 | 3300042115 | Bacteria | 3825 |
| 202 | Ga0450919_002550 | 3300042121 | Bacteria | 2365 |
| 203 | Ga0450920_000498 | 3300042122 | Bacteria | 6180 |
| 204 | Ga0450922_000140 | 3300042124 | Bacteria | 7480 |
| 205 | Ga0450890_000469 | 3300042127 | Bacteria | 5906 |
| 206 | Ga0450897_000682 | 3300042128 | Bacteria | 1995 |
| 207 | Ga0450898_000233 | 3300042134 | Bacteria | 6045 |
| 208 | Ga0450902_001727 | 3300042137 | Bacteria | 3014 |
| 209 | Ga0450902_007718 | 3300042137 | Bacteria | 1669 |
| 210 | Ga0450903_002190 | 3300042138 | Bacteria | 3494 |
| 211 | Ga0450903_004813 | 3300042138 | Bacteria | 2281 |
| 212 | Ga0450903_005281 | 3300042138 | Bacteria | 2166 |
| 213 | Ga0450904_000022 | 3300042139 | Bacteria | 37057 |
| 214 | Ga0450904_000230 | 3300042139 | Bacteria | 12252 |
| 215 | Ga0450906_000141 | 3300042145 | Bacteria | 13114 |
| 216 | Ga0450906_001974 | 3300042145 | Bacteria | 4484 |
| 217 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 218 | Ga0450907_000991 | 3300042146 | Bacteria | 6691 |
| 219 | Ga0450907_002320 | 3300042146 | Bacteria | 3679 |
| 220 | Ga0450910_001288 | 3300042147 | Bacteria | 3134 |
| 221 | Ga0450910_001905 | 3300042147 | Bacteria | 2698 |
| 222 | Ga0439446_0015076 | 3300042156 | Bacteria | 2141 |
| 223 | Ga0450908_000223 | 3300042184 | Bacteria | 11424 |
| 224 | Ga0450909_000846 | 3300042185 | Bacteria | 4157 |
| 225 | Ga0439434_0000001 | 3300042435 | Bacteria | 86314 |
| 226 | Ga0439434_0008620 | 3300042435 | Bacteria | 2993 |
| 227 | Ga0439460_0001210 | 3300042461 | Bacteria | 6084 |
| 228 | Ga0450918_010680 | 3300042531 | Bacteria | 1602 |
| 229 | Ga0466969_0054489 | 3300044656 | Bacteria | 1958 |
| 230 | Ga0495617_000135 | 3300046452 | Bacteria | 49103 |
| 231 | Ga0495617_000916 | 3300046452 | Bacteria | 13723 |
| 232 | Ga0495617_001640 | 3300046452 | Bacteria | 9629 |
| 233 | Ga0495617_004621 | 3300046452 | Bacteria | 4983 |
| 234 | Ga0495617_006731 | 3300046452 | Bacteria | 4018 |
| 235 | Ga0495617_007069 | 3300046452 | Bacteria | 3914 |
| 236 | Ga0495617_026340 | 3300046452 | Bacteria | 1957 |
| 237 | Ga0495617_034635 | 3300046452 | Bacteria | 1695 |
| 238 | Ga0495627_000647 | 3300046453 | Bacteria | 27096 |
| 239 | Ga0495627_000756 | 3300046453 | Bacteria | 24092 |
| 240 | Ga0495627_000776 | 3300046453 | Bacteria | 23616 |
| 241 | Ga0495627_002056 | 3300046453 | Bacteria | 10263 |
| 242 | Ga0495627_005507 | 3300046453 | Bacteria | 5088 |
| 243 | Ga0495603_0003715 | 3300046455 | Bacteria | 9081 |
| 244 | Ga0495603_0023874 | 3300046455 | Bacteria | 3699 |
| 245 | Ga0495603_0036465 | 3300046455 | Bacteria | 2952 |
| 246 | Ga0495590_0000286 | 3300046457 | Bacteria | 27212 |
| 247 | Ga0495590_0003373 | 3300046457 | Bacteria | 6533 |
| 248 | Ga0495590_0003644 | 3300046457 | Bacteria | 6278 |
| 249 | Ga0495590_0008636 | 3300046457 | Bacteria | 3882 |
| 250 | Ga0495590_0055486 | 3300046457 | Bacteria | 1384 |
| 251 | Ga0495591_000064 | 3300046458 | Bacteria | 123820 |
| 252 | Ga0495591_000121 | 3300046458 | Bacteria | 84919 |
| 253 | Ga0495591_000536 | 3300046458 | Bacteria | 29440 |
| 254 | Ga0495591_000698 | 3300046458 | Bacteria | 24481 |
| 255 | Ga0495591_000747 | 3300046458 | Bacteria | 23512 |
| 256 | Ga0495591_001040 | 3300046458 | Bacteria | 18728 |
| 257 | Ga0495591_003797 | 3300046458 | Bacteria | 7638 |
| 258 | Ga0495591_004337 | 3300046458 | Bacteria | 6987 |
| 259 | Ga0495591_004522 | 3300046458 | Bacteria | 6757 |
| 260 | Ga0495591_008661 | 3300046458 | Bacteria | 4139 |
| 261 | Ga0495591_016697 | 3300046458 | Bacteria | 2545 |
| 262 | Ga0495638_0000871 | 3300046460 | Bacteria | 31342 |
| 263 | Ga0495638_0003790 | 3300046460 | Bacteria | 11748 |
| 264 | Ga0495638_0006223 | 3300046460 | Bacteria | 8712 |
| 265 | Ga0495638_0009745 | 3300046460 | Bacteria | 6708 |
| 266 | Ga0495638_0014637 | 3300046460 | Bacteria | 5292 |
| 267 | Ga0495638_0016441 | 3300046460 | Bacteria | 4955 |
| 268 | Ga0495638_0019401 | 3300046460 | Bacteria | 4500 |
| 269 | Ga0495638_0020068 | 3300046460 | Bacteria | 4417 |
| 270 | Ga0495638_0021251 | 3300046460 | Bacteria | 4280 |
| 271 | Ga0495638_0023553 | 3300046460 | Bacteria | 4025 |
| 272 | Ga0495638_0023623 | 3300046460 | Bacteria | 4017 |
| 273 | Ga0495638_0049747 | 3300046460 | Bacteria | 2619 |
| 274 | Ga0495653_0000461 | 3300046463 | Bacteria | 31721 |
| 275 | Ga0495650_0000557 | 3300046471 | Bacteria | 52926 |
| 276 | Ga0495650_0002692 | 3300046471 | Bacteria | 13800 |
| 277 | Ga0495650_0003386 | 3300046471 | Bacteria | 11677 |
| 278 | Ga0495650_0003676 | 3300046471 | Bacteria | 10989 |
| 279 | Ga0495650_0005315 | 3300046471 | Bacteria | 8416 |
| 280 | Ga0495650_0007466 | 3300046471 | Bacteria | 6561 |
| 281 | Ga0495650_0011260 | 3300046471 | Bacteria | 4914 |
| 282 | Ga0495650_0014313 | 3300046471 | Bacteria | 4136 |
| 283 | Ga0495605_0000057 | 3300046474 | Bacteria | 150333 |
| 284 | Ga0495605_0000698 | 3300046474 | Bacteria | 25090 |
| 285 | Ga0495605_0001956 | 3300046474 | Bacteria | 13070 |
| 286 | Ga0495605_0004754 | 3300046474 | Bacteria | 7938 |
| 287 | Ga0495605_0005985 | 3300046474 | Bacteria | 7029 |
| 288 | Ga0495605_0018910 | 3300046474 | Bacteria | 3688 |
| 289 | Ga0495605_0043499 | 3300046474 | Bacteria | 2226 |
| 290 | Ga0495605_0045769 | 3300046474 | Bacteria | 2154 |
| 291 | Ga0495639_0000032 | 3300046475 | Bacteria | 64548 |
| 292 | Ga0495639_0015253 | 3300046475 | Bacteria | 3331 |
| 293 | Ga0495584_0000286 | 3300046491 | Bacteria | 35701 |
| 294 | Ga0495584_0000481 | 3300046491 | Bacteria | 27434 |
| 295 | Ga0495584_0000719 | 3300046491 | Bacteria | 21817 |
| 296 | Ga0495584_0001172 | 3300046491 | Bacteria | 16118 |
| 297 | Ga0495584_0002123 | 3300046491 | Bacteria | 11352 |
| 298 | Ga0495584_0005775 | 3300046491 | Bacteria | 6528 |
| 299 | Ga0495584_0011599 | 3300046491 | Bacteria | 4514 |
| 300 | Ga0495584_0011638 | 3300046491 | Bacteria | 4504 |
| 301 | Ga0495585_0000030 | 3300046492 | Bacteria | 145184 |
| 302 | Ga0495585_0000165 | 3300046492 | Bacteria | 71444 |
| 303 | Ga0495585_0001689 | 3300046492 | Bacteria | 16864 |
| 304 | Ga0495585_0013909 | 3300046492 | Bacteria | 4701 |
| 305 | Ga0495585_0016008 | 3300046492 | Bacteria | 4348 |
| 306 | Ga0495594_0002903 | 3300046499 | Bacteria | 8915 |
| 307 | Ga0495594_0025569 | 3300046499 | Bacteria | 3174 |
| 308 | Ga0495594_0025911 | 3300046499 | Bacteria | 3153 |
| 309 | Ga0495596_0000056 | 3300046500 | Bacteria | 81755 |
| 310 | Ga0495596_0012842 | 3300046500 | Bacteria | 3572 |
| 311 | Ga0495596_0021817 | 3300046500 | Bacteria | 2609 |
| 312 | Ga0495596_0028081 | 3300046500 | Bacteria | 2259 |
| 313 | Ga0495607_0000058 | 3300046501 | Bacteria | 109864 |
| 314 | Ga0495607_0000702 | 3300046501 | Bacteria | 32246 |
| 315 | Ga0495607_0001961 | 3300046501 | Bacteria | 17373 |
| 316 | Ga0495607_0002414 | 3300046501 | Bacteria | 15246 |
| 317 | Ga0495607_0002783 | 3300046501 | Bacteria | 13933 |
| 318 | Ga0495607_0003390 | 3300046501 | Bacteria | 12218 |
| 319 | Ga0495607_0004759 | 3300046501 | Bacteria | 9925 |
| 320 | Ga0495607_0004988 | 3300046501 | Bacteria | 9630 |
| 321 | Ga0495607_0008114 | 3300046501 | Bacteria | 7209 |
| 322 | Ga0495607_0013633 | 3300046501 | Bacteria | 5319 |
| 323 | Ga0495607_0033139 | 3300046501 | Bacteria | 3145 |
| 324 | Ga0495607_0040036 | 3300046501 | Bacteria | 2793 |
| 325 | Ga0495607_0089437 | 3300046501 | Bacteria | 1671 |
| 326 | Ga0495607_0104385 | 3300046501 | Bacteria | 1512 |
| 327 | Ga0495583_0000483 | 3300046506 | Bacteria | 58302 |
| 328 | Ga0495583_0000788 | 3300046506 | Bacteria | 39445 |
| 329 | Ga0495583_0001540 | 3300046506 | Bacteria | 22821 |
| 330 | Ga0495583_0001617 | 3300046506 | Bacteria | 22083 |
| 331 | Ga0495583_0005914 | 3300046506 | Bacteria | 8134 |
| 332 | Ga0495583_0008193 | 3300046506 | Bacteria | 6423 |
| 333 | Ga0495606_0000743 | 3300046507 | Bacteria | 50416 |
| 334 | Ga0495606_0002429 | 3300046507 | Bacteria | 21709 |
| 335 | Ga0495606_0002495 | 3300046507 | Bacteria | 21252 |
| 336 | Ga0495606_0002616 | 3300046507 | Bacteria | 20556 |
| 337 | Ga0495606_0003284 | 3300046507 | Bacteria | 17312 |
| 338 | Ga0495606_0005906 | 3300046507 | Bacteria | 11507 |
| 339 | Ga0495606_0006645 | 3300046507 | Bacteria | 10605 |
| 340 | Ga0495606_0042861 | 3300046507 | Bacteria | 3023 |
| 341 | Ga0495606_0049673 | 3300046507 | Bacteria | 2748 |
| 342 | Ga0495610_0001186 | 3300046512 | Bacteria | 23573 |
| 343 | Ga0495610_0003744 | 3300046512 | Bacteria | 11642 |
| 344 | Ga0495610_0004037 | 3300046512 | Bacteria | 11047 |
| 345 | Ga0495610_0004666 | 3300046512 | Bacteria | 10025 |
| 346 | Ga0495610_0005939 | 3300046512 | Bacteria | 8549 |
| 347 | Ga0495610_0038252 | 3300046512 | Bacteria | 2436 |
