metagRoot

F484475

General Info

Members	Datasets	Scaffolds	Average Seq Length
880	552	605	164

Family's Representative Sequence

Representative Sequence	3300001979\|JGI24740J21852_10007862\|JGI24740J21852_100078622
Length	176
Sequence	MRIIFPGARADMISRDDFVGRFGGVFEHSPFVAERAYDAGAIVAPLTSGGVHAALVRAFRAASEAERLGVLRAHPDLAGRLAIAGQLTEDSRKEQAGAGLDRLSPEEHARFTELNAAYVTKFGFPFIIAVKGLGKDDILAAFETRVDNSRDAEFATAAAQVEKIALLRLQSLLPDA

Samples

	Sample ID	Description	Type	Environment
1	2509276019	Ensifer aridi TW10	Isolate	Nodule
2	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
3	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
4	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
5	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
6	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
7	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
8	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
9	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
10	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
11	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
12	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
13	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
14	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
15	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
16	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
17	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
18	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
19	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
20	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
21	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
22	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
23	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
24	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
25	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
26	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
27	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
28	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
29	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
30	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
31	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
32	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
33	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
34	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
35	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
36	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
37	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
38	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
39	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
40	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
41	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
42	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
43	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
44	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
45	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
46	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
47	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
48	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
49	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
50	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
51	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
52	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
53	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
54	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
55	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
56	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
57	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
58	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
59	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
60	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
61	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
62	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
63	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
64	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
65	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
66	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
67	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
68	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
69	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
70	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
71	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
72	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
73	2718217882	Rhizobium sp. N741	Isolate	Nodule
74	2718217927	Rhizobium sp. N324	Isolate	Nodule
75	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
76	2718218009	Rhizobium sp. N561	Isolate	Nodule
77	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
78	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
79	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
80	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
81	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
82	2718218363	Rhizobium sp. N113	Isolate	Nodule
83	2718218365	Rhizobium sp. N731	Isolate	Nodule
84	2718218366	Rhizobium sp. N621	Isolate	Nodule
85	2718218423	Rhizobium sp. N941	Isolate	Nodule
86	2721755514	Rhizobium sp. N6212	Isolate	Nodule
87	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
88	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
89	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
90	2721755809	Rhizobium sp. N541	Isolate	Nodule
91	2721755810	Rhizobium sp. N871	Isolate	Nodule
92	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
93	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
94	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
95	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
96	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
97	2728369365	Rhizobium sp. N1341	Isolate	Nodule
98	2728369397	Rhizobium sp. N1314	Isolate	Nodule
99	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
100	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
101	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
102	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
103	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
104	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
105	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
106	2791355260	Rhizobium sp. L9	Isolate	Nodule
107	2791355261	Rhizobium sp. J15	Isolate	Nodule
108	2791355263	Rhizobium chutanense C5	Isolate	Nodule
109	2791355266	Rhizobium sp. L43	Isolate	Nodule
110	2791355267	Rhizobium sp. L18	Isolate	Nodule
111	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
112	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
113	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
114	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
115	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
116	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
117	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
118	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
119	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
120	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
121	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
122	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
123	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
124	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
125	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
126	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
127	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
128	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
129	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
130	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
131	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
132	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
133	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
134	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
135	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
136	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
137	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
138	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
139	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
140	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
141	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
142	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
143	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
144	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
145	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
146	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
147	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
148	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
149	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
150	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
151	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
152	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
153	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
154	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
155	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
156	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
157	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
158	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
159	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
160	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
161	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
162	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
163	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
164	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
165	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
166	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
167	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
168	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
169	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
170	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
171	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
172	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
173	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
174	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
175	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
176	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
177	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
178	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
179	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
180	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
181	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
182	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
183	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
184	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
185	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
186	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
187	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
188	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
189	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
190	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
191	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
192	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
193	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
194	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
195	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
196	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
197	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
198	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
199	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
200	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
201	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
202	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
203	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
204	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
205	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
206	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
207	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
208	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
209	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
210	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
211	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
212	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
213	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
214	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
215	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
216	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
217	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
218	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
219	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
220	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
221	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
222	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
223	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
224	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
225	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
226	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
227	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
228	2996887358	Rhizobium sp. R711	Isolate	Nodule
229	2996893221	Rhizobium sp. R635	Isolate	Nodule
230	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
231	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
232	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
233	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
234	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
235	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
236	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
237	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
238	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
239	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
240	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
241	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
242	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
243	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
244	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
245	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
246	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
247	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
248	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
249	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
250	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
251	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
252	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
253	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
254	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
255	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
256	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
257	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
258	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
259	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
260	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
261	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
262	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
263	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
264	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
265	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
266	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
267	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
268	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
269	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
270	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
271	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
272	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
273	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
274	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
275	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
276	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
277	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
278	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
279	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
280	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
281	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
282	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
283	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
284	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
285	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
286	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
287	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
288	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
289	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
290	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
291	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
292	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
293	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
294	3300009763	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix	Metagenome	Nodule
295	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
296	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
297	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
298	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
299	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
300	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
301	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
302	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
303	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
304	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
305	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
306	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
307	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
309	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
310	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
311	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
312	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
313	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
314	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
316	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
317	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
321	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
324	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
325	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
327	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
330	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
348	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
350	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
351	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
353	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
354	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
355	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
356	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
357	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
358	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
359	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
360	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
361	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
362	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
363	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
364	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
365	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
366	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
367	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
368	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
369	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
370	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
371	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
372	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
373	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
374	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
375	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
376	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
377	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
378	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
379	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
380	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
381	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
382	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
383	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
384	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
385	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
386	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
387	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
388	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
389	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
390	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
391	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
392	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
393	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
394	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
395	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
396	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
397	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
398	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
399	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
400	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
401	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
402	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
403	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
404	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
405	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
406	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
407	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
408	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
409	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
410	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
411	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
412	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
413	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
414	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
415	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
416	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
417	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
418	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
419	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
420	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
421	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
422	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
423	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
424	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
425	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
426	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
427	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
428	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
429	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
430	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
431	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
432	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
433	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
434	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
435	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
436	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
437	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
438	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
439	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
440	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
441	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
442	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
443	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
444	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
445	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
446	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
447	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
448	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
449	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
450	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
451	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
452	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
453	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
454	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
455	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
456	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
457	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
458	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
459	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
460	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
461	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
462	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
463	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
464	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
465	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
466	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
467	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
468	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
469	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
470	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
471	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
472	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
473	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
474	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
475	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
476	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
477	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
478	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
479	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
480	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
481	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
482	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
483	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
484	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
485	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
486	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
487	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
488	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
489	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
490	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
491	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
492	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
493	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
494	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
495	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
496	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
497	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
498	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
499	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
500	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
501	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
502	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
503	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
504	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
505	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
506	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
507	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
508	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
509	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
510	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
511	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
512	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
513	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
514	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
515	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
516	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
517	8005258706	Rhizobium sp. R693	Isolate	Nodule
518	8005275841	Rhizobium sp. N4311	Isolate	Nodule
519	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
520	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
521	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
522	8005321885	Rhizobium sp. R72	Isolate	Nodule
523	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
524	8005382845	Rhizobium sp. