F484479

General Info

Members Datasets Scaffolds Average Seq Length
880 322 1760 191

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100053191|Ga0070713_1000531914
Length 222
Sequence MTKAPKERRSIRARWRGWRRSRPFWAGLFTLLSGAILTLIPMSGMRVAFVQGSVLWASLLVGLLMLLCGFTLFAFSLSVVCDIVTREIGRPWLWLQEVTSTFFIYGIFIGAAVATRRNDHLYLAAVGDSMTGRPRMIIESAIRMVVIGVGLFLVWFGYVNFLRGFASFRMPSMTPIASLYAAIPICGALIALFAFEQLVNGCRNGFETRPEDRLPEEGAGSP

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
105 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 8.75
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100053191 3300005436 Bacteria 3355
2 Ga0065712_10483230 3300005290 Bacteria 648
3 Ga0070658_10081862 3300005327 Bacteria 2652
4 Ga0070676_10000847 3300005328 Bacteria 15150
5 Ga0070676_10076395 3300005328 Bacteria 2022
6 Ga0070676_10126199 3300005328 Bacteria 1613
7 Ga0070676_10194291 3300005328 Bacteria 1327
8 Ga0070676_10302408 3300005328 Bacteria 1085
9 Ga0070683_100323707 3300005329 Bacteria 1467
10 Ga0070683_100467700 3300005329 Bacteria 1204
11 Ga0070670_100026430 3300005331 Bacteria 4995
12 Ga0070670_100034811 3300005331 Bacteria 4334
13 Ga0070670_100371574 3300005331 Bacteria 1259
14 Ga0070670_100474485 3300005331 Bacteria 1110
15 Ga0070677_10130336 3300005333 Bacteria 1147
16 Ga0068869_100039523 3300005334 Bacteria 3369
17 Ga0068869_100100516 3300005334 Bacteria 2187
18 Ga0068869_100158040 3300005334 Bacteria 1763
19 Ga0070666_10007180 3300005335 Bacteria 6869
20 Ga0070666_10016386 3300005335 Bacteria 4742
21 Ga0070666_10089412 3300005335 Bacteria 2114
22 Ga0070666_10107282 3300005335 Bacteria 1930
23 Ga0070666_10861835 3300005335 Bacteria 669
24 Ga0070680_100000933 3300005336 Bacteria 20696
25 Ga0070682_100011560 3300005337 Bacteria 5047
26 Ga0070682_100015105 3300005337 Bacteria 4470
27 Ga0070682_100072844 3300005337 Bacteria 2202
28 Ga0068868_100019189 3300005338 Bacteria 5123
29 Ga0068868_100114985 3300005338 Bacteria 2190
30 Ga0068868_100130503 3300005338 Bacteria 2056
31 Ga0068868_100410314 3300005338 Bacteria 1171
32 Ga0068868_100456767 3300005338 Bacteria 1112
33 Ga0070660_100328813 3300005339 Bacteria 1256
34 Ga0070660_100336016 3300005339 Bacteria 1243
35 Ga0070689_100027304 3300005340 Bacteria 4303
36 Ga0070689_100028079 3300005340 Bacteria 4250
37 Ga0070689_100029734 3300005340 Bacteria 4139
38 Ga0070689_100106442 3300005340 Bacteria 2225
39 Ga0070689_100150431 3300005340 Bacteria 1877
40 Ga0070689_100170817 3300005340 Bacteria 1762
41 Ga0070691_10009000 3300005341 Bacteria 4567
42 Ga0070687_100006230 3300005343 Bacteria 4879
43 Ga0070687_100101598 3300005343 Bacteria 1611
44 Ga0070661_100103487 3300005344 Bacteria 2120
45 Ga0070661_101242938 3300005344 Bacteria 624
46 Ga0070668_100004542 3300005347 Bacteria 10295
47 Ga0070668_100668584 3300005347 Bacteria 914
48 Ga0070669_100005778 3300005353 Bacteria 8918
49 Ga0070669_100370722 3300005353 Bacteria 1166
50 Ga0070675_100001685 3300005354 Bacteria 16306
51 Ga0070675_100124241 3300005354 Bacteria 2195
52 Ga0070675_100485032 3300005354 Bacteria 1112
53 Ga0070675_100528793 3300005354 Bacteria 1065
54 Ga0070675_100722109 3300005354 Bacteria 908
55 Ga0070671_100010441 3300005355 Bacteria 7450
56 Ga0070671_100021219 3300005355 Bacteria 5304
57 Ga0070671_100163771 3300005355 Bacteria 1880
58 Ga0070671_100449118 3300005355 Bacteria 1106
59 Ga0070674_100003123 3300005356 Bacteria 9227
60 Ga0070674_100034449 3300005356 Bacteria 3382
61 Ga0070674_100093096 3300005356 Bacteria 2180
62 Ga0070674_100422566 3300005356 Bacteria 1094
63 Ga0070673_100031821 3300005364 Bacteria 3963
64 Ga0070673_100052687 3300005364 Bacteria 3194
65 Ga0070673_100082620 3300005364 Bacteria 2608
66 Ga0070673_100083704 3300005364 Bacteria 2592
67 Ga0070673_100117678 3300005364 Bacteria 2212
68 Ga0070673_100607081 3300005364 Unclassified 998
69 Ga0070688_100009043 3300005365 Bacteria 5431
70 Ga0070688_100091149 3300005365 Bacteria 1992
71 Ga0070659_100260774 3300005366 Bacteria 1438
72 Ga0070659_100308486 3300005366 Bacteria 1321
73 Ga0070659_100498768 3300005366 Bacteria 1037
74 Ga0070667_100010578 3300005367 Bacteria 7617
75 Ga0070667_100048749 3300005367 Bacteria 3566
76 Ga0070667_100076418 3300005367 Bacteria 2859
77 Ga0070667_100151466 3300005367 Bacteria 2037
78 Ga0070667_100758360 3300005367 Bacteria 900
79 Ga0070709_10005103 3300005434 Bacteria 7098
80 Ga0070709_10015799 3300005434 Bacteria 4298
81 Ga0070709_10112268 3300005434 Bacteria 1834
82 Ga0070709_10205940 3300005434 Bacteria 1396
83 Ga0070709_10226386 3300005434 Bacteria 1336
84 Ga0070709_10452902 3300005434 Bacteria 967
85 Ga0070714_100004407 3300005435 Bacteria 10595
86 Ga0070714_100031975 3300005435 Bacteria 4393
87 Ga0070714_100050832 3300005435 Bacteria 3532
88 Ga0070714_100192350 3300005435 Bacteria 1862
89 Ga0070714_100289260 3300005435 Bacteria 1524
90 Ga0070714_100539274 3300005435 Bacteria 1116
91 Ga0070713_100000039 3300005436 Bacteria 83384
92 Ga0070713_100005026 3300005436 Bacteria 8988
93 Ga0070713_100005783 3300005436 Bacteria 8500
94 Ga0070713_100030937 3300005436 Bacteria 4257
95 Ga0070713_100059691 3300005436 Bacteria 3186
96 Ga0070713_100153211 3300005436 Bacteria 2052
97 Ga0070710_10001919 3300005437 Bacteria 9846
98 Ga0070710_10151809 3300005437 Bacteria 1429
99 Ga0070710_10289472 3300005437 Bacteria 1066
100 Ga0070701_10087033 3300005438 Bacteria 1704
101 Ga0070711_100003421 3300005439 Bacteria 9245
102 Ga0070711_100250160 3300005439 Bacteria 1390
103 Ga0070711_100296402 3300005439 Bacteria 1284
104 Ga0070711_100429923 3300005439 Bacteria 1077
105 Ga0070711_100537556 3300005439 Bacteria 968
106 Ga0070705_100145847 3300005440 Bacteria 1564
107 Ga0070705_100275999 3300005440 Bacteria 1193
108 Ga0070705_100666759 3300005440 Bacteria 813
109 Ga0070700_100266928 3300005441 Bacteria 1235
110 Ga0070708_100108249 3300005445 Bacteria 2552
111 Ga0070663_100010454 3300005455 Bacteria 5784
112 Ga0070663_100020275 3300005455 Bacteria 4399
113 Ga0070663_100371418 3300005455 Bacteria 1163
114 Ga0070663_100980063 3300005455 Bacteria 734
115 Ga0070663_101012519 3300005455 Bacteria 723
116 Ga0070678_100000728 3300005456 Bacteria 16377
117 Ga0070678_100001027 3300005456 Bacteria 14545
118 Ga0070678_100016483 3300005456 Bacteria 4729
119 Ga0070678_100070575 3300005456 Bacteria 2612
120 Ga0070678_100237585 3300005456 Bacteria 1522
121 Ga0070662_100337719 3300005457 Bacteria 1232
122 Ga0070681_10009517 3300005458 Bacteria 9562
123 Ga0070681_10061084 3300005458 Bacteria 3745
124 Ga0070681_10157011 3300005458 Bacteria 2199
125 Ga0070681_10430920 3300005458 Bacteria 1231
126 Ga0068867_100001109 3300005459 Bacteria 18410
127 Ga0068867_100026711 3300005459 Bacteria 4147
128 Ga0068867_100325004 3300005459 Bacteria 1276
129 Ga0068867_100357024 3300005459 Bacteria 1221
130 Ga0068867_100438499 3300005459 Bacteria 1110
131 Ga0070685_10012319 3300005466 Bacteria 4491
132 Ga0070685_10027399 3300005466 Bacteria 3148
133 Ga0070706_100021874 3300005467 Bacteria 5889
134 Ga0070706_100878300 3300005467 Bacteria 829
135 Ga0070698_100002091 3300005471 Bacteria 22152
136 Ga0070699_100013134 3300005518 Bacteria 7140
137 Ga0070679_100009132 3300005530 Bacteria 9359
138 Ga0070679_100088967 3300005530 Bacteria 3075
139 Ga0070679_100207694 3300005530 Bacteria 1923
140 Ga0070684_100085454 3300005535 Bacteria 2798
141 Ga0070684_100262668 3300005535 Bacteria 1579
142 Ga0070684_100305443 3300005535 Bacteria 1460
143 Ga0070684_100333786 3300005535 Bacteria 1393
144 Ga0070684_100761394 3300005535 Bacteria 904
145 Ga0070697_100099113 3300005536 Bacteria 2419
146 Ga0070697_100658826 3300005536 Bacteria 922
147 Ga0068853_100052274 3300005539 Bacteria 3520
148 Ga0068853_100269607 3300005539 Bacteria 1567
149 Ga0070672_100001043 3300005543 Bacteria 16892
150 Ga0070672_100105024 3300005543 Bacteria 2296
151 Ga0070672_100125652 3300005543 Bacteria 2103
152 Ga0070672_100228011 3300005543 Bacteria 1564
153 Ga0070672_100293517 3300005543 Bacteria 1377
154 Ga0070672_100437397 3300005543 Bacteria 1125
155 Ga0070686_100005547 3300005544 Bacteria 6980
156 Ga0070686_100025992 3300005544 Bacteria 3528
157 Ga0070695_100298841 3300005545 Bacteria 1189
158 Ga0070696_100082166 3300005546 Bacteria 2283
