F484536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 881 | 351 | 1762 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0019746|Ga0495668_0019746_69_431 |
| Length | 120 |
| Sequence | VLRFNYVMRGVEMIIGFVRRRPFSSLLLLILAALAVLIWQYRVALGAFPGIISAYTAKEYCSCRYVMLNSADYCRGYVKQYVPSSLLDDPANKQVSADGLGRSSVAAWQGERQGCRLLPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 91 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 92 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 93 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 94 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 95 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 96 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 97 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 108 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 109 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 110 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 111 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 112 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 114 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 115 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 116 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 117 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 118 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 119 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 120 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 121 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 122 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 123 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 124 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 125 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 126 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 127 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 128 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 129 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 130 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 131 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 132 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 133 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 134 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 135 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 136 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 203 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 204 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 215 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 220 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 221 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 222 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 223 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 224 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 225 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 226 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 227 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 228 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 229 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 230 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 231 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 232 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 233 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 234 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 235 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 236 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 237 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 238 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 239 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 240 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 241 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 242 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 243 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 244 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 245 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 246 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 247 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 248 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 249 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 250 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 251 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 252 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 253 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 254 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 255 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 256 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 257 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 258 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 259 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 260 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 261 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 262 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 263 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 264 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 265 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 266 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 267 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 268 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 269 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 270 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 271 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 272 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 273 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 274 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 275 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 276 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 277 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 278 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 279 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 280 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 281 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 282 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 283 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 284 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 285 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 286 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 287 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 288 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 289 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 290 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 291 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 292 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 293 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 294 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 295 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 296 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 297 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 298 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 299 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 300 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 301 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 302 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 303 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 304 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 305 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 306 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 307 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 308 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 309 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 310 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 311 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 312 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 313 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 314 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 315 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 316 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 317 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 318 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 319 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 320 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 321 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 322 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 323 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 324 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 325 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 326 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 327 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 328 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 329 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 330 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 331 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 332 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 333 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 334 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 335 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 336 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 337 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 338 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 339 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 340 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 341 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 342 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 343 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 344 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 345 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 346 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 347 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 348 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 349 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 350 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 351 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.13 |
| Metatranscriptomes | 0 |
| Isolates | 14.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.43 |
| Nodule | 1.02 |
| Rhizoplane | 6.36 |
| Rhizosphere | 75.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495668_0019746 | 3300046616 | Bacteria | 3879 |
| 2 | SwRhRL2b_contig_2134850 | 2162886007 | Bacteria | 904 |
| 3 | MRS1b_contig_5200652 | 2162886011 | Bacteria | 2057 |
| 4 | JGI25154J39366_1020427 | 3300002738 | Bacteria | 635 |
| 5 | JGI25163J39215_1000501 | 3300002771 | Bacteria | 11658 |
| 6 | JGI25164J39214_1000106 | 3300002772 | Bacteria | 80803 |
| 7 | JGI25165J46597_1000217 | 3300003214 | Bacteria | 80803 |
| 8 | Ga0055538_1000082 | 3300003751 | Bacteria | 84434 |
| 9 | Ga0055539_1000121 | 3300003752 | Bacteria | 84434 |
| 10 | Ga0055533_1000129 | 3300003756 | Bacteria | 84434 |
| 11 | Ga0055532_1000104 | 3300003758 | Bacteria | 91442 |
| 12 | Ga0055525_1000167 | 3300003759 | Bacteria | 84434 |
| 13 | Ga0055525_1004613 | 3300003759 | Bacteria | 1182 |
| 14 | Ga0055535_1004640 | 3300003761 | Bacteria | 3263 |
| 15 | Ga0055530_10000383 | 3300003791 | Bacteria | 39787 |
| 16 | Ga0055540_1000341 | 3300003792 | Bacteria | 39787 |
| 17 | Ga0055541_1000081 | 3300003841 | Bacteria | 84434 |