| 348 | Ga0495610_0043821 | 3300046512 | Bacteria | 2225 |
| 349 | Ga0495610_0060432 | 3300046512 | Bacteria | 1804 |
| 350 | Ga0495616_0000696 | 3300046513 | Bacteria | 24901 |
| 351 | Ga0495616_0001239 | 3300046513 | Bacteria | 17954 |
| 352 | Ga0495616_0001778 | 3300046513 | Bacteria | 14662 |
| 353 | Ga0495616_0003042 | 3300046513 | Bacteria | 10859 |
| 354 | Ga0495616_0007689 | 3300046513 | Bacteria | 6444 |
| 355 | Ga0495616_0008881 | 3300046513 | Bacteria | 5911 |
| 356 | Ga0495616_0011867 | 3300046513 | Bacteria | 4965 |
| 357 | Ga0495616_0035318 | 3300046513 | Bacteria | 2588 |
| 358 | Ga0495620_0000166 | 3300046515 | Bacteria | 52419 |
| 359 | Ga0495620_0000574 | 3300046515 | Bacteria | 23138 |
| 360 | Ga0495620_0002002 | 3300046515 | Bacteria | 11906 |
| 361 | Ga0495620_0002328 | 3300046515 | Bacteria | 11013 |
| 362 | Ga0495620_0005792 | 3300046515 | Bacteria | 6862 |
| 363 | Ga0495620_0024417 | 3300046515 | Bacteria | 2874 |
| 364 | Ga0495620_0059460 | 3300046515 | Bacteria | 1597 |
| 365 | Ga0495628_0032984 | 3300046516 | Bacteria | 4177 |
| 366 | Ga0495630_0016569 | 3300046517 | Bacteria | 5389 |
| 367 | Ga0495630_0039004 | 3300046517 | Bacteria | 3552 |
| 368 | Ga0495631_0000018 | 3300046518 | Bacteria | 95764 |
| 369 | Ga0495631_0001878 | 3300046518 | Bacteria | 12389 |
| 370 | Ga0495631_0004217 | 3300046518 | Bacteria | 7689 |
| 371 | Ga0495631_0009392 | 3300046518 | Bacteria | 4886 |
| 372 | Ga0495631_0009721 | 3300046518 | Bacteria | 4794 |
| 373 | Ga0495631_0013063 | 3300046518 | Bacteria | 4039 |
| 374 | Ga0495632_0000281 | 3300046519 | Bacteria | 49992 |
| 375 | Ga0495632_0000629 | 3300046519 | Bacteria | 32489 |
| 376 | Ga0495632_0001086 | 3300046519 | Bacteria | 23313 |
| 377 | Ga0495632_0003908 | 3300046519 | Bacteria | 10356 |
| 378 | Ga0495632_0005057 | 3300046519 | Bacteria | 8820 |
| 379 | Ga0495632_0006314 | 3300046519 | Bacteria | 7648 |
| 380 | Ga0495632_0007703 | 3300046519 | Bacteria | 6726 |
| 381 | Ga0495632_0012950 | 3300046519 | Bacteria | 4782 |
| 382 | Ga0495632_0019042 | 3300046519 | Bacteria | 3748 |
| 383 | Ga0495632_0022190 | 3300046519 | Bacteria | 3405 |
| 384 | Ga0495632_0031857 | 3300046519 | Bacteria | 2721 |
| 385 | Ga0495632_0039712 | 3300046519 | Bacteria | 2373 |
| 386 | Ga0495637_0000037 | 3300046520 | Bacteria | 120732 |
| 387 | Ga0495637_0000134 | 3300046520 | Bacteria | 55462 |
| 388 | Ga0495637_0000141 | 3300046520 | Bacteria | 54791 |
| 389 | Ga0495637_0000652 | 3300046520 | Bacteria | 24207 |
| 390 | Ga0495637_0001084 | 3300046520 | Bacteria | 16857 |
| 391 | Ga0495637_0001361 | 3300046520 | Bacteria | 14686 |
| 392 | Ga0495637_0003179 | 3300046520 | Bacteria | 8771 |
| 393 | Ga0495637_0004110 | 3300046520 | Bacteria | 7584 |
| 394 | Ga0495637_0004969 | 3300046520 | Bacteria | 6844 |
| 395 | Ga0495637_0006239 | 3300046520 | Bacteria | 5994 |
| 396 | Ga0495637_0007097 | 3300046520 | Bacteria | 5578 |
| 397 | Ga0495637_0007217 | 3300046520 | Bacteria | 5528 |
| 398 | Ga0495637_0008921 | 3300046520 | Bacteria | 4906 |
| 399 | Ga0495643_0004153 | 3300046522 | Bacteria | 10286 |
| 400 | Ga0495643_0006213 | 3300046522 | Bacteria | 7923 |
| 401 | Ga0495643_0007105 | 3300046522 | Bacteria | 7264 |
| 402 | Ga0495643_0022657 | 3300046522 | Bacteria | 3580 |
| 403 | Ga0495643_0038639 | 3300046522 | Bacteria | 2613 |
| 404 | Ga0495643_0077791 | 3300046522 | Bacteria | 1732 |
| 405 | Ga0495644_0000102 | 3300046523 | Bacteria | 41286 |
| 406 | Ga0495644_0000864 | 3300046523 | Bacteria | 12524 |
| 407 | Ga0495644_0001461 | 3300046523 | Bacteria | 9643 |
| 408 | Ga0495644_0013882 | 3300046523 | Bacteria | 3087 |
| 409 | Ga0495644_0049915 | 3300046523 | Bacteria | 1570 |
| 410 | Ga0495648_0000377 | 3300046524 | Bacteria | 48820 |
| 411 | Ga0495648_0000695 | 3300046524 | Bacteria | 35872 |
| 412 | Ga0495648_0001525 | 3300046524 | Bacteria | 22656 |
| 413 | Ga0495648_0003029 | 3300046524 | Bacteria | 15043 |
| 414 | Ga0495648_0003349 | 3300046524 | Bacteria | 14125 |
| 415 | Ga0495648_0008610 | 3300046524 | Bacteria | 8002 |
| 416 | Ga0495648_0018959 | 3300046524 | Bacteria | 4853 |
| 417 | Ga0495648_0019289 | 3300046524 | Bacteria | 4800 |
| 418 | Ga0495648_0028235 | 3300046524 | Bacteria | 3741 |
| 419 | Ga0495648_0029208 | 3300046524 | Bacteria | 3662 |
| 420 | Ga0495648_0035214 | 3300046524 | Bacteria | 3247 |
| 421 | Ga0495648_0042837 | 3300046524 | Bacteria | 2844 |
| 422 | Ga0495648_0050572 | 3300046524 | Bacteria | 2537 |
| 423 | Ga0495648_0070602 | 3300046524 | Bacteria | 2028 |
| 424 | Ga0495666_0000610 | 3300046526 | Bacteria | 16047 |
| 425 | Ga0495666_0021549 | 3300046526 | Bacteria | 3190 |
| 426 | Ga0495666_0071535 | 3300046526 | Bacteria | 1648 |
| 427 | Ga0495642_0000016 | 3300046528 | Bacteria | 114282 |
| 428 | Ga0495642_0000030 | 3300046528 | Bacteria | 89032 |
| 429 | Ga0495642_0000885 | 3300046528 | Bacteria | 14126 |
| 430 | Ga0495654_0000288 | 3300046530 | Bacteria | 45799 |
| 431 | Ga0495654_0000764 | 3300046530 | Bacteria | 24919 |
| 432 | Ga0495654_0003316 | 3300046530 | Bacteria | 9913 |
| 433 | Ga0495654_0004901 | 3300046530 | Bacteria | 7877 |
| 434 | Ga0495654_0006448 | 3300046530 | Bacteria | 6668 |
| 435 | Ga0495654_0009348 | 3300046530 | Bacteria | 5372 |
| 436 | Ga0495654_0012594 | 3300046530 | Bacteria | 4540 |
| 437 | Ga0495654_0018346 | 3300046530 | Bacteria | 3668 |
| 438 | Ga0495654_0019061 | 3300046530 | Bacteria | 3590 |
| 439 | Ga0495654_0020018 | 3300046530 | Bacteria | 3494 |
| 440 | Ga0495654_0020396 | 3300046530 | Bacteria | 3454 |
| 441 | Ga0495654_0023908 | 3300046530 | Bacteria | 3161 |
| 442 | Ga0495654_0035231 | 3300046530 | Bacteria | 2522 |
| 443 | Ga0495654_0068442 | 3300046530 | Bacteria | 1687 |
| 444 | Ga0495587_0001872 | 3300046536 | Bacteria | 14000 |
| 445 | Ga0495587_0034095 | 3300046536 | Bacteria | 3070 |
| 446 | Ga0495609_0000075 | 3300046538 | Bacteria | 121584 |
| 447 | Ga0495609_0000665 | 3300046538 | Bacteria | 26632 |
| 448 | Ga0495609_0001539 | 3300046538 | Bacteria | 15130 |
| 449 | Ga0495609_0005548 | 3300046538 | Bacteria | 6590 |
| 450 | Ga0495609_0010227 | 3300046538 | Bacteria | 4507 |
| 451 | Ga0495597_0000818 | 3300046542 | Bacteria | 24528 |
| 452 | Ga0495597_0001083 | 3300046542 | Bacteria | 20671 |
| 453 | Ga0495597_0001603 | 3300046542 | Bacteria | 15887 |
| 454 | Ga0495597_0009154 | 3300046542 | Bacteria | 4913 |
| 455 | Ga0495597_0013299 | 3300046542 | Bacteria | 3947 |
| 456 | Ga0495597_0038794 | 3300046542 | Bacteria | 2134 |
| 457 | Ga0495622_0000425 | 3300046557 | Bacteria | 27845 |
| 458 | Ga0495622_0000508 | 3300046557 | Bacteria | 24105 |
| 459 | Ga0495622_0000950 | 3300046557 | Bacteria | 15527 |
| 460 | Ga0495622_0031789 | 3300046557 | Bacteria | 2465 |
| 461 | Ga0495622_0061625 | 3300046557 | Bacteria | 1736 |
| 462 | Ga0495633_0000784 | 3300046558 | Bacteria | 28455 |
| 463 | Ga0495633_0001091 | 3300046558 | Bacteria | 21908 |
| 464 | Ga0495656_0005662 | 3300046615 | Bacteria | 4324 |
| 465 | Ga0495656_0047086 | 3300046615 | Bacteria | 1827 |
| 466 | Ga0495668_0000176 | 3300046616 | Bacteria | 95098 |
| 467 | Ga0495668_0006430 | 3300046616 | Bacteria | 7689 |
| 468 | Ga0495668_0017828 | 3300046616 | Bacteria | 4113 |
| 469 | Ga0495634_0030193 | 3300046642 | Bacteria | 3746 |
| 470 | Ga0495611_0000349 | 3300046648 | Bacteria | 30120 |
| 471 | Ga0495611_0000353 | 3300046648 | Bacteria | 30055 |
| 472 | Ga0495611_0000584 | 3300046648 | Bacteria | 21088 |
| 473 | Ga0495611_0001851 | 3300046648 | Bacteria | 10088 |
| 474 | Ga0495611_0002581 | 3300046648 | Bacteria | 8203 |
| 475 | Ga0495611_0008942 | 3300046648 | Bacteria | 4236 |
| 476 | Ga0495625_0000089 | 3300046660 | Bacteria | 147075 |
| 477 | Ga0495625_0001577 | 3300046660 | Bacteria | 27107 |
| 478 | Ga0495625_0001820 | 3300046660 | Bacteria | 24404 |
| 479 | Ga0495625_0003404 | 3300046660 | Bacteria | 15909 |
| 480 | Ga0495625_0007837 | 3300046660 | Bacteria | 9203 |
| 481 | Ga0495625_0041587 | 3300046660 | Bacteria | 3345 |
| 482 | Ga0495625_0125798 | 3300046660 | Bacteria | 1740 |
| 483 | Ga0495625_0164479 | 3300046660 | Bacteria | 1484 |
| 484 | Ga0495635_0001792 | 3300046663 | Bacteria | 14509 |
| 485 | Ga0495659_0000123 | 3300046664 | Bacteria | 33987 |
| 486 | Ga0495659_0001934 | 3300046664 | Bacteria | 6827 |
| 487 | Ga0495661_0000101 | 3300046665 | Bacteria | 104928 |
| 488 | Ga0495661_0012211 | 3300046665 | Bacteria | 5801 |
| 489 | Ga0495661_0014214 | 3300046665 | Bacteria | 5334 |
| 490 | Ga0495661_0018448 | 3300046665 | Bacteria | 4589 |
| 491 | Ga0495661_0022712 | 3300046665 | Bacteria | 4078 |
| 492 | Ga0495661_0042985 | 3300046665 | Bacteria | 2781 |
| 493 | Ga0495661_0061731 | 3300046665 | Bacteria | 2223 |
| 494 | Ga0495661_0112951 | 3300046665 | Bacteria | 1511 |
| 495 | Ga0495588_0006252 | 3300046674 | Bacteria | 5353 |
| 496 | Ga0495623_0001437 | 3300046679 | Bacteria | 16145 |
| 497 | Ga0495646_0012187 | 3300046680 | Bacteria | 5466 |
| 498 | Ga0495646_0018419 | 3300046680 | Bacteria | 4422 |
| 499 | Ga0495669_0001317 | 3300046684 | Bacteria | 10272 |
| 500 | Ga0495669_0028927 | 3300046684 | Bacteria | 2429 |
| 501 | Ga0495613_0014000 | 3300046689 | Bacteria | 5954 |
| 502 | Ga0495670_0000080 | 3300046691 | Bacteria | 42734 |
| 503 | Ga0495670_0000269 | 3300046691 | Bacteria | 24362 |
| 504 | Ga0495670_0000564 | 3300046691 | Bacteria | 17685 |
| 505 | Ga0495670_0000871 | 3300046691 | Bacteria | 14645 |
| 506 | Ga0495670_0006697 | 3300046691 | Bacteria | 5665 |
| 507 | Ga0495670_0006871 | 3300046691 | Bacteria | 5599 |
| 508 | Ga0495670_0064369 | 3300046691 | Bacteria | 1847 |
| 509 | Ga0495671_0000061 | 3300046692 | Bacteria | 107050 |
| 510 | Ga0495671_0000171 | 3300046692 | Bacteria | 57447 |
| 511 | Ga0495671_0000773 | 3300046692 | Bacteria | 22987 |
| 512 | Ga0495671_0000912 | 3300046692 | Bacteria | 21020 |
| 513 | Ga0495671_0004723 | 3300046692 | Bacteria | 8053 |
| 514 | Ga0495671_0013715 | 3300046692 | Bacteria | 4379 |
| 515 | Ga0495671_0017023 | 3300046692 | Bacteria | 3872 |
| 516 | Ga0495671_0017910 | 3300046692 | Bacteria | 3766 |
| 517 | Ga0495671_0026079 | 3300046692 | Bacteria | 3032 |
| 518 | Ga0495671_0039570 | 3300046692 | Bacteria | 2380 |
| 519 | Ga0495671_0074806 | 3300046692 | Bacteria | 1661 |
| 520 | Ga0495649_0000244 | 3300046694 | Bacteria | 48008 |
| 521 | Ga0495649_0000848 | 3300046694 | Bacteria | 24561 |
| 522 | Ga0495649_0001145 | 3300046694 | Bacteria | 20661 |
| 523 | Ga0495649_0001189 | 3300046694 | Bacteria | 20107 |
| 524 | Ga0495649_0001392 | 3300046694 | Bacteria | 18265 |
| 525 | Ga0495649_0003063 | 3300046694 | Bacteria | 11437 |
| 526 | Ga0495649_0003731 | 3300046694 | Bacteria | 10127 |
| 527 | Ga0495649_0007913 | 3300046694 | Bacteria | 6432 |
| 528 | Ga0495649_0009725 | 3300046694 | Bacteria | 5696 |
| 529 | Ga0495649_0011246 | 3300046694 | Bacteria | 5258 |
| 530 | Ga0495649_0012758 | 3300046694 | Bacteria | 4873 |
| 531 | Ga0495649_0063231 | 3300046694 | Bacteria | 1988 |
| 532 | Ga0495589_0000222 | 3300046794 | Bacteria | 48332 |
| 533 | Ga0495589_0000637 | 3300046794 | Bacteria | 22968 |
| 534 | Ga0495589_0001776 | 3300046794 | Bacteria | 12260 |
| 535 | Ga0495589_0002235 | 3300046794 | Bacteria | 10876 |
| 536 | Ga0495589_0007117 | 3300046794 | Bacteria | 5862 |
| 537 | Ga0495589_0010236 | 3300046794 | Bacteria | 4874 |
| 538 | Ga0495589_0019884 | 3300046794 | Bacteria | 3435 |
| 539 | Ga0495589_0034554 | 3300046794 | Bacteria | 2537 |
| 540 | Ga0495589_0044640 | 3300046794 | Bacteria | 2203 |
| 541 | Ga0495600_0001498 | 3300046809 | Bacteria | 12947 |
| 542 | Ga0495660_0001089 | 3300046810 | Bacteria | 19438 |
| 543 | Ga0495660_0002805 | 3300046810 | Bacteria | 10977 |
| 544 | Ga0495660_0011193 | 3300046810 | Bacteria | 5208 |
| 545 | Ga0495660_0017092 | 3300046810 | Bacteria | 4177 |
| 546 | Ga0495660_0018671 | 3300046810 | Bacteria | 3984 |
| 547 | Ga0495660_0023456 | 3300046810 | Bacteria | 3518 |
| 548 | Ga0495660_0037952 | 3300046810 | Bacteria | 2681 |
| 549 | Ga0495660_0050593 | 3300046810 | Bacteria | 2263 |
| 550 | Ga0495660_0058696 | 3300046810 | Bacteria | 2071 |
| 551 | Ga0495660_0099793 | 3300046810 | Bacteria | 1496 |
| 552 | Ga0495581_0011859 | 3300047315 | Bacteria | 5044 |
| 553 | Ga0495581_0015201 | 3300047315 | Bacteria | 4467 |
| 554 | Ga0495604_0009276 | 3300047317 | Bacteria | 7787 |
| 555 | Ga0495604_0017535 | 3300047317 | Bacteria | 5733 |
| 556 | Ga0495604_0068487 | 3300047317 | Bacteria | 2693 |
| 557 | Ga0495636_0023822 | 3300047318 | Bacteria | 2480 |
| 558 | Ga0495674_0049432 | 3300047319 | Bacteria | 3716 |
| 559 | Ga0495672_0000474 | 3300047320 | Bacteria | 47544 |
| 560 | Ga0495672_0000728 | 3300047320 | Bacteria | 36149 |
| 561 | Ga0495672_0000841 | 3300047320 | Bacteria | 32658 |
| 562 | Ga0495672_0002771 | 3300047320 | Bacteria | 15677 |
| 563 | Ga0495672_0002974 | 3300047320 | Bacteria | 14912 |
| 564 | Ga0495672_0003472 | 3300047320 | Bacteria | 13474 |
| 565 | Ga0495672_0010756 | 3300047320 | Bacteria | 6494 |
| 566 | Ga0495672_0016599 | 3300047320 | Bacteria | 4955 |
| 567 | Ga0495672_0045002 | 3300047320 | Bacteria | 2644 |
| 568 | Ga0495676_0000020 | 3300047321 | Bacteria | 166813 |
| 569 | Ga0495676_0000745 | 3300047321 | Bacteria | 27073 |
| 570 | Ga0495680_0006721 | 3300047322 | Bacteria | 10636 |
| 571 | Ga0495680_0060976 | 3300047322 | Bacteria | 2903 |
| 572 | Ga0495683_0000131 | 3300047323 | Bacteria | 75476 |
| 573 | Ga0495683_0000156 | 3300047323 | Bacteria | 67301 |
| 574 | Ga0495683_0004735 | 3300047323 | Bacteria | 7647 |
| 575 | Ga0495683_0012877 | 3300047323 | Bacteria | 4385 |
| 576 | Ga0495683_0013860 | 3300047323 | Bacteria | 4207 |
| 577 | Ga0495683_0014611 | 3300047323 | Bacteria | 4091 |
| 578 | Ga0495683_0032660 | 3300047323 | Bacteria | 2650 |
| 579 | Ga0495687_001066 | 3300047443 | Bacteria | 27067 |
| 580 | Ga0495687_001294 | 3300047443 | Bacteria | 23488 |
| 581 | Ga0495687_003856 | 3300047443 | Bacteria | 10550 |
| 582 | Ga0495687_005099 | 3300047443 | Bacteria | 8518 |
| 583 | Ga0495677_0000167 | 3300047445 | Bacteria | 31626 |
| 584 | Ga0495679_000079 | 3300047446 | Bacteria | 90806 |
| 585 | Ga0495679_000608 | 3300047446 | Bacteria | 24243 |
| 586 | Ga0495679_001159 | 3300047446 | Bacteria | 15746 |
| 587 | Ga0495679_005633 | 3300047446 | Bacteria | 5524 |
| 588 | Ga0495679_010062 | 3300047446 | Bacteria | 3741 |
| 589 | Ga0495679_019272 | 3300047446 | Bacteria | 2400 |
| 590 | Ga0495685_033253 | 3300047447 | Bacteria | 1772 |
| 591 | Ga0495673_0000169 | 3300047469 | Bacteria | 107858 |
| 592 | Ga0495673_0000404 | 3300047469 | Bacteria | 50564 |
| 593 | Ga0495673_0000442 | 3300047469 | Bacteria | 45981 |
| 594 | Ga0495673_0000579 | 3300047469 | Bacteria | 36826 |
| 595 | Ga0495673_0001149 | 3300047469 | Bacteria | 22560 |
| 596 | Ga0495673_0001228 | 3300047469 | Bacteria | 21230 |
| 597 | Ga0495673_0001383 | 3300047469 | Bacteria | 19527 |
| 598 | Ga0495673_0001596 | 3300047469 | Bacteria | 17660 |
| 599 | Ga0495673_0002337 | 3300047469 | Bacteria | 13490 |
| 600 | Ga0495673_0005419 | 3300047469 | Bacteria | 7713 |
| 601 | Ga0495673_0005601 | 3300047469 | Bacteria | 7557 |
| 602 | Ga0495673_0006304 | 3300047469 | Bacteria | 6990 |
| 603 | Ga0495673_0014880 | 3300047469 | Bacteria | 4029 |
| 604 | Ga0495673_0016965 | 3300047469 | Bacteria | 3709 |
| 605 | Ga0495673_0023140 | 3300047469 | Bacteria | 3029 |
| 606 | Ga0495673_0027182 | 3300047469 | Bacteria | 2726 |
| 607 | Ga0495673_0028312 | 3300047469 | Bacteria | 2655 |
| 608 | Ga0495681_0000386 | 3300047470 | Bacteria | 34441 |
| 609 | Ga0495681_0000501 | 3300047470 | Bacteria | 30014 |
| 610 | Ga0495681_0000552 | 3300047470 | Bacteria | 28671 |
| 611 | Ga0495681_0000581 | 3300047470 | Bacteria | 27903 |
| 612 | Ga0495681_0000652 | 3300047470 | Bacteria | 26406 |
| 613 | Ga0495681_0000753 | 3300047470 | Bacteria | 24948 |
| 614 | Ga0495681_0000878 | 3300047470 | Bacteria | 23196 |
| 615 | Ga0495681_0001496 | 3300047470 | Bacteria | 17454 |
| 616 | Ga0495681_0002047 | 3300047470 | Bacteria | 14665 |
| 617 | Ga0495681_0002216 | 3300047470 | Bacteria | 13992 |
| 618 | Ga0495681_0012498 | 3300047470 | Bacteria | 4984 |
| 619 | Ga0495681_0013005 | 3300047470 | Bacteria | 4857 |
| 620 | Ga0495681_0014037 | 3300047470 | Bacteria | 4617 |
| 621 | Ga0495681_0021189 | 3300047470 | Bacteria | 3506 |
| 622 | Ga0495684_0151185 | 3300047471 | Bacteria | 1735 |
| 623 | Ga0495686_0000991 | 3300047472 | Bacteria | 34618 |
| 624 | Ga0495686_0001160 | 3300047472 | Bacteria | 30955 |
| 625 | Ga0495686_0005382 | 3300047472 | Bacteria | 10115 |
| 626 | Ga0495686_0050753 | 3300047472 | Bacteria | 2606 |
| 627 | Ga0495686_0050890 | 3300047472 | Bacteria | 2601 |
| 628 | Ga0495686_0087207 | 3300047472 | Bacteria | 1898 |
| 629 | Ga0495593_0000302 | 3300047673 | Bacteria | 26949 |
| 630 | Ga0495593_0005642 | 3300047673 | Bacteria | 7386 |
| 631 | Ga0495593_0006254 | 3300047673 | Bacteria | 6989 |
| 632 | Ga0495593_0057007 | 3300047673 | Bacteria | 2052 |
| 633 | Ga0495626_0000041 | 3300048091 | Bacteria | 172663 |
| 634 | Ga0495626_0000070 | 3300048091 | Bacteria | 137389 |
| 635 | Ga0495626_0000087 | 3300048091 | Bacteria | 122878 |
| 636 | Ga0495626_0000583 | 3300048091 | Bacteria | 36143 |
| 637 | Ga0495626_0000844 | 3300048091 | Bacteria | 27454 |
| 638 | Ga0495626_0000976 | 3300048091 | Bacteria | 24638 |
| 639 | Ga0495626_0001234 | 3300048091 | Bacteria | 21012 |
| 640 | Ga0495626_0002413 | 3300048091 | Bacteria | 13013 |
| 641 | Ga0495626_0002549 | 3300048091 | Bacteria | 12497 |
| 642 | Ga0495626_0005113 | 3300048091 | Bacteria | 7810 |
| 643 | Ga0495626_0028103 | 3300048091 | Bacteria | 2729 |
| 644 | Ga0496102_0002797 | 3300048905 | Bacteria | 14879 |
| 645 | Ga0496103_0001618 | 3300048906 | Bacteria | 14777 |
| 646 | Ga0496109_0106295 | 3300048912 | Bacteria | 2607 |
| 647 | Ga0496110_0011601 | 3300048913 | Bacteria | 7224 |
| 648 | Ga0496110_0135095 | 3300048913 | Bacteria | 2228 |
| 649 | Ga0496111_0119150 | 3300048914 | Bacteria | 1949 |
| 650 | Ga0496111_0125474 | 3300048914 | Bacteria | 1897 |
| 651 | Ga0496112_0254915 | 3300048915 | Bacteria | 1705 |
| 652 | Ga0496116_0001258 | 3300048919 | Bacteria | 29371 |
| 653 | Ga0496116_0001602 | 3300048919 | Bacteria | 24842 |
| 654 | Ga0496116_0003680 | 3300048919 | Bacteria | 15024 |
| 655 | Ga0496116_0022933 | 3300048919 | Bacteria | 4660 |
| 656 | Ga0496117_0004123 | 3300048920 | Bacteria | 16275 |
| 657 | Ga0496117_0005050 | 3300048920 | Bacteria | 14147 |
| 658 | Ga0496117_0007211 | 3300048920 | Bacteria | 10952 |
| 659 | Ga0496117_0059859 | 3300048920 | Bacteria | 2628 |
| 660 | Ga0496117_0076702 | 3300048920 | Bacteria | 2214 |
| 661 | Ga0496118_0004589 | 3300048921 | Bacteria | 16242 |
| 662 | Ga0496118_0006907 | 3300048921 | Bacteria | 12283 |
| 663 | Ga0496118_0009287 | 3300048921 | Bacteria | 9973 |
| 664 | Ga0496118_0073890 | 3300048921 | Bacteria | 2440 |
| 665 | Ga0496118_0094221 | 3300048921 | Bacteria | 2048 |
| 666 | Ga0496119_0041075 | 3300048922 | Bacteria | 2951 |
| 667 | Ga0496119_0079133 | 3300048922 | Bacteria | 1899 |
| 668 | Ga0496120_0016221 | 3300048923 | Bacteria | 4875 |
| 669 | Ga0496120_0052777 | 3300048923 | Bacteria | 2313 |
| 670 | Ga0496121_0004890 | 3300048924 | Bacteria | 17587 |
| 671 | Ga0496121_0006152 | 3300048924 | Bacteria | 15063 |
| 672 | Ga0496121_0010373 | 3300048924 | Bacteria | 10524 |
| 673 | Ga0496121_0034416 | 3300048924 | Bacteria | 4560 |
| 674 | Ga0496121_0126533 | 3300048924 | Bacteria | 1919 |
| 675 | Ga0496122_0000285 | 3300048925 | Bacteria | 113073 |
| 676 | Ga0496122_0004992 | 3300048925 | Bacteria | 16058 |
| 677 | Ga0496122_0006925 | 3300048925 | Bacteria | 12805 |
| 678 | Ga0496122_0063918 | 3300048925 | Bacteria | 2681 |
| 679 | Ga0496122_0114954 | 3300048925 | Bacteria | 1754 |
| 680 | Ga0496123_0000232 | 3300048926 | Bacteria | 113073 |
| 681 | Ga0496123_0003450 | 3300048926 | Bacteria | 17686 |
| 682 | Ga0496123_0085938 | 3300048926 | Bacteria | 1889 |
| 683 | Ga0496124_0000172 | 3300048927 | Bacteria | 130204 |
| 684 | Ga0496124_0001091 | 3300048927 | Bacteria | 42641 |
| 685 | Ga0496124_0003094 | 3300048927 | Bacteria | 20687 |
| 686 | Ga0496124_0016100 | 3300048927 | Bacteria | 7133 |
| 687 | Ga0496124_0022106 | 3300048927 | Bacteria | 5840 |
| 688 | Ga0496124_0083700 | 3300048927 | Bacteria | 2617 |
| 689 | Ga0496124_0133727 | 3300048927 | Bacteria | 1966 |
| 690 | Ga0496125_0023800 | 3300048928 | Bacteria | 5645 |
| 691 | Ga0496125_0070841 | 3300048928 | Bacteria | 2727 |
| 692 | Ga0496125_0088918 | 3300048928 | Bacteria | 2325 |
| 693 | Ga0496126_0002098 | 3300048929 | Bacteria | 27910 |
| 694 | Ga0495678_000406 | 3300049459 | Bacteria | 43574 |
| 695 | Ga0495678_000856 | 3300049459 | Bacteria | 27148 |
| 696 | Ga0495678_000871 | 3300049459 | Bacteria | 26848 |
| 697 | Ga0495678_000894 | 3300049459 | Bacteria | 26433 |
| 698 | Ga0495678_000982 | 3300049459 | Bacteria | 24421 |
| 699 | Ga0495678_001246 | 3300049459 | Bacteria | 20715 |
| 700 | Ga0495678_001362 | 3300049459 | Bacteria | 19487 |
| 701 | Ga0495678_002513 | 3300049459 | Bacteria | 12351 |
| 702 | Ga0495678_003598 | 3300049459 | Bacteria | 9458 |
| 703 | Ga0495678_004286 | 3300049459 | Bacteria | 8323 |
| 704 | Ga0495678_007293 | 3300049459 | Bacteria | 5749 |
| 705 | Ga0495678_010240 | 3300049459 | Bacteria | 4568 |
| 706 | Ga0495678_012697 | 3300049459 | Bacteria | 3982 |
| 707 | Ga0495678_013727 | 3300049459 | Bacteria | 3792 |
| 708 | Ga0495682_0000065 | 3300049460 | Bacteria | 98530 |
| 709 | Ga0495682_0000538 | 3300049460 | Bacteria | 26200 |
| 710 | Ga0495682_0003532 | 3300049460 | Bacteria | 6924 |
| 711 | Ga0495682_0010806 | 3300049460 | Bacteria | 3522 |
| 712 | Ga0501032_0006163 | 3300049569 | Bacteria | 8826 |
| 713 | Ga0501034_0051988 | 3300049571 | Bacteria | 4130 |
| 714 | Ga0501034_0073629 | 3300049571 | Bacteria | 3425 |
| 715 | Ga0501241_000104 | 3300049758 | Bacteria | 18414 |
| 716 | Ga0501269_001008 | 3300049766 | Bacteria | 4022 |
| 717 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 718 | nmdc:mga00v17_34473_c1 | 3300050491 | Bacteria | 3007 |
| 719 | Ga0500572_000111 | 3300053111 | Bacteria | 27156 |
| 720 | Ga0500621_016510 | 3300053126 | Bacteria | 2738 |
| 721 | 2511253236 | 2511231004 | Bacteria | 6669789 |
| 722 | 2511272424 | 2511231007 | Bacteria | 6306603 |
| 723 | 2511278317 | 2511231008 | Bacteria | 6624100 |
| 724 | 2511291400 | 2511231010 | Bacteria | 6373152 |
| 725 | 2511303760 | 2511231012 | Bacteria | 6738011 |
| 726 | 2511314430 | 2511231014 | Bacteria | 6462302 |
| 727 | 2511318993 | 2511231015 | Bacteria | 6598026 |
| 728 | 2511327646 | 2511231016 | Bacteria | 6704427 |
| 729 | 2511335676 | 2511231017 | Bacteria | 6503007 |
| 730 | 2511337956 | 2511231018 | Bacteria | 6436256 |
| 731 | 2511346593 | 2511231019 | Bacteria | 6520662 |
| 732 | 2511350729 | 2511231020 | Bacteria | 6115223 |
| 733 | 2511358438 | 2511231021 | Bacteria | 7302637 |
| 734 | 2511364092 | 2511231022 | Bacteria | 6719296 |
| 735 | 2511416121 | 2511231031 | Bacteria | 6558529 |
| 736 | 2511825695 | 2511231156 | Bacteria | 6845832 |
| 737 | 2512323558 | 2512047018 | Bacteria | 6663241 |
| 738 | 2562464121 | 2561511199 | Bacteria | 5155034 |
| 739 | 2583791806 | 2582580891 | Bacteria | 6800976 |
| 740 | 2597857798 | 2597489887 | Bacteria | 6666321 |
| 741 | 2599399605 | 2599185167 | Bacteria | 6353609 |
| 742 | 2599453752 | 2599185179 | Bacteria | 6611171 |
| 743 | 2599484831 | 2599185185 | Bacteria | 6652270 |
| 744 | 2599502267 | 2599185188 | Bacteria | 6164180 |
| 745 | 2599507413 | 2599185189 | Bacteria | 5862825 |
| 746 | 2599515856 | 2599185190 | Bacteria | 6285678 |
| 747 | 2599519276 | 2599185191 | Bacteria | 6297582 |
| 748 | 2599773124 | 2599185248 | Bacteria | 6696816 |
| 749 | 2599802461 | 2599185257 | Bacteria | 6492581 |
| 750 | 2599884929 | 2599185289 | Bacteria | 6778765 |
| 751 | 2599895234 | 2599185290 | Bacteria | 6289611 |
| 752 | 2599899654 | 2599185291 | Bacteria | 6775623 |
| 753 | 2599932670 | 2599185300 | Bacteria | 6062622 |
| 754 | 2599943426 | 2599185302 | Bacteria | 5954930 |
| 755 | 2599946625 | 2599185303 | Bacteria | 6512725 |
| 756 | 2599954537 | 2599185304 | Bacteria | 5951361 |
| 757 | 2599960745 | 2599185305 | Bacteria | 6748700 |
| 758 | 2599968582 | 2599185306 | Bacteria | 6637356 |
| 759 | 2599976481 | 2599185308 | Bacteria | 6621546 |
| 760 | 2599983850 | 2599185309 | Bacteria | 5969593 |
| 761 | 2599988644 | 2599185310 | Bacteria | 6014457 |
| 762 | 2599992549 | 2599185311 | Bacteria | 6354990 |
| 763 | 2600001452 | 2599185312 | Bacteria | 5912071 |
| 764 | 2600007533 | 2599185313 | Bacteria | 6658188 |
| 765 | 2600010774 | 2599185314 | Bacteria | 6621749 |
| 766 | 2600018239 | 2599185315 | Bacteria | 6771107 |
| 767 | 2600023216 | 2599185316 | Bacteria | 6320029 |
| 768 | 2600030914 | 2599185317 | Bacteria | 6435722 |
| 769 | 2600033818 | 2599185318 | Bacteria | 6961590 |
| 770 | 2600040973 | 2599185319 | Bacteria | 6637840 |
| 771 | 2600048655 | 2599185320 | Bacteria | 5963263 |
| 772 | 2600052759 | 2599185321 | Bacteria | 6764560 |
| 773 | 2600058815 | 2599185322 | Bacteria | 6763055 |
| 774 | 2600067320 | 2599185323 | Bacteria | 6688755 |
| 775 | 2600070679 | 2599185324 | Bacteria | 6590677 |
| 776 | 2600076964 | 2599185325 | Bacteria | 6324919 |
| 777 | 2600360718 | 2600254930 | Bacteria | 6431253 |
| 778 | 2600367685 | 2600254931 | Bacteria | 6734225 |
| 779 | 2601628096 | 2600255283 | Bacteria | 6061572 |
| 780 | 2601691860 | 2600255296 | Bacteria | 5784754 |
| 781 | 2601796015 | 2600255318 | Bacteria | 6383414 |
| 782 | 2602011447 | 2600255389 | Bacteria | 5275336 |
| 783 | 2606075133 | 2603880185 | Bacteria | 6379190 |
| 784 | 2606127996 | 2603880199 | Bacteria | 6377649 |
| 785 | 2624480061 | 2623620443 | Bacteria | 6427864 |
| 786 | 2624491461 | 2623620446 | Bacteria | 6500345 |
| 787 | 2643846180 | 2643221565 | Bacteria | 6216018 |
| 788 | 2643874197 | 2643221571 | Bacteria | 6228673 |
| 789 | 2643953750 | 2643221589 | Bacteria | 6250934 |
| 790 | 2644021683 | 2643221602 | Bacteria | 6249926 |
| 791 | 2644186915 | 2643221633 | Bacteria | 6733554 |
| 792 | 2644286442 | 2643221650 | Bacteria | 7029547 |
| 793 | 2652548359 | 2651869719 | Bacteria | 6047974 |
| 794 | 2671092772 | 2667528170 | Bacteria | 6786960 |
| 795 | 2671125085 | 2667528176 | Bacteria | 6724917 |
| 796 | 2671586959 | 2671180115 | Bacteria | 5353919 |
| 797 | 2671769920 | 2671180172 | Bacteria | 6495783 |
| 798 | 2678262124 | 2675903515 | Bacteria | 6580491 |
| 799 | 2715752745 | 2713897148 | Bacteria | 5883533 |
| 800 | 2715756247 | 2713897149 | Bacteria | 6506249 |
| 801 | 2718633610 | 2718217725 | Bacteria | 5758958 |
| 802 | 2739200121 | 2738543004 | Bacteria | 6381073 |
| 803 | 2739261825 | 2738543015 | Bacteria | 6750701 |
| 804 | 2739287552 | 2738543020 | Bacteria | 5718238 |
| 805 | 2739292865 | 2738543021 | Bacteria | 5718241 |
| 806 | 2739316892 | 2738543025 | Bacteria | 6600348 |
| 807 | 2743737261 | 2740892503 | Bacteria | 6855563 |
| 808 | 2745008472 | 2744054620 | Bacteria | 6551379 |
| 809 | 2774118842 | 2773857670 | Bacteria | 6407454 |
| 810 | 2774134381 | 2773857673 | Bacteria | 6513460 |
| 811 | 2784312480 | 2784132072 | Bacteria | 6596533 |
| 812 | 2792313836 | 2791355010 | Bacteria | 4864581 |
| 813 | 2794594800 | 2791355520 | Bacteria | 5948615 |
| 814 | 2808856321 | 2808606361 | Bacteria | 6136259 |
| 815 | 2808924659 | 2808606376 | Bacteria | 6248667 |
| 816 | 2808930129 | 2808606377 | Bacteria | 6646337 |
| 817 | 2808936869 | 2808606378 | Bacteria | 6177535 |
| 818 | 2808946759 | 2808606380 | Bacteria | 6248705 |
| 819 | 2808952306 | 2808606381 | Bacteria | 6646461 |
| 820 | 2808961830 | 2808606382 | Bacteria | 6841132 |
| 821 | 2808964711 | 2808606383 | Bacteria | 6138645 |
| 822 | 2809000419 | 2808606389 | Bacteria | 6138126 |
| 823 | 2809215415 | 2808606445 | Bacteria | 6057339 |
| 824 | 2825657470 | 2825651385 | Bacteria | 6715909 |
| 825 | 2834033922 | 2834028612 | Bacteria | 6354979 |
| 826 | 2842805852 | 2842805378 | Bacteria | 5385175 |
| 827 | 2842836182 | 2842832357 | Bacteria | 5959113 |
| 828 | 2842839300 | 2842837860 | Bacteria | 6066181 |
| 829 | 2842847121 | 2842843487 | Bacteria | 6004777 |
| 830 | 2842858101 | 2842854478 | Bacteria | 6143501 |
| 831 | 2860342122 | 2860339153 | Bacteria | 6846989 |
| 832 | 2860870575 | 2860867994 | Bacteria | 5645326 |
| 833 | 2878031967 | 2878029506 | Bacteria | 6418441 |
| 834 | 2904522724 | 2904518522 | Bacteria | 6068986 |
| 835 | 2904551932 | 2904550169 | Bacteria | 6221258 |
| 836 | 2913039625 | 2913036834 | Bacteria | 6704877 |
| 837 | 2919068445 | 2919063839 | Bacteria | 6302690 |
| 838 | 2919387487 | 2919385768 | Bacteria | 5897293 |
| 839 | 2919456425 | 2919456309 | Bacteria | 6586567 |
| 840 | 2919484717 | 2919481497 | Bacteria | 6907839 |
| 841 | 2919492421 | 2919487758 | Bacteria | 5929766 |
| 842 | 2919700980 | 2919697872 | Bacteria | 6553725 |
| 843 | 2923156299 | 2923153595 | Bacteria | 6870622 |
| 844 | 2923586419 | 2923586266 | Bacteria | 6565975 |
| 845 | 2929147053 | 2929144301 | Bacteria | 6622272 |
| 846 | 2931369602 | 2931369376 | Bacteria | 6847892 |
| 847 | 2931392995 | 2931390751 | Bacteria | 6273349 |
| 848 | 2931401039 | 2931396565 | Bacteria | 7251677 |
| 849 | 2939641599 | 2939636861 | Bacteria | 6297853 |
| 850 | 2946030964 | 2946027586 | Bacteria | 6049274 |
| 851 | 2947237780 | 2947233263 | Bacteria | 6439278 |
| 852 | 2969306766 | 2969304461 | Bacteria | 6601805 |
| 853 | 2974290444 | 2974289157 | Bacteria | 6080362 |
| 854 | 2984289768 | 2984286254 | Bacteria | 6702062 |
| 855 | 2988728807 | 2988728565 | Bacteria | 6124362 |
| 856 | 2998143408 | 2998139840 | Bacteria | 6073514 |
| 857 | 3000380253 | 3000376612 | Bacteria | 4705565 |
| 858 | 3007395678 | 3007395558 | Bacteria | 6755444 |
| 859 | 3007420273 | 3007419365 | Bacteria | 7026924 |
| 860 | 3007513653 | 3007511990 | Bacteria | 6481491 |
| 861 | 3007619486 | 3007614139 | Bacteria | 6053559 |
| 862 | 3007621682 | 3007619802 | Bacteria | 6411688 |
| 863 | 3007722376 | 3007718800 | Bacteria | 5971527 |
| 864 | 3007857906 | 3007855910 | Bacteria | 5637581 |
| 865 | 3007862619 | 3007861166 | Bacteria | 6045338 |
| 866 | 3007869082 | 3007866637 | Bacteria | 5899198 |
| 867 | 8011354985 | 8011350971 | Bacteria | 6158957 |
| 868 | 8015690492 | 8015687852 | Bacteria | 6613826 |
| 869 | 8019778355 | 8019775933 | Bacteria | 6858656 |
| 870 | 8029997411 | 8029995093 | Bacteria | 5990776 |
| 871 | 8054289052 | 8054285046 | Bacteria | 6919322 |
| 872 | 8054352239 | 8054347763 | Bacteria | 5901107 |
| 873 | 8054846062 | 8054844752 | Bacteria | 4450330 |
| 874 | 8055773620 | 8055770955 | Bacteria | 6827675 |
| 875 | 8055820083 | 8055817908 | Bacteria | 6609162 |
| 876 | 8056128190 | 8056125926 | Bacteria | 6228218 |
| 877 | 8056146251 | 8056143049 | Bacteria | 6307666 |
| 878 | 8056154790 | 8056148874 | Bacteria | 6479865 |
| 879 | 8056157379 | 8056155041 | Bacteria | 6486948 |
| 880 | 8056167804 | 8056166840 | Bacteria | 5820959 |
| 881 | 8056174956 | 8056172158 | Bacteria | 6133900 |
| 882 | 8056178856 | 8056177738 | Bacteria | 6748268 |
| 883 | Ga0495671_0026647 | |||
| 884 | MRS2a_Contig_163 | |||
| 885 | JGI25162J39368_1000060 | |||
| 886 | JGI25163J39215_1000017 | |||
| 887 | JGI25164J39214_1000037 | |||
| 888 | JGI25165J46597_1000118 | |||
| 889 | rootH2_10037663 | |||
| 890 | Ga0055536_1000032 | |||
| 891 | Ga0055536_1000182 | |||
| 892 | Ga0055530_10000029 | |||
| 893 | Ga0055530_10000062 | |||
| 894 | Ga0055530_10002137 | |||
| 895 | Ga0055540_1000122 | |||
| 896 | Ga0055540_1000166 | |||
| 897 | Ga0055531_10000146 | |||
| 898 | Ga0065714_10002675 | |||
| 899 | Ga0065714_10002743 | |||
| 900 | Ga0065714_10008147 | |||
| 901 | Ga0065714_10064705 | |||
| 902 | Ga0065714_10065862 | |||
| 903 | Ga0065714_10075963 | |||
| 904 | Ga0065714_10107313 | |||
| 905 | Ga0065704_10000613 | |||
| 906 | Ga0065704_10084120 | |||
| 907 | Ga0070670_100002666 | |||
| 908 | Ga0070669_100006030 | |||
| 909 | Ga0070662_100000940 | |||
| 910 | Ga0068853_100004871 | |||
| 911 | Ga0068851_10000273 | |||
| 912 | Ga0075432_10004590 | |||
| 913 | Ga0075432_10007110 | |||
| 914 | Ga0075432_10028791 | |||
| 915 | Ga0075369_10014769 | |||
| 916 | Ga0079104_1000253 | |||
| 917 | Ga0079104_1000265 | |||
| 918 | Ga0079104_1001496 | |||
| 919 | Ga0079104_1023714 | |||
| 920 | Ga0099826_10001473 | |||
| 921 | Ga0105251_10000031 | |||
| 922 | Ga0105251_10000148 | |||
| 923 | Ga0105251_10038636 | |||
| 924 | Ga0105251_10048924 | |||
| 925 | Ga0105244_10000075 | |||
| 926 | Ga0105244_10001126 | |||
| 927 | Ga0105244_10069110 | |||
| 928 | Ga0105250_10000015 | |||
| 929 | Ga0105250_10019760 | |||
| 930 | Ga0105250_10035637 | |||
| 931 | Ga0105243_10000203 | |||
| 932 | Ga0105246_10000088 | |||
| 933 | Ga0105246_10116979 | |||
| 934 | Ga0157345_1000054 | |||
| 935 | Ga0157373_10000543 | |||
| 936 | Ga0157373_10001645 | |||
| 937 | Ga0157373_10002746 | |||
| 938 | Ga0157373_10007160 | |||
| 939 | Ga0157373_10009292 | |||
| 940 | Ga0157373_10009738 | |||
| 941 | Ga0157373_10013060 | |||
| 942 | Ga0157373_10020408 | |||
| 943 | Ga0157373_10095835 | |||
| 944 | Ga0157371_10001236 | |||
| 945 | Ga0157371_10018773 | |||
| 946 | Ga0157370_10000070 | |||
| 947 | Ga0157370_10118146 | |||
| 948 | Ga0157370_10226135 | |||
| 949 | Ga0157369_10002026 | |||
| 950 | Ga0157369_10009867 | |||
| 951 | Ga0157369_10011176 | |||
| 952 | Ga0157369_10029232 | |||
| 953 | Ga0157369_10220195 | |||
| 954 | Ga0163162_10007127 | |||
| 955 | Ga0163162_10030640 | |||
| 956 | Ga0157375_10204795 | |||
| 957 | Ga0157375_10266000 | |||
| 958 | Ga0182008_10001566 | |||
| 959 | Ga0182008_10009736 | |||
| 960 | Ga0182008_10011994 | |||
| 961 | Ga0182008_10012285 | |||
| 962 | Ga0182008_10018524 | |||
| 963 | Ga0182008_10046199 | |||
| 964 | Ga0182006_1000106 | |||
| 965 | Ga0182006_1000342 | |||
| 966 | Ga0182006_1001530 | |||
| 967 | Ga0182006_1014709 | |||
| 968 | Ga0182006_1033027 | |||
| 969 | Ga0182007_10000177 | |||
| 970 | Ga0182007_10000991 | |||
| 971 | Ga0182007_10036854 | |||
| 972 | Ga0182005_1000395 | |||
| 973 | Ga0182005_1004507 | |||
| 974 | Ga0182005_1004850 | |||
| 975 | Ga0163161_10000623 | |||
| 976 | Ga0163161_10003654 | |||
| 977 | Ga0163161_10020540 | |||
| 978 | Ga0163161_10061918 | |||
| 979 | Ga0209760_100023 | |||
| 980 | Ga0207427_100018 | |||
| 981 | Ga0209437_100031 | |||
| 982 | Ga0209233_1000012 | |||
| 983 | Ga0209675_1005017 | |||
| 984 | Ga0209676_1000003 | |||
| 985 | Ga0209676_1000102 | |||
| 986 | Ga0209676_1000154 | |||
| 987 | Ga0209676_1003385 | |||
| 988 | Ga0209050_1000004 | |||
| 989 | Ga0209050_1000105 | |||
| 990 | Ga0209050_1000920 | |||