159 Ga0070696_100677242 3300005546 Bacteria 839
160 Ga0070693_100006850 3300005547 Bacteria 5539
161 Ga0070693_100139528 3300005547 Bacteria 1524
162 Ga0070693_100264257 3300005547 Bacteria 1146
163 Ga0070665_100002989 3300005548 Bacteria 18261
164 Ga0070665_100088331 3300005548 Bacteria 3105
165 Ga0070665_100475083 3300005548 Bacteria 1261
166 Ga0070665_100512216 3300005548 Bacteria 1211
167 Ga0070665_100948496 3300005548 Bacteria 873
168 Ga0070704_100308004 3300005549 Bacteria 1322
169 Ga0070704_100363471 3300005549 Bacteria 1225
170 Ga0070704_100532462 3300005549 Bacteria 1024
171 Ga0068855_100455754 3300005563 Bacteria 1395
172 Ga0068855_100994653 3300005563 Bacteria 881
173 Ga0070664_100034445 3300005564 Bacteria 4248
174 Ga0070664_100189837 3300005564 Bacteria 1830
175 Ga0070664_100252212 3300005564 Bacteria 1586
176 Ga0070664_100723375 3300005564 Bacteria 928
177 Ga0068857_100119758 3300005577 Bacteria 2369
178 Ga0068857_100206745 3300005577 Bacteria 1790
179 Ga0068854_100273307 3300005578 Bacteria 1358
180 Ga0068854_100649616 3300005578 Bacteria 905
181 Ga0068856_100150900 3300005614 Bacteria 2333
182 Ga0068856_100180424 3300005614 Bacteria 2124
183 Ga0068856_100305419 3300005614 Bacteria 1609
184 Ga0070702_100012876 3300005615 Bacteria 4210
185 Ga0070702_100381995 3300005615 Bacteria 1002
186 Ga0068859_100140301 3300005617 Bacteria 2490
187 Ga0068859_100162478 3300005617 Bacteria 2313
188 Ga0068859_100715312 3300005617 Bacteria 1092
189 Ga0068864_100010322 3300005618 Bacteria 7713
190 Ga0068864_100021942 3300005618 Bacteria 5352
191 Ga0068864_100026129 3300005618 Bacteria 4922
192 Ga0068866_10045919 3300005718 Bacteria 2194
193 Ga0068866_10083519 3300005718 Bacteria 1721
194 Ga0068861_100162574 3300005719 Bacteria 1843
195 Ga0068863_100190757 3300005841 Bacteria 1969
196 Ga0068863_100740153 3300005841 Unclassified 979
197 Ga0068863_101157154 3300005841 Bacteria 779
198 Ga0068858_100003682 3300005842 Bacteria 15187
199 Ga0068858_100056529 3300005842 Bacteria 3626
200 Ga0068858_100083784 3300005842 Bacteria 2965
201 Ga0068858_100402662 3300005842 Bacteria 1315
202 Ga0068858_100819590 3300005842 Bacteria 908
203 Ga0068860_100012825 3300005843 Bacteria 8239
204 Ga0068860_100106733 3300005843 Bacteria 2675
205 Ga0068862_100039466 3300005844 Bacteria 4010
206 Ga0081455_10034958 3300005937 Bacteria 4497
207 Ga0070717_10000217 3300006028 Bacteria 39845
208 Ga0070717_10005760 3300006028 Bacteria 9073
209 Ga0070717_10077749 3300006028 Bacteria 2779
210 Ga0070717_10388727 3300006028 Bacteria 1252
211 Ga0070717_10697980 3300006028 Bacteria 922
212 Ga0075365_10533119 3300006038 Bacteria 830
213 Ga0075363_100599798 3300006048 Bacteria 660
214 Ga0070715_10013506 3300006163 Bacteria 3002
215 Ga0070715_10018821 3300006163 Bacteria 2639
216 Ga0070715_10022051 3300006163 Bacteria 2479
217 Ga0070715_10169171 3300006163 Bacteria 1087
218 Ga0070715_10342259 3300006163 Bacteria 814
219 Ga0070716_100000793 3300006173 Bacteria 13575
220 Ga0070716_100002302 3300006173 Bacteria 8796
221 Ga0070716_100023037 3300006173 Bacteria 3298
222 Ga0070716_100089845 3300006173 Bacteria 1857
223 Ga0070716_100454115 3300006173 Bacteria 935
224 Ga0070712_100009890 3300006175 Bacteria 6014
225 Ga0070712_100013119 3300006175 Bacteria 5285
226 Ga0070712_100043893 3300006175 Bacteria 3080
227 Ga0070712_100067602 3300006175 Bacteria 2543
228 Ga0070712_100170328 3300006175 Bacteria 1689
229 Ga0070712_100191421 3300006175 Bacteria 1601
230 Ga0070712_100230118 3300006175 Bacteria 1472
231 Ga0070712_100318807 3300006175 Bacteria 1263
232 Ga0075367_10220166 3300006178 Bacteria 1188
233 Ga0075369_10044353 3300006186 Bacteria 1910
234 Ga0097621_100002390 3300006237 Bacteria 12862
235 Ga0097621_100008604 3300006237 Bacteria 7357
236 Ga0097621_100010225 3300006237 Bacteria 6852
237 Ga0097621_100113837 3300006237 Bacteria 2288
238 Ga0097621_100194548 3300006237 Bacteria 1758
239 Ga0097621_100586033 3300006237 Bacteria 1018
240 Ga0097621_100775284 3300006237 Bacteria 887
241 Ga0075370_10022929 3300006353 Bacteria 3434
242 Ga0068871_100001576 3300006358 Bacteria 15330
243 Ga0068871_100003994 3300006358 Bacteria 10204
244 Ga0068871_100009547 3300006358 Bacteria 7040
245 Ga0068871_100041628 3300006358 Bacteria 3684
246 Ga0068871_100317186 3300006358 Bacteria 1372
247 Ga0068871_100319267 3300006358 Bacteria 1367
248 Ga0075434_100081494 3300006871 Bacteria 3233
249 Ga0075434_100623383 3300006871 Bacteria 1097
250 Ga0075434_100736699 3300006871 Bacteria 1003
251 Ga0075434_101836747 3300006871 Unclassified 612
252 Ga0068865_100038086 3300006881 Bacteria 3252
253 Ga0068865_100094688 3300006881 Bacteria 2174
254 Ga0068865_100564237 3300006881 Bacteria 958
255 Ga0068865_100791873 3300006881 Bacteria 817
256 Ga0068865_101089029 3300006881 Unclassified 703
257 Ga0075436_100101786 3300006914 Bacteria 2001
258 Ga0075436_100181462 3300006914 Bacteria 1488
259 Ga0097620_100128607 3300006931 Bacteria 2604
260 Ga0097620_100140316 3300006931 Bacteria 2490
261 Ga0097620_100162473 3300006931 Bacteria 2313
262 Ga0097620_100715278 3300006931 Bacteria 1092
263 Ga0075435_100768089 3300007076 Bacteria 839
264 Ga0099794_10006876 3300007265 Bacteria 4636
265 Ga0099795_10010690 3300007788 Bacteria 2713
266 Ga0099795_10070276 3300007788 Bacteria 1319
267 Ga0105251_10023867 3300009011 Bacteria 3149
268 Ga0105250_10024795 3300009092 Bacteria 2416
269 Ga0105240_10004752 3300009093 Bacteria 20518
270 Ga0105240_10583003 3300009093 Bacteria 1233
271 Ga0111539_10499406 3300009094 Bacteria 1417
272 Ga0105245_10029333 3300009098 Bacteria 4859
273 Ga0105245_10072585 3300009098 Bacteria 3127
274 Ga0105245_10127957 3300009098 Bacteria 2379
275 Ga0105245_10261620 3300009098 Bacteria 1684
276 Ga0105245_10363129 3300009098 Bacteria 1437
277 Ga0105245_10446651 3300009098 Bacteria 1301
278 Ga0105247_10029031 3300009101 Bacteria 3349
279 Ga0105247_10173383 3300009101 Bacteria 1435
280 Ga0105247_10197289 3300009101 Bacteria 1351
281 Ga0105247_10225357 3300009101 Bacteria 1271
282 Ga0105243_10023934 3300009148 Bacteria 4654
283 Ga0105243_10026026 3300009148 Bacteria 4477
284 Ga0105243_10071930 3300009148 Bacteria 2798
285 Ga0105241_10014601 3300009174 Bacteria 5751
286 Ga0105241_10018681 3300009174 Bacteria 5104
287 Ga0105241_10166234 3300009174 Bacteria 1818
288 Ga0105241_10177093 3300009174 Bacteria 1766
289 Ga0105241_10493190 3300009174 Bacteria 1091
290 Ga0105242_10009790 3300009176 Bacteria 7346
291 Ga0105242_10010141 3300009176 Bacteria 7218
292 Ga0105242_10014350 3300009176 Bacteria 6137
293 Ga0105242_10685281 3300009176 Bacteria 1001
294 Ga0105242_11102524 3300009176 Unclassified 808
295 Ga0105248_10001952 3300009177 Bacteria 22922
296 Ga0105248_10043581 3300009177 Bacteria 5031
297 Ga0105248_10097657 3300009177 Bacteria 3309
298 Ga0105248_10124081 3300009177 Bacteria 2913
299 Ga0105248_10265100 3300009177 Bacteria 1934
300 Ga0105248_10295765 3300009177 Bacteria 1823
301 Ga0105248_10651701 3300009177 Bacteria 1188
302 Ga0105248_11796547 3300009177 Bacteria 695
303 Ga0105237_10054170 3300009545 Bacteria 4019
304 Ga0105237_10111632 3300009545 Bacteria 2726
305 Ga0105237_10138192 3300009545 Bacteria 2431
306 Ga0105237_10254079 3300009545 Bacteria 1760
307 Ga0105237_10422871 3300009545 Bacteria 1338
308 Ga0105237_10602444 3300009545 Bacteria 1106
309 Ga0105238_10082146 3300009551 Bacteria 3212
310 Ga0105238_10157549 3300009551 Bacteria 2246
311 Ga0105238_10276775 3300009551 Bacteria 1659
312 Ga0105238_10288779 3300009551 Bacteria 1622
313 Ga0105249_10104828 3300009553 Bacteria 2665
314 Ga0105249_10178494 3300009553 Bacteria 2064
315 Ga0105249_10379928 3300009553 Bacteria 1438
316 Ga0105249_11354522 3300009553 Unclassified 783
317 Ga0099796_10055649 3300010159 Bacteria 1386
318 Ga0105239_10062965 3300010375 Bacteria 4072
319 Ga0105239_10190768 3300010375 Bacteria 2294
320 Ga0105239_10200568 3300010375 Bacteria 2235
321 Ga0105239_10249737 3300010375 Bacteria 1992
322 Ga0105239_10379095 3300010375 Bacteria 1599
323 Ga0105246_10173807 3300011119 Bacteria 1652
324 Ga0105246_11430036 3300011119 Bacteria 646
325 Ga0157328_1000881 3300012478 Bacteria 1183
326 Ga0157313_1018652 3300012503 Unclassified 685
327 Ga0157342_1006406 3300012507 Bacteria 1113
328 Ga0157373_10095337 3300013100 Bacteria 2094
329 Ga0157373_10115335 3300013100 Bacteria 1888
330 Ga0157370_10160708 3300013104 Bacteria 2090
331 Ga0157370_10200552 3300013104 Bacteria 1851
332 Ga0157370_10540463 3300013104 Bacteria 1069
333 Ga0157374_10008845 3300013296 Bacteria 8621
334 Ga0157374_10009414 3300013296 Bacteria 8384
335 Ga0157374_10128543 3300013296 Bacteria 2450
336 Ga0157374_10309945 3300013296 Bacteria 1562
337 Ga0157374_10554852 3300013296 Bacteria 1157
338 Ga0157374_10780799 3300013296 Bacteria 971
339 Ga0157378_10028760 3300013297 Bacteria 4907
340 Ga0157378_10029323 3300013297 Bacteria 4857
341 Ga0157378_10122317 3300013297 Bacteria 2401
342 Ga0157378_10141988 3300013297 Bacteria 2230
343 Ga0157378_10161621 3300013297 Bacteria 2095
344 Ga0157378_10381392 3300013297 Bacteria 1384
345 Ga0157378_10477251 3300013297 Bacteria 1242
346 Ga0157378_10918132 3300013297 Bacteria 907
347 Ga0163162_10001709 3300013306 Bacteria 20590
348 Ga0163162_10045452 3300013306 Bacteria 4399
349 Ga0157372_10413301 3300013307 Bacteria 1572
350 Ga0157375_10009216 3300013308 Bacteria 8657
351 Ga0157375_10020260 3300013308 Bacteria 6071
352 Ga0157375_10079270 3300013308 Bacteria 3319
353 Ga0157375_10269533 3300013308 Bacteria 1864
354 Ga0157375_10299424 3300013308 Bacteria 1772
355 Ga0157375_10476049 3300013308 Bacteria 1414
356 Ga0157375_10708299 3300013308 Bacteria 1160
357 Ga0163163_10023573 3300014325 Bacteria 5843
358 Ga0163163_10347580 3300014325 Bacteria 1539
359 Ga0163163_10542852 3300014325 Bacteria 1225
360 Ga0157380_10334421 3300014326 Bacteria 1410
361 Ga0157380_10372182 3300014326 Bacteria 1345
362 Ga0157377_10105301 3300014745 Bacteria 1688
363 Ga0157377_10933187 3300014745 Bacteria 652
364 Ga0157379_10002943 3300014968 Bacteria 14369
365 Ga0157379_10025689 3300014968 Bacteria 5234
366 Ga0157379_10027789 3300014968 Bacteria 5036
367 Ga0157379_10346149 3300014968 Bacteria 1360
368 Ga0157379_10351343 3300014968 Bacteria 1350
369 Ga0157376_10003569 3300014969 Bacteria 10722
370 Ga0157376_10153633 3300014969 Bacteria 2078
371 Ga0157376_10177971 3300014969 Bacteria 1942
372 Ga0157376_10202990 3300014969 Bacteria 1825
373 Ga0157376_10310276 3300014969 Bacteria 1496
374 Ga0157376_10332841 3300014969 Bacteria 1447
375 Ga0157376_11215520 3300014969 Bacteria 782
376 Ga0157376_11267269 3300014969 Unclassified 767
377 Ga0163161_10069944 3300017792 Bacteria 2566
378 Ga0163161_10197934 3300017792 Bacteria 1547
379 Ga0163161_10275425 3300017792 Bacteria 1318
380 Ga0213873_10013063 3300021358 Bacteria 1814
381 Ga0213874_10084189 3300021377 Bacteria 1035
382 Ga0213876_10036782 3300021384 Bacteria 2583
383 Ga0213876_10273573 3300021384 Bacteria 898
384 Ga0213875_10308522 3300021388 Bacteria 749
385 Ga0207426_1022401 3300025302 Bacteria 2168
386 Ga0207697_10003098 3300025315 Bacteria 8320
387 Ga0207656_10200211 3300025321 Bacteria 964
388 Ga0207682_10074864 3300025893 Bacteria 1440
389 Ga0207692_10001674 3300025898 Bacteria 8378
390 Ga0207692_10014567 3300025898 Bacteria 3439
391 Ga0207642_10046942 3300025899 Bacteria 1928
392 Ga0207642_10057025 3300025899 Bacteria 1795
393 Ga0207642_10411742 3300025899 Bacteria 811
394 Ga0207710_10001666 3300025900 Bacteria 10815
395 Ga0207710_10002946 3300025900 Bacteria 7718
396 Ga0207710_10017187 3300025900 Bacteria 3066
397 Ga0207710_10458589 3300025900 Bacteria 659
398 Ga0207688_10305378 3300025901 Bacteria 974
399 Ga0207680_10020003 3300025903 Bacteria 3592
400 Ga0207680_10092028 3300025903 Bacteria 1931
401 Ga0207680_10109528 3300025903 Bacteria 1788
402 Ga0207685_10000852 3300025905 Bacteria 5726
403 Ga0207685_10010994 3300025905 Bacteria 2702
404 Ga0207685_10014352 3300025905 Bacteria 2478
405 Ga0207699_10000138 3300025906 Bacteria 49255
406 Ga0207699_10006404 3300025906 Bacteria 5697
407 Ga0207699_10012288 3300025906 Bacteria 4353
408 Ga0207699_10369612 3300025906 Bacteria 1016
409 Ga0207645_10000588 3300025907 Bacteria 30197
410 Ga0207645_10035490 3300025907 Bacteria 3201
411 Ga0207645_10052631 3300025907 Bacteria 2601
412 Ga0207645_10094801 3300025907 Bacteria 1921
413 Ga0207645_10191258 3300025907 Bacteria 1345
414 Ga0207705_10020452 3300025909 Bacteria 4729
415 Ga0207684_10025016 3300025910 Bacteria 5088
416 Ga0207684_10141231 3300025910 Bacteria 2070
417 Ga0207654_10002446 3300025911 Bacteria 9470
418 Ga0207654_10172411 3300025911 Bacteria 1406
419 Ga0207654_10236912 3300025911 Bacteria 1218
420 Ga0207707_10010605 3300025912 Bacteria 8001
421 Ga0207707_10106369 3300025912 Bacteria 2452
422 Ga0207695_10009523 3300025913 Bacteria 12011
423 Ga0207695_10800230 3300025913 Bacteria 823
424 Ga0207671_10039867 3300025914 Bacteria 3478
425 Ga0207671_10907036 3300025914 Bacteria 697
426 Ga0207693_10002257 3300025915 Bacteria 16770
427 Ga0207693_10007885 3300025915 Bacteria 8745
428 Ga0207693_10034136 3300025915 Unclassified 4013
429 Ga0207693_10049736 3300025915 Bacteria 3292
430 Ga0207693_10059404 3300025915 Bacteria 2995
431 Ga0207693_10062001 3300025915 Bacteria 2929
432 Ga0207693_10068703 3300025915 Bacteria 2773
433 Ga0207693_10092385 3300025915 Bacteria 2372
434 Ga0207693_10188144 3300025915 Bacteria 1625
435 Ga0207663_10004484 3300025916 Bacteria 6951
436 Ga0207663_10009885 3300025916 Bacteria 5051
437 Ga0207663_10049960 3300025916 Bacteria 2597
438 Ga0207663_10272334 3300025916 Bacteria 1255
439 Ga0207663_10546715 3300025916 Bacteria 905
440 Ga0207663_10584609 3300025916 Bacteria 876
441 Ga0207660_10069311 3300025917 Bacteria 2560
442 Ga0207662_10109126 3300025918 Bacteria 1724
443 Ga0207657_10058704 3300025919 Bacteria 3309
444 Ga0207657_10103652 3300025919 Bacteria 2358
445 Ga0207657_10115039 3300025919 Bacteria 2217
446 Ga0207649_10077536 3300025920 Bacteria 2141
447 Ga0207652_10006590 3300025921 Bacteria 9362
448 Ga0207646_10189428 3300025922 Bacteria 1858
449 Ga0207646_10303334 3300025922 Bacteria 1443
450 Ga0207681_10008861 3300025923 Bacteria 6147
451 Ga0207694_10269481 3300025924 Bacteria 1396
452 Ga0207694_10532443 3300025924 Bacteria 985
453 Ga0207650_10008427 3300025925 Bacteria 7036
454 Ga0207650_10023679 3300025925 Bacteria 4359
455 Ga0207650_10032631 3300025925 Bacteria 3767
456 Ga0207650_10107696 3300025925 Bacteria 2153
457 Ga0207650_10610848 3300025925 Bacteria 917
458 Ga0207659_10001888 3300025926 Bacteria 12411
459 Ga0207659_10207470 3300025926 Bacteria 1568
460 Ga0207659_10558219 3300025926 Bacteria 974
461 Ga0207659_10773830 3300025926 Bacteria 824
462 Ga0207687_10002691 3300025927 Bacteria 12023
463 Ga0207687_10017501 3300025927 Bacteria 4720
464 Ga0207687_10071298 3300025927 Bacteria 2482
465 Ga0207687_10561229 3300025927 Bacteria 959
466 Ga0207700_10000082 3300025928 Bacteria 58939
467 Ga0207700_10001380 3300025928 Bacteria 13781
468 Ga0207700_10005532 3300025928 Bacteria 7579
469 Ga0207700_10006593 3300025928 Bacteria 7029
470 Ga0207700_10013374 3300025928 Bacteria 5337
471 Ga0207700_10071967 3300025928 Bacteria 2664
472 Ga0207700_10380501 3300025928 Bacteria 1234
473 Ga0207700_10449311 3300025928 Bacteria 1136
474 Ga0207700_10775904 3300025928 Bacteria 857
475 Ga0207664_10007607 3300025929 Bacteria 7517
476 Ga0207664_10019090 3300025929 Bacteria 5060
477 Ga0207664_10065103 3300025929 Bacteria 2917
478 Ga0207664_10175216 3300025929 Bacteria 1838
479 Ga0207664_10626436 3300025929 Bacteria 966
480 Ga0207664_10701535 3300025929 Bacteria 910
481 Ga0207644_10000935 3300025931 Bacteria 18571
482 Ga0207644_10005948 3300025931 Bacteria 7952
483 Ga0207644_10023814 3300025931 Bacteria 4198
484 Ga0207644_10071137 3300025931 Bacteria 2544
485 Ga0207644_10199204 3300025931 Bacteria 1579
486 Ga0207644_10227425 3300025931 Bacteria 1481
487 Ga0207644_10315610 3300025931 Bacteria 1263
488 Ga0207644_10510639 3300025931 Bacteria 992
489 Ga0207644_10555580 3300025931 Bacteria 950
490 Ga0207690_10027669 3300025932 Bacteria 3585
491 Ga0207690_10257216 3300025932 Bacteria 1351
492 Ga0207706_10007456 3300025933 Bacteria 10116
493 Ga0207706_10094134 3300025933 Bacteria 2635
494 Ga0207706_10505190 3300025933 Bacteria 1043
495 Ga0207686_10039576 3300025934 Bacteria 2861
496 Ga0207686_10072241 3300025934 Bacteria 2223
497 Ga0207686_10082835 3300025934 Bacteria 2098
498 Ga0207709_10018229 3300025935 Bacteria 3928
499 Ga0207709_10022885 3300025935 Bacteria 3550
500 Ga0207670_10059938 3300025936 Bacteria 2591
501 Ga0207670_10122899 3300025936 Bacteria 1890
502 Ga0207670_10172597 3300025936 Bacteria 1622
503 Ga0207670_10373369 3300025936 Bacteria 1134
504 Ga0207669_10027702 3300025937 Bacteria 3107
505 Ga0207669_10158660 3300025937 Bacteria 1594
506 Ga0207669_10640651 3300025937 Bacteria 868
507 Ga0207669_10686317 3300025937 Bacteria 840
508 Ga0207704_10003966 3300025938 Bacteria 6733
509 Ga0207704_10034813 3300025938 Bacteria 2878
510 Ga0207704_10068626 3300025938 Bacteria 2236
511 Ga0207665_10004818 3300025939 Bacteria 8981
512 Ga0207665_10024706 3300025939 Bacteria 3962
513 Ga0207691_10000899 3300025940 Bacteria 29484
514 Ga0207691_10039440 3300025940 Bacteria 4370
515 Ga0207691_10076199 3300025940 Bacteria 3023
516 Ga0207691_10355046 3300025940 Bacteria 1254
517 Ga0207711_10002933 3300025941 Bacteria 14911
518 Ga0207711_10003009 3300025941 Bacteria 14738
519 Ga0207711_10008791 3300025941 Bacteria 8446
520 Ga0207711_10009116 3300025941 Bacteria 8285
521 Ga0207711_10076825 3300025941 Bacteria 2909
522 Ga0207711_11076564 3300025941 Bacteria 744
523 Ga0207689_10001983 3300025942 Bacteria 19334
524 Ga0207689_10046798 3300025942 Bacteria 3574
525 Ga0207689_10050225 3300025942 Bacteria 3440
526 Ga0207689_10128129 3300025942 Bacteria 2088
527 Ga0207661_10055119 3300025944 Bacteria 3187
528 Ga0207661_10064941 3300025944 Bacteria 2961
529 Ga0207661_10482685 3300025944 Bacteria 1131
530 Ga0207661_10689277 3300025944 Bacteria 939
531 Ga0207679_10276040 3300025945 Bacteria 1439
532 Ga0207679_10678892 3300025945 Bacteria 933
533 Ga0207667_10007731 3300025949 Bacteria 12852
534 Ga0207667_10634872 3300025949 Bacteria 1075
535 Ga0207651_10008269 3300025960 Bacteria 5610
536 Ga0207651_10069283 3300025960 Bacteria 2490
537 Ga0207651_10090793 3300025960 Bacteria 2234
538 Ga0207651_10632879 3300025960 Bacteria 938
539 Ga0207651_10761422 3300025960 Unclassified 856
540 Ga0207651_11122415 3300025960 Bacteria 705
541 Ga0207712_10056019 3300025961 Bacteria 2776
542 Ga0207712_10157687 3300025961 Bacteria 1760
543 Ga0207712_10309288 3300025961 Bacteria 1300
544 Ga0207712_10486734 3300025961 Bacteria 1052
545 Ga0207668_10005107 3300025972 Bacteria 7723
546 Ga0207668_10287708 3300025972 Bacteria 1351
547 Ga0207640_10077434 3300025981 Bacteria 2261
548 Ga0207640_10292019 3300025981 Bacteria 1286
549 Ga0207640_10786704 3300025981 Bacteria 823
550 Ga0207658_10003966 3300025986 Bacteria 10396
551 Ga0207658_10043132 3300025986 Bacteria 3277
552 Ga0207658_10134960 3300025986 Bacteria 1988
553 Ga0207658_10137294 3300025986 Bacteria 1974
554 Ga0207658_10274986 3300025986 Bacteria 1441
555 Ga0207677_10014584 3300026023 Bacteria 4595
556 Ga0207677_10039478 3300026023 Bacteria 3104
557 Ga0207677_10043068 3300026023 Bacteria 2999
558 Ga0207677_10053908 3300026023 Bacteria 2741
559 Ga0207677_10904651 3300026023 Bacteria 796
560 Ga0207703_10011838 3300026035 Bacteria 6792
561 Ga0207703_10021693 3300026035 Bacteria 5027
562 Ga0207703_10028873 3300026035 Bacteria 4377
563 Ga0207703_10059365 3300026035 Bacteria 3124
564 Ga0207639_10087372 3300026041 Bacteria 2485
565 Ga0207639_10503493 3300026041 Bacteria 1107
566 Ga0207678_10018666 3300026067 Bacteria 6089
567 Ga0207678_10128643 3300026067 Bacteria 2160
568 Ga0207678_10144614 3300026067 Bacteria 2030
569 Ga0207708_10119935 3300026075 Bacteria 2049
570 Ga0207708_10230239 3300026075 Bacteria 1488
571 Ga0207708_10307722 3300026075 Bacteria 1290
572 Ga0207708_10560777 3300026075 Bacteria 964
573 Ga0207702_10037311 3300026078 Bacteria 4067
574 Ga0207702_10337087 3300026078 Bacteria 1440
575 Ga0207702_10394779 3300026078 Bacteria 1333
576 Ga0207702_10436872 3300026078 Bacteria 1268
577 Ga0207702_10473895 3300026078 Bacteria 1217
578 Ga0207641_10003310 3300026088 Bacteria 14332
579 Ga0207641_10059622 3300026088 Bacteria 3250
580 Ga0207641_10138937 3300026088 Bacteria 2189
581 Ga0207648_10000949 3300026089 Bacteria 32818
582 Ga0207648_10097767 3300026089 Bacteria 2569
583 Ga0207648_10994207 3300026089 Bacteria 785
584 Ga0207676_10007601 3300026095 Bacteria 7694
585 Ga0207676_10019980 3300026095 Bacteria 4893
586 Ga0207676_10820288 3300026095 Bacteria 908
587 Ga0207674_10070740 3300026116 Bacteria 3508
588 Ga0207674_10135299 3300026116 Bacteria 2426
589 Ga0207674_10291894 3300026116 Bacteria 1579
590 Ga0207675_100089500 3300026118 Bacteria 2893
591 Ga0207683_10000210 3300026121 Bacteria 50885
592 Ga0207683_10000480 3300026121 Bacteria 36946
593 Ga0207683_10001479 3300026121 Bacteria 21177
594 Ga0207683_10009436 3300026121 Bacteria 8315
595 Ga0207683_10062449 3300026121 Bacteria 3281
596 Ga0207683_10270802 3300026121 Bacteria 1551
597 Ga0207698_10027778 3300026142 Bacteria 4024
598 Ga0207698_11620535 3300026142 Bacteria 663
599 Ga0207428_10760941 3300027907 Unclassified 690
600 Ga0268266_10005275 3300028379 Bacteria 12134
601 Ga0268266_10028221 3300028379 Bacteria 4771
602 Ga0268266_10045267 3300028379 Bacteria 3764
603 Ga0268266_10287372 3300028379 Bacteria 1530
604 Ga0268266_10434179 3300028379 Bacteria 1246
605 Ga0268266_10467240 3300028379 Bacteria 1201
606 Ga0268265_10202704 3300028380 Bacteria 1722
607 Ga0268265_10356902 3300028380 Bacteria 1337
608 Ga0268264_10016111 3300028381 Bacteria 6125
609 Ga0268264_10665660 3300028381 Bacteria 1031
610 Ga0265332_10239652 3300031238 Unclassified 751
611 Ga0265339_10111078 3300031249 Bacteria 1418
612 Ga0307513_10296736 3300031456 Bacteria 1385
613 Ga0307509_10130561 3300031507 Bacteria 2469
614 Ga0265313_10015163 3300031595 Bacteria 4508
615 Ga0373950_0014700 3300034818 Bacteria 1319
616 Ga0373938_0014105 3300034957 Bacteria 1529
617 Ga0373938_0063768 3300034957 Bacteria 867
618 Ga0373926_0044929 3300035083 Bacteria 1583
619 Ga0373926_0053387 3300035083 Bacteria 1462
620 Ga0373934_0014177 3300035086 Bacteria 3019
621 Ga0373944_0003706 3300035089 Bacteria 3950
622 Ga0373944_0022547 3300035089 Bacteria 1830
623 Ga0373949_0053951 3300035090 Bacteria 1019
624 Ga0373952_0015400 3300035092 Bacteria 1544
625 Ga0373923_0004472 3300035111 Bacteria 4641
626 Ga0373936_0088302 3300035113 Bacteria 1297
627 Ga0373936_0154046 3300035113 Bacteria 998
628 Ga0373939_0157285 3300035114 Bacteria 832
629 Ga0373941_0044152 3300035115 Bacteria 1390
630 Ga0373945_0014083 3300035116 Bacteria 2676
631 Ga0373953_0005116 3300035117 Bacteria 4236
632 Ga0373954_0005514 3300035118 Bacteria 5473
633 Ga0373957_0001985 3300035120 Bacteria 5712
634 Ga0373960_0011455 3300035121 Bacteria 2186
635 Ga0373960_0180484 3300035121 Unclassified 737
636 Ga0373943_0016010 3300035170 Bacteria 3414
637 Ga0373943_0016358 3300035170 Bacteria 3381
638 Ga0373943_0118281 3300035170 Bacteria 1406
639 Ga0373946_0010307 3300035171 Bacteria 3456
640 Ga0373946_0064686 3300035171 Bacteria 1565
641 Ga0373961_0041732 3300035241 Bacteria 1327
642 Ga0373962_0043302 3300035242 Bacteria 1276
643 Ga0373924_0061551 3300035410 Bacteria 1571
644 Ga0373931_0045589 3300035691 Bacteria 2316
645 Ga0373931_0055066 3300035691 Bacteria 2127
646 Ga0373931_0060654 3300035691 Bacteria 2037
647 Ga0373931_0219834 3300035691 Bacteria 1143
648 Ga0373931_0371679 3300035691 Bacteria 899
649 Ga0373935_0001749 3300035692 Bacteria 12185
650 Ga0373935_0050340 3300035692 Bacteria 2643
651 Ga0373935_0154447 3300035692 Bacteria 1560
652 Ga0373935_0689937 3300035692 Bacteria 751
653 Ga0373927_0049597 3300035695 Bacteria 2714
654 Ga0373927_0114758 3300035695 Bacteria 1756
655 Ga0373933_0009136 3300035724 Bacteria 5411
656 Ga0373933_0055799 3300035724 Bacteria 2371
657 Ga0373933_0186062 3300035724 Bacteria 1326
658 Ga0373947_0001187 3300035725 Bacteria 16034
659 Ga0373947_0055216 3300035725 Bacteria 2398
660 Ga0373947_0088994 3300035725 Bacteria 1922
661 Ga0373947_0218404 3300035725 Bacteria 1252
662 Ga0373947_0328429 3300035725 Bacteria 1024
663 Ga0373937_0027974 3300036401 Bacteria 5100
664 Ga0373925_0004244 3300037068 Bacteria 10859
665 Ga0373925_0031296 3300037068 Bacteria 3909
666 Ga0373925_0098000 3300037068 Bacteria 2249
667 Ga0373925_0280237 3300037068 Bacteria 1342