| 18 | Ga0065714_10002649 | 3300005288 | Bacteria | 12614 |
| 19 | Ga0065714_10004105 | 3300005288 | Bacteria | 7142 |
| 20 | Ga0065714_10007722 | 3300005288 | Bacteria | 3149 |
| 21 | Ga0065714_10020555 | 3300005288 | Bacteria | 1337 |
| 22 | Ga0065714_10065614 | 3300005288 | Bacteria | 9160 |
| 23 | Ga0065714_10069233 | 3300005288 | Bacteria | 4327 |
| 24 | Ga0065714_10103799 | 3300005288 | Bacteria | 1596 |
| 25 | Ga0065714_10199652 | 3300005288 | Bacteria | 899 |
| 26 | Ga0065704_10044559 | 3300005289 | Bacteria | 772 |
| 27 | Ga0065704_10074387 | 3300005289 | Bacteria | 6298 |
| 28 | Ga0065704_10687777 | 3300005289 | Bacteria | 555 |
| 29 | Ga0065704_10744385 | 3300005289 | Bacteria | 544 |
| 30 | Ga0065712_10068085 | 3300005290 | Bacteria | 15225 |
| 31 | Ga0065712_10070272 | 3300005290 | Bacteria | 6159 |
| 32 | Ga0070670_100003000 | 3300005331 | Bacteria | 13978 |
| 33 | Ga0070670_100024752 | 3300005331 | Bacteria | 5163 |
| 34 | Ga0070661_100000238 | 3300005344 | Bacteria | 45456 |
| 35 | Ga0070669_100000150 | 3300005353 | Bacteria | 62681 |
| 36 | Ga0070669_100014789 | 3300005353 | Bacteria | 5557 |
| 37 | Ga0070659_100470551 | 3300005366 | Bacteria | 1068 |
| 38 | Ga0070662_100003244 | 3300005457 | Bacteria | 10117 |
| 39 | Ga0070662_101747428 | 3300005457 | Bacteria | 537 |
| 40 | Ga0070665_100083065 | 3300005548 | Bacteria | 3208 |
| 41 | Ga0070664_100001048 | 3300005564 | Bacteria | 21723 |
| 42 | Ga0070664_100096005 | 3300005564 | Bacteria | 2572 |
| 43 | Ga0068857_101764070 | 3300005577 | Bacteria | 605 |
| 44 | Ga0068854_100003503 | 3300005578 | Bacteria | 9807 |
| 45 | Ga0068851_10000182 | 3300005834 | Bacteria | 31167 |
| 46 | Ga0075364_10024831 | 3300006051 | Bacteria | 3809 |
| 47 | Ga0075364_10224631 | 3300006051 | Bacteria | 1275 |
| 48 | Ga0075364_10294785 | 3300006051 | Bacteria | 1104 |
| 49 | Ga0075364_10485035 | 3300006051 | Bacteria | 845 |
| 50 | Ga0075432_10012331 | 3300006058 | Bacteria | 2903 |
| 51 | Ga0075432_10013811 | 3300006058 | Bacteria | 2747 |
| 52 | Ga0075432_10036556 | 3300006058 | Bacteria | 1707 |
| 53 | Ga0075432_10041102 | 3300006058 | Bacteria | 1614 |
| 54 | Ga0075432_10076722 | 3300006058 | Bacteria | 1207 |
| 55 | Ga0075432_10459031 | 3300006058 | Bacteria | 560 |
| 56 | Ga0075362_10086754 | 3300006177 | Bacteria | 1449 |
| 57 | Ga0075436_100202621 | 3300006914 | Bacteria | 1406 |
| 58 | Ga0079104_1000134 | 3300006946 | Bacteria | 103774 |
| 59 | Ga0105251_10000519 | 3300009011 | Bacteria | 36305 |
| 60 | Ga0105251_10000636 | 3300009011 | Bacteria | 32197 |
| 61 | Ga0105251_10000761 | 3300009011 | Bacteria | 29412 |
| 62 | Ga0105251_10011273 | 3300009011 | Bacteria | 5115 |
| 63 | Ga0105251_10014616 | 3300009011 | Bacteria | 4329 |
| 64 | Ga0105251_10030980 | 3300009011 | Bacteria | 2680 |
| 65 | Ga0105251_10034402 | 3300009011 | Bacteria | 2508 |
| 66 | Ga0105251_10102908 | 3300009011 | Bacteria | 1304 |
| 67 | Ga0105251_10219461 | 3300009011 | Bacteria | 856 |
| 68 | Ga0105251_10265235 | 3300009011 | Bacteria | 775 |
| 69 | Ga0105251_10465263 | 3300009011 | Bacteria | 587 |
| 70 | Ga0105244_10005059 | 3300009036 | Bacteria | 8869 |
| 71 | Ga0105244_10010013 | 3300009036 | Bacteria | 5776 |
| 72 | Ga0105244_10010658 | 3300009036 | Bacteria | 5559 |
| 73 | Ga0105244_10018282 | 3300009036 | Bacteria | 3936 |
| 74 | Ga0105244_10019511 | 3300009036 | Bacteria | 3782 |
| 75 | Ga0105244_10093699 | 3300009036 | Bacteria | 1475 |
| 76 | Ga0105244_10110387 | 3300009036 | Bacteria | 1339 |
| 77 | Ga0105244_10127830 | 3300009036 | Bacteria | 1227 |
| 78 | Ga0105244_10281194 | 3300009036 | Bacteria | 772 |
| 79 | Ga0105244_10326791 | 3300009036 | Bacteria | 708 |
| 80 | Ga0105244_10508955 | 3300009036 | Bacteria | 554 |
| 81 | Ga0105250_10000118 | 3300009092 | Bacteria | 71419 |
| 82 | Ga0105250_10001221 | 3300009092 | Bacteria | 14282 |
| 83 | Ga0105250_10006525 | 3300009092 | Bacteria | 5092 |
| 84 | Ga0105250_10029658 | 3300009092 | Bacteria | 2201 |
| 85 | Ga0105250_10119213 | 3300009092 | Bacteria | 1084 |
| 86 | Ga0105250_10319690 | 3300009092 | Bacteria | 674 |
| 87 | Ga0105250_10517015 | 3300009092 | Bacteria | 544 |
| 88 | Ga0105243_10000592 | 3300009148 | Bacteria | 36341 |
| 89 | Ga0105243_10203131 | 3300009148 | Bacteria | 1739 |
| 90 | Ga0105243_10338116 | 3300009148 | Bacteria | 1378 |
| 91 | Ga0105242_10003316 | 3300009176 | Bacteria | 12526 |
| 92 | Ga0105248_10432146 | 3300009177 | Bacteria | 1483 |
| 93 | Ga0105237_10001417 | 3300009545 | Bacteria | 31682 |
| 94 | Ga0105246_10004551 | 3300011119 | Bacteria | 8437 |
| 95 | Ga0105246_10007263 | 3300011119 | Bacteria | 6787 |
| 96 | Ga0105246_10158749 | 3300011119 | Bacteria | 1720 |
| 97 | Ga0157373_10000309 | 3300013100 | Bacteria | 39589 |
| 98 | Ga0157373_10006208 | 3300013100 | Bacteria | 8927 |
| 99 | Ga0157373_10018032 | 3300013100 | Bacteria | 5140 |
| 100 | Ga0157373_10029742 | 3300013100 | Bacteria | 3932 |
| 101 | Ga0157373_10046460 | 3300013100 | Bacteria | 3098 |
| 102 | Ga0157373_10120230 | 3300013100 | Bacteria | 1846 |
| 103 | Ga0157373_10783227 | 3300013100 | Bacteria | 702 |
| 104 | Ga0157371_10000281 | 3300013102 | Bacteria | 68624 |
| 105 | Ga0157371_11308574 | 3300013102 | Bacteria | 561 |
| 106 | Ga0157370_10034330 | 3300013104 | Bacteria | 4941 |
| 107 | Ga0157370_10166073 | 3300013104 | Bacteria | 2053 |
| 108 | Ga0157370_10996457 | 3300013104 | Bacteria | 759 |
| 109 | Ga0157370_11347506 | 3300013104 | Bacteria | 643 |
| 110 | Ga0157370_11478880 | 3300013104 | Bacteria | 611 |
| 111 | Ga0157370_12146435 | 3300013104 | Bacteria | 500 |
| 112 | Ga0157369_10014243 | 3300013105 | Bacteria | 8985 |
| 113 | Ga0157369_10082425 | 3300013105 | Bacteria | 3441 |
| 114 | Ga0157369_10836729 | 3300013105 | Bacteria | 945 |
| 115 | Ga0163162_10293815 | 3300013306 | Bacteria | 1756 |
| 116 | Ga0163162_10567527 | 3300013306 | Bacteria | 1262 |
| 117 | Ga0163162_10623693 | 3300013306 | Bacteria | 1203 |
| 118 | Ga0163162_10732051 | 3300013306 | Bacteria | 1109 |
| 119 | Ga0163162_11043520 | 3300013306 | Bacteria | 925 |
| 120 | Ga0163162_11408734 | 3300013306 | Bacteria | 793 |
| 121 | Ga0157372_10122042 | 3300013307 | Bacteria | 2994 |
| 122 | Ga0157375_10000770 | 3300013308 | Bacteria | 28095 |
| 123 | Ga0157375_10100354 | 3300013308 | Bacteria | 2975 |
| 124 | Ga0182008_10003721 | 3300014497 | Bacteria | 9098 |
| 125 | Ga0182008_10010930 | 3300014497 | Bacteria | 4842 |
| 126 | Ga0182008_10019034 | 3300014497 | Bacteria | 3550 |
| 127 | Ga0182008_10019348 | 3300014497 | Bacteria | 3516 |
| 128 | Ga0182008_10103436 | 3300014497 | Bacteria | 1408 |
| 129 | Ga0182008_10162879 | 3300014497 | Bacteria | 1123 |
| 130 | Ga0182006_1001770 | 3300015261 | Bacteria | 12526 |
| 131 | Ga0182006_1005447 | 3300015261 | Bacteria | 6069 |
| 132 | Ga0182006_1012362 | 3300015261 | Bacteria | 3731 |
| 133 | Ga0182006_1024112 | 3300015261 | Bacteria | 2512 |
| 134 | Ga0182006_1036144 | 3300015261 | Bacteria | 1965 |
| 135 | Ga0182006_1055297 | 3300015261 | Bacteria | 1515 |
| 136 | Ga0182007_10011315 | 3300015262 | Bacteria | 3477 |
| 137 | Ga0182007_10084973 | 3300015262 | Bacteria | 1039 |
| 138 | Ga0182005_1181736 | 3300015265 | Bacteria | 625 |
| 139 | Ga0182005_1217844 | 3300015265 | Bacteria | 580 |
| 140 | Ga0182005_1278857 | 3300015265 | Bacteria | 524 |
| 141 | Ga0163161_10082705 | 3300017792 | Bacteria | 2366 |
| 142 | Ga0163161_10083508 | 3300017792 | Bacteria | 2354 |
| 143 | Ga0163161_10149016 | 3300017792 | Bacteria | 1777 |
| 144 | Ga0163161_10274802 | 3300017792 | Bacteria | 1319 |
| 145 | Ga0163161_10574376 | 3300017792 | Bacteria | 927 |
| 146 | Ga0163161_10646933 | 3300017792 | Bacteria | 876 |
| 147 | Ga0163161_10753156 | 3300017792 | Bacteria | 815 |
| 148 | Ga0163161_10879248 | 3300017792 | Bacteria | 758 |
| 149 | Ga0163161_11028569 | 3300017792 | Bacteria | 705 |
| 150 | Ga0209435_100662 | 3300025206 | Bacteria | 6107 |
| 151 | Ga0209760_100047 | 3300025207 | Bacteria | 107520 |
| 152 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 153 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 154 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 155 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 156 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 157 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 158 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 159 | Ga0209258_100250 | 3300025242 | Bacteria | 97656 |
| 160 | Ga0209646_1000263 | 3300025246 | Bacteria | 51493 |
| 161 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 162 | Ga0209759_1015996 | 3300025256 | Bacteria | 1914 |
| 163 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 164 | Ga0209676_1009528 | 3300025292 | Bacteria | 4180 |
| 165 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 166 | Ga0209051_1000053 | 3300025303 | Bacteria | 281564 |
| 167 | Ga0209257_1024255 | 3300025304 | Bacteria | 2105 |
| 168 | Ga0207656_10000026 | 3300025321 | Bacteria | 86789 |
| 169 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 170 | Ga0207696_1000111 | 3300025711 | Bacteria | 155243 |
| 171 | Ga0207696_1002525 | 3300025711 | Bacteria | 8938 |
| 172 | Ga0207696_1015216 | 3300025711 | Bacteria | 2613 |
| 173 | Ga0207655_1000435 | 3300025728 | Bacteria | 55875 |
| 174 | Ga0207655_1004894 | 3300025728 | Bacteria | 9292 |
| 175 | Ga0207655_1007033 | 3300025728 | Bacteria | 7367 |
| 176 | Ga0207655_1007316 | 3300025728 | Bacteria | 7177 |
| 177 | Ga0207655_1009473 | 3300025728 | Bacteria | 6040 |
| 178 | Ga0207655_1039031 | 3300025728 | Bacteria | 2067 |
| 179 | Ga0207655_1046881 | 3300025728 | Bacteria | 1789 |
| 180 | Ga0207655_1109472 | 3300025728 | Bacteria | 936 |
| 181 | Ga0207713_1000566 | 3300025735 | Bacteria | 36759 |
| 182 | Ga0207713_1000574 | 3300025735 | Bacteria | 36506 |
| 183 | Ga0207713_1001013 | 3300025735 | Bacteria | 24465 |
| 184 | Ga0207713_1002530 | 3300025735 | Bacteria | 13231 |
| 185 | Ga0207713_1004071 | 3300025735 | Bacteria | 9639 |
| 186 | Ga0207713_1010451 | 3300025735 | Bacteria | 5133 |
| 187 | Ga0207713_1081434 | 3300025735 | Bacteria | 1163 |
| 188 | Ga0207713_1208371 | 3300025735 | Bacteria | 595 |
| 189 | Ga0207671_10000436 | 3300025914 | Bacteria | 57399 |
| 190 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 191 | Ga0207681_10000475 | 3300025923 | Bacteria | 28041 |
| 192 | Ga0207681_10003184 | 3300025923 | Bacteria | 10302 |
| 193 | Ga0207650_10000341 | 3300025925 | Bacteria | 45117 |
| 194 | Ga0207650_10000543 | 3300025925 | Bacteria | 30748 |
| 195 | Ga0207706_10002059 | 3300025933 | Bacteria | 19704 |
| 196 | Ga0207686_10003220 | 3300025934 | Bacteria | 8777 |
| 197 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 198 | Ga0207709_10010603 | 3300025935 | Bacteria | 5078 |
| 199 | Ga0207709_10042839 | 3300025935 | Bacteria | 2725 |
| 200 | Ga0207709_10817573 | 3300025935 | Bacteria | 753 |
| 201 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 202 | Ga0207679_10344160 | 3300025945 | Bacteria | 1298 |
| 203 | Ga0207640_10035644 | 3300025981 | Bacteria | 3115 |
| 204 | Ga0207674_10244075 | 3300026116 | Bacteria | 1743 |
| 205 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 206 | Ga0207428_10065620 | 3300027907 | Bacteria | 2863 |
| 207 | Ga0207428_10120405 | 3300027907 | Bacteria | 2013 |
| 208 | Ga0207428_10200972 | 3300027907 | Bacteria | 1500 |
| 209 | Ga0207428_10236540 | 3300027907 | Bacteria | 1366 |
| 210 | Ga0207428_10265458 | 3300027907 | Bacteria | 1278 |
| 211 | Ga0207428_10342241 | 3300027907 | Bacteria | 1102 |
| 212 | Ga0207428_10463024 | 3300027907 | Bacteria | 924 |
| 213 | Ga0207428_10750476 | 3300027907 | Bacteria | 696 |
| 214 | Ga0268266_10103348 | 3300028379 | Bacteria | 2514 |
| 215 | Ga0307517_10125890 | 3300028786 | Bacteria | 1870 |
| 216 | Ga0307517_10132544 | 3300028786 | Bacteria | 1787 |
| 217 | Ga0307511_10024142 | 3300030521 | Bacteria | 5643 |
| 218 | Ga0316177_1179323 | 3300030731 | Bacteria | 2287 |
| 219 | Ga0314311_1016558 | 3300030733 | Bacteria | 2171 |
| 220 | Ga0316179_1024935 | 3300030734 | Bacteria | 591 |
| 221 | Ga0316179_1108273 | 3300030734 | Bacteria | 537 |
| 222 | Ga0316183_1205945 | 3300030742 | Bacteria | 2945 |
| 223 | Ga0316181_1002344 | 3300030744 | Bacteria | 2100 |
| 224 | Ga0265340_10061335 | 3300031247 | Bacteria | 1799 |
| 225 | Ga0307408_100000653 | 3300031548 | Bacteria | 29111 |
| 226 | Ga0307408_100031073 | 3300031548 | Bacteria | 3714 |
| 227 | Ga0307408_100075100 | 3300031548 | Bacteria | 2510 |
| 228 | Ga0307408_100162569 | 3300031548 | Bacteria | 1774 |
| 229 | Ga0307408_100334162 | 3300031548 | Bacteria | 1280 |
| 230 | Ga0307408_100360763 | 3300031548 | Bacteria | 1236 |
| 231 | Ga0307516_10229237 | 3300031730 | Bacteria | 1562 |
| 232 | Ga0307405_10000489 | 3300031731 | Bacteria | 14923 |
| 233 | Ga0307405_10007647 | 3300031731 | Bacteria | 5424 |
| 234 | Ga0307405_10008680 | 3300031731 | Bacteria | 5163 |
| 235 | Ga0307405_10281869 | 3300031731 | Bacteria | 1251 |
| 236 | Ga0307405_11195309 | 3300031731 | Bacteria | 657 |
| 237 | Ga0307413_10007458 | 3300031824 | Bacteria | 5080 |
| 238 | Ga0307413_10053048 | 3300031824 | Bacteria | 2452 |
| 239 | Ga0307406_10011259 | 3300031901 | Bacteria | 5072 |
| 240 | Ga0307406_10019318 | 3300031901 | Bacteria | 3997 |
| 241 | Ga0307406_10064515 | 3300031901 | Bacteria | 2377 |
| 242 | Ga0307406_10893087 | 3300031901 | Bacteria | 756 |
| 243 | Ga0307407_10773396 | 3300031903 | Bacteria | 728 |
| 244 | Ga0307412_10001818 | 3300031911 | Bacteria | 11808 |
| 245 | Ga0307412_10012714 | 3300031911 | Bacteria | 4910 |
| 246 | Ga0307412_10014040 | 3300031911 | Bacteria | 4716 |
| 247 | Ga0307412_10038731 | 3300031911 | Bacteria | 3072 |
| 248 | Ga0307412_10076585 | 3300031911 | Bacteria | 2298 |
| 249 | Ga0307412_10199740 | 3300031911 | Bacteria | 1517 |
| 250 | Ga0307409_100169180 | 3300031995 | Bacteria | 1921 |
| 251 | Ga0307414_10190069 | 3300032004 | Bacteria | 1660 |
| 252 | Ga0307414_10232641 | 3300032004 | Bacteria | 1520 |
| 253 | Ga0307414_10353696 | 3300032004 | Bacteria | 1262 |
| 254 | Ga0307411_10023183 | 3300032005 | Bacteria | 3671 |
| 255 | Ga0307411_10055766 | 3300032005 | Bacteria | 2601 |
| 256 | Ga0307411_10597408 | 3300032005 | Bacteria | 948 |
| 257 | Ga0237819_00918 | 3300038705 | Bacteria | 9077 |
| 258 | Ga0439438_001959 | 3300041405 | Bacteria | 8995 |
| 259 | Ga0439438_004047 | 3300041405 | Bacteria | 5755 |
| 260 | Ga0439438_004550 | 3300041405 | Bacteria | 5286 |
| 261 | Ga0439438_008480 | 3300041405 | Bacteria | 3400 |
| 262 | Ga0439447_008598 | 3300041407 | Bacteria | 3153 |
| 263 | Ga0439447_042313 | 3300041407 | Bacteria | 1106 |
| 264 | Ga0439447_046810 | 3300041407 | Bacteria | 1040 |
| 265 | Ga0439447_121761 | 3300041407 | Bacteria | 598 |
| 266 | Ga0439466_0000975 | 3300041411 | Bacteria | 11019 |
| 267 | Ga0439466_0007401 | 3300041411 | Bacteria | 4158 |
| 268 | Ga0439466_0016390 | 3300041411 | Bacteria | 2678 |
| 269 | Ga0439466_0039153 | 3300041411 | Bacteria | 1590 |
| 270 | Ga0439466_0204122 | 3300041411 | Bacteria | 601 |
| 271 | Ga0451797_1373657 | 3300041453 | Bacteria | 510 |
| 272 | Ga0451837_0710161 | 3300041494 | Bacteria | 602 |
| 273 | Ga0451841_0661852 | 3300041498 | Bacteria | 619 |
| 274 | Ga0451841_0704577 | 3300041498 | Bacteria | 703 |
| 275 | Ga0451853_1222240 | 3300041512 | Bacteria | 1341 |
| 276 | Ga0439431_0001788 | 3300041997 | Bacteria | 4756 |
| 277 | Ga0439445_0017395 | 3300042004 | Bacteria | 1776 |
| 278 | Ga0439432_002268 | 3300042006 | Bacteria | 7252 |
| 279 | Ga0439432_005274 | 3300042006 | Bacteria | 4664 |
| 280 | Ga0439432_084588 | 3300042006 | Bacteria | 958 |
| 281 | Ga0439451_114980 | 3300042009 | Bacteria | 546 |
| 282 | Ga0439452_028949 | 3300042010 | Bacteria | 1378 |
| 283 | Ga0439452_031313 | 3300042010 | Bacteria | 1306 |
| 284 | Ga0439456_001582 | 3300042013 | Bacteria | 4588 |
| 285 | Ga0439456_030371 | 3300042013 | Bacteria | 1156 |
| 286 | Ga0439456_057414 | 3300042013 | Bacteria | 853 |
| 287 | Ga0439463_000865 | 3300042016 | Bacteria | 8323 |
| 288 | Ga0439463_016536 | 3300042016 | Bacteria | 1824 |
| 289 | Ga0450911_001166 | 3300042115 | Bacteria | 6454 |
| 290 | Ga0450891_009206 | 3300042129 | Bacteria | 908 |
| 291 | Ga0450894_015021 | 3300042131 | Bacteria | 1024 |
| 292 | Ga0450902_004255 | 3300042137 | Bacteria | 2123 |
| 293 | Ga0450902_004644 | 3300042137 | Bacteria | 2047 |
| 294 | Ga0450902_012704 | 3300042137 | Bacteria | 1350 |
| 295 | Ga0450902_056094 | 3300042137 | Bacteria | 678 |
| 296 | Ga0450902_067091 | 3300042137 | Bacteria | 623 |
| 297 | Ga0450903_001474 | 3300042138 | Bacteria | 4384 |
| 298 | Ga0450903_009632 | 3300042138 | Bacteria | 1572 |
| 299 | Ga0450903_011031 | 3300042138 | Bacteria | 1458 |
| 300 | Ga0450904_001781 | 3300042139 | Bacteria | 2825 |
| 301 | Ga0450905_065705 | 3300042142 | Bacteria | 612 |
| 302 | Ga0450906_016048 | 3300042145 | Bacteria | 1358 |
| 303 | Ga0450907_082541 | 3300042146 | Bacteria | 558 |
| 304 | Ga0450910_001588 | 3300042147 | Bacteria | 2895 |
| 305 | Ga0450909_002018 | 3300042185 | Bacteria | 2863 |
| 306 | Ga0450909_077760 | 3300042185 | Bacteria | 535 |
| 307 | Ga0439460_0004074 | 3300042461 | Bacteria | 3550 |
| 308 | Ga0439460_0078586 | 3300042461 | Bacteria | 1032 |
| 309 | Ga0439440_0037822 | 3300042993 | Bacteria | 1166 |
| 310 | Ga0439440_0051062 | 3300042993 | Bacteria | 1033 |
| 311 | Ga0495617_000194 | 3300046452 | Bacteria | 38338 |
| 312 | Ga0495617_000681 | 3300046452 | Bacteria | 17000 |
| 313 | Ga0495617_014353 | 3300046452 | Bacteria | 2693 |
| 314 | Ga0495617_037439 | 3300046452 | Bacteria | 1624 |
| 315 | Ga0495617_058040 | 3300046452 | Bacteria | 1282 |
| 316 | Ga0495617_080516 | 3300046452 | Bacteria | 1067 |
| 317 | Ga0495617_084917 | 3300046452 | Bacteria | 1036 |
| 318 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 319 | Ga0495627_002079 | 3300046453 | Bacteria | 10190 |
| 320 | Ga0495627_052561 | 3300046453 | Bacteria | 1221 |
| 321 | Ga0495627_057751 | 3300046453 | Bacteria | 1154 |
| 322 | Ga0495627_087400 | 3300046453 | Bacteria | 898 |
| 323 | Ga0495592_0089705 | 3300046454 | Bacteria | 2207 |
| 324 | Ga0495603_0013533 | 3300046455 | Bacteria | 4935 |
| 325 | Ga0495590_0009358 | 3300046457 | Bacteria | 3716 |
| 326 | Ga0495590_0014858 | 3300046457 | Bacteria | 2837 |
| 327 | Ga0495590_0023135 | 3300046457 | Bacteria | 2196 |
| 328 | Ga0495590_0047923 | 3300046457 | Bacteria | 1490 |
| 329 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 330 | Ga0495591_000157 | 3300046458 | Bacteria | 72549 |
| 331 | Ga0495591_000243 | 3300046458 | Bacteria | 52402 |
| 332 | Ga0495591_000450 | 3300046458 | Bacteria | 33410 |
| 333 | Ga0495591_002782 | 3300046458 | Bacteria | 9435 |
| 334 | Ga0495591_006474 | 3300046458 | Bacteria | 5175 |
| 335 | Ga0495591_008390 | 3300046458 | Bacteria | 4235 |
| 336 | Ga0495591_010075 | 3300046458 | Bacteria | 3697 |
| 337 | Ga0495591_010368 | 3300046458 | Bacteria | 3618 |
| 338 | Ga0495591_011316 | 3300046458 | Bacteria | 3387 |
| 339 | Ga0495591_015329 | 3300046458 | Bacteria | 2713 |
| 340 | Ga0495591_017646 | 3300046458 | Bacteria | 2443 |
| 341 | Ga0495591_021612 | 3300046458 | Bacteria | 2095 |
| 342 | Ga0495591_047935 | 3300046458 | Bacteria | 1180 |
| 343 | Ga0495591_077134 | 3300046458 | Bacteria | 855 |
| 344 | Ga0495591_082954 | 3300046458 | Bacteria | 814 |
| 345 | Ga0495591_154927 | 3300046458 | Bacteria | 549 |
| 346 | Ga0495638_0008973 | 3300046460 | Bacteria | 7050 |
| 347 | Ga0495638_0012440 | 3300046460 | Bacteria | 5834 |
| 348 | Ga0495638_0017729 | 3300046460 | Bacteria | 4740 |
| 349 | Ga0495638_0026612 | 3300046460 | Bacteria | 3748 |
| 350 | Ga0495638_0026768 | 3300046460 | Bacteria | 3737 |
| 351 | Ga0495638_0029199 | 3300046460 | Bacteria | 3556 |
| 352 | Ga0495638_0033685 | 3300046460 | Bacteria | 3275 |
| 353 | Ga0495638_0078813 | 3300046460 | Bacteria | 2004 |
| 354 | Ga0495638_0126012 | 3300046460 | Bacteria | 1509 |
| 355 | Ga0495638_0164164 | 3300046460 | Bacteria | 1279 |
| 356 | Ga0495638_0569381 | 3300046460 | Bacteria | 560 |
| 357 | Ga0495653_0032718 | 3300046463 | Bacteria | 4126 |
| 358 | Ga0495653_0092924 | 3300046463 | Bacteria | 2201 |
| 359 | Ga0495650_0000214 | 3300046471 | Bacteria | 123366 |
| 360 | Ga0495650_0005934 | 3300046471 | Bacteria | 7756 |
| 361 | Ga0495650_0011949 | 3300046471 | Bacteria | 4704 |
| 362 | Ga0495650_0014205 | 3300046471 | Bacteria | 4159 |
| 363 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 364 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 365 | Ga0495605_0000552 | 3300046474 | Bacteria | 30680 |
| 366 | Ga0495605_0004687 | 3300046474 | Bacteria | 7994 |
| 367 | Ga0495605_0009922 | 3300046474 | Bacteria | 5338 |
| 368 | Ga0495605_0013127 | 3300046474 | Bacteria | 4577 |
| 369 | Ga0495605_0018430 | 3300046474 | Bacteria | 3741 |
| 370 | Ga0495605_0087425 | 3300046474 | Bacteria | 1449 |
| 371 | Ga0495639_0394014 | 3300046475 | Bacteria | 699 |
| 372 | Ga0495584_0019688 | 3300046491 | Bacteria | 3428 |
| 373 | Ga0495584_0022969 | 3300046491 | Bacteria | 3164 |
| 374 | Ga0495584_0035118 | 3300046491 | Bacteria | 2534 |
| 375 | Ga0495584_0035935 | 3300046491 | Bacteria | 2503 |
| 376 | Ga0495584_0037475 | 3300046491 | Bacteria | 2451 |
| 377 | Ga0495584_0094942 | 3300046491 | Bacteria | 1505 |
| 378 | Ga0495585_0000349 | 3300046492 | Bacteria | 44718 |
| 379 | Ga0495585_0022376 | 3300046492 | Bacteria | 3628 |
| 380 | Ga0495585_0031336 | 3300046492 | Bacteria | 3018 |
| 381 | Ga0495585_0572942 | 3300046492 | Bacteria | 532 |
| 382 | Ga0495594_0011345 | 3300046499 | Bacteria | 4629 |
| 383 | Ga0495596_0000073 | 3300046500 | Bacteria | 74267 |
| 384 | Ga0495607_0000216 | 3300046501 | Bacteria | 61507 |
| 385 | Ga0495607_0000577 | 3300046501 | Bacteria | 35671 |
| 386 | Ga0495607_0000803 | 3300046501 | Bacteria | 29676 |
| 387 | Ga0495607_0005761 | 3300046501 | Bacteria | 8815 |
| 388 | Ga0495607_0014011 | 3300046501 | Bacteria | 5235 |
| 389 | Ga0495607_0014689 | 3300046501 | Bacteria | 5089 |
| 390 | Ga0495607_0035323 | 3300046501 | Bacteria | 3024 |
| 391 | Ga0495607_0039569 | 3300046501 | Bacteria | 2815 |
| 392 | Ga0495607_0041797 | 3300046501 | Bacteria | 2721 |
| 393 | Ga0495607_0083254 | 3300046501 | Bacteria | 1752 |
| 394 | Ga0495607_0104200 | 3300046501 | Bacteria | 1514 |
| 395 | Ga0495607_0116046 | 3300046501 | Bacteria | 1412 |
| 396 | Ga0495607_0142928 | 3300046501 | Bacteria | 1232 |
| 397 | Ga0495607_0208246 | 3300046501 | Bacteria | 964 |
| 398 | Ga0495607_0302353 | 3300046501 | Bacteria | 752 |
| 399 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 400 | Ga0495583_0001233 | 3300046506 | Bacteria | 27201 |
| 401 | Ga0495583_0001426 | 3300046506 | Bacteria | 24343 |
| 402 | Ga0495583_0003972 | 3300046506 | Bacteria | 10920 |
| 403 | Ga0495583_0003987 | 3300046506 | Bacteria | 10895 |
| 404 | Ga0495583_0008721 | 3300046506 | Bacteria | 6157 |
| 405 | Ga0495583_0013056 | 3300046506 | Bacteria | 4659 |