| 991 | Ga0209051_1000052 | |||
| 992 | Ga0209051_1000066 | |||
| 993 | Ga0209051_1004054 | |||
| 994 | Ga0209257_1000124 | |||
| 995 | Ga0209257_1031639 | |||
| 996 | Ga0207656_10000028 | |||
| 997 | Ga0207696_1000017 | |||
| 998 | Ga0207696_1002423 | |||
| 999 | Ga0207696_1008729 | |||
| 1000 | Ga0207655_1000141 | |||
| 1001 | Ga0207655_1001420 | |||
| 1002 | Ga0207655_1003953 | |||
| 1003 | Ga0207713_1000042 | |||
| 1004 | Ga0207713_1000343 | |||
| 1005 | Ga0207713_1001128 | |||
| 1006 | Ga0207713_1001443 | |||
| 1007 | Ga0207681_10001339 | |||
| 1008 | Ga0207650_10000086 | |||
| 1009 | Ga0207706_10000172 | |||
| 1010 | Ga0207709_10000011 | |||
| 1011 | Ga0207639_10016680 | |||
| 1012 | Ga0209281_1000009 | |||
| 1013 | Ga0209281_1000060 | |||
| 1014 | Ga0209281_1000320 | |||
| 1015 | Ga0209281_1002991 | |||
| 1016 | Ga0209281_1015114 | |||
| 1017 | Ga0209282_1016288 | |||
| 1018 | Ga0207428_10012604 | |||
| 1019 | Ga0207428_10041396 | |||
| 1020 | Ga0268256_1015414 | |||
| 1021 | Ga0307511_10067735 | |||
| 1022 | Ga0316181_1143202 | |||
| 1023 | Ga0307408_100000085 | |||
| 1024 | Ga0307408_100025423 | |||
| 1025 | Ga0307408_100034066 | |||
| 1026 | Ga0307408_100048131 | |||
| 1027 | Ga0307405_10029949 | |||
| 1028 | Ga0307405_10032592 | |||
| 1029 | Ga0307413_10006385 | |||
| 1030 | Ga0307412_10002693 | |||
| 1031 | Ga0307412_10038023 | |||
| 1032 | Ga0307412_10048992 | |||
| 1033 | Ga0307414_10012782 | |||
| 1034 | Ga0307411_10037319 | |||
| 1035 | Ga0307510_10006150 | |||
| 1036 | Ga0237819_01159 | |||
| 1037 | Ga0439436_0006496 | |||
| 1038 | Ga0439438_000214 | |||
| 1039 | Ga0439438_001114 | |||
| 1040 | Ga0439438_002049 | |||
| 1041 | Ga0439438_003659 | |||
| 1042 | Ga0439438_004207 | |||
| 1043 | Ga0439438_005130 | |||
| 1044 | Ga0439438_005211 | |||
| 1045 | Ga0439447_000351 | |||
| 1046 | Ga0439447_001046 | |||
| 1047 | Ga0439447_001996 | |||
| 1048 | Ga0439447_006193 | |||
| 1049 | Ga0439447_011108 | |||
| 1050 | Ga0439466_0001949 | |||
| 1051 | Ga0439466_0005954 | |||
| 1052 | Ga0439466_0010724 | |||
| 1053 | Ga0439466_0012774 | |||
| 1054 | Ga0439466_0023164 | |||
| 1055 | Ga0439431_0002570 | |||
| 1056 | Ga0439443_002108 | |||
| 1057 | Ga0439432_002458 | |||
| 1058 | Ga0439432_006706 | |||
| 1059 | Ga0439432_006954 | |||
| 1060 | Ga0439432_009196 | |||
| 1061 | Ga0439432_019084 | |||
| 1062 | Ga0439432_054437 | |||
| 1063 | Ga0439451_001285 | |||
| 1064 | Ga0439451_001310 | |||
| 1065 | Ga0439451_006637 | |||
| 1066 | Ga0439451_009342 | |||
| 1067 | Ga0439452_000093 | |||
| 1068 | Ga0439452_000113 | |||
| 1069 | Ga0439452_000265 | |||
| 1070 | Ga0439452_001383 | |||
| 1071 | Ga0439452_005668 | |||
| 1072 | Ga0439452_010625 | |||
| 1073 | Ga0439452_014016 | |||
| 1074 | Ga0439455_0015143 | |||
| 1075 | Ga0439456_000701 | |||
| 1076 | Ga0439456_004322 | |||
| 1077 | Ga0439463_000586 | |||
| 1078 | Ga0439463_006858 | |||
| 1079 | Ga0450911_000015 | |||
| 1080 | Ga0450911_000115 | |||
| 1081 | Ga0450911_000310 | |||
| 1082 | Ga0450911_000518 | |||
| 1083 | Ga0450911_002299 | |||
| 1084 | Ga0450919_002550 | |||
| 1085 | Ga0450920_000498 | |||
| 1086 | Ga0450922_000140 | |||
| 1087 | Ga0450890_000469 | |||
| 1088 | Ga0450897_000682 | |||
| 1089 | Ga0450898_000233 | |||
| 1090 | Ga0450902_001727 | |||
| 1091 | Ga0450902_007718 | |||
| 1092 | Ga0450903_002190 | |||
| 1093 | Ga0450903_004813 | |||
| 1094 | Ga0450903_005281 | |||
| 1095 | Ga0450904_000022 | |||
| 1096 | Ga0450904_000230 | |||
| 1097 | Ga0450906_000141 | |||
| 1098 | Ga0450906_001974 | |||
| 1099 | Ga0450907_000001 | |||
| 1100 | Ga0450907_000991 | |||
| 1101 | Ga0450907_002320 | |||
| 1102 | Ga0450910_001288 | |||
| 1103 | Ga0450910_001905 | |||
| 1104 | Ga0439446_0015076 | |||
| 1105 | Ga0450908_000223 | |||
| 1106 | Ga0450909_000846 | |||
| 1107 | Ga0439434_0000001 | |||
| 1108 | Ga0439434_0008620 | |||
| 1109 | Ga0439460_0001210 | |||
| 1110 | Ga0450918_010680 | |||
| 1111 | Ga0466969_0054489 | |||
| 1112 | Ga0495617_000135 | |||
| 1113 | Ga0495617_000916 | |||
| 1114 | Ga0495617_001640 | |||
| 1115 | Ga0495617_004621 | |||
| 1116 | Ga0495617_006731 | |||
| 1117 | Ga0495617_007069 | |||
| 1118 | Ga0495617_026340 | |||
| 1119 | Ga0495617_034635 | |||
| 1120 | Ga0495627_000647 | |||
| 1121 | Ga0495627_000756 | |||
| 1122 | Ga0495627_000776 | |||
| 1123 | Ga0495627_002056 | |||
| 1124 | Ga0495627_005507 | |||
| 1125 | Ga0495603_0003715 | |||
| 1126 | Ga0495603_0023874 | |||
| 1127 | Ga0495603_0036465 | |||
| 1128 | Ga0495590_0000286 | |||
| 1129 | Ga0495590_0003373 | |||
| 1130 | Ga0495590_0003644 | |||
| 1131 | Ga0495590_0008636 | |||
| 1132 | Ga0495590_0055486 | |||
| 1133 | Ga0495591_000064 | |||
| 1134 | Ga0495591_000121 | |||
| 1135 | Ga0495591_000536 | |||
| 1136 | Ga0495591_000698 | |||
| 1137 | Ga0495591_000747 | |||
| 1138 | Ga0495591_001040 | |||
| 1139 | Ga0495591_003797 | |||
| 1140 | Ga0495591_004337 | |||
| 1141 | Ga0495591_004522 | |||
| 1142 | Ga0495591_008661 | |||
| 1143 | Ga0495591_016697 | |||
| 1144 | Ga0495638_0000871 | |||
| 1145 | Ga0495638_0003790 | |||
| 1146 | Ga0495638_0006223 | |||
| 1147 | Ga0495638_0009745 | |||
| 1148 | Ga0495638_0014637 | |||
| 1149 | Ga0495638_0016441 | |||
| 1150 | Ga0495638_0019401 | |||
| 1151 | Ga0495638_0020068 | |||
| 1152 | Ga0495638_0021251 | |||
| 1153 | Ga0495638_0023553 | |||
| 1154 | Ga0495638_0023623 | |||
| 1155 | Ga0495638_0049747 | |||
| 1156 | Ga0495653_0000461 | |||
| 1157 | Ga0495650_0000557 | |||
| 1158 | Ga0495650_0002692 | |||
| 1159 | Ga0495650_0003386 | |||
| 1160 | Ga0495650_0003676 | |||
| 1161 | Ga0495650_0005315 | |||
| 1162 | Ga0495650_0007466 | |||
| 1163 | Ga0495650_0011260 | |||
| 1164 | Ga0495650_0014313 | |||
| 1165 | Ga0495605_0000057 | |||
| 1166 | Ga0495605_0000698 | |||
| 1167 | Ga0495605_0001956 | |||
| 1168 | Ga0495605_0004754 | |||
| 1169 | Ga0495605_0005985 | |||
| 1170 | Ga0495605_0018910 | |||
| 1171 | Ga0495605_0043499 | |||
| 1172 | Ga0495605_0045769 | |||
| 1173 | Ga0495639_0000032 | |||
| 1174 | Ga0495639_0015253 | |||
| 1175 | Ga0495584_0000286 | |||
| 1176 | Ga0495584_0000481 | |||
| 1177 | Ga0495584_0000719 | |||
| 1178 | Ga0495584_0001172 | |||
| 1179 | Ga0495584_0002123 | |||
| 1180 | Ga0495584_0005775 | |||
| 1181 | Ga0495584_0011599 | |||
| 1182 | Ga0495584_0011638 | |||
| 1183 | Ga0495585_0000030 | |||
| 1184 | Ga0495585_0000165 | |||
| 1185 | Ga0495585_0001689 | |||
| 1186 | Ga0495585_0013909 | |||
| 1187 | Ga0495585_0016008 | |||
| 1188 | Ga0495594_0002903 | |||
| 1189 | Ga0495594_0025569 | |||
| 1190 | Ga0495594_0025911 | |||
| 1191 | Ga0495596_0000056 | |||
| 1192 | Ga0495596_0012842 | |||
| 1193 | Ga0495596_0021817 | |||
| 1194 | Ga0495596_0028081 | |||
| 1195 | Ga0495607_0000058 | |||
| 1196 | Ga0495607_0000702 | |||
| 1197 | Ga0495607_0001961 | |||
| 1198 | Ga0495607_0002414 | |||
| 1199 | Ga0495607_0002783 | |||
| 1200 | Ga0495607_0003390 | |||
| 1201 | Ga0495607_0004759 | |||
| 1202 | Ga0495607_0004988 | |||
| 1203 | Ga0495607_0008114 | |||
| 1204 | Ga0495607_0013633 | |||
| 1205 | Ga0495607_0033139 | |||
| 1206 | Ga0495607_0040036 | |||
| 1207 | Ga0495607_0089437 | |||
| 1208 | Ga0495607_0104385 | |||
| 1209 | Ga0495583_0000483 | |||
| 1210 | Ga0495583_0000788 | |||
| 1211 | Ga0495583_0001540 | |||
| 1212 | Ga0495583_0001617 | |||
| 1213 | Ga0495583_0005914 | |||
| 1214 | Ga0495583_0008193 | |||
| 1215 | Ga0495606_0000743 | |||
| 1216 | Ga0495606_0002429 | |||
| 1217 | Ga0495606_0002495 | |||
| 1218 | Ga0495606_0002616 | |||
| 1219 | Ga0495606_0003284 | |||
| 1220 | Ga0495606_0005906 | |||
| 1221 | Ga0495606_0006645 | |||
| 1222 | Ga0495606_0042861 | |||
| 1223 | Ga0495606_0049673 | |||
| 1224 | Ga0495610_0001186 | |||
| 1225 | Ga0495610_0003744 | |||
| 1226 | Ga0495610_0004037 | |||
| 1227 | Ga0495610_0004666 | |||
| 1228 | Ga0495610_0005939 | |||
| 1229 | Ga0495610_0038252 | |||
| 1230 | Ga0495610_0043821 | |||
| 1231 | Ga0495610_0060432 | |||
| 1232 | Ga0495616_0000696 | |||
| 1233 | Ga0495616_0001239 | |||
| 1234 | Ga0495616_0001778 | |||
| 1235 | Ga0495616_0003042 | |||
| 1236 | Ga0495616_0007689 | |||
| 1237 | Ga0495616_0008881 | |||
| 1238 | Ga0495616_0011867 | |||
| 1239 | Ga0495616_0035318 | |||
| 1240 | Ga0495620_0000166 | |||
| 1241 | Ga0495620_0000574 | |||
| 1242 | Ga0495620_0002002 | |||
| 1243 | Ga0495620_0002328 | |||
| 1244 | Ga0495620_0005792 | |||
| 1245 | Ga0495620_0024417 | |||
| 1246 | Ga0495620_0059460 | |||
| 1247 | Ga0495628_0032984 | |||
| 1248 | Ga0495630_0016569 | |||
| 1249 | Ga0495630_0039004 | |||
| 1250 | Ga0495631_0000018 | |||
| 1251 | Ga0495631_0001878 | |||
| 1252 | Ga0495631_0004217 | |||
| 1253 | Ga0495631_0009392 | |||
| 1254 | Ga0495631_0009721 | |||
| 1255 | Ga0495631_0013063 | |||