668 Ga0373925_0407901 3300037068 Bacteria 1109
669 Ga0373925_0720753 3300037068 Bacteria 822
670 Ga0395899_0226593 3300037312 Bacteria 1292
671 Ga0395898_0584294 3300037466 Bacteria 1059
672 Ga0436364_0355624 3300037853 Unclassified 632
673 Ga0436364_0518470 3300037853 Bacteria 958
674 Ga0436364_1028562 3300037853 Bacteria 2308
675 Ga0395901_0387110 3300038443 Bacteria 1438
676 Ga0395901_0718909 3300038443 Bacteria 994
677 Ga0436365_0149298 3300039437 Bacteria 3877
678 Ga0436365_0197847 3300039437 Bacteria 1387
679 Ga0436365_0824382 3300039437 Bacteria 33017
680 Ga0436365_0935211 3300039437 Bacteria 4319
681 Ga0436365_1674695 3300039437 Bacteria 1636
682 Ga0436365_1830793 3300039437 Bacteria 7430
683 Ga0436365_1847958 3300039437 Bacteria 1444
684 Ga0436360_0240872 3300039438 Bacteria 1876
685 Ga0436360_0439418 3300039438 Bacteria 618
686 Ga0436360_0499041 3300039438 Unclassified 1164
687 Ga0436363_1542522 3300039450 Bacteria 1800
688 Ga0436362_0355831 3300039453 Bacteria 6148
689 Ga0436362_0450274 3300039453 Bacteria 1059
690 Ga0451853_0763982 3300041512 Bacteria 895
691 Ga0466964_0323269 3300044706 Bacteria 785
692 Ga0466957_0106069 3300044842 Bacteria 1777
693 Ga0466967_0148355 3300045976 Bacteria 2189
694 Ga0495592_0010242 3300046454 Bacteria 7067
695 Ga0495603_0019912 3300046455 Bacteria 4064
696 Ga0495603_0061344 3300046455 Bacteria 2220
697 Ga0495603_0092761 3300046455 Bacteria 1765
698 Ga0495603_0360030 3300046455 Bacteria 835
699 Ga0495629_0000968 3300046459 Bacteria 23136
700 Ga0495629_0002739 3300046459 Bacteria 13484
701 Ga0495629_0170466 3300046459 Bacteria 1510
702 Ga0495629_0194292 3300046459 Bacteria 1404
703 Ga0495629_0237156 3300046459 Bacteria 1256
704 Ga0495641_0017865 3300046461 Bacteria 3678
705 Ga0495641_0067514 3300046461 Bacteria 1608
706 Ga0495651_0002173 3300046462 Bacteria 15168
707 Ga0495580_0169764 3300046472 Bacteria 1508
708 Ga0495580_0207559 3300046472 Bacteria 1348
709 Ga0495582_0002401 3300046473 Bacteria 10460
710 Ga0495582_0125756 3300046473 Bacteria 1446
711 Ga0495639_0010527 3300046475 Bacteria 3983
712 Ga0495662_0033198 3300046476 Bacteria 2494
713 Ga0495664_0048328 3300046477 Bacteria 2525
714 Ga0495664_0050516 3300046477 Bacteria 2469
715 Ga0495584_0116793 3300046491 Bacteria 1351
716 Ga0495608_0009348 3300046511 Bacteria 6852
717 Ga0495618_0137727 3300046514 Bacteria 1561
718 Ga0495618_0172602 3300046514 Bacteria 1375
719 Ga0495628_0019118 3300046516 Bacteria 5666
720 Ga0495630_0103761 3300046517 Bacteria 2151
721 Ga0495666_0069639 3300046526 Bacteria 1673
722 Ga0495652_0040582 3300046529 Bacteria 4022
723 Ga0495652_0204387 3300046529 Bacteria 1496
724 Ga0495665_0047177 3300046531 Bacteria 2285
725 Ga0495640_0029383 3300046533 Bacteria 3947
726 Ga0495640_0039156 3300046533 Bacteria 3328
727 Ga0495586_0058031 3300046535 Bacteria 2101
728 Ga0495586_0059730 3300046535 Bacteria 2072
729 Ga0495586_0234475 3300046535 Bacteria 1045
730 Ga0495587_0008084 3300046536 Bacteria 6783
731 Ga0495621_0102654 3300046539 Bacteria 1090
732 Ga0495645_0015451 3300046543 Bacteria 5428
733 Ga0495622_0112543 3300046557 Bacteria 1246
734 Ga0495667_0000293 3300046559 Bacteria 32233
735 Ga0495634_0041569 3300046642 Bacteria 3121
736 Ga0495634_0116882 3300046642 Bacteria 1710
737 Ga0495635_0067993 3300046663 Bacteria 2443
738 Ga0495635_0248520 3300046663 Bacteria 1199
739 Ga0495588_0023331 3300046674 Bacteria 3063
740 Ga0495657_0009103 3300046675 Bacteria 7544
741 Ga0495599_0006529 3300046678 Bacteria 7036
742 Ga0495623_0000668 3300046679 Bacteria 22825
743 Ga0495646_0022084 3300046680 Bacteria 4016
744 Ga0495647_0061937 3300046681 Bacteria 1478
745 Ga0495658_0016691 3300046683 Bacteria 3780
746 Ga0495658_0018823 3300046683 Bacteria 3596
747 Ga0495658_0028467 3300046683 Bacteria 3016
748 Ga0495613_0004415 3300046689 Bacteria 10535
749 Ga0495613_0129516 3300046689 Bacteria 1807
750 Ga0495624_0059043 3300046690 Bacteria 2407
751 Ga0495624_0115959 3300046690 Bacteria 1646
752 Ga0495600_0004765 3300046809 Bacteria 8139
753 Ga0495581_0010403 3300047315 Bacteria 5382
754 Ga0495581_0056406 3300047315 Bacteria 2267
755 Ga0495581_0159070 3300047315 Bacteria 1320
756 Ga0495604_0005199 3300047317 Bacteria 10311
757 Ga0495674_0009612 3300047319 Bacteria 9185
758 Ga0495674_0311394 3300047319 Bacteria 1284
759 Ga0495676_0038286 3300047321 Bacteria 3983
760 Ga0495680_0003160 3300047322 Bacteria 16401
761 Ga0495680_0013735 3300047322 Bacteria 7048
762 Ga0495680_0072609 3300047322 Bacteria 2617
763 Ga0495680_0273544 3300047322 Bacteria 1192
764 Ga0495675_0002509 3300047444 Bacteria 10987
765 Ga0495684_0037697 3300047471 Bacteria 3708
766 Ga0495684_0240931 3300047471 Bacteria 1319
767 Ga0495684_0258369 3300047471 Bacteria 1264
768 Ga0495593_0063278 3300047673 Bacteria 1932
769 Ga0495602_0020889 3300048088 Bacteria 6460
770 Ga0495614_0327169 3300048089 Unclassified 712
771 Ga0496100_0000750 3300048903 Bacteria 15473
772 Ga0496100_0017698 3300048903 Bacteria 4212
773 Ga0496100_0355975 3300048903 Bacteria 1106
774 Ga0496101_0001812 3300048904 Bacteria 12875
775 Ga0496101_0002124 3300048904 Bacteria 12082
776 Ga0496102_0004194 3300048905 Bacteria 12188
777 Ga0496102_0217808 3300048905 Bacteria 1799
778 Ga0496102_0545231 3300048905 Bacteria 1082
779 Ga0496102_0604557 3300048905 Bacteria 1019
780 Ga0496103_0018426 3300048906 Bacteria 4187
781 Ga0496103_0332495 3300048906 Bacteria 977
782 Ga0496103_0374971 3300048906 Bacteria 914
783 Ga0496104_0029377 3300048907 Bacteria 5098
784 Ga0496104_0035486 3300048907 Bacteria 4655
785 Ga0496104_0059292 3300048907 Bacteria 3623
786 Ga0496104_0061938 3300048907 Bacteria 3547
787 Ga0496104_0065245 3300048907 Bacteria 3454
788 Ga0496104_0090101 3300048907 Bacteria 2930
789 Ga0496104_0092744 3300048907 Bacteria 2888
790 Ga0496104_0607820 3300048907 Bacteria 1003
791 Ga0496104_0914367 3300048907 Bacteria 782
792 Ga0496105_0020983 3300048908 Bacteria 5283
793 Ga0496105_0032117 3300048908 Bacteria 4306
794 Ga0496105_0063766 3300048908 Bacteria 3040
795 Ga0496105_0126202 3300048908 Bacteria 2109
796 Ga0496106_0006214 3300048909 Bacteria 8836
797 Ga0496106_0051165 3300048909 Bacteria 3114
798 Ga0496106_0072695 3300048909 Bacteria 2630
799 Ga0496106_0125465 3300048909 Bacteria 2009
800 Ga0496106_0257141 3300048909 Bacteria 1397
801 Ga0496107_0001758 3300048910 Bacteria 13650
802 Ga0496107_0018485 3300048910 Bacteria 4907
803 Ga0496107_0029092 3300048910 Bacteria 3928
804 Ga0496107_0031019 3300048910 Bacteria 3811
805 Ga0496107_0289079 3300048910 Unclassified 1220
806 Ga0496108_0004140 3300048911 Bacteria 11661
807 Ga0496108_0075310 3300048911 Bacteria 2851
808 Ga0496108_0127310 3300048911 Bacteria 2187
809 Ga0496108_0210282 3300048911 Bacteria 1689
810 Ga0496109_0011017 3300048912 Bacteria 7749
811 Ga0496109_0043248 3300048912 Bacteria 4082
812 Ga0496109_0053904 3300048912 Bacteria 3669
813 Ga0496109_0057152 3300048912 Bacteria 3560
814 Ga0496109_0067238 3300048912 Bacteria 3283
815 Ga0496109_0087812 3300048912 Bacteria 2872
816 Ga0496109_1083213 3300048912 Bacteria 738
817 Ga0496110_0006110 3300048913 Bacteria 9492
818 Ga0496110_0029921 3300048913 Bacteria 4692
819 Ga0496110_0098292 3300048913 Bacteria 2623
820 Ga0496110_0161538 3300048913 Bacteria 2031
821 Ga0496110_0237197 3300048913 Bacteria 1659
822 Ga0496111_0003203 3300048914 Bacteria 10103
823 Ga0496111_0005507 3300048914 Bacteria 8129
824 Ga0496111_0008722 3300048914 Bacteria 6728
825 Ga0496111_0288518 3300048914 Bacteria 1217
826 Ga0496112_0020496 3300048915 Bacteria 6269
827 Ga0496112_0022976 3300048915 Bacteria 5950
828 Ga0496112_0048980 3300048915 Bacteria 4140
829 Ga0496112_0132298 3300048915 Bacteria 2465
830 Ga0496112_0143502 3300048915 Bacteria 2356
831 Ga0496112_0308903 3300048915 Bacteria 1526
832 Ga0496112_1068710 3300048915 Bacteria 726
833 Ga0496113_0011380 3300048916 Bacteria 5932
834 Ga0496113_0016379 3300048916 Bacteria 5120
835 Ga0496113_0020122 3300048916 Bacteria 4685
836 Ga0496113_0081844 3300048916 Bacteria 2475
837 Ga0496113_0216394 3300048916 Bacteria 1526
838 Ga0496114_0002778 3300048917 Bacteria 13400
839 Ga0496114_0015488 3300048917 Bacteria 6131
840 Ga0496114_0211590 3300048917 Bacteria 1701
841 Ga0496114_0356194 3300048917 Bacteria 1294