| 406 | Ga0495606_0000055 | 3300046507 | Bacteria | 199348 |
| 407 | Ga0495606_0000695 | 3300046507 | Bacteria | 52206 |
| 408 | Ga0495606_0007473 | 3300046507 | Bacteria | 9763 |
| 409 | Ga0495606_0022660 | 3300046507 | Bacteria | 4566 |
| 410 | Ga0495606_0031442 | 3300046507 | Bacteria | 3690 |
| 411 | Ga0495606_0031931 | 3300046507 | Bacteria | 3655 |
| 412 | Ga0495606_0063822 | 3300046507 | Bacteria | 2346 |
| 413 | Ga0495606_0069130 | 3300046507 | Bacteria | 2231 |
| 414 | Ga0495606_0098064 | 3300046507 | Bacteria | 1789 |
| 415 | Ga0495606_0101388 | 3300046507 | Bacteria | 1752 |
| 416 | Ga0495606_0262045 | 3300046507 | Bacteria | 954 |
| 417 | Ga0495606_0466748 | 3300046507 | Bacteria | 643 |
| 418 | Ga0495610_0009169 | 3300046512 | Bacteria | 6286 |
| 419 | Ga0495610_0010391 | 3300046512 | Bacteria | 5789 |
| 420 | Ga0495610_0014085 | 3300046512 | Bacteria | 4717 |
| 421 | Ga0495610_0021816 | 3300046512 | Bacteria | 3514 |
| 422 | Ga0495610_0025309 | 3300046512 | Bacteria | 3186 |
| 423 | Ga0495610_0042019 | 3300046512 | Bacteria | 2290 |
| 424 | Ga0495610_0043820 | 3300046512 | Bacteria | 2225 |
| 425 | Ga0495610_0058141 | 3300046512 | Bacteria | 1851 |
| 426 | Ga0495610_0132368 | 3300046512 | Bacteria | 1081 |
| 427 | Ga0495610_0174621 | 3300046512 | Bacteria | 898 |
| 428 | Ga0495610_0210495 | 3300046512 | Bacteria | 790 |
| 429 | Ga0495610_0219275 | 3300046512 | Bacteria | 769 |
| 430 | Ga0495610_0299976 | 3300046512 | Bacteria | 620 |
| 431 | Ga0495616_0011891 | 3300046513 | Bacteria | 4960 |
| 432 | Ga0495616_0023857 | 3300046513 | Bacteria | 3287 |
| 433 | Ga0495616_0026953 | 3300046513 | Bacteria | 3053 |
| 434 | Ga0495616_0043072 | 3300046513 | Bacteria | 2294 |
| 435 | Ga0495616_0068813 | 3300046513 | Bacteria | 1718 |
| 436 | Ga0495616_0106618 | 3300046513 | Bacteria | 1307 |
| 437 | Ga0495616_0213353 | 3300046513 | Bacteria | 843 |
| 438 | Ga0495616_0257634 | 3300046513 | Bacteria | 747 |
| 439 | Ga0495620_0002402 | 3300046515 | Bacteria | 10842 |
| 440 | Ga0495620_0007069 | 3300046515 | Bacteria | 6118 |
| 441 | Ga0495620_0008256 | 3300046515 | Bacteria | 5600 |
| 442 | Ga0495620_0013812 | 3300046515 | Bacteria | 4126 |
| 443 | Ga0495620_0015145 | 3300046515 | Bacteria | 3900 |
| 444 | Ga0495620_0023458 | 3300046515 | Bacteria | 2948 |
| 445 | Ga0495620_0033553 | 3300046515 | Bacteria | 2329 |
| 446 | Ga0495620_0044196 | 3300046515 | Bacteria | 1937 |
| 447 | Ga0495620_0045604 | 3300046515 | Bacteria | 1896 |
| 448 | Ga0495620_0201462 | 3300046515 | Bacteria | 765 |
| 449 | Ga0495630_0042898 | 3300046517 | Bacteria | 3378 |
| 450 | Ga0495631_0011499 | 3300046518 | Bacteria | 4352 |
| 451 | Ga0495631_0017288 | 3300046518 | Bacteria | 3416 |
| 452 | Ga0495631_0021204 | 3300046518 | Bacteria | 3026 |
| 453 | Ga0495631_0065645 | 3300046518 | Bacteria | 1571 |
| 454 | Ga0495631_0426356 | 3300046518 | Bacteria | 565 |
| 455 | Ga0495632_0002345 | 3300046519 | Bacteria | 14512 |
| 456 | Ga0495632_0004348 | 3300046519 | Bacteria | 9653 |
| 457 | Ga0495632_0011266 | 3300046519 | Bacteria | 5230 |
| 458 | Ga0495632_0014141 | 3300046519 | Bacteria | 4527 |
| 459 | Ga0495632_0045252 | 3300046519 | Bacteria | 2193 |
| 460 | Ga0495632_0146960 | 3300046519 | Bacteria | 1091 |
| 461 | Ga0495632_0164922 | 3300046519 | Bacteria | 1019 |
| 462 | Ga0495632_0302770 | 3300046519 | Bacteria | 708 |
| 463 | Ga0495632_0317566 | 3300046519 | Bacteria | 688 |
| 464 | Ga0495637_0000311 | 3300046520 | Bacteria | 37854 |
| 465 | Ga0495637_0000361 | 3300046520 | Bacteria | 34578 |
| 466 | Ga0495637_0000615 | 3300046520 | Bacteria | 25236 |
| 467 | Ga0495637_0003967 | 3300046520 | Bacteria | 7737 |
| 468 | Ga0495637_0009986 | 3300046520 | Bacteria | 4613 |
| 469 | Ga0495637_0018640 | 3300046520 | Bacteria | 3217 |
| 470 | Ga0495637_0026550 | 3300046520 | Bacteria | 2597 |
| 471 | Ga0495637_0030291 | 3300046520 | Bacteria | 2401 |
| 472 | Ga0495637_0150375 | 3300046520 | Bacteria | 878 |
| 473 | Ga0495643_0004218 | 3300046522 | Bacteria | 10175 |
| 474 | Ga0495643_0027334 | 3300046522 | Bacteria | 3208 |
| 475 | Ga0495643_0031781 | 3300046522 | Bacteria | 2935 |
| 476 | Ga0495643_0037214 | 3300046522 | Bacteria | 2671 |
| 477 | Ga0495644_0005267 | 3300046523 | Bacteria | 5055 |
| 478 | Ga0495644_0015043 | 3300046523 | Bacteria | 2963 |
| 479 | Ga0495644_0088983 | 3300046523 | Bacteria | 1165 |
| 480 | Ga0495648_0003023 | 3300046524 | Bacteria | 15069 |
| 481 | Ga0495648_0010738 | 3300046524 | Bacteria | 6953 |
| 482 | Ga0495648_0015782 | 3300046524 | Bacteria | 5464 |
| 483 | Ga0495648_0030572 | 3300046524 | Bacteria | 3558 |
| 484 | Ga0495648_0058081 | 3300046524 | Bacteria | 2315 |
| 485 | Ga0495648_0085417 | 3300046524 | Bacteria | 1783 |
| 486 | Ga0495648_0093868 | 3300046524 | Bacteria | 1672 |
| 487 | Ga0495654_0007580 | 3300046530 | Bacteria | 6046 |
| 488 | Ga0495654_0009317 | 3300046530 | Bacteria | 5381 |
| 489 | Ga0495654_0010481 | 3300046530 | Bacteria | 5040 |
| 490 | Ga0495654_0013010 | 3300046530 | Bacteria | 4458 |
| 491 | Ga0495654_0016509 | 3300046530 | Bacteria | 3901 |
| 492 | Ga0495654_0018187 | 3300046530 | Bacteria | 3686 |
| 493 | Ga0495654_0020420 | 3300046530 | Bacteria | 3452 |
| 494 | Ga0495654_0021167 | 3300046530 | Bacteria | 3385 |
| 495 | Ga0495654_0027018 | 3300046530 | Bacteria | 2945 |
| 496 | Ga0495654_0041534 | 3300046530 | Bacteria | 2287 |
| 497 | Ga0495654_0057196 | 3300046530 | Bacteria | 1884 |
| 498 | Ga0495654_0061446 | 3300046530 | Bacteria | 1803 |
| 499 | Ga0495654_0081683 | 3300046530 | Bacteria | 1514 |
| 500 | Ga0495654_0086045 | 3300046530 | Bacteria | 1465 |
| 501 | Ga0495654_0145021 | 3300046530 | Bacteria | 1054 |
| 502 | Ga0495654_0151879 | 3300046530 | Bacteria | 1023 |
| 503 | Ga0495654_0182994 | 3300046530 | Bacteria | 906 |
| 504 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 505 | Ga0495609_0000424 | 3300046538 | Bacteria | 35256 |
| 506 | Ga0495609_0013621 | 3300046538 | Bacteria | 3838 |
| 507 | Ga0495609_0034684 | 3300046538 | Bacteria | 2286 |
| 508 | Ga0495609_0047974 | 3300046538 | Bacteria | 1910 |
| 509 | Ga0495609_0048955 | 3300046538 | Bacteria | 1887 |
| 510 | Ga0495597_0000132 | 3300046542 | Bacteria | 67506 |
| 511 | Ga0495597_0002994 | 3300046542 | Bacteria | 10196 |
| 512 | Ga0495597_0017440 | 3300046542 | Bacteria | 3380 |
| 513 | Ga0495597_0021754 | 3300046542 | Bacteria | 2980 |
| 514 | Ga0495597_0023780 | 3300046542 | Bacteria | 2832 |
| 515 | Ga0495597_0078906 | 3300046542 | Bacteria | 1410 |
| 516 | Ga0495597_0084787 | 3300046542 | Bacteria | 1350 |
| 517 | Ga0495597_0244589 | 3300046542 | Bacteria | 706 |
| 518 | Ga0495597_0322429 | 3300046542 | Bacteria | 596 |
| 519 | Ga0495645_0145424 | 3300046543 | Bacteria | 1651 |
| 520 | Ga0495645_0160557 | 3300046543 | Bacteria | 1554 |
| 521 | Ga0495622_0008181 | 3300046557 | Bacteria | 4845 |
| 522 | Ga0495622_0018515 | 3300046557 | Bacteria | 3244 |
| 523 | Ga0495622_0081223 | 3300046557 | Bacteria | 1491 |
| 524 | Ga0495622_0335056 | 3300046557 | Bacteria | 656 |
| 525 | Ga0495633_0000363 | 3300046558 | Bacteria | 48912 |
| 526 | Ga0495656_0054366 | 3300046615 | Bacteria | 1722 |
| 527 | Ga0495656_0363191 | 3300046615 | Bacteria | 752 |
| 528 | Ga0495668_0016058 | 3300046616 | Bacteria | 4358 |
| 529 | Ga0495668_0021021 | 3300046616 | Bacteria | 3748 |
| 530 | Ga0495668_0055302 | 3300046616 | Bacteria | 2191 |
| 531 | Ga0495668_0126943 | 3300046616 | Bacteria | 1396 |
| 532 | Ga0495611_0000452 | 3300046648 | Bacteria | 24844 |
| 533 | Ga0495611_0015535 | 3300046648 | Bacteria | 3254 |
| 534 | Ga0495611_0140514 | 3300046648 | Bacteria | 1127 |
| 535 | Ga0495625_0000055 | 3300046660 | Bacteria | 186381 |
| 536 | Ga0495625_0038620 | 3300046660 | Bacteria | 3493 |
| 537 | Ga0495625_0370396 | 3300046660 | Bacteria | 901 |
| 538 | Ga0495625_0491850 | 3300046660 | Bacteria | 751 |
| 539 | Ga0495625_0601519 | 3300046660 | Bacteria | 660 |
| 540 | Ga0495661_0000046 | 3300046665 | Bacteria | 148306 |
| 541 | Ga0495661_0000105 | 3300046665 | Bacteria | 101167 |
| 542 | Ga0495661_0003779 | 3300046665 | Bacteria | 11082 |
| 543 | Ga0495661_0005667 | 3300046665 | Bacteria | 8847 |
| 544 | Ga0495661_0012029 | 3300046665 | Bacteria | 5855 |
| 545 | Ga0495661_0029898 | 3300046665 | Bacteria | 3473 |
| 546 | Ga0495661_0032929 | 3300046665 | Bacteria | 3272 |
| 547 | Ga0495661_0048829 | 3300046665 | Bacteria | 2569 |
| 548 | Ga0495661_0097686 | 3300046665 | Bacteria | 1658 |
| 549 | Ga0495588_0155614 | 3300046674 | Bacteria | 1208 |
| 550 | Ga0495669_0532576 | 3300046684 | Bacteria | 571 |
| 551 | Ga0495670_0024732 | 3300046691 | Bacteria | 2969 |
| 552 | Ga0495670_0152628 | 3300046691 | Bacteria | 1211 |
| 553 | Ga0495670_0331599 | 3300046691 | Bacteria | 817 |
| 554 | Ga0495670_0561174 | 3300046691 | Bacteria | 621 |
| 555 | Ga0495671_0004602 | 3300046692 | Bacteria | 8203 |
| 556 | Ga0495671_0013922 | 3300046692 | Bacteria | 4339 |
| 557 | Ga0495671_0021909 | 3300046692 | Bacteria | 3351 |
| 558 | Ga0495671_0030333 | 3300046692 | Bacteria | 2770 |
| 559 | Ga0495671_0032354 | 3300046692 | Bacteria | 2670 |
| 560 | Ga0495671_0124780 | 3300046692 | Bacteria | 1255 |
| 561 | Ga0495671_0126788 | 3300046692 | Bacteria | 1244 |
| 562 | Ga0495671_0127466 | 3300046692 | Bacteria | 1241 |
| 563 | Ga0495671_0150616 | 3300046692 | Bacteria | 1132 |
| 564 | Ga0495671_0390403 | 3300046692 | Bacteria | 666 |
| 565 | Ga0495649_0005256 | 3300046694 | Bacteria | 8273 |
| 566 | Ga0495649_0005519 | 3300046694 | Bacteria | 8014 |
| 567 | Ga0495649_0007416 | 3300046694 | Bacteria | 6686 |
| 568 | Ga0495649_0014018 | 3300046694 | Bacteria | 4608 |
| 569 | Ga0495649_0026487 | 3300046694 | Bacteria | 3223 |
| 570 | Ga0495649_0035386 | 3300046694 | Bacteria | 2746 |
| 571 | Ga0495649_0042100 | 3300046694 | Bacteria | 2495 |
| 572 | Ga0495649_0057255 | 3300046694 | Bacteria | 2102 |
| 573 | Ga0495649_0123176 | 3300046694 | Bacteria | 1370 |
| 574 | Ga0495649_0264820 | 3300046694 | Bacteria | 880 |
| 575 | Ga0495589_0001272 | 3300046794 | Bacteria | 14933 |
| 576 | Ga0495589_0002996 | 3300046794 | Bacteria | 9295 |
| 577 | Ga0495589_0006488 | 3300046794 | Bacteria | 6168 |
| 578 | Ga0495589_0017248 | 3300046794 | Bacteria | 3707 |
| 579 | Ga0495589_0029921 | 3300046794 | Bacteria | 2744 |
| 580 | Ga0495589_0262462 | 3300046794 | Bacteria | 805 |
| 581 | Ga0495600_0050439 | 3300046809 | Bacteria | 2715 |
| 582 | Ga0495660_0000686 | 3300046810 | Bacteria | 25942 |
| 583 | Ga0495660_0001371 | 3300046810 | Bacteria | 16777 |
| 584 | Ga0495660_0004789 | 3300046810 | Bacteria | 8167 |
| 585 | Ga0495660_0011214 | 3300046810 | Bacteria | 5203 |
| 586 | Ga0495660_0015171 | 3300046810 | Bacteria | 4453 |
| 587 | Ga0495660_0030768 | 3300046810 | Bacteria | 3022 |
| 588 | Ga0495660_0032006 | 3300046810 | Bacteria | 2955 |
| 589 | Ga0495660_0049694 | 3300046810 | Bacteria | 2287 |
| 590 | Ga0495660_0092504 | 3300046810 | Bacteria | 1569 |
| 591 | Ga0495672_0004585 | 3300047320 | Bacteria | 11232 |
| 592 | Ga0495672_0010286 | 3300047320 | Bacteria | 6683 |
| 593 | Ga0495672_0012115 | 3300047320 | Bacteria | 6036 |
| 594 | Ga0495672_0013999 | 3300047320 | Bacteria | 5512 |
| 595 | Ga0495672_0017842 | 3300047320 | Bacteria | 4734 |
| 596 | Ga0495672_0030817 | 3300047320 | Bacteria | 3356 |
| 597 | Ga0495672_0034249 | 3300047320 | Bacteria | 3139 |
| 598 | Ga0495672_0061002 | 3300047320 | Bacteria | 2175 |
| 599 | Ga0495672_0079560 | 3300047320 | Bacteria | 1830 |
| 600 | Ga0495672_0491008 | 3300047320 | Bacteria | 547 |
| 601 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 602 | Ga0495676_0048737 | 3300047321 | Bacteria | 3412 |
| 603 | Ga0495676_0057866 | 3300047321 | Bacteria | 3053 |
| 604 | Ga0495680_0035990 | 3300047322 | Bacteria | 3980 |
| 605 | Ga0495683_0000219 | 3300047323 | Bacteria | 53978 |
| 606 | Ga0495683_0005606 | 3300047323 | Bacteria | 6956 |
| 607 | Ga0495683_0026619 | 3300047323 | Bacteria | 2959 |
| 608 | Ga0495683_0114273 | 3300047323 | Bacteria | 1286 |
| 609 | Ga0495683_0280242 | 3300047323 | Bacteria | 721 |
| 610 | Ga0495683_0331899 | 3300047323 | Bacteria | 646 |
| 611 | Ga0495687_009215 | 3300047443 | Bacteria | 5551 |
| 612 | Ga0495679_001326 | 3300047446 | Bacteria | 14358 |
| 613 | Ga0495679_001454 | 3300047446 | Bacteria | 13419 |
| 614 | Ga0495679_004751 | 3300047446 | Bacteria | 6159 |
| 615 | Ga0495679_006773 | 3300047446 | Bacteria | 4876 |
| 616 | Ga0495679_010526 | 3300047446 | Bacteria | 3626 |
| 617 | Ga0495679_012122 | 3300047446 | Bacteria | 3296 |
| 618 | Ga0495679_015185 | 3300047446 | Bacteria | 2824 |
| 619 | Ga0495679_119904 | 3300047446 | Bacteria | 719 |
| 620 | Ga0495673_0000707 | 3300047469 | Bacteria | 32354 |
| 621 | Ga0495673_0002341 | 3300047469 | Bacteria | 13470 |
| 622 | Ga0495673_0002364 | 3300047469 | Bacteria | 13392 |
| 623 | Ga0495673_0003827 | 3300047469 | Bacteria | 9718 |
| 624 | Ga0495673_0004660 | 3300047469 | Bacteria | 8522 |
| 625 | Ga0495673_0006163 | 3300047469 | Bacteria | 7103 |
| 626 | Ga0495673_0008393 | 3300047469 | Bacteria | 5822 |
| 627 | Ga0495673_0013870 | 3300047469 | Bacteria | 4211 |
| 628 | Ga0495673_0015988 | 3300047469 | Bacteria | 3848 |
| 629 | Ga0495673_0019328 | 3300047469 | Bacteria | 3414 |
| 630 | Ga0495673_0019870 | 3300047469 | Bacteria | 3356 |
| 631 | Ga0495673_0022951 | 3300047469 | Bacteria | 3047 |
| 632 | Ga0495673_0024890 | 3300047469 | Bacteria | 2882 |
| 633 | Ga0495673_0074899 | 3300047469 | Bacteria | 1415 |
| 634 | Ga0495673_0078559 | 3300047469 | Bacteria | 1371 |
| 635 | Ga0495673_0185592 | 3300047469 | Bacteria | 785 |
| 636 | Ga0495681_0004996 | 3300047470 | Bacteria | 8945 |
| 637 | Ga0495681_0012773 | 3300047470 | Bacteria | 4914 |
| 638 | Ga0495681_0016737 | 3300047470 | Bacteria | 4096 |
| 639 | Ga0495681_0030297 | 3300047470 | Bacteria | 2757 |
| 640 | Ga0495681_0063374 | 3300047470 | Bacteria | 1696 |
| 641 | Ga0495681_0080093 | 3300047470 | Bacteria | 1459 |
| 642 | Ga0495681_0147495 | 3300047470 | Bacteria | 989 |
| 643 | Ga0495681_0164811 | 3300047470 | Bacteria | 921 |
| 644 | Ga0495686_0022208 | 3300047472 | Bacteria | 4199 |
| 645 | Ga0495686_0058080 | 3300047472 | Bacteria | 2412 |
| 646 | Ga0495686_0157131 | 3300047472 | Bacteria | 1331 |
| 647 | Ga0495686_0206793 | 3300047472 | Bacteria | 1123 |
| 648 | Ga0495593_0029838 | 3300047673 | Bacteria | 2987 |
| 649 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 650 | Ga0495626_0000496 | 3300048091 | Bacteria | 39625 |
| 651 | Ga0495626_0003484 | 3300048091 | Bacteria | 10080 |
| 652 | Ga0495626_0008875 | 3300048091 | Bacteria | 5462 |
| 653 | Ga0495626_0058813 | 3300048091 | Bacteria | 1755 |
| 654 | Ga0495626_0101013 | 3300048091 | Bacteria | 1257 |
| 655 | Ga0495626_0233251 | 3300048091 | Bacteria | 743 |
| 656 | Ga0496102_0275264 | 3300048905 | Bacteria | 1587 |
| 657 | Ga0496102_0334097 | 3300048905 | Bacteria | 1427 |
| 658 | Ga0496102_1201961 | 3300048905 | Bacteria | 678 |
| 659 | Ga0496104_1492195 | 3300048907 | Bacteria | 579 |
| 660 | Ga0496106_0597776 | 3300048909 | Bacteria | 884 |
| 661 | Ga0496110_0050531 | 3300048913 | Bacteria | 3651 |
| 662 | Ga0496112_0045170 | 3300048915 | Bacteria | 4318 |
| 663 | Ga0496112_0343869 | 3300048915 | Bacteria | 1435 |
| 664 | Ga0496113_0316299 | 3300048916 | Bacteria | 1251 |
| 665 | Ga0496116_0021368 | 3300048919 | Bacteria | 4883 |
| 666 | Ga0496116_0100796 | 3300048919 | Bacteria | 1726 |
| 667 | Ga0496116_0300728 | 3300048919 | Bacteria | 764 |
| 668 | Ga0496116_0381666 | 3300048919 | Bacteria | 631 |
| 669 | Ga0496117_0002364 | 3300048920 | Bacteria | 24081 |
| 670 | Ga0496117_0008772 | 3300048920 | Bacteria | 9539 |
| 671 | Ga0496117_0035449 | 3300048920 | Bacteria | 3744 |
| 672 | Ga0496117_0052648 | 3300048920 | Bacteria | 2865 |
| 673 | Ga0496117_0107867 | 3300048920 | Bacteria | 1743 |
| 674 | Ga0496118_0032626 | 3300048921 | Bacteria | 4285 |
| 675 | Ga0496118_0056044 | 3300048921 | Bacteria | 2966 |
| 676 | Ga0496118_0180238 | 3300048921 | Bacteria | 1277 |
| 677 | Ga0496118_0231606 | 3300048921 | Bacteria | 1065 |
| 678 | Ga0496119_0007398 | 3300048922 | Bacteria | 9902 |
| 679 | Ga0496119_0163761 | 3300048922 | Bacteria | 1180 |
| 680 | Ga0496119_0330606 | 3300048922 | Bacteria | 743 |
| 681 | Ga0496120_0005071 | 3300048923 | Bacteria | 10660 |
| 682 | Ga0496120_0033312 | 3300048923 | Bacteria | 3096 |
| 683 | Ga0496120_0039529 | 3300048923 | Bacteria | 2781 |
| 684 | Ga0496121_0001347 | 3300048924 | Bacteria | 41983 |
| 685 | Ga0496121_0007481 | 3300048924 | Bacteria | 13191 |
| 686 | Ga0496121_0026606 | 3300048924 | Bacteria | 5443 |
| 687 | Ga0496121_0058010 | 3300048924 | Bacteria | 3204 |
| 688 | Ga0496121_0114867 | 3300048924 | Bacteria | 2045 |
| 689 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 690 | Ga0496122_0005968 | 3300048925 | Bacteria | 14255 |
| 691 | Ga0496122_0029037 | 3300048925 | Bacteria | 4676 |
| 692 | Ga0496122_0058635 | 3300048925 | Bacteria | 2847 |
| 693 | Ga0496122_0083818 | 3300048925 | Bacteria | 2208 |
| 694 | Ga0496122_0099909 | 3300048925 | Bacteria | 1943 |
| 695 | Ga0496122_0128376 | 3300048925 | Bacteria | 1617 |
| 696 | Ga0496122_0243519 | 3300048925 | Bacteria | 1012 |
| 697 | Ga0496122_0257343 | 3300048925 | Bacteria | 971 |
| 698 | Ga0496122_0304006 | 3300048925 | Bacteria | 858 |
| 699 | Ga0496123_0000173 | 3300048926 | Bacteria | 130586 |
| 700 | Ga0496123_0027754 | 3300048926 | Bacteria | 4209 |
| 701 | Ga0496123_0046715 | 3300048926 | Bacteria | 2933 |
| 702 | Ga0496123_0060044 | 3300048926 | Bacteria | 2453 |
| 703 | Ga0496123_0061148 | 3300048926 | Bacteria | 2422 |
| 704 | Ga0496123_0073404 | 3300048926 | Bacteria | 2123 |
| 705 | Ga0496123_0199670 | 3300048926 | Bacteria | 1026 |
| 706 | Ga0496124_0000145 | 3300048927 | Bacteria | 146878 |
| 707 | Ga0496124_0002454 | 3300048927 | Bacteria | 24263 |
| 708 | Ga0496124_0008355 | 3300048927 | Bacteria | 10841 |
| 709 | Ga0496124_0009092 | 3300048927 | Bacteria | 10275 |
| 710 | Ga0496124_0067435 | 3300048927 | Bacteria | 2977 |
| 711 | Ga0496124_0072026 | 3300048927 | Bacteria | 2862 |
| 712 | Ga0496124_0110565 | 3300048927 | Bacteria | 2212 |
| 713 | Ga0496124_0125791 | 3300048927 | Bacteria | 2042 |
| 714 | Ga0496124_0195290 | 3300048927 | Bacteria | 1544 |
| 715 | Ga0496124_0321992 | 3300048927 | Bacteria | 1106 |
| 716 | Ga0496124_0355378 | 3300048927 | Bacteria | 1035 |
| 717 | Ga0496125_0001578 | 3300048928 | Bacteria | 32443 |
| 718 | Ga0496125_0009144 | 3300048928 | Bacteria | 10248 |
| 719 | Ga0496125_0027716 | 3300048928 | Bacteria | 5128 |
| 720 | Ga0496125_0053412 | 3300048928 | Bacteria | 3312 |
| 721 | Ga0496125_0056410 | 3300048928 | Bacteria | 3190 |
| 722 | Ga0496125_0087928 | 3300048928 | Bacteria | 2344 |
| 723 | Ga0496125_0100061 | 3300048928 | Bacteria | 2138 |
| 724 | Ga0496125_0336868 | 3300048928 | Bacteria | 907 |
| 725 | Ga0496125_0621138 | 3300048928 | Bacteria | 586 |
| 726 | Ga0496126_0043455 | 3300048929 | Bacteria | 4145 |
| 727 | Ga0496126_0358007 | 3300048929 | Bacteria | 1192 |
| 728 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 729 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 730 | Ga0495678_005448 | 3300049459 | Bacteria | 7025 |
| 731 | Ga0495678_007296 | 3300049459 | Bacteria | 5748 |
| 732 | Ga0495678_018450 | 3300049459 | Bacteria | 3136 |
| 733 | Ga0495678_039779 | 3300049459 | Bacteria | 1894 |
| 734 | Ga0495678_043057 | 3300049459 | Bacteria | 1795 |
| 735 | Ga0495682_0000599 | 3300049460 | Bacteria | 24419 |
| 736 | Ga0495682_0019448 | 3300049460 | Bacteria | 2554 |
| 737 | Ga0495682_0034671 | 3300049460 | Bacteria | 1860 |
| 738 | Ga0495682_0050062 | 3300049460 | Bacteria | 1521 |
| 739 | Ga0501252_044227 | 3300049682 | Bacteria | 655 |
| 740 | Ga0501241_096005 | 3300049758 | Bacteria | 633 |
| 741 | Ga0501241_134236 | 3300049758 | Bacteria | 560 |
| 742 | Ga0501269_006047 | 3300049766 | Bacteria | 1457 |
| 743 | nmdc:mga03683_55733_c1 | 3300050489 | Bacteria | 1661 |
| 744 | nmdc:mga00v17_252375_c1 | 3300050491 | Bacteria | 833 |
| 745 | nmdc:mga00v17_29701_c1 | 3300050491 | Bacteria | 3210 |
| 746 | nmdc:mga08x19_106693_c1 | 3300050514 | Bacteria | 1864 |
| 747 | nmdc:mga08x19_911753_c1 | 3300050514 | Bacteria | 624 |
| 748 | Ga0500618_046858 | 3300053125 | Bacteria | 984 |
| 749 | Ga0500586_008033 | 3300053145 | Bacteria | 2853 |
| 750 | Ga0500634_0008096 | 3300053161 | Bacteria | 5234 |
| 751 | 2511291820 | 2511231010 | Bacteria | 6373152 |
| 752 | 2511312044 | 2511231014 | Bacteria | 6462302 |
| 753 | 2511319058 | 2511231015 | Bacteria | 6598026 |
| 754 | 2511333138 | 2511231017 | Bacteria | 6503007 |
| 755 | 2511351509 | 2511231020 | Bacteria | 6115223 |
| 756 | 2511368214 | 2511231023 | Bacteria | 6808468 |
| 757 | 2511823350 | 2511231156 | Bacteria | 6845832 |
| 758 | 2597862650 | 2597489888 | Bacteria | 6179543 |
| 759 | 2597868493 | 2597489889 | Bacteria | 6297495 |
| 760 | 2599331240 | 2599185155 | Bacteria | 5827168 |
| 761 | 2599396748 | 2599185167 | Bacteria | 6353609 |
| 762 | 2599448734 | 2599185179 | Bacteria | 6611171 |
| 763 | 2599501478 | 2599185188 | Bacteria | 6164180 |
| 764 | 2599507718 | 2599185189 | Bacteria | 5862825 |
| 765 | 2599511507 | 2599185190 | Bacteria | 6285678 |
| 766 | 2599517545 | 2599185191 | Bacteria | 6297582 |
| 767 | 2599615439 | 2599185212 | Bacteria | 6765997 |
| 768 | 2599772842 | 2599185248 | Bacteria | 6696816 |
| 769 | 2599879957 | 2599185288 | Bacteria | 6666191 |
| 770 | 2599889339 | 2599185289 | Bacteria | 6778765 |
| 771 | 2599890881 | 2599185290 | Bacteria | 6289611 |
| 772 | 2599896662 | 2599185291 | Bacteria | 6775623 |
| 773 | 2599931777 | 2599185300 | Bacteria | 6062622 |
| 774 | 2599945458 | 2599185302 | Bacteria | 5954930 |
| 775 | 2599948464 | 2599185303 | Bacteria | 6512725 |
| 776 | 2599956576 | 2599185304 | Bacteria | 5951361 |
| 777 | 2599962508 | 2599185305 | Bacteria | 6748700 |
| 778 | 2599968317 | 2599185306 | Bacteria | 6637356 |
| 779 | 2599974236 | 2599185307 | Bacteria | 6194719 |
| 780 | 2599979504 | 2599185308 | Bacteria | 6621546 |
| 781 | 2599985502 | 2599185309 | Bacteria | 5969593 |
| 782 | 2599992294 | 2599185310 | Bacteria | 6014457 |
| 783 | 2599997801 | 2599185311 | Bacteria | 6354990 |
| 784 | 2600002456 | 2599185312 | Bacteria | 5912071 |
| 785 | 2600006771 | 2599185313 | Bacteria | 6658188 |
| 786 | 2600013316 | 2599185314 | Bacteria | 6621749 |
| 787 | 2600020136 | 2599185315 | Bacteria | 6771107 |
| 788 | 2600026137 | 2599185316 | Bacteria | 6320029 |
| 789 | 2600031496 | 2599185317 | Bacteria | 6435722 |
| 790 | 2600036423 | 2599185318 | Bacteria | 6961590 |
| 791 | 2600044975 | 2599185319 | Bacteria | 6637840 |
| 792 | 2600049989 | 2599185320 | Bacteria | 5963263 |
| 793 | 2600053409 | 2599185321 | Bacteria | 6764560 |
| 794 | 2600061937 | 2599185322 | Bacteria | 6763055 |
| 795 | 2600067164 | 2599185323 | Bacteria | 6688755 |
| 796 | 2600070504 | 2599185324 | Bacteria | 6590677 |
| 797 | 2600080115 | 2599185325 | Bacteria | 6324919 |