| 1256 | Ga0495632_0000281 | |||
| 1257 | Ga0495632_0000629 | |||
| 1258 | Ga0495632_0001086 | |||
| 1259 | Ga0495632_0003908 | |||
| 1260 | Ga0495632_0005057 | |||
| 1261 | Ga0495632_0006314 | |||
| 1262 | Ga0495632_0007703 | |||
| 1263 | Ga0495632_0012950 | |||
| 1264 | Ga0495632_0019042 | |||
| 1265 | Ga0495632_0022190 | |||
| 1266 | Ga0495632_0031857 | |||
| 1267 | Ga0495632_0039712 | |||
| 1268 | Ga0495637_0000037 | |||
| 1269 | Ga0495637_0000134 | |||
| 1270 | Ga0495637_0000141 | |||
| 1271 | Ga0495637_0000652 | |||
| 1272 | Ga0495637_0001084 | |||
| 1273 | Ga0495637_0001361 | |||
| 1274 | Ga0495637_0003179 | |||
| 1275 | Ga0495637_0004110 | |||
| 1276 | Ga0495637_0004969 | |||
| 1277 | Ga0495637_0006239 | |||
| 1278 | Ga0495637_0007097 | |||
| 1279 | Ga0495637_0007217 | |||
| 1280 | Ga0495637_0008921 | |||
| 1281 | Ga0495643_0004153 | |||
| 1282 | Ga0495643_0006213 | |||
| 1283 | Ga0495643_0007105 | |||
| 1284 | Ga0495643_0022657 | |||
| 1285 | Ga0495643_0038639 | |||
| 1286 | Ga0495643_0077791 | |||
| 1287 | Ga0495644_0000102 | |||
| 1288 | Ga0495644_0000864 | |||
| 1289 | Ga0495644_0001461 | |||
| 1290 | Ga0495644_0013882 | |||
| 1291 | Ga0495644_0049915 | |||
| 1292 | Ga0495648_0000377 | |||
| 1293 | Ga0495648_0000695 | |||
| 1294 | Ga0495648_0001525 | |||
| 1295 | Ga0495648_0003029 | |||
| 1296 | Ga0495648_0003349 | |||
| 1297 | Ga0495648_0008610 | |||
| 1298 | Ga0495648_0018959 | |||
| 1299 | Ga0495648_0019289 | |||
| 1300 | Ga0495648_0028235 | |||
| 1301 | Ga0495648_0029208 | |||
| 1302 | Ga0495648_0035214 | |||
| 1303 | Ga0495648_0042837 | |||
| 1304 | Ga0495648_0050572 | |||
| 1305 | Ga0495648_0070602 | |||
| 1306 | Ga0495666_0000610 | |||
| 1307 | Ga0495666_0021549 | |||
| 1308 | Ga0495666_0071535 | |||
| 1309 | Ga0495642_0000016 | |||
| 1310 | Ga0495642_0000030 | |||
| 1311 | Ga0495642_0000885 | |||
| 1312 | Ga0495654_0000288 | |||
| 1313 | Ga0495654_0000764 | |||
| 1314 | Ga0495654_0003316 | |||
| 1315 | Ga0495654_0004901 | |||
| 1316 | Ga0495654_0006448 | |||
| 1317 | Ga0495654_0009348 | |||
| 1318 | Ga0495654_0012594 | |||
| 1319 | Ga0495654_0018346 | |||
| 1320 | Ga0495654_0019061 | |||
| 1321 | Ga0495654_0020018 | |||
| 1322 | Ga0495654_0020396 | |||
| 1323 | Ga0495654_0023908 | |||
| 1324 | Ga0495654_0035231 | |||
| 1325 | Ga0495654_0068442 | |||
| 1326 | Ga0495587_0001872 | |||
| 1327 | Ga0495587_0034095 | |||
| 1328 | Ga0495609_0000075 | |||
| 1329 | Ga0495609_0000665 | |||
| 1330 | Ga0495609_0001539 | |||
| 1331 | Ga0495609_0005548 | |||
| 1332 | Ga0495609_0010227 | |||
| 1333 | Ga0495597_0000818 | |||
| 1334 | Ga0495597_0001083 | |||
| 1335 | Ga0495597_0001603 | |||
| 1336 | Ga0495597_0009154 | |||
| 1337 | Ga0495597_0013299 | |||
| 1338 | Ga0495597_0038794 | |||
| 1339 | Ga0495622_0000425 | |||
| 1340 | Ga0495622_0000508 | |||
| 1341 | Ga0495622_0000950 | |||
| 1342 | Ga0495622_0031789 | |||
| 1343 | Ga0495622_0061625 | |||
| 1344 | Ga0495633_0000784 | |||
| 1345 | Ga0495633_0001091 | |||
| 1346 | Ga0495656_0005662 | |||
| 1347 | Ga0495656_0047086 | |||
| 1348 | Ga0495668_0000176 | |||
| 1349 | Ga0495668_0006430 | |||
| 1350 | Ga0495668_0017828 | |||
| 1351 | Ga0495634_0030193 | |||
| 1352 | Ga0495611_0000349 | |||
| 1353 | Ga0495611_0000353 | |||
| 1354 | Ga0495611_0000584 | |||
| 1355 | Ga0495611_0001851 | |||
| 1356 | Ga0495611_0002581 | |||
| 1357 | Ga0495611_0008942 | |||
| 1358 | Ga0495625_0000089 | |||
| 1359 | Ga0495625_0001577 | |||
| 1360 | Ga0495625_0001820 | |||
| 1361 | Ga0495625_0003404 | |||
| 1362 | Ga0495625_0007837 | |||
| 1363 | Ga0495625_0041587 | |||
| 1364 | Ga0495625_0125798 | |||
| 1365 | Ga0495625_0164479 | |||
| 1366 | Ga0495635_0001792 | |||
| 1367 | Ga0495659_0000123 | |||
| 1368 | Ga0495659_0001934 | |||
| 1369 | Ga0495661_0000101 | |||
| 1370 | Ga0495661_0012211 | |||
| 1371 | Ga0495661_0014214 | |||
| 1372 | Ga0495661_0018448 | |||
| 1373 | Ga0495661_0022712 | |||
| 1374 | Ga0495661_0042985 | |||
| 1375 | Ga0495661_0061731 | |||
| 1376 | Ga0495661_0112951 | |||
| 1377 | Ga0495588_0006252 | |||
| 1378 | Ga0495623_0001437 | |||
| 1379 | Ga0495646_0012187 | |||
| 1380 | Ga0495646_0018419 | |||
| 1381 | Ga0495669_0001317 | |||
| 1382 | Ga0495669_0028927 | |||
| 1383 | Ga0495613_0014000 | |||
| 1384 | Ga0495670_0000080 | |||
| 1385 | Ga0495670_0000269 | |||
| 1386 | Ga0495670_0000564 | |||
| 1387 | Ga0495670_0000871 | |||
| 1388 | Ga0495670_0006697 | |||
| 1389 | Ga0495670_0006871 | |||
| 1390 | Ga0495670_0064369 | |||
| 1391 | Ga0495671_0000061 | |||
| 1392 | Ga0495671_0000171 | |||
| 1393 | Ga0495671_0000773 | |||
| 1394 | Ga0495671_0000912 | |||
| 1395 | Ga0495671_0004723 | |||
| 1396 | Ga0495671_0013715 | |||
| 1397 | Ga0495671_0017023 | |||
| 1398 | Ga0495671_0017910 | |||
| 1399 | Ga0495671_0026079 | |||
| 1400 | Ga0495671_0039570 | |||
| 1401 | Ga0495671_0074806 | |||
| 1402 | Ga0495649_0000244 | |||
| 1403 | Ga0495649_0000848 | |||
| 1404 | Ga0495649_0001145 | |||
| 1405 | Ga0495649_0001189 | |||
| 1406 | Ga0495649_0001392 | |||
| 1407 | Ga0495649_0003063 | |||
| 1408 | Ga0495649_0003731 | |||
| 1409 | Ga0495649_0007913 | |||
| 1410 | Ga0495649_0009725 | |||
| 1411 | Ga0495649_0011246 | |||
| 1412 | Ga0495649_0012758 | |||
| 1413 | Ga0495649_0063231 | |||
| 1414 | Ga0495589_0000222 | |||
| 1415 | Ga0495589_0000637 | |||
| 1416 | Ga0495589_0001776 | |||
| 1417 | Ga0495589_0002235 | |||
| 1418 | Ga0495589_0007117 | |||
| 1419 | Ga0495589_0010236 | |||
| 1420 | Ga0495589_0019884 | |||
| 1421 | Ga0495589_0034554 | |||
| 1422 | Ga0495589_0044640 | |||
| 1423 | Ga0495600_0001498 | |||
| 1424 | Ga0495660_0001089 | |||
| 1425 | Ga0495660_0002805 | |||
| 1426 | Ga0495660_0011193 | |||
| 1427 | Ga0495660_0017092 | |||
| 1428 | Ga0495660_0018671 | |||
| 1429 | Ga0495660_0023456 | |||
| 1430 | Ga0495660_0037952 | |||
| 1431 | Ga0495660_0050593 | |||
| 1432 | Ga0495660_0058696 | |||
| 1433 | Ga0495660_0099793 | |||
| 1434 | Ga0495581_0011859 | |||
| 1435 | Ga0495581_0015201 | |||
| 1436 | Ga0495604_0009276 | |||
| 1437 | Ga0495604_0017535 | |||
| 1438 | Ga0495604_0068487 | |||
| 1439 | Ga0495636_0023822 | |||
| 1440 | Ga0495674_0049432 | |||
| 1441 | Ga0495672_0000474 | |||
| 1442 | Ga0495672_0000728 | |||
| 1443 | Ga0495672_0000841 | |||
| 1444 | Ga0495672_0002771 | |||
| 1445 | Ga0495672_0002974 | |||
| 1446 | Ga0495672_0003472 | |||
| 1447 | Ga0495672_0010756 | |||
| 1448 | Ga0495672_0016599 | |||
| 1449 | Ga0495672_0045002 | |||
| 1450 | Ga0495676_0000020 | |||
| 1451 | Ga0495676_0000745 | |||
| 1452 | Ga0495680_0006721 | |||
| 1453 | Ga0495680_0060976 | |||
| 1454 | Ga0495683_0000131 | |||
| 1455 | Ga0495683_0000156 | |||
| 1456 | Ga0495683_0004735 | |||
| 1457 | Ga0495683_0012877 | |||
| 1458 | Ga0495683_0013860 | |||
| 1459 | Ga0495683_0014611 | |||
| 1460 | Ga0495683_0032660 | |||
| 1461 | Ga0495687_001066 | |||
| 1462 | Ga0495687_001294 | |||
| 1463 | Ga0495687_003856 | |||
| 1464 | Ga0495687_005099 | |||
| 1465 | Ga0495677_0000167 | |||
| 1466 | Ga0495679_000079 | |||
| 1467 | Ga0495679_000608 | |||
| 1468 | Ga0495679_001159 | |||
| 1469 | Ga0495679_005633 | |||
| 1470 | Ga0495679_010062 | |||
| 1471 | Ga0495679_019272 | |||
| 1472 | Ga0495685_033253 | |||
| 1473 | Ga0495673_0000169 | |||
| 1474 | Ga0495673_0000404 | |||
| 1475 | Ga0495673_0000442 | |||
| 1476 | Ga0495673_0000579 | |||
| 1477 | Ga0495673_0001149 | |||
| 1478 | Ga0495673_0001228 | |||
| 1479 | Ga0495673_0001383 | |||
| 1480 | Ga0495673_0001596 | |||
| 1481 | Ga0495673_0002337 | |||
| 1482 | Ga0495673_0005419 | |||
| 1483 | Ga0495673_0005601 | |||
| 1484 | Ga0495673_0006304 | |||
| 1485 | Ga0495673_0014880 | |||
| 1486 | Ga0495673_0016965 | |||
| 1487 | Ga0495673_0023140 | |||
| 1488 | Ga0495673_0027182 | |||
| 1489 | Ga0495673_0028312 | |||
| 1490 | Ga0495681_0000386 | |||
| 1491 | Ga0495681_0000501 | |||
| 1492 | Ga0495681_0000552 | |||
| 1493 | Ga0495681_0000581 | |||
| 1494 | Ga0495681_0000652 | |||
| 1495 | Ga0495681_0000753 | |||
| 1496 | Ga0495681_0000878 | |||
| 1497 | Ga0495681_0001496 | |||
| 1498 | Ga0495681_0002047 | |||
| 1499 | Ga0495681_0002216 | |||
| 1500 | Ga0495681_0012498 | |||
| 1501 | Ga0495681_0013005 | |||
| 1502 | Ga0495681_0014037 | |||
| 1503 | Ga0495681_0021189 | |||
| 1504 | Ga0495684_0151185 | |||
| 1505 | Ga0495686_0000991 | |||
| 1506 | Ga0495686_0001160 | |||
| 1507 | Ga0495686_0005382 | |||
| 1508 | Ga0495686_0050753 | |||
| 1509 | Ga0495686_0050890 | |||
| 1510 | Ga0495686_0087207 | |||
| 1511 | Ga0495593_0000302 | |||
| 1512 | Ga0495593_0005642 | |||
| 1513 | Ga0495593_0006254 | |||
| 1514 | Ga0495593_0057007 | |||
| 1515 | Ga0495626_0000041 | |||
| 1516 | Ga0495626_0000070 | |||
| 1517 | Ga0495626_0000087 | |||
| 1518 | Ga0495626_0000583 | |||