842 Ga0496115_0007409 3300048918 Bacteria 8072
843 Ga0496115_0025791 3300048918 Bacteria 4580
844 Ga0496115_0042324 3300048918 Bacteria 3628
845 Ga0496115_0105287 3300048918 Bacteria 2315
846 Ga0496115_0259452 3300048918 Bacteria 1429
847 Ga0496115_0579949 3300048918 Bacteria 893
848 Ga0496124_0297108 3300048927 Bacteria 1169
849 Ga0501034_0193514 3300049571 Bacteria 1995
850 nmdc:mga03683_1814_c1 3300050489 Bacteria 6480
851 nmdc:mga0yw44_210807_c2 3300050492 Bacteria 824
852 nmdc:mga0k408_657126_c1 3300050493 Unclassified 616
853 nmdc:mga07m45_13018_c1 3300050496 Bacteria 4402
854 nmdc:mga08y16_1274714_c1 3300050511 Unclassified 703
855 nmdc:mga0n895_1498942_c1 3300050512 Bacteria 641
856 nmdc:mga0n895_340577_c1 3300050512 Bacteria 1519
857 nmdc:mga0n895_340581_c1 3300050512 Bacteria 1519
858 nmdc:mga0n895_840153_c1 3300050512 Bacteria 907
859 nmdc:mga0rr50_398764_c1 3300050513 Bacteria 1162
860 nmdc:mga0rr50_709556_c1 3300050513 Bacteria 858
861 nmdc:mga08x19_143908_c1 3300050514 Bacteria 1611
862 nmdc:mga08x19_601871_c1 3300050514 Unclassified 779
863 nmdc:mga0sz30_14243_c1 3300050516 Bacteria 3126
864 Ga0495601_0001091 3300053077 Bacteria 14889
865 Ga0495601_0259441 3300053077 Bacteria 1134
866 Ga0495612_0008078 3300053078 Bacteria 4283
867 Ga0495612_0073496 3300053078 Bacteria 1428
868 Ga0495612_0130860 3300053078 Bacteria 1084
869 Ga0495612_0265321 3300053078 Bacteria 766
870 Ga0495595_0001076 3300053084 Bacteria 10560
871 Ga0495619_0000324 3300053085 Bacteria 33369
872 Ga0495619_0002201 3300053085 Bacteria 12906
873 Ga0495619_0007062 3300053085 Bacteria 7106
874 Ga0495619_0132260 3300053085 Bacteria 1715
875 Ga0500643_110651 3300053087 Unclassified 742
876 Ga0500647_0128028 3300053091 Bacteria 1198
877 Ga0500650_0346865 3300053098 Unclassified 650
878 Ga0500642_0024659 3300053130 Bacteria 2433
879 Ga0500559_0138601 3300053136 Bacteria 1139
880 Ga0500616_0001916 3300053153 Bacteria 18590
881 Ga0070713_100053191
882 Ga0065712_10483230
883 Ga0070658_10081862
884 Ga0070676_10000847
885 Ga0070676_10076395
886 Ga0070676_10126199
887 Ga0070676_10194291
888 Ga0070676_10302408
889 Ga0070683_100323707
890 Ga0070683_100467700
891 Ga0070670_100026430
892 Ga0070670_100034811
893 Ga0070670_100371574
894 Ga0070670_100474485
895 Ga0070677_10130336
896 Ga0068869_100039523
897 Ga0068869_100100516
898 Ga0068869_100158040
899 Ga0070666_10007180
900 Ga0070666_10016386
901 Ga0070666_10089412
902 Ga0070666_10107282
903 Ga0070666_10861835
904 Ga0070680_100000933
905 Ga0070682_100011560
906 Ga0070682_100015105
907 Ga0070682_100072844
908 Ga0068868_100019189
909 Ga0068868_100114985
910 Ga0068868_100130503
911 Ga0068868_100410314
912 Ga0068868_100456767
913 Ga0070660_100328813
914 Ga0070660_100336016
915 Ga0070689_100027304
916 Ga0070689_100028079
917 Ga0070689_100029734
918 Ga0070689_100106442
919 Ga0070689_100150431
920 Ga0070689_100170817
921 Ga0070691_10009000
922 Ga0070687_100006230
923 Ga0070687_100101598
924 Ga0070661_100103487
925 Ga0070661_101242938
926 Ga0070668_100004542
927 Ga0070668_100668584
928 Ga0070669_100005778
929 Ga0070669_100370722
930 Ga0070675_100001685
931 Ga0070675_100124241
932 Ga0070675_100485032
933 Ga0070675_100528793
934 Ga0070675_100722109
935 Ga0070671_100010441
936 Ga0070671_100021219
937 Ga0070671_100163771
938 Ga0070671_100449118
939 Ga0070674_100003123
940 Ga0070674_100034449
941 Ga0070674_100093096
942 Ga0070674_100422566
943 Ga0070673_100031821
944 Ga0070673_100052687
945 Ga0070673_100082620
946 Ga0070673_100083704
947 Ga0070673_100117678
948 Ga0070673_100607081
949 Ga0070688_100009043
950 Ga0070688_100091149
951 Ga0070659_100260774
952 Ga0070659_100308486
953 Ga0070659_100498768
954 Ga0070667_100010578
955 Ga0070667_100048749
956 Ga0070667_100076418
957 Ga0070667_100151466
958 Ga0070667_100758360
959 Ga0070709_10005103
960 Ga0070709_10015799
961 Ga0070709_10112268
962 Ga0070709_10205940
963 Ga0070709_10226386
964 Ga0070709_10452902
965 Ga0070714_100004407
966 Ga0070714_100031975
967 Ga0070714_100050832
968 Ga0070714_100192350
969 Ga0070714_100289260
970 Ga0070714_100539274
971 Ga0070713_100000039
972 Ga0070713_100005026
973 Ga0070713_100005783
974 Ga0070713_100030937
975 Ga0070713_100059691
976 Ga0070713_100153211
977 Ga0070710_10001919
978 Ga0070710_10151809
979 Ga0070710_10289472
980 Ga0070701_10087033
981 Ga0070711_100003421
982 Ga0070711_100250160
983 Ga0070711_100296402
984 Ga0070711_100429923
985 Ga0070711_100537556
986 Ga0070705_100145847
987 Ga0070705_100275999
988 Ga0070705_100666759
989 Ga0070700_100266928
990 Ga0070708_100108249
991 Ga0070663_100010454
992 Ga0070663_100020275
993 Ga0070663_100371418
994 Ga0070663_100980063
995 Ga0070663_101012519
996 Ga0070678_100000728
997 Ga0070678_100001027
998 Ga0070678_100016483
999 Ga0070678_100070575
1000 Ga0070678_100237585
1001 Ga0070662_100337719
1002 Ga0070681_10009517
1003 Ga0070681_10061084
1004 Ga0070681_10157011
1005 Ga0070681_10430920
1006 Ga0068867_100001109
1007 Ga0068867_100026711
1008 Ga0068867_100325004
1009 Ga0068867_100357024
1010 Ga0068867_100438499
1011 Ga0070685_10012319
1012 Ga0070685_10027399
1013 Ga0070706_100021874
1014 Ga0070706_100878300
1015 Ga0070698_100002091
1016 Ga0070699_100013134
1017 Ga0070679_100009132
1018 Ga0070679_100088967
1019 Ga0070679_100207694
1020 Ga0070684_100085454
1021 Ga0070684_100262668
1022 Ga0070684_100305443
1023 Ga0070684_100333786
1024 Ga0070684_100761394
1025 Ga0070697_100099113
1026 Ga0070697_100658826
1027 Ga0068853_100052274
1028 Ga0068853_100269607
1029 Ga0070672_100001043
1030 Ga0070672_100105024
1031 Ga0070672_100125652
1032 Ga0070672_100228011
1033 Ga0070672_100293517
1034 Ga0070672_100437397
1035 Ga0070686_100005547
1036 Ga0070686_100025992
1037 Ga0070695_100298841
1038 Ga0070696_100082166
1039 Ga0070696_100677242
1040 Ga0070693_100006850
1041 Ga0070693_100139528
1042 Ga0070693_100264257
1043 Ga0070665_100002989
1044 Ga0070665_100088331
1045 Ga0070665_100475083
1046 Ga0070665_100512216
1047 Ga0070665_100948496
1048 Ga0070704_100308004
1049 Ga0070704_100363471
1050 Ga0070704_100532462
1051 Ga0068855_100455754
1052 Ga0068855_100994653
1053 Ga0070664_100034445
1054 Ga0070664_100189837
1055 Ga0070664_100252212
1056 Ga0070664_100723375
1057 Ga0068857_100119758
1058 Ga0068857_100206745
1059 Ga0068854_100273307
1060 Ga0068854_100649616
1061 Ga0068856_100150900
1062 Ga0068856_100180424
1063 Ga0068856_100305419
1064 Ga0070702_100012876
1065 Ga0070702_100381995
1066 Ga0068859_100140301
1067 Ga0068859_100162478
1068 Ga0068859_100715312
1069 Ga0068864_100010322
1070 Ga0068864_100021942
1071 Ga0068864_100026129
1072 Ga0068866_10045919
1073 Ga0068866_10083519
1074 Ga0068861_100162574
1075 Ga0068863_100190757
1076 Ga0068863_100740153
1077 Ga0068863_101157154
1078 Ga0068858_100003682
1079 Ga0068858_100056529
1080 Ga0068858_100083784
1081 Ga0068858_100402662
1082 Ga0068858_100819590
1083 Ga0068860_100012825
1084 Ga0068860_100106733
1085 Ga0068862_100039466
1086 Ga0081455_10034958
1087 Ga0070717_10000217
1088 Ga0070717_10005760
1089 Ga0070717_10077749
1090 Ga0070717_10388727
1091 Ga0070717_10697980
1092 Ga0075365_10533119
1093 Ga0075363_100599798
1094 Ga0070715_10013506
1095 Ga0070715_10018821
1096 Ga0070715_10022051
1097 Ga0070715_10169171
1098 Ga0070715_10342259
1099 Ga0070716_100000793
1100 Ga0070716_100002302
1101 Ga0070716_100023037
1102 Ga0070716_100089845
1103 Ga0070716_100454115
1104 Ga0070712_100009890
1105 Ga0070712_100013119
1106 Ga0070712_100043893
1107 Ga0070712_100067602
1108 Ga0070712_100170328
1109 Ga0070712_100191421
1110 Ga0070712_100230118
1111 Ga0070712_100318807
1112 Ga0075367_10220166
1113 Ga0075369_10044353
1114 Ga0097621_100002390
1115 Ga0097621_100008604
1116 Ga0097621_100010225
1117 Ga0097621_100113837
1118 Ga0097621_100194548
1119 Ga0097621_100586033
1120 Ga0097621_100775284
1121 Ga0075370_10022929
1122 Ga0068871_100001576
1123 Ga0068871_100003994
1124 Ga0068871_100009547
1125 Ga0068871_100041628
1126 Ga0068871_100317186
1127 Ga0068871_100319267
1128 Ga0075434_100081494
1129 Ga0075434_100623383
1130 Ga0075434_100736699
1131 Ga0075434_101836747
1132 Ga0068865_100038086
1133 Ga0068865_100094688
1134 Ga0068865_100564237
1135 Ga0068865_100791873
1136 Ga0068865_101089029