| 798 | 2600361297 | 2600254930 | Bacteria | 6431253 |
| 799 | 2601625840 | 2600255283 | Bacteria | 6061572 |
| 800 | 2601691227 | 2600255296 | Bacteria | 5784754 |
| 801 | 2601799838 | 2600255318 | Bacteria | 6383414 |
| 802 | 2606074363 | 2603880185 | Bacteria | 6379190 |
| 803 | 2606127226 | 2603880199 | Bacteria | 6377649 |
| 804 | 2621301220 | 2619619299 | Bacteria | 6649820 |
| 805 | 2624479124 | 2623620443 | Bacteria | 6427864 |
| 806 | 2643873140 | 2643221571 | Bacteria | 6228673 |
| 807 | 2644283507 | 2643221650 | Bacteria | 7029547 |
| 808 | 2644624323 | 2643221713 | Bacteria | 6554480 |
| 809 | 2652546864 | 2651869719 | Bacteria | 6047974 |
| 810 | 2671090537 | 2667528170 | Bacteria | 6786960 |
| 811 | 2671127727 | 2667528176 | Bacteria | 6724917 |
| 812 | 2677897377 | 2675903420 | Bacteria | 6247433 |
| 813 | 2678261902 | 2675903515 | Bacteria | 6580491 |
| 814 | 2715758845 | 2713897149 | Bacteria | 6506249 |
| 815 | 2718633010 | 2718217725 | Bacteria | 5758958 |
| 816 | 2723247526 | 2721755607 | Bacteria | 5841722 |
| 817 | 2738674011 | 2738541265 | Bacteria | 6594665 |
| 818 | 2738689641 | 2738541271 | Bacteria | 5657310 |
| 819 | 2738752404 | 2738541282 | Bacteria | 6593925 |
| 820 | 2738809423 | 2738541294 | Bacteria | 6925949 |
| 821 | 2738861445 | 2738541303 | Bacteria | 6591772 |
| 822 | 2738896783 | 2738541309 | Bacteria | 6926455 |
| 823 | 2739256592 | 2738543015 | Bacteria | 6750701 |
| 824 | 2739265415 | 2738543016 | Bacteria | 5657564 |
| 825 | 2745008250 | 2744054620 | Bacteria | 6551379 |
| 826 | 2794596063 | 2791355520 | Bacteria | 5948615 |
| 827 | 2808856764 | 2808606361 | Bacteria | 6136259 |
| 828 | 2808924045 | 2808606376 | Bacteria | 6248667 |
| 829 | 2808936787 | 2808606378 | Bacteria | 6177535 |
| 830 | 2808945986 | 2808606380 | Bacteria | 6248705 |
| 831 | 2808965151 | 2808606383 | Bacteria | 6138645 |
| 832 | 2808975580 | 2808606385 | Bacteria | 6711065 |
| 833 | 2808990781 | 2808606388 | Bacteria | 6706662 |
| 834 | 2809000043 | 2808606389 | Bacteria | 6138126 |
| 835 | 2812368473 | 2811994881 | Bacteria | 6298475 |
| 836 | 2817489416 | 2816332298 | Bacteria | 6852809 |
| 837 | 2825653375 | 2825651385 | Bacteria | 6715909 |
| 838 | 2826585614 | 2826581358 | Bacteria | 5963467 |
| 839 | 2834029327 | 2834028612 | Bacteria | 6354979 |
| 840 | 2842818472 | 2842815866 | Bacteria | 5947510 |
| 841 | 2842830256 | 2842826826 | Bacteria | 5974129 |
| 842 | 2842839930 | 2842837860 | Bacteria | 6066181 |
| 843 | 2842853173 | 2842849001 | Bacteria | 5924277 |
| 844 | 2842860029 | 2842854478 | Bacteria | 6143501 |
| 845 | 2852615186 | 2852612431 | Bacteria | 6885235 |
| 846 | 2852670154 | 2852667396 | Bacteria | 6885555 |
| 847 | 2860869370 | 2860867994 | Bacteria | 5645326 |
| 848 | 2878031082 | 2878029506 | Bacteria | 6418441 |
| 849 | 2880231997 | 2880230671 | Bacteria | 6140320 |
| 850 | 2904551626 | 2904550169 | Bacteria | 6221258 |
| 851 | 2908448240 | 2908446538 | Bacteria | 6829095 |
| 852 | 2913038248 | 2913036834 | Bacteria | 6704877 |
| 853 | 2919064405 | 2919063839 | Bacteria | 6302690 |
| 854 | 2919386119 | 2919385768 | Bacteria | 5897293 |
| 855 | 2919481515 | 2919481497 | Bacteria | 6907839 |
| 856 | 2923522530 | 2923519811 | Bacteria | 6298479 |
| 857 | 2923590622 | 2923586266 | Bacteria | 6565975 |
| 858 | 2929145692 | 2929144301 | Bacteria | 6622272 |
| 859 | 2929191345 | 2929189879 | Bacteria | 5930554 |
| 860 | 2931370975 | 2931369376 | Bacteria | 6847892 |
| 861 | 2931392347 | 2931390751 | Bacteria | 6273349 |
| 862 | 2945929233 | 2945928738 | Bacteria | 6053221 |
| 863 | 2945961598 | 2945961074 | Bacteria | 7342064 |
| 864 | 2946011496 | 2946006987 | Bacteria | 6705746 |
| 865 | 2946029565 | 2946027586 | Bacteria | 6049274 |
| 866 | 2947236160 | 2947233263 | Bacteria | 6439278 |
| 867 | 2988733237 | 2988728565 | Bacteria | 6124362 |
| 868 | 3007420957 | 3007419365 | Bacteria | 7026924 |
| 869 | 3007614940 | 3007614139 | Bacteria | 6053559 |
| 870 | 3007722980 | 3007718800 | Bacteria | 5971527 |
| 871 | 3007870685 | 3007866637 | Bacteria | 5899198 |
| 872 | 8054288804 | 8054285046 | Bacteria | 6919322 |
| 873 | 8054348900 | 8054347763 | Bacteria | 5901107 |
| 874 | 8054504911 | 8054503363 | Bacteria | 6101651 |
| 875 | 8055819370 | 8055817908 | Bacteria | 6609162 |
| 876 | 8056127367 | 8056125926 | Bacteria | 6228218 |
| 877 | 8056133278 | 8056131705 | Bacteria | 6107031 |
| 878 | 8056147587 | 8056143049 | Bacteria | 6307666 |
| 879 | 8056149520 | 8056148874 | Bacteria | 6479865 |
| 880 | 8056164686 | 8056161164 | Bacteria | 6106669 |
| 881 | 8056175837 | 8056172158 | Bacteria | 6133900 |
| 882 | Ga0495668_0019746 | |||
| 883 | SwRhRL2b_contig_2134850 | |||
| 884 | MRS1b_contig_5200652 | |||
| 885 | JGI25154J39366_1020427 | |||
| 886 | JGI25163J39215_1000501 | |||
| 887 | JGI25164J39214_1000106 | |||
| 888 | JGI25165J46597_1000217 | |||
| 889 | Ga0055538_1000082 | |||
| 890 | Ga0055539_1000121 | |||
| 891 | Ga0055533_1000129 | |||
| 892 | Ga0055532_1000104 | |||
| 893 | Ga0055525_1000167 | |||
| 894 | Ga0055525_1004613 | |||
| 895 | Ga0055535_1004640 | |||
| 896 | Ga0055530_10000383 | |||
| 897 | Ga0055540_1000341 | |||
| 898 | Ga0055541_1000081 | |||
| 899 | Ga0065714_10002649 | |||
| 900 | Ga0065714_10004105 | |||
| 901 | Ga0065714_10007722 | |||
| 902 | Ga0065714_10020555 | |||
| 903 | Ga0065714_10065614 | |||
| 904 | Ga0065714_10069233 | |||
| 905 | Ga0065714_10103799 | |||
| 906 | Ga0065714_10199652 | |||
| 907 | Ga0065704_10044559 | |||
| 908 | Ga0065704_10074387 | |||
| 909 | Ga0065704_10687777 | |||
| 910 | Ga0065704_10744385 | |||
| 911 | Ga0065712_10068085 | |||
| 912 | Ga0065712_10070272 | |||
| 913 | Ga0070670_100003000 | |||
| 914 | Ga0070670_100024752 | |||
| 915 | Ga0070661_100000238 | |||
| 916 | Ga0070669_100000150 | |||
| 917 | Ga0070669_100014789 | |||
| 918 | Ga0070659_100470551 | |||
| 919 | Ga0070662_100003244 | |||
| 920 | Ga0070662_101747428 | |||
| 921 | Ga0070665_100083065 | |||
| 922 | Ga0070664_100001048 | |||
| 923 | Ga0070664_100096005 | |||
| 924 | Ga0068857_101764070 | |||
| 925 | Ga0068854_100003503 | |||
| 926 | Ga0068851_10000182 | |||
| 927 | Ga0075364_10024831 | |||
| 928 | Ga0075364_10224631 | |||
| 929 | Ga0075364_10294785 | |||
| 930 | Ga0075364_10485035 | |||
| 931 | Ga0075432_10012331 | |||
| 932 | Ga0075432_10013811 | |||
| 933 | Ga0075432_10036556 | |||
| 934 | Ga0075432_10041102 | |||
| 935 | Ga0075432_10076722 | |||
| 936 | Ga0075432_10459031 | |||
| 937 | Ga0075362_10086754 | |||
| 938 | Ga0075436_100202621 | |||
| 939 | Ga0079104_1000134 | |||
| 940 | Ga0105251_10000519 | |||
| 941 | Ga0105251_10000636 | |||
| 942 | Ga0105251_10000761 | |||
| 943 | Ga0105251_10011273 | |||
| 944 | Ga0105251_10014616 | |||
| 945 | Ga0105251_10030980 | |||
| 946 | Ga0105251_10034402 | |||
| 947 | Ga0105251_10102908 | |||
| 948 | Ga0105251_10219461 | |||
| 949 | Ga0105251_10265235 | |||
| 950 | Ga0105251_10465263 | |||
| 951 | Ga0105244_10005059 | |||
| 952 | Ga0105244_10010013 | |||
| 953 | Ga0105244_10010658 | |||
| 954 | Ga0105244_10018282 | |||
| 955 | Ga0105244_10019511 | |||
| 956 | Ga0105244_10093699 | |||
| 957 | Ga0105244_10110387 | |||
| 958 | Ga0105244_10127830 | |||
| 959 | Ga0105244_10281194 | |||
| 960 | Ga0105244_10326791 | |||
| 961 | Ga0105244_10508955 | |||
| 962 | Ga0105250_10000118 | |||
| 963 | Ga0105250_10001221 | |||
| 964 | Ga0105250_10006525 | |||
| 965 | Ga0105250_10029658 | |||
| 966 | Ga0105250_10119213 | |||
| 967 | Ga0105250_10319690 | |||
| 968 | Ga0105250_10517015 | |||
| 969 | Ga0105243_10000592 | |||
| 970 | Ga0105243_10203131 | |||
| 971 | Ga0105243_10338116 | |||
| 972 | Ga0105242_10003316 | |||
| 973 | Ga0105248_10432146 | |||
| 974 | Ga0105237_10001417 | |||
| 975 | Ga0105246_10004551 | |||
| 976 | Ga0105246_10007263 | |||
| 977 | Ga0105246_10158749 | |||
| 978 | Ga0157373_10000309 | |||
| 979 | Ga0157373_10006208 | |||
| 980 | Ga0157373_10018032 | |||
| 981 | Ga0157373_10029742 | |||
| 982 | Ga0157373_10046460 | |||
| 983 | Ga0157373_10120230 | |||
| 984 | Ga0157373_10783227 | |||
| 985 | Ga0157371_10000281 | |||
| 986 | Ga0157371_11308574 | |||
| 987 | Ga0157370_10034330 | |||
| 988 | Ga0157370_10166073 | |||
| 989 | Ga0157370_10996457 | |||
| 990 | Ga0157370_11347506 | |||
| 991 | Ga0157370_11478880 | |||
| 992 | Ga0157370_12146435 | |||
| 993 | Ga0157369_10014243 | |||
| 994 | Ga0157369_10082425 | |||
| 995 | Ga0157369_10836729 | |||
| 996 | Ga0163162_10293815 | |||
| 997 | Ga0163162_10567527 | |||
| 998 | Ga0163162_10623693 | |||
| 999 | Ga0163162_10732051 | |||
| 1000 | Ga0163162_11043520 | |||
| 1001 | Ga0163162_11408734 | |||
| 1002 | Ga0157372_10122042 | |||
| 1003 | Ga0157375_10000770 | |||
| 1004 | Ga0157375_10100354 | |||
| 1005 | Ga0182008_10003721 | |||
| 1006 | Ga0182008_10010930 | |||
| 1007 | Ga0182008_10019034 | |||
| 1008 | Ga0182008_10019348 | |||
| 1009 | Ga0182008_10103436 | |||
| 1010 | Ga0182008_10162879 | |||
| 1011 | Ga0182006_1001770 | |||
| 1012 | Ga0182006_1005447 | |||
| 1013 | Ga0182006_1012362 | |||
| 1014 | Ga0182006_1024112 | |||
| 1015 | Ga0182006_1036144 | |||
| 1016 | Ga0182006_1055297 | |||
| 1017 | Ga0182007_10011315 | |||
| 1018 | Ga0182007_10084973 | |||
| 1019 | Ga0182005_1181736 | |||
| 1020 | Ga0182005_1217844 | |||
| 1021 | Ga0182005_1278857 | |||
| 1022 | Ga0163161_10082705 | |||
| 1023 | Ga0163161_10083508 | |||
| 1024 | Ga0163161_10149016 | |||
| 1025 | Ga0163161_10274802 | |||
| 1026 | Ga0163161_10574376 | |||
| 1027 | Ga0163161_10646933 | |||
| 1028 | Ga0163161_10753156 | |||
| 1029 | Ga0163161_10879248 | |||
| 1030 | Ga0163161_11028569 | |||
| 1031 | Ga0209435_100662 | |||
| 1032 | Ga0209760_100047 | |||
| 1033 | Ga0209784_100015 | |||
| 1034 | Ga0209566_100012 | |||
| 1035 | Ga0209674_100027 | |||
| 1036 | Ga0209147_100019 | |||
| 1037 | Ga0209563_100031 | |||
| 1038 | Ga0207427_100029 | |||
| 1039 | Ga0209437_100009 | |||
| 1040 | Ga0209258_100250 | |||
| 1041 | Ga0209646_1000263 | |||
| 1042 | Ga0209677_100016 | |||
| 1043 | Ga0209759_1015996 | |||
| 1044 | Ga0209233_1000032 | |||
| 1045 | Ga0209676_1009528 | |||
| 1046 | Ga0209050_1000009 | |||
| 1047 | Ga0209051_1000053 | |||
| 1048 | Ga0209257_1024255 | |||
| 1049 | Ga0207656_10000026 | |||
| 1050 | Ga0207696_1000083 | |||
| 1051 | Ga0207696_1000111 | |||
| 1052 | Ga0207696_1002525 | |||
| 1053 | Ga0207696_1015216 | |||
| 1054 | Ga0207655_1000435 | |||
| 1055 | Ga0207655_1004894 | |||
| 1056 | Ga0207655_1007033 | |||
| 1057 | Ga0207655_1007316 | |||
| 1058 | Ga0207655_1009473 | |||
| 1059 | Ga0207655_1039031 | |||
| 1060 | Ga0207655_1046881 | |||
| 1061 | Ga0207655_1109472 | |||
| 1062 | Ga0207713_1000566 | |||
| 1063 | Ga0207713_1000574 | |||
| 1064 | Ga0207713_1001013 | |||
| 1065 | Ga0207713_1002530 | |||
| 1066 | Ga0207713_1004071 | |||
| 1067 | Ga0207713_1010451 | |||
| 1068 | Ga0207713_1081434 | |||
| 1069 | Ga0207713_1208371 | |||
| 1070 | Ga0207671_10000436 | |||
| 1071 | Ga0207649_10000002 | |||
| 1072 | Ga0207681_10000475 | |||
| 1073 | Ga0207681_10003184 | |||
| 1074 | Ga0207650_10000341 | |||
| 1075 | Ga0207650_10000543 | |||
| 1076 | Ga0207706_10002059 | |||
| 1077 | Ga0207686_10003220 | |||
| 1078 | Ga0207709_10000036 | |||
| 1079 | Ga0207709_10010603 | |||
| 1080 | Ga0207709_10042839 | |||
| 1081 | Ga0207709_10817573 | |||
| 1082 | Ga0207679_10000006 | |||
| 1083 | Ga0207679_10344160 | |||
| 1084 | Ga0207640_10035644 | |||
| 1085 | Ga0207674_10244075 | |||
| 1086 | Ga0209281_1000172 | |||