| 1519 | Ga0495626_0000844 | |||
| 1520 | Ga0495626_0000976 | |||
| 1521 | Ga0495626_0001234 | |||
| 1522 | Ga0495626_0002413 | |||
| 1523 | Ga0495626_0002549 | |||
| 1524 | Ga0495626_0005113 | |||
| 1525 | Ga0495626_0028103 | |||
| 1526 | Ga0496102_0002797 | |||
| 1527 | Ga0496103_0001618 | |||
| 1528 | Ga0496109_0106295 | |||
| 1529 | Ga0496110_0011601 | |||
| 1530 | Ga0496110_0135095 | |||
| 1531 | Ga0496111_0119150 | |||
| 1532 | Ga0496111_0125474 | |||
| 1533 | Ga0496112_0254915 | |||
| 1534 | Ga0496116_0001258 | |||
| 1535 | Ga0496116_0001602 | |||
| 1536 | Ga0496116_0003680 | |||
| 1537 | Ga0496116_0022933 | |||
| 1538 | Ga0496117_0004123 | |||
| 1539 | Ga0496117_0005050 | |||
| 1540 | Ga0496117_0007211 | |||
| 1541 | Ga0496117_0059859 | |||
| 1542 | Ga0496117_0076702 | |||
| 1543 | Ga0496118_0004589 | |||
| 1544 | Ga0496118_0006907 | |||
| 1545 | Ga0496118_0009287 | |||
| 1546 | Ga0496118_0073890 | |||
| 1547 | Ga0496118_0094221 | |||
| 1548 | Ga0496119_0041075 | |||
| 1549 | Ga0496119_0079133 | |||
| 1550 | Ga0496120_0016221 | |||
| 1551 | Ga0496120_0052777 | |||
| 1552 | Ga0496121_0004890 | |||
| 1553 | Ga0496121_0006152 | |||
| 1554 | Ga0496121_0010373 | |||
| 1555 | Ga0496121_0034416 | |||
| 1556 | Ga0496121_0126533 | |||
| 1557 | Ga0496122_0000285 | |||
| 1558 | Ga0496122_0004992 | |||
| 1559 | Ga0496122_0006925 | |||
| 1560 | Ga0496122_0063918 | |||
| 1561 | Ga0496122_0114954 | |||
| 1562 | Ga0496123_0000232 | |||
| 1563 | Ga0496123_0003450 | |||
| 1564 | Ga0496123_0085938 | |||
| 1565 | Ga0496124_0000172 | |||
| 1566 | Ga0496124_0001091 | |||
| 1567 | Ga0496124_0003094 | |||
| 1568 | Ga0496124_0016100 | |||
| 1569 | Ga0496124_0022106 | |||
| 1570 | Ga0496124_0083700 | |||
| 1571 | Ga0496124_0133727 | |||
| 1572 | Ga0496125_0023800 | |||
| 1573 | Ga0496125_0070841 | |||
| 1574 | Ga0496125_0088918 | |||
| 1575 | Ga0496126_0002098 | |||
| 1576 | Ga0495678_000406 | |||
| 1577 | Ga0495678_000856 | |||
| 1578 | Ga0495678_000871 | |||
| 1579 | Ga0495678_000894 | |||
| 1580 | Ga0495678_000982 | |||
| 1581 | Ga0495678_001246 | |||
| 1582 | Ga0495678_001362 | |||
| 1583 | Ga0495678_002513 | |||
| 1584 | Ga0495678_003598 | |||
| 1585 | Ga0495678_004286 | |||
| 1586 | Ga0495678_007293 | |||
| 1587 | Ga0495678_010240 | |||
| 1588 | Ga0495678_012697 | |||
| 1589 | Ga0495678_013727 | |||
| 1590 | Ga0495682_0000065 | |||
| 1591 | Ga0495682_0000538 | |||
| 1592 | Ga0495682_0003532 | |||
| 1593 | Ga0495682_0010806 | |||
| 1594 | Ga0501032_0006163 | |||
| 1595 | Ga0501034_0051988 | |||
| 1596 | Ga0501034_0073629 | |||
| 1597 | Ga0501241_000104 | |||
| 1598 | Ga0501269_001008 | |||
| 1599 | Ga0501226_000009 | |||
| 1600 | nmdc:mga00v17_34473_c1 | |||
| 1601 | Ga0500572_000111 | |||
| 1602 | Ga0500621_016510 | |||
| 1603 | 2511253236 | |||
| 1604 | 2511272424 | |||
| 1605 | 2511278317 | |||
| 1606 | 2511291400 | |||
| 1607 | 2511303760 | |||
| 1608 | 2511314430 | |||
| 1609 | 2511318993 | |||
| 1610 | 2511327646 | |||
| 1611 | 2511335676 | |||
| 1612 | 2511337956 | |||
| 1613 | 2511346593 | |||
| 1614 | 2511350729 | |||
| 1615 | 2511358438 | |||
| 1616 | 2511364092 | |||
| 1617 | 2511416121 | |||
| 1618 | 2511825695 | |||
| 1619 | 2512323558 | |||
| 1620 | 2562464121 | |||
| 1621 | 2583791806 | |||
| 1622 | 2597857798 | |||
| 1623 | 2599399605 | |||
| 1624 | 2599453752 | |||
| 1625 | 2599484831 | |||
| 1626 | 2599502267 | |||
| 1627 | 2599507413 | |||
| 1628 | 2599515856 | |||
| 1629 | 2599519276 | |||
| 1630 | 2599773124 | |||
| 1631 | 2599802461 | |||
| 1632 | 2599884929 | |||
| 1633 | 2599895234 | |||
| 1634 | 2599899654 | |||
| 1635 | 2599932670 | |||
| 1636 | 2599943426 | |||
| 1637 | 2599946625 | |||
| 1638 | 2599954537 | |||
| 1639 | 2599960745 | |||
| 1640 | 2599968582 | |||
| 1641 | 2599976481 | |||
| 1642 | 2599983850 | |||
| 1643 | 2599988644 | |||
| 1644 | 2599992549 | |||
| 1645 | 2600001452 | |||
| 1646 | 2600007533 | |||
| 1647 | 2600010774 | |||
| 1648 | 2600018239 | |||
| 1649 | 2600023216 | |||
| 1650 | 2600030914 | |||
| 1651 | 2600033818 | |||
| 1652 | 2600040973 | |||
| 1653 | 2600048655 | |||
| 1654 | 2600052759 | |||
| 1655 | 2600058815 | |||
| 1656 | 2600067320 | |||
| 1657 | 2600070679 | |||
| 1658 | 2600076964 | |||
| 1659 | 2600360718 | |||
| 1660 | 2600367685 | |||
| 1661 | 2601628096 | |||
| 1662 | 2601691860 | |||
| 1663 | 2601796015 | |||
| 1664 | 2602011447 | |||
| 1665 | 2606075133 | |||
| 1666 | 2606127996 | |||
| 1667 | 2624480061 | |||
| 1668 | 2624491461 | |||
| 1669 | 2643846180 | |||
| 1670 | 2643874197 | |||
| 1671 | 2643953750 | |||
| 1672 | 2644021683 | |||
| 1673 | 2644186915 | |||
| 1674 | 2644286442 | |||
| 1675 | 2652548359 | |||
| 1676 | 2671092772 | |||
| 1677 | 2671125085 | |||
| 1678 | 2671586959 | |||
| 1679 | 2671769920 | |||
| 1680 | 2678262124 | |||
| 1681 | 2715752745 | |||
| 1682 | 2715756247 | |||
| 1683 | 2718633610 | |||
| 1684 | 2739200121 | |||
| 1685 | 2739261825 | |||
| 1686 | 2739287552 | |||
| 1687 | 2739292865 | |||
| 1688 | 2739316892 | |||
| 1689 | 2743737261 | |||
| 1690 | 2745008472 | |||
| 1691 | 2774118842 | |||
| 1692 | 2774134381 | |||
| 1693 | 2784312480 | |||
| 1694 | 2792313836 | |||
| 1695 | 2794594800 | |||
| 1696 | 2808856321 | |||
| 1697 | 2808924659 | |||
| 1698 | 2808930129 | |||
| 1699 | 2808936869 | |||
| 1700 | 2808946759 | |||
| 1701 | 2808952306 | |||
| 1702 | 2808961830 | |||
| 1703 | 2808964711 | |||
| 1704 | 2809000419 | |||
| 1705 | 2809215415 | |||
| 1706 | 2825657470 | |||
| 1707 | 2834033922 | |||
| 1708 | 2842805852 | |||
| 1709 | 2842836182 | |||
| 1710 | 2842839300 | |||
| 1711 | 2842847121 | |||
| 1712 | 2842858101 | |||
| 1713 | 2860342122 | |||
| 1714 | 2860870575 | |||
| 1715 | 2878031967 | |||
| 1716 | 2904522724 | |||
| 1717 | 2904551932 | |||
| 1718 | 2913039625 | |||
| 1719 | 2919068445 | |||
| 1720 | 2919387487 | |||
| 1721 | 2919456425 | |||
| 1722 | 2919484717 | |||
| 1723 | 2919492421 | |||
| 1724 | 2919700980 | |||
| 1725 | 2923156299 | |||
| 1726 | 2923586419 | |||
| 1727 | 2929147053 | |||
| 1728 | 2931369602 | |||
| 1729 | 2931392995 | |||
| 1730 | 2931401039 | |||
| 1731 | 2939641599 | |||
| 1732 | 2946030964 | |||
| 1733 | 2947237780 | |||
| 1734 | 2969306766 | |||
| 1735 | 2974290444 | |||
| 1736 | 2984289768 | |||
| 1737 | 2988728807 | |||
| 1738 | 2998143408 | |||
| 1739 | 3000380253 | |||
| 1740 | 3007395678 | |||
| 1741 | 3007420273 | |||
| 1742 | 3007513653 | |||
| 1743 | 3007619486 | |||
| 1744 | 3007621682 | |||
| 1745 | 3007722376 | |||
| 1746 | 3007857906 | |||
| 1747 | 3007862619 | |||
| 1748 | 3007869082 | |||
| 1749 | 8011354985 | |||
| 1750 | 8015690492 | |||
| 1751 | 8019778355 | |||
| 1752 | 8029997411 | |||
| 1753 | 8054289052 | |||
| 1754 | 8054352239 | |||
| 1755 | 8054846062 | |||
| 1756 | 8055773620 | |||
| 1757 | 8055820083 | |||
| 1758 | 8056128190 | |||
| 1759 | 8056146251 | |||
| 1760 | 8056154790 | |||
| 1761 | 8056157379 | |||
| 1762 | 8056167804 | |||
| 1763 | 8056174956 | |||
| 1764 | 8056178856 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cyy-assembly2.cif.gz_C | structure of the c-terminal domains of dipz from mycobacterium tuberculosis | 0.9533 | 254 | 399 |
| 2hyx-assembly2.cif.gz_C | structure of the c-terminal domain of dipz from mycobacterium tuberculosis | 0.9384 | 251 | 399 |
| 7djk-assembly1.cif.gz_A | structure of four truncated and mutated forms of quenching protein | 0.9363 | 254 | 393 |
| 2b5y-assembly1.cif.gz_A | solution structure of a thioredoxin-like protein in the oxidized form | 0.8872 | 250 | 393 |
| 3eyt-assembly1.cif.gz_B | crystal structure of thioredoxin-like superfamily protein spoa0173 | 0.8845 | 255 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W5T4_48_199_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9285 | 252 | 392 | 3.40.30.10 |
| 2b5yA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8872 | 250 | 393 | 3.40.30.10 |
| af_O06392_67_205_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8695 | 271 | 392 | 3.40.30.10 |
| 2l5oA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8629 | 256 | 399 | 3.40.30.10 |
| 2b5yA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8594 | 250 | 393 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0L6FSS9-F1-model_v4 | deleted | 1.002 | 253 | 391 |
|
| AF-E0X6C1-F1-model_v4 | Redoxin-containing protein | 1.001 | 253 | 391 |
GO:0016209
GO:0016491 |
| AF-A0A1C4WTW9-F1-model_v4 | AhpC/TSA family protein | 0.9978 | 254 | 392 |
GO:0016209
GO:0016491 |
| AF-A0A562ZGM5-F1-model_v4 | Thioredoxin family protein | 0.9954 | 253 | 396 |
GO:0016491
|
| AF-A0A4D4JS84-F1-model_v4 | Thioredoxin domain-containing protein | 0.9942 | 253 | 394 |
GO:0016209
GO:0016491 |