1137 Ga0075436_100101786
1138 Ga0075436_100181462
1139 Ga0097620_100128607
1140 Ga0097620_100140316
1141 Ga0097620_100162473
1142 Ga0097620_100715278
1143 Ga0075435_100768089
1144 Ga0099794_10006876
1145 Ga0099795_10010690
1146 Ga0099795_10070276
1147 Ga0105251_10023867
1148 Ga0105250_10024795
1149 Ga0105240_10004752
1150 Ga0105240_10583003
1151 Ga0111539_10499406
1152 Ga0105245_10029333
1153 Ga0105245_10072585
1154 Ga0105245_10127957
1155 Ga0105245_10261620
1156 Ga0105245_10363129
1157 Ga0105245_10446651
1158 Ga0105247_10029031
1159 Ga0105247_10173383
1160 Ga0105247_10197289
1161 Ga0105247_10225357
1162 Ga0105243_10023934
1163 Ga0105243_10026026
1164 Ga0105243_10071930
1165 Ga0105241_10014601
1166 Ga0105241_10018681
1167 Ga0105241_10166234
1168 Ga0105241_10177093
1169 Ga0105241_10493190
1170 Ga0105242_10009790
1171 Ga0105242_10010141
1172 Ga0105242_10014350
1173 Ga0105242_10685281
1174 Ga0105242_11102524
1175 Ga0105248_10001952
1176 Ga0105248_10043581
1177 Ga0105248_10097657
1178 Ga0105248_10124081
1179 Ga0105248_10265100
1180 Ga0105248_10295765
1181 Ga0105248_10651701
1182 Ga0105248_11796547
1183 Ga0105237_10054170
1184 Ga0105237_10111632
1185 Ga0105237_10138192
1186 Ga0105237_10254079
1187 Ga0105237_10422871
1188 Ga0105237_10602444
1189 Ga0105238_10082146
1190 Ga0105238_10157549
1191 Ga0105238_10276775
1192 Ga0105238_10288779
1193 Ga0105249_10104828
1194 Ga0105249_10178494
1195 Ga0105249_10379928
1196 Ga0105249_11354522
1197 Ga0099796_10055649
1198 Ga0105239_10062965
1199 Ga0105239_10190768
1200 Ga0105239_10200568
1201 Ga0105239_10249737
1202 Ga0105239_10379095
1203 Ga0105246_10173807
1204 Ga0105246_11430036
1205 Ga0157328_1000881
1206 Ga0157313_1018652
1207 Ga0157342_1006406
1208 Ga0157373_10095337
1209 Ga0157373_10115335
1210 Ga0157370_10160708
1211 Ga0157370_10200552
1212 Ga0157370_10540463
1213 Ga0157374_10008845
1214 Ga0157374_10009414
1215 Ga0157374_10128543
1216 Ga0157374_10309945
1217 Ga0157374_10554852
1218 Ga0157374_10780799
1219 Ga0157378_10028760
1220 Ga0157378_10029323
1221 Ga0157378_10122317
1222 Ga0157378_10141988
1223 Ga0157378_10161621
1224 Ga0157378_10381392
1225 Ga0157378_10477251
1226 Ga0157378_10918132
1227 Ga0163162_10001709
1228 Ga0163162_10045452
1229 Ga0157372_10413301
1230 Ga0157375_10009216
1231 Ga0157375_10020260
1232 Ga0157375_10079270
1233 Ga0157375_10269533
1234 Ga0157375_10299424
1235 Ga0157375_10476049
1236 Ga0157375_10708299
1237 Ga0163163_10023573
1238 Ga0163163_10347580
1239 Ga0163163_10542852
1240 Ga0157380_10334421
1241 Ga0157380_10372182
1242 Ga0157377_10105301
1243 Ga0157377_10933187
1244 Ga0157379_10002943
1245 Ga0157379_10025689
1246 Ga0157379_10027789
1247 Ga0157379_10346149
1248 Ga0157379_10351343
1249 Ga0157376_10003569
1250 Ga0157376_10153633
1251 Ga0157376_10177971
1252 Ga0157376_10202990
1253 Ga0157376_10310276
1254 Ga0157376_10332841
1255 Ga0157376_11215520
1256 Ga0157376_11267269
1257 Ga0163161_10069944
1258 Ga0163161_10197934
1259 Ga0163161_10275425
1260 Ga0213873_10013063
1261 Ga0213874_10084189
1262 Ga0213876_10036782
1263 Ga0213876_10273573
1264 Ga0213875_10308522
1265 Ga0207426_1022401
1266 Ga0207697_10003098
1267 Ga0207656_10200211
1268 Ga0207682_10074864
1269 Ga0207692_10001674
1270 Ga0207692_10014567
1271 Ga0207642_10046942
1272 Ga0207642_10057025
1273 Ga0207642_10411742
1274 Ga0207710_10001666
1275 Ga0207710_10002946
1276 Ga0207710_10017187
1277 Ga0207710_10458589
1278 Ga0207688_10305378
1279 Ga0207680_10020003
1280 Ga0207680_10092028
1281 Ga0207680_10109528
1282 Ga0207685_10000852
1283 Ga0207685_10010994
1284 Ga0207685_10014352
1285 Ga0207699_10000138
1286 Ga0207699_10006404
1287 Ga0207699_10012288
1288 Ga0207699_10369612
1289 Ga0207645_10000588
1290 Ga0207645_10035490
1291 Ga0207645_10052631
1292 Ga0207645_10094801
1293 Ga0207645_10191258
1294 Ga0207705_10020452
1295 Ga0207684_10025016
1296 Ga0207684_10141231
1297 Ga0207654_10002446
1298 Ga0207654_10172411
1299 Ga0207654_10236912
1300 Ga0207707_10010605
1301 Ga0207707_10106369
1302 Ga0207695_10009523
1303 Ga0207695_10800230
1304 Ga0207671_10039867
1305 Ga0207671_10907036
1306 Ga0207693_10002257
1307 Ga0207693_10007885
1308 Ga0207693_10034136
1309 Ga0207693_10049736
1310 Ga0207693_10059404
1311 Ga0207693_10062001
1312 Ga0207693_10068703
1313 Ga0207693_10092385
1314 Ga0207693_10188144
1315 Ga0207663_10004484
1316 Ga0207663_10009885
1317 Ga0207663_10049960
1318 Ga0207663_10272334
1319 Ga0207663_10546715
1320 Ga0207663_10584609
1321 Ga0207660_10069311
1322 Ga0207662_10109126
1323 Ga0207657_10058704
1324 Ga0207657_10103652
1325 Ga0207657_10115039
1326 Ga0207649_10077536
1327 Ga0207652_10006590
1328 Ga0207646_10189428
1329 Ga0207646_10303334
1330 Ga0207681_10008861
1331 Ga0207694_10269481
1332 Ga0207694_10532443
1333 Ga0207650_10008427
1334 Ga0207650_10023679
1335 Ga0207650_10032631
1336 Ga0207650_10107696
1337 Ga0207650_10610848
1338 Ga0207659_10001888
1339 Ga0207659_10207470
1340 Ga0207659_10558219
1341 Ga0207659_10773830
1342 Ga0207687_10002691
1343 Ga0207687_10017501
1344 Ga0207687_10071298
1345 Ga0207687_10561229
1346 Ga0207700_10000082
1347 Ga0207700_10001380
1348 Ga0207700_10005532
1349 Ga0207700_10006593
1350 Ga0207700_10013374
1351 Ga0207700_10071967
1352 Ga0207700_10380501
1353 Ga0207700_10449311
1354 Ga0207700_10775904
1355 Ga0207664_10007607
1356 Ga0207664_10019090
1357 Ga0207664_10065103
1358 Ga0207664_10175216
1359 Ga0207664_10626436
1360 Ga0207664_10701535
1361 Ga0207644_10000935
1362 Ga0207644_10005948
1363 Ga0207644_10023814
1364 Ga0207644_10071137
1365 Ga0207644_10199204
1366 Ga0207644_10227425
1367 Ga0207644_10315610
1368 Ga0207644_10510639
1369 Ga0207644_10555580
1370 Ga0207690_10027669
1371 Ga0207690_10257216
1372 Ga0207706_10007456
1373 Ga0207706_10094134
1374 Ga0207706_10505190
1375 Ga0207686_10039576
1376 Ga0207686_10072241
1377 Ga0207686_10082835
1378 Ga0207709_10018229
1379 Ga0207709_10022885
1380 Ga0207670_10059938
1381 Ga0207670_10122899
1382 Ga0207670_10172597
1383 Ga0207670_10373369
1384 Ga0207669_10027702
1385 Ga0207669_10158660
1386 Ga0207669_10640651
1387 Ga0207669_10686317
1388 Ga0207704_10003966
1389 Ga0207704_10034813
1390 Ga0207704_10068626
1391 Ga0207665_10004818
1392 Ga0207665_10024706
1393 Ga0207691_10000899
1394 Ga0207691_10039440
1395 Ga0207691_10076199
1396 Ga0207691_10355046
1397 Ga0207711_10002933
1398 Ga0207711_10003009
1399 Ga0207711_10008791
1400 Ga0207711_10009116
1401 Ga0207711_10076825
1402 Ga0207711_11076564
1403 Ga0207689_10001983
1404 Ga0207689_10046798
1405 Ga0207689_10050225
1406 Ga0207689_10128129
1407 Ga0207661_10055119
1408 Ga0207661_10064941
1409 Ga0207661_10482685
1410 Ga0207661_10689277
1411 Ga0207679_10276040
1412 Ga0207679_10678892
1413 Ga0207667_10007731
1414 Ga0207667_10634872
1415 Ga0207651_10008269
1416 Ga0207651_10069283
1417 Ga0207651_10090793
1418 Ga0207651_10632879
1419 Ga0207651_10761422
1420 Ga0207651_11122415
1421 Ga0207712_10056019
1422 Ga0207712_10157687
1423 Ga0207712_10309288
1424 Ga0207712_10486734
1425 Ga0207668_10005107
1426 Ga0207668_10287708
1427 Ga0207640_10077434
1428 Ga0207640_10292019
1429 Ga0207640_10786704
1430 Ga0207658_10003966
1431 Ga0207658_10043132
1432 Ga0207658_10134960
1433 Ga0207658_10137294
1434 Ga0207658_10274986
1435 Ga0207677_10014584
1436 Ga0207677_10039478
1437 Ga0207677_10043068
1438 Ga0207677_10053908
1439 Ga0207677_10904651
1440 Ga0207703_10011838
1441 Ga0207703_10021693
1442 Ga0207703_10028873
1443 Ga0207703_10059365
1444 Ga0207639_10087372
1445 Ga0207639_10503493
1446 Ga0207678_10018666
1447 Ga0207678_10128643
1448 Ga0207678_10144614
1449 Ga0207708_10119935
1450 Ga0207708_10230239
1451 Ga0207708_10307722
1452 Ga0207708_10560777
1453 Ga0207702_10037311
1454 Ga0207702_10337087
1455 Ga0207702_10394779
1456 Ga0207702_10436872
1457 Ga0207702_10473895
1458 Ga0207641_10003310
1459 Ga0207641_10059622
1460 Ga0207641_10138937
1461 Ga0207648_10000949
1462 Ga0207648_10097767
1463 Ga0207648_10994207
1464 Ga0207676_10007601
1465 Ga0207676_10019980
1466 Ga0207676_10820288
1467 Ga0207674_10070740
1468 Ga0207674_10135299
1469 Ga0207674_10291894
1470 Ga0207675_100089500
1471 Ga0207683_10000210
1472 Ga0207683_10000480
1473 Ga0207683_10001479
1474 Ga0207683_10009436
1475 Ga0207683_10062449
1476 Ga0207683_10270802