| 1087 | Ga0207428_10065620 | |||
| 1088 | Ga0207428_10120405 | |||
| 1089 | Ga0207428_10200972 | |||
| 1090 | Ga0207428_10236540 | |||
| 1091 | Ga0207428_10265458 | |||
| 1092 | Ga0207428_10342241 | |||
| 1093 | Ga0207428_10463024 | |||
| 1094 | Ga0207428_10750476 | |||
| 1095 | Ga0268266_10103348 | |||
| 1096 | Ga0307517_10125890 | |||
| 1097 | Ga0307517_10132544 | |||
| 1098 | Ga0307511_10024142 | |||
| 1099 | Ga0316177_1179323 | |||
| 1100 | Ga0314311_1016558 | |||
| 1101 | Ga0316179_1024935 | |||
| 1102 | Ga0316179_1108273 | |||
| 1103 | Ga0316183_1205945 | |||
| 1104 | Ga0316181_1002344 | |||
| 1105 | Ga0265340_10061335 | |||
| 1106 | Ga0307408_100000653 | |||
| 1107 | Ga0307408_100031073 | |||
| 1108 | Ga0307408_100075100 | |||
| 1109 | Ga0307408_100162569 | |||
| 1110 | Ga0307408_100334162 | |||
| 1111 | Ga0307408_100360763 | |||
| 1112 | Ga0307516_10229237 | |||
| 1113 | Ga0307405_10000489 | |||
| 1114 | Ga0307405_10007647 | |||
| 1115 | Ga0307405_10008680 | |||
| 1116 | Ga0307405_10281869 | |||
| 1117 | Ga0307405_11195309 | |||
| 1118 | Ga0307413_10007458 | |||
| 1119 | Ga0307413_10053048 | |||
| 1120 | Ga0307406_10011259 | |||
| 1121 | Ga0307406_10019318 | |||
| 1122 | Ga0307406_10064515 | |||
| 1123 | Ga0307406_10893087 | |||
| 1124 | Ga0307407_10773396 | |||
| 1125 | Ga0307412_10001818 | |||
| 1126 | Ga0307412_10012714 | |||
| 1127 | Ga0307412_10014040 | |||
| 1128 | Ga0307412_10038731 | |||
| 1129 | Ga0307412_10076585 | |||
| 1130 | Ga0307412_10199740 | |||
| 1131 | Ga0307409_100169180 | |||
| 1132 | Ga0307414_10190069 | |||
| 1133 | Ga0307414_10232641 | |||
| 1134 | Ga0307414_10353696 | |||
| 1135 | Ga0307411_10023183 | |||
| 1136 | Ga0307411_10055766 | |||
| 1137 | Ga0307411_10597408 | |||
| 1138 | Ga0237819_00918 | |||
| 1139 | Ga0439438_001959 | |||
| 1140 | Ga0439438_004047 | |||
| 1141 | Ga0439438_004550 | |||
| 1142 | Ga0439438_008480 | |||
| 1143 | Ga0439447_008598 | |||
| 1144 | Ga0439447_042313 | |||
| 1145 | Ga0439447_046810 | |||
| 1146 | Ga0439447_121761 | |||
| 1147 | Ga0439466_0000975 | |||
| 1148 | Ga0439466_0007401 | |||
| 1149 | Ga0439466_0016390 | |||
| 1150 | Ga0439466_0039153 | |||
| 1151 | Ga0439466_0204122 | |||
| 1152 | Ga0451797_1373657 | |||
| 1153 | Ga0451837_0710161 | |||
| 1154 | Ga0451841_0661852 | |||
| 1155 | Ga0451841_0704577 | |||
| 1156 | Ga0451853_1222240 | |||
| 1157 | Ga0439431_0001788 | |||
| 1158 | Ga0439445_0017395 | |||
| 1159 | Ga0439432_002268 | |||
| 1160 | Ga0439432_005274 | |||
| 1161 | Ga0439432_084588 | |||
| 1162 | Ga0439451_114980 | |||
| 1163 | Ga0439452_028949 | |||
| 1164 | Ga0439452_031313 | |||
| 1165 | Ga0439456_001582 | |||
| 1166 | Ga0439456_030371 | |||
| 1167 | Ga0439456_057414 | |||
| 1168 | Ga0439463_000865 | |||
| 1169 | Ga0439463_016536 | |||
| 1170 | Ga0450911_001166 | |||
| 1171 | Ga0450891_009206 | |||
| 1172 | Ga0450894_015021 | |||
| 1173 | Ga0450902_004255 | |||
| 1174 | Ga0450902_004644 | |||
| 1175 | Ga0450902_012704 | |||
| 1176 | Ga0450902_056094 | |||
| 1177 | Ga0450902_067091 | |||
| 1178 | Ga0450903_001474 | |||
| 1179 | Ga0450903_009632 | |||
| 1180 | Ga0450903_011031 | |||
| 1181 | Ga0450904_001781 | |||
| 1182 | Ga0450905_065705 | |||
| 1183 | Ga0450906_016048 | |||
| 1184 | Ga0450907_082541 | |||
| 1185 | Ga0450910_001588 | |||
| 1186 | Ga0450909_002018 | |||
| 1187 | Ga0450909_077760 | |||
| 1188 | Ga0439460_0004074 | |||
| 1189 | Ga0439460_0078586 | |||
| 1190 | Ga0439440_0037822 | |||
| 1191 | Ga0439440_0051062 | |||
| 1192 | Ga0495617_000194 | |||
| 1193 | Ga0495617_000681 | |||
| 1194 | Ga0495617_014353 | |||
| 1195 | Ga0495617_037439 | |||
| 1196 | Ga0495617_058040 | |||
| 1197 | Ga0495617_080516 | |||
| 1198 | Ga0495617_084917 | |||
| 1199 | Ga0495627_000021 | |||
| 1200 | Ga0495627_002079 | |||
| 1201 | Ga0495627_052561 | |||
| 1202 | Ga0495627_057751 | |||
| 1203 | Ga0495627_087400 | |||
| 1204 | Ga0495592_0089705 | |||
| 1205 | Ga0495603_0013533 | |||
| 1206 | Ga0495590_0009358 | |||
| 1207 | Ga0495590_0014858 | |||
| 1208 | Ga0495590_0023135 | |||
| 1209 | Ga0495590_0047923 | |||
| 1210 | Ga0495591_000015 | |||
| 1211 | Ga0495591_000157 | |||
| 1212 | Ga0495591_000243 | |||
| 1213 | Ga0495591_000450 | |||
| 1214 | Ga0495591_002782 | |||
| 1215 | Ga0495591_006474 | |||
| 1216 | Ga0495591_008390 | |||
| 1217 | Ga0495591_010075 | |||
| 1218 | Ga0495591_010368 | |||
| 1219 | Ga0495591_011316 | |||
| 1220 | Ga0495591_015329 | |||
| 1221 | Ga0495591_017646 | |||
| 1222 | Ga0495591_021612 | |||
| 1223 | Ga0495591_047935 | |||
| 1224 | Ga0495591_077134 | |||
| 1225 | Ga0495591_082954 | |||
| 1226 | Ga0495591_154927 | |||
| 1227 | Ga0495638_0008973 | |||
| 1228 | Ga0495638_0012440 | |||
| 1229 | Ga0495638_0017729 | |||
| 1230 | Ga0495638_0026612 | |||
| 1231 | Ga0495638_0026768 | |||
| 1232 | Ga0495638_0029199 | |||
| 1233 | Ga0495638_0033685 | |||
| 1234 | Ga0495638_0078813 | |||
| 1235 | Ga0495638_0126012 | |||
| 1236 | Ga0495638_0164164 | |||
| 1237 | Ga0495638_0569381 | |||
| 1238 | Ga0495653_0032718 | |||
| 1239 | Ga0495653_0092924 | |||
| 1240 | Ga0495650_0000214 | |||
| 1241 | Ga0495650_0005934 | |||
| 1242 | Ga0495650_0011949 | |||
| 1243 | Ga0495650_0014205 | |||
| 1244 | Ga0495605_0000016 | |||
| 1245 | Ga0495605_0000031 | |||
| 1246 | Ga0495605_0000552 | |||
| 1247 | Ga0495605_0004687 | |||
| 1248 | Ga0495605_0009922 | |||
| 1249 | Ga0495605_0013127 | |||
| 1250 | Ga0495605_0018430 | |||
| 1251 | Ga0495605_0087425 | |||
| 1252 | Ga0495639_0394014 | |||
| 1253 | Ga0495584_0019688 | |||
| 1254 | Ga0495584_0022969 | |||
| 1255 | Ga0495584_0035118 | |||
| 1256 | Ga0495584_0035935 | |||
| 1257 | Ga0495584_0037475 | |||
| 1258 | Ga0495584_0094942 | |||
| 1259 | Ga0495585_0000349 | |||
| 1260 | Ga0495585_0022376 | |||
| 1261 | Ga0495585_0031336 | |||
| 1262 | Ga0495585_0572942 | |||
| 1263 | Ga0495594_0011345 | |||
| 1264 | Ga0495596_0000073 | |||
| 1265 | Ga0495607_0000216 | |||
| 1266 | Ga0495607_0000577 | |||
| 1267 | Ga0495607_0000803 | |||
| 1268 | Ga0495607_0005761 | |||
| 1269 | Ga0495607_0014011 | |||
| 1270 | Ga0495607_0014689 | |||
| 1271 | Ga0495607_0035323 | |||
| 1272 | Ga0495607_0039569 | |||
| 1273 | Ga0495607_0041797 | |||
| 1274 | Ga0495607_0083254 | |||
| 1275 | Ga0495607_0104200 | |||
| 1276 | Ga0495607_0116046 | |||
| 1277 | Ga0495607_0142928 | |||
| 1278 | Ga0495607_0208246 | |||
| 1279 | Ga0495607_0302353 | |||
| 1280 | Ga0495583_0000041 | |||
| 1281 | Ga0495583_0001233 | |||
| 1282 | Ga0495583_0001426 | |||
| 1283 | Ga0495583_0003972 | |||
| 1284 | Ga0495583_0003987 | |||
| 1285 | Ga0495583_0008721 | |||
| 1286 | Ga0495583_0013056 | |||
| 1287 | Ga0495606_0000055 | |||
| 1288 | Ga0495606_0000695 | |||
| 1289 | Ga0495606_0007473 | |||
| 1290 | Ga0495606_0022660 | |||
| 1291 | Ga0495606_0031442 | |||
| 1292 | Ga0495606_0031931 | |||
| 1293 | Ga0495606_0063822 | |||
| 1294 | Ga0495606_0069130 | |||
| 1295 | Ga0495606_0098064 | |||
| 1296 | Ga0495606_0101388 | |||
| 1297 | Ga0495606_0262045 | |||
| 1298 | Ga0495606_0466748 | |||
| 1299 | Ga0495610_0009169 | |||
| 1300 | Ga0495610_0010391 | |||
| 1301 | Ga0495610_0014085 | |||
| 1302 | Ga0495610_0021816 | |||
| 1303 | Ga0495610_0025309 | |||
| 1304 | Ga0495610_0042019 | |||
| 1305 | Ga0495610_0043820 | |||
| 1306 | Ga0495610_0058141 | |||
| 1307 | Ga0495610_0132368 | |||
| 1308 | Ga0495610_0174621 | |||
| 1309 | Ga0495610_0210495 | |||
| 1310 | Ga0495610_0219275 | |||
| 1311 | Ga0495610_0299976 | |||
| 1312 | Ga0495616_0011891 | |||
| 1313 | Ga0495616_0023857 | |||
| 1314 | Ga0495616_0026953 | |||
| 1315 | Ga0495616_0043072 | |||
| 1316 | Ga0495616_0068813 | |||
| 1317 | Ga0495616_0106618 | |||
| 1318 | Ga0495616_0213353 | |||
| 1319 | Ga0495616_0257634 | |||
| 1320 | Ga0495620_0002402 | |||
| 1321 | Ga0495620_0007069 | |||
| 1322 | Ga0495620_0008256 | |||
| 1323 | Ga0495620_0013812 | |||
| 1324 | Ga0495620_0015145 | |||
| 1325 | Ga0495620_0023458 | |||
| 1326 | Ga0495620_0033553 | |||
| 1327 | Ga0495620_0044196 | |||
| 1328 | Ga0495620_0045604 | |||
| 1329 | Ga0495620_0201462 | |||
| 1330 | Ga0495630_0042898 | |||
| 1331 | Ga0495631_0011499 | |||
| 1332 | Ga0495631_0017288 | |||
| 1333 | Ga0495631_0021204 | |||
| 1334 | Ga0495631_0065645 | |||
| 1335 | Ga0495631_0426356 | |||
| 1336 | Ga0495632_0002345 | |||
| 1337 | Ga0495632_0004348 | |||
| 1338 | Ga0495632_0011266 | |||
| 1339 | Ga0495632_0014141 | |||
| 1340 | Ga0495632_0045252 | |||
| 1341 | Ga0495632_0146960 | |||
| 1342 | Ga0495632_0164922 | |||
| 1343 | Ga0495632_0302770 | |||
| 1344 | Ga0495632_0317566 | |||
| 1345 | Ga0495637_0000311 | |||
| 1346 | Ga0495637_0000361 | |||
| 1347 | Ga0495637_0000615 | |||
| 1348 | Ga0495637_0003967 | |||
| 1349 | Ga0495637_0009986 | |||
| 1350 | Ga0495637_0018640 | |||
| 1351 | Ga0495637_0026550 | |||
| 1352 | Ga0495637_0030291 | |||
| 1353 | Ga0495637_0150375 | |||
| 1354 | Ga0495643_0004218 | |||
| 1355 | Ga0495643_0027334 | |||
| 1356 | Ga0495643_0031781 | |||
| 1357 | Ga0495643_0037214 | |||
| 1358 | Ga0495644_0005267 | |||
| 1359 | Ga0495644_0015043 | |||
| 1360 | Ga0495644_0088983 | |||
| 1361 | Ga0495648_0003023 | |||
| 1362 | Ga0495648_0010738 | |||
| 1363 | Ga0495648_0015782 | |||
| 1364 | Ga0495648_0030572 | |||
| 1365 | Ga0495648_0058081 | |||
| 1366 | Ga0495648_0085417 | |||
| 1367 | Ga0495648_0093868 | |||
| 1368 | Ga0495654_0007580 | |||
| 1369 | Ga0495654_0009317 | |||
| 1370 | Ga0495654_0010481 | |||
| 1371 | Ga0495654_0013010 | |||
| 1372 | Ga0495654_0016509 | |||
| 1373 | Ga0495654_0018187 | |||
| 1374 | Ga0495654_0020420 | |||
| 1375 | Ga0495654_0021167 | |||
| 1376 | Ga0495654_0027018 | |||
| 1377 | Ga0495654_0041534 | |||
| 1378 | Ga0495654_0057196 | |||
| 1379 | Ga0495654_0061446 | |||
| 1380 | Ga0495654_0081683 | |||
| 1381 | Ga0495654_0086045 | |||
| 1382 | Ga0495654_0145021 | |||
| 1383 | Ga0495654_0151879 | |||
| 1384 | Ga0495654_0182994 | |||
| 1385 | Ga0495609_0000015 | |||
| 1386 | Ga0495609_0000424 | |||
| 1387 | Ga0495609_0013621 | |||
| 1388 | Ga0495609_0034684 | |||
| 1389 | Ga0495609_0047974 | |||
| 1390 | Ga0495609_0048955 | |||
| 1391 | Ga0495597_0000132 | |||
| 1392 | Ga0495597_0002994 | |||
| 1393 | Ga0495597_0017440 | |||
| 1394 | Ga0495597_0021754 | |||
| 1395 | Ga0495597_0023780 | |||
| 1396 | Ga0495597_0078906 | |||
| 1397 | Ga0495597_0084787 | |||
| 1398 | Ga0495597_0244589 | |||
| 1399 | Ga0495597_0322429 | |||
| 1400 | Ga0495645_0145424 | |||
| 1401 | Ga0495645_0160557 | |||
| 1402 | Ga0495622_0008181 | |||
| 1403 | Ga0495622_0018515 | |||
| 1404 | Ga0495622_0081223 | |||
| 1405 | Ga0495622_0335056 | |||
| 1406 | Ga0495633_0000363 | |||
| 1407 | Ga0495656_0054366 | |||
| 1408 | Ga0495656_0363191 | |||
| 1409 | Ga0495668_0016058 | |||
| 1410 | Ga0495668_0021021 | |||
| 1411 | Ga0495668_0055302 | |||
| 1412 | Ga0495668_0126943 | |||
| 1413 | Ga0495611_0000452 | |||
| 1414 | Ga0495611_0015535 | |||
| 1415 | Ga0495611_0140514 | |||
| 1416 | Ga0495625_0000055 | |||
| 1417 | Ga0495625_0038620 | |||
| 1418 | Ga0495625_0370396 | |||
| 1419 | Ga0495625_0491850 | |||
| 1420 | Ga0495625_0601519 | |||
| 1421 | Ga0495661_0000046 | |||
| 1422 | Ga0495661_0000105 | |||
| 1423 | Ga0495661_0003779 | |||
| 1424 | Ga0495661_0005667 | |||
| 1425 | Ga0495661_0012029 | |||
| 1426 | Ga0495661_0029898 | |||
| 1427 | Ga0495661_0032929 | |||
| 1428 | Ga0495661_0048829 | |||
| 1429 | Ga0495661_0097686 | |||
| 1430 | Ga0495588_0155614 | |||
| 1431 | Ga0495669_0532576 | |||
| 1432 | Ga0495670_0024732 | |||
| 1433 | Ga0495670_0152628 | |||
| 1434 | Ga0495670_0331599 | |||
| 1435 | Ga0495670_0561174 | |||
| 1436 | Ga0495671_0004602 | |||
| 1437 | Ga0495671_0013922 | |||
| 1438 | Ga0495671_0021909 | |||
| 1439 | Ga0495671_0030333 | |||
| 1440 | Ga0495671_0032354 | |||
| 1441 | Ga0495671_0124780 | |||
| 1442 | Ga0495671_0126788 | |||
| 1443 | Ga0495671_0127466 | |||
| 1444 | Ga0495671_0150616 | |||
| 1445 | Ga0495671_0390403 | |||
| 1446 | Ga0495649_0005256 | |||
| 1447 | Ga0495649_0005519 | |||
| 1448 | Ga0495649_0007416 | |||
| 1449 | Ga0495649_0014018 | |||
| 1450 | Ga0495649_0026487 | |||
| 1451 | Ga0495649_0035386 | |||
| 1452 | Ga0495649_0042100 | |||
| 1453 | Ga0495649_0057255 | |||
| 1454 | Ga0495649_0123176 | |||
| 1455 | Ga0495649_0264820 | |||
| 1456 | Ga0495589_0001272 | |||
| 1457 | Ga0495589_0002996 | |||
| 1458 | Ga0495589_0006488 | |||
| 1459 | Ga0495589_0017248 | |||
| 1460 | Ga0495589_0029921 | |||
| 1461 | Ga0495589_0262462 | |||
| 1462 | Ga0495600_0050439 | |||
| 1463 | Ga0495660_0000686 | |||
| 1464 | Ga0495660_0001371 | |||
| 1465 | Ga0495660_0004789 | |||
| 1466 | Ga0495660_0011214 | |||
| 1467 | Ga0495660_0015171 | |||
| 1468 | Ga0495660_0030768 | |||
| 1469 | Ga0495660_0032006 | |||
| 1470 | Ga0495660_0049694 | |||
| 1471 | Ga0495660_0092504 | |||
| 1472 | Ga0495672_0004585 | |||
| 1473 | Ga0495672_0010286 | |||
| 1474 | Ga0495672_0012115 | |||
| 1475 | Ga0495672_0013999 | |||
| 1476 | Ga0495672_0017842 | |||
| 1477 | Ga0495672_0030817 | |||
| 1478 | Ga0495672_0034249 | |||
| 1479 | Ga0495672_0061002 | |||
| 1480 | Ga0495672_0079560 | |||
| 1481 | Ga0495672_0491008 | |||
| 1482 | Ga0495676_0000013 | |||
| 1483 | Ga0495676_0048737 | |||
| 1484 | Ga0495676_0057866 | |||
| 1485 | Ga0495680_0035990 | |||
| 1486 | Ga0495683_0000219 | |||
| 1487 | Ga0495683_0005606 | |||
| 1488 | Ga0495683_0026619 | |||
| 1489 | Ga0495683_0114273 | |||
| 1490 | Ga0495683_0280242 | |||
| 1491 | Ga0495683_0331899 | |||
| 1492 | Ga0495687_009215 | |||
| 1493 | Ga0495679_001326 | |||
| 1494 | Ga0495679_001454 | |||
| 1495 | Ga0495679_004751 | |||
| 1496 | Ga0495679_006773 | |||
| 1497 | Ga0495679_010526 | |||
| 1498 | Ga0495679_012122 | |||
| 1499 | Ga0495679_015185 | |||
| 1500 | Ga0495679_119904 | |||
| 1501 | Ga0495673_0000707 | |||
| 1502 | Ga0495673_0002341 | |||
| 1503 | Ga0495673_0002364 | |||
| 1504 | Ga0495673_0003827 | |||
| 1505 | Ga0495673_0004660 | |||
| 1506 | Ga0495673_0006163 | |||
| 1507 | Ga0495673_0008393 | |||
| 1508 | Ga0495673_0013870 | |||
| 1509 | Ga0495673_0015988 | |||
| 1510 | Ga0495673_0019328 | |||
| 1511 | Ga0495673_0019870 | |||
| 1512 | Ga0495673_0022951 | |||
| 1513 | Ga0495673_0024890 | |||
| 1514 | Ga0495673_0074899 | |||
| 1515 | Ga0495673_0078559 | |||
| 1516 | Ga0495673_0185592 | |||
| 1517 | Ga0495681_0004996 | |||
| 1518 | Ga0495681_0012773 | |||
| 1519 | Ga0495681_0016737 | |||
| 1520 | Ga0495681_0030297 | |||
| 1521 | Ga0495681_0063374 | |||
| 1522 | Ga0495681_0080093 | |||
| 1523 | Ga0495681_0147495 | |||
| 1524 | Ga0495681_0164811 | |||
| 1525 | Ga0495686_0022208 | |||
| 1526 | Ga0495686_0058080 | |||
| 1527 | Ga0495686_0157131 | |||
| 1528 | Ga0495686_0206793 | |||
| 1529 | Ga0495593_0029838 | |||
| 1530 | Ga0495626_0000056 | |||
| 1531 | Ga0495626_0000496 | |||
| 1532 | Ga0495626_0003484 | |||
| 1533 | Ga0495626_0008875 | |||
| 1534 | Ga0495626_0058813 | |||
| 1535 | Ga0495626_0101013 | |||
| 1536 | Ga0495626_0233251 | |||
| 1537 | Ga0496102_0275264 | |||
| 1538 | Ga0496102_0334097 | |||
| 1539 | Ga0496102_1201961 | |||
| 1540 | Ga0496104_1492195 | |||
| 1541 | Ga0496106_0597776 | |||
| 1542 | Ga0496110_0050531 | |||
| 1543 | Ga0496112_0045170 | |||
| 1544 | Ga0496112_0343869 | |||
| 1545 | Ga0496113_0316299 | |||
| 1546 | Ga0496116_0021368 | |||
| 1547 | Ga0496116_0100796 | |||
| 1548 | Ga0496116_0300728 | |||
| 1549 | Ga0496116_0381666 | |||
| 1550 | Ga0496117_0002364 | |||
| 1551 | Ga0496117_0008772 | |||
| 1552 | Ga0496117_0035449 | |||
| 1553 | Ga0496117_0052648 | |||
| 1554 | Ga0496117_0107867 | |||
| 1555 | Ga0496118_0032626 | |||
| 1556 | Ga0496118_0056044 | |||
| 1557 | Ga0496118_0180238 | |||
| 1558 | Ga0496118_0231606 | |||
| 1559 | Ga0496119_0007398 | |||
| 1560 | Ga0496119_0163761 | |||
| 1561 | Ga0496119_0330606 | |||
| 1562 | Ga0496120_0005071 | |||
| 1563 | Ga0496120_0033312 | |||
| 1564 | Ga0496120_0039529 | |||
| 1565 | Ga0496121_0001347 | |||
| 1566 | Ga0496121_0007481 | |||
| 1567 | Ga0496121_0026606 | |||
| 1568 | Ga0496121_0058010 | |||
| 1569 | Ga0496121_0114867 | |||
| 1570 | Ga0496122_0000122 | |||
| 1571 | Ga0496122_0005968 | |||
| 1572 | Ga0496122_0029037 | |||
| 1573 | Ga0496122_0058635 | |||
| 1574 | Ga0496122_0083818 | |||
| 1575 | Ga0496122_0099909 | |||
| 1576 | Ga0496122_0128376 | |||
| 1577 | Ga0496122_0243519 | |||
| 1578 | Ga0496122_0257343 | |||
| 1579 | Ga0496122_0304006 | |||
| 1580 | Ga0496123_0000173 | |||
| 1581 | Ga0496123_0027754 | |||
| 1582 | Ga0496123_0046715 | |||
| 1583 | Ga0496123_0060044 | |||
| 1584 | Ga0496123_0061148 | |||
| 1585 | Ga0496123_0073404 | |||
| 1586 | Ga0496123_0199670 | |||
| 1587 | Ga0496124_0000145 | |||
| 1588 | Ga0496124_0002454 | |||
| 1589 | Ga0496124_0008355 | |||
| 1590 | Ga0496124_0009092 | |||
| 1591 | Ga0496124_0067435 | |||
| 1592 | Ga0496124_0072026 | |||
| 1593 | Ga0496124_0110565 | |||
| 1594 | Ga0496124_0125791 | |||
| 1595 | Ga0496124_0195290 | |||
| 1596 | Ga0496124_0321992 | |||
| 1597 | Ga0496124_0355378 | |||
| 1598 | Ga0496125_0001578 | |||
| 1599 | Ga0496125_0009144 | |||
| 1600 | Ga0496125_0027716 | |||
| 1601 | Ga0496125_0053412 | |||
| 1602 | Ga0496125_0056410 | |||
| 1603 | Ga0496125_0087928 | |||
| 1604 | Ga0496125_0100061 | |||
| 1605 | Ga0496125_0336868 | |||
| 1606 | Ga0496125_0621138 | |||
| 1607 | Ga0496126_0043455 | |||
| 1608 | Ga0496126_0358007 | |||
| 1609 | Ga0495678_000031 | |||
| 1610 | Ga0495678_000039 | |||
| 1611 | Ga0495678_005448 | |||
| 1612 | Ga0495678_007296 | |||
| 1613 | Ga0495678_018450 | |||
| 1614 | Ga0495678_039779 | |||
| 1615 | Ga0495678_043057 | |||
| 1616 | Ga0495682_0000599 | |||
| 1617 | Ga0495682_0019448 | |||
| 1618 | Ga0495682_0034671 | |||
| 1619 | Ga0495682_0050062 | |||
| 1620 | Ga0501252_044227 | |||
| 1621 | Ga0501241_096005 | |||
| 1622 | Ga0501241_134236 | |||
| 1623 | Ga0501269_006047 | |||
| 1624 | nmdc:mga03683_55733_c1 | |||
| 1625 | nmdc:mga00v17_252375_c1 | |||
| 1626 | nmdc:mga00v17_29701_c1 | |||
| 1627 | nmdc:mga08x19_106693_c1 | |||
| 1628 | nmdc:mga08x19_911753_c1 | |||
| 1629 | Ga0500618_046858 | |||
| 1630 | Ga0500586_008033 | |||
| 1631 | Ga0500634_0008096 | |||
| 1632 | 2511291820 | |||
| 1633 | 2511312044 | |||
| 1634 | 2511319058 | |||
| 1635 | 2511333138 | |||
| 1636 | 2511351509 | |||
| 1637 | 2511368214 | |||
| 1638 | 2511823350 | |||
| 1639 | 2597862650 | |||
| 1640 | 2597868493 | |||
| 1641 | 2599331240 | |||
| 1642 | 2599396748 | |||
| 1643 | 2599448734 | |||
| 1644 | 2599501478 | |||
| 1645 | 2599507718 | |||
| 1646 | 2599511507 | |||
| 1647 | 2599517545 | |||
| 1648 | 2599615439 | |||
| 1649 | 2599772842 | |||
| 1650 | 2599879957 | |||
| 1651 | 2599889339 | |||
| 1652 | 2599890881 | |||
| 1653 | 2599896662 | |||
| 1654 | 2599931777 | |||
| 1655 | 2599945458 | |||
| 1656 | 2599948464 | |||
| 1657 | 2599956576 | |||
| 1658 | 2599962508 | |||
| 1659 | 2599968317 | |||
| 1660 | 2599974236 | |||
| 1661 | 2599979504 | |||
| 1662 | 2599985502 | |||
| 1663 | 2599992294 | |||
| 1664 | 2599997801 | |||
| 1665 | 2600002456 | |||
| 1666 | 2600006771 | |||
| 1667 | 2600013316 | |||
| 1668 | 2600020136 | |||
| 1669 | 2600026137 | |||
| 1670 | 2600031496 | |||
| 1671 | 2600036423 | |||
| 1672 | 2600044975 | |||
| 1673 | 2600049989 | |||
| 1674 | 2600053409 | |||
| 1675 | 2600061937 | |||
| 1676 | 2600067164 | |||
| 1677 | 2600070504 | |||
| 1678 | 2600080115 | |||
| 1679 | 2600361297 | |||
| 1680 | 2601625840 | |||
| 1681 | 2601691227 | |||
| 1682 | 2601799838 | |||
| 1683 | 2606074363 | |||
| 1684 | 2606127226 | |||
| 1685 | 2621301220 | |||
| 1686 | 2624479124 | |||
| 1687 | 2643873140 | |||
| 1688 | 2644283507 | |||
| 1689 | 2644624323 | |||
| 1690 | 2652546864 | |||
| 1691 | 2671090537 | |||
| 1692 | 2671127727 | |||
| 1693 | 2677897377 | |||
| 1694 | 2678261902 | |||
| 1695 | 2715758845 | |||
| 1696 | 2718633010 | |||
| 1697 | 2723247526 | |||
| 1698 | 2738674011 | |||
| 1699 | 2738689641 | |||
| 1700 | 2738752404 | |||
| 1701 | 2738809423 | |||
| 1702 | 2738861445 | |||
| 1703 | 2738896783 | |||
| 1704 | 2739256592 | |||
| 1705 | 2739265415 | |||
| 1706 | 2745008250 | |||
| 1707 | 2794596063 | |||
| 1708 | 2808856764 | |||
| 1709 | 2808924045 | |||
| 1710 | 2808936787 | |||
| 1711 | 2808945986 | |||
| 1712 | 2808965151 | |||
| 1713 | 2808975580 | |||
| 1714 | 2808990781 | |||
| 1715 | 2809000043 | |||
| 1716 | 2812368473 | |||
| 1717 | 2817489416 | |||
| 1718 | 2825653375 | |||
| 1719 | 2826585614 | |||
| 1720 | 2834029327 | |||
| 1721 | 2842818472 | |||
| 1722 | 2842830256 | |||
| 1723 | 2842839930 | |||
| 1724 | 2842853173 | |||
| 1725 | 2842860029 | |||
| 1726 | 2852615186 | |||
| 1727 | 2852670154 | |||
| 1728 | 2860869370 | |||
| 1729 | 2878031082 | |||
| 1730 | 2880231997 | |||
| 1731 | 2904551626 | |||
| 1732 | 2908448240 | |||
| 1733 | 2913038248 | |||
| 1734 | 2919064405 | |||
| 1735 | 2919386119 | |||
| 1736 | 2919481515 | |||
| 1737 | 2923522530 | |||
| 1738 | 2923590622 | |||
| 1739 | 2929145692 | |||
| 1740 | 2929191345 | |||
| 1741 | 2931370975 | |||
| 1742 | 2931392347 | |||
| 1743 | 2945929233 | |||
| 1744 | 2945961598 | |||
| 1745 | 2946011496 | |||
| 1746 | 2946029565 | |||
| 1747 | 2947236160 | |||
| 1748 | 2988733237 | |||
| 1749 | 3007420957 | |||
| 1750 | 3007614940 | |||
| 1751 | 3007722980 | |||
| 1752 | 3007870685 | |||
| 1753 | 8054288804 | |||
| 1754 | 8054348900 | |||
| 1755 | 8054504911 | |||
| 1756 | 8055819370 | |||
| 1757 | 8056127367 | |||
| 1758 | 8056133278 | |||
| 1759 | 8056147587 | |||
| 1760 | 8056149520 | |||
| 1761 | 8056164686 | |||
| 1762 | 8056175837 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2l6n-assembly1.cif.gz_A | nmr solution structure of the protein yp_001092504.1 | 0.767 | 64 | 91 |
| 7jq7-assembly1.cif.gz_B | the phi-28 gp11 dna packaging motor | 0.7359 | 67 | 101 |
| 3kvp-assembly1.cif.gz_B | crystal structure of uncharacterized protein ymzc precursor from bacillus subtilis, northeast structural genomics consortium target sr378a | 0.7136 | 75 | 103 |
| 8u7n-assembly1.cif.gz_B | error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8u7n | 0.698 | 78 | 101 |
| 8cti-assembly1.cif.gz_B | cryo-em structure of human mettl1-wdr4-trna(val) complex | 0.684 | 65 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P92937_305_418_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.8398 | 69 | 94 | 3.30.310.80 |
| af_A0A1D8PUA0_43_492_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7869 | 64 | 89 | 1.25.10.10 |
| af_Q8IJT5_23_144_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7705 | 61 | 92 | 2.30.29.30 |
| af_P0C5J9_121_355_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7705 | 66 | 101 | 2.130.10.10 |
| af_O45657_31_457_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7617 | 64 | 89 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q0S350-F1-model_v4 | deleted | 0.9547 | 1 | 103 |
|
| AF-A0A1G4TNX5-F1-model_v4 | deleted | 0.9458 | 1 | 102 |
|
| AF-A0A0W8H768-F1-model_v4 | Amidase | 0.944 | 12 | 103 |
|
| AF-A0A0Q0ADT7-F1-model_v4 | Amidase | 0.9418 | 8 | 103 |
|
| AF-A0A0Q0EQI5-F1-model_v4 | Amidase | 0.9414 | 12 | 103 |
|