1477 Ga0207698_10027778
1478 Ga0207698_11620535
1479 Ga0207428_10760941
1480 Ga0268266_10005275
1481 Ga0268266_10028221
1482 Ga0268266_10045267
1483 Ga0268266_10287372
1484 Ga0268266_10434179
1485 Ga0268266_10467240
1486 Ga0268265_10202704
1487 Ga0268265_10356902
1488 Ga0268264_10016111
1489 Ga0268264_10665660
1490 Ga0265332_10239652
1491 Ga0265339_10111078
1492 Ga0307513_10296736
1493 Ga0307509_10130561
1494 Ga0265313_10015163
1495 Ga0373950_0014700
1496 Ga0373938_0014105
1497 Ga0373938_0063768
1498 Ga0373926_0044929
1499 Ga0373926_0053387
1500 Ga0373934_0014177
1501 Ga0373944_0003706
1502 Ga0373944_0022547
1503 Ga0373949_0053951
1504 Ga0373952_0015400
1505 Ga0373923_0004472
1506 Ga0373936_0088302
1507 Ga0373936_0154046
1508 Ga0373939_0157285
1509 Ga0373941_0044152
1510 Ga0373945_0014083
1511 Ga0373953_0005116
1512 Ga0373954_0005514
1513 Ga0373957_0001985
1514 Ga0373960_0011455
1515 Ga0373960_0180484
1516 Ga0373943_0016010
1517 Ga0373943_0016358
1518 Ga0373943_0118281
1519 Ga0373946_0010307
1520 Ga0373946_0064686
1521 Ga0373961_0041732
1522 Ga0373962_0043302
1523 Ga0373924_0061551
1524 Ga0373931_0045589
1525 Ga0373931_0055066
1526 Ga0373931_0060654
1527 Ga0373931_0219834
1528 Ga0373931_0371679
1529 Ga0373935_0001749
1530 Ga0373935_0050340
1531 Ga0373935_0154447
1532 Ga0373935_0689937
1533 Ga0373927_0049597
1534 Ga0373927_0114758
1535 Ga0373933_0009136
1536 Ga0373933_0055799
1537 Ga0373933_0186062
1538 Ga0373947_0001187
1539 Ga0373947_0055216
1540 Ga0373947_0088994
1541 Ga0373947_0218404
1542 Ga0373947_0328429
1543 Ga0373937_0027974
1544 Ga0373925_0004244
1545 Ga0373925_0031296
1546 Ga0373925_0098000
1547 Ga0373925_0280237
1548 Ga0373925_0407901
1549 Ga0373925_0720753
1550 Ga0395899_0226593
1551 Ga0395898_0584294
1552 Ga0436364_0355624
1553 Ga0436364_0518470
1554 Ga0436364_1028562
1555 Ga0395901_0387110
1556 Ga0395901_0718909
1557 Ga0436365_0149298
1558 Ga0436365_0197847
1559 Ga0436365_0824382
1560 Ga0436365_0935211
1561 Ga0436365_1674695
1562 Ga0436365_1830793
1563 Ga0436365_1847958
1564 Ga0436360_0240872
1565 Ga0436360_0439418
1566 Ga0436360_0499041
1567 Ga0436363_1542522
1568 Ga0436362_0355831
1569 Ga0436362_0450274
1570 Ga0451853_0763982
1571 Ga0466964_0323269
1572 Ga0466957_0106069
1573 Ga0466967_0148355
1574 Ga0495592_0010242
1575 Ga0495603_0019912
1576 Ga0495603_0061344
1577 Ga0495603_0092761
1578 Ga0495603_0360030
1579 Ga0495629_0000968
1580 Ga0495629_0002739
1581 Ga0495629_0170466
1582 Ga0495629_0194292
1583 Ga0495629_0237156
1584 Ga0495641_0017865
1585 Ga0495641_0067514
1586 Ga0495651_0002173
1587 Ga0495580_0169764
1588 Ga0495580_0207559
1589 Ga0495582_0002401
1590 Ga0495582_0125756
1591 Ga0495639_0010527
1592 Ga0495662_0033198
1593 Ga0495664_0048328
1594 Ga0495664_0050516
1595 Ga0495584_0116793
1596 Ga0495608_0009348
1597 Ga0495618_0137727
1598 Ga0495618_0172602
1599 Ga0495628_0019118
1600 Ga0495630_0103761
1601 Ga0495666_0069639
1602 Ga0495652_0040582
1603 Ga0495652_0204387
1604 Ga0495665_0047177
1605 Ga0495640_0029383
1606 Ga0495640_0039156
1607 Ga0495586_0058031
1608 Ga0495586_0059730
1609 Ga0495586_0234475
1610 Ga0495587_0008084
1611 Ga0495621_0102654
1612 Ga0495645_0015451
1613 Ga0495622_0112543
1614 Ga0495667_0000293
1615 Ga0495634_0041569
1616 Ga0495634_0116882
1617 Ga0495635_0067993
1618 Ga0495635_0248520
1619 Ga0495588_0023331
1620 Ga0495657_0009103
1621 Ga0495599_0006529
1622 Ga0495623_0000668
1623 Ga0495646_0022084
1624 Ga0495647_0061937
1625 Ga0495658_0016691
1626 Ga0495658_0018823
1627 Ga0495658_0028467
1628 Ga0495613_0004415
1629 Ga0495613_0129516
1630 Ga0495624_0059043
1631 Ga0495624_0115959
1632 Ga0495600_0004765
1633 Ga0495581_0010403
1634 Ga0495581_0056406
1635 Ga0495581_0159070
1636 Ga0495604_0005199
1637 Ga0495674_0009612
1638 Ga0495674_0311394
1639 Ga0495676_0038286
1640 Ga0495680_0003160
1641 Ga0495680_0013735
1642 Ga0495680_0072609
1643 Ga0495680_0273544
1644 Ga0495675_0002509
1645 Ga0495684_0037697
1646 Ga0495684_0240931
1647 Ga0495684_0258369
1648 Ga0495593_0063278
1649 Ga0495602_0020889
1650 Ga0495614_0327169
1651 Ga0496100_0000750
1652 Ga0496100_0017698
1653 Ga0496100_0355975
1654 Ga0496101_0001812
1655 Ga0496101_0002124
1656 Ga0496102_0004194
1657 Ga0496102_0217808
1658 Ga0496102_0545231
1659 Ga0496102_0604557
1660 Ga0496103_0018426
1661 Ga0496103_0332495
1662 Ga0496103_0374971
1663 Ga0496104_0029377
1664 Ga0496104_0035486
1665 Ga0496104_0059292
1666 Ga0496104_0061938
1667 Ga0496104_0065245
1668 Ga0496104_0090101
1669 Ga0496104_0092744
1670 Ga0496104_0607820
1671 Ga0496104_0914367
1672 Ga0496105_0020983
1673 Ga0496105_0032117
1674 Ga0496105_0063766
1675 Ga0496105_0126202
1676 Ga0496106_0006214
1677 Ga0496106_0051165
1678 Ga0496106_0072695
1679 Ga0496106_0125465
1680 Ga0496106_0257141
1681 Ga0496107_0001758
1682 Ga0496107_0018485
1683 Ga0496107_0029092
1684 Ga0496107_0031019
1685 Ga0496107_0289079
1686 Ga0496108_0004140
1687 Ga0496108_0075310
1688 Ga0496108_0127310
1689 Ga0496108_0210282
1690 Ga0496109_0011017
1691 Ga0496109_0043248
1692 Ga0496109_0053904
1693 Ga0496109_0057152
1694 Ga0496109_0067238
1695 Ga0496109_0087812
1696 Ga0496109_1083213
1697 Ga0496110_0006110
1698 Ga0496110_0029921
1699 Ga0496110_0098292
1700 Ga0496110_0161538
1701 Ga0496110_0237197
1702 Ga0496111_0003203
1703 Ga0496111_0005507
1704 Ga0496111_0008722
1705 Ga0496111_0288518
1706 Ga0496112_0020496
1707 Ga0496112_0022976
1708 Ga0496112_0048980
1709 Ga0496112_0132298
1710 Ga0496112_0143502
1711 Ga0496112_0308903
1712 Ga0496112_1068710
1713 Ga0496113_0011380
1714 Ga0496113_0016379
1715 Ga0496113_0020122
1716 Ga0496113_0081844
1717 Ga0496113_0216394
1718 Ga0496114_0002778
1719 Ga0496114_0015488
1720 Ga0496114_0211590
1721 Ga0496114_0356194
1722 Ga0496115_0007409
1723 Ga0496115_0025791
1724 Ga0496115_0042324
1725 Ga0496115_0105287
1726 Ga0496115_0259452
1727 Ga0496115_0579949
1728 Ga0496124_0297108
1729 Ga0501034_0193514
1730 nmdc:mga03683_1814_c1
1731 nmdc:mga0yw44_210807_c2
1732 nmdc:mga0k408_657126_c1
1733 nmdc:mga07m45_13018_c1
1734 nmdc:mga08y16_1274714_c1
1735 nmdc:mga0n895_1498942_c1
1736 nmdc:mga0n895_340577_c1
1737 nmdc:mga0n895_340581_c1
1738 nmdc:mga0n895_840153_c1
1739 nmdc:mga0rr50_398764_c1
1740 nmdc:mga0rr50_709556_c1
1741 nmdc:mga08x19_143908_c1
1742 nmdc:mga08x19_601871_c1
1743 nmdc:mga0sz30_14243_c1
1744 Ga0495601_0001091
1745 Ga0495601_0259441
1746 Ga0495612_0008078
1747 Ga0495612_0073496
1748 Ga0495612_0130860
1749 Ga0495612_0265321
1750 Ga0495595_0001076
1751 Ga0495619_0000324
1752 Ga0495619_0002201
1753 Ga0495619_0007062
1754 Ga0495619_0132260
1755 Ga0500643_110651
1756 Ga0500647_0128028
1757 Ga0500650_0346865
1758 Ga0500642_0024659
1759 Ga0500559_0138601
1760 Ga0500616_0001916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

75

204

0.97

PF19609

DUF6114

Family of unknown function (DUF6114)

15

88

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8053 16 168
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.796 16 168
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.79 17 168
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6412 17 168
8u4v-assembly1.cif.gz_A cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody 0.4955 54 162
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8586 39 166 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.835 39 166 1.20.120.550
af_I1JXM9_128_228_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6431 59 177 1.20.1280.290
af_I1JXM9_128_228_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6048 59 177 1.20.1280.290
af_O13657_599_717_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.6042 63 163 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A536V873-F1-model_v4 TRAP transporter small permease protein 0.933 1 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A2V7ADU2-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.928 4 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A847PBP4-F1-model_v4 TRAP transporter small permease 0.9266 18 167 GO:0005886
GO:0015740
GO:0022857
AF-A0A537NAW7-F1-model_v4 TRAP transporter small permease protein 0.9254 1 175 GO:0005886
GO:0015740
GO:0022857
AF-V8QV81-F1-model_v4 TRAP transporter small permease protein 0.9238 23 167 GO:0005886
GO:0015740
GO:0022857

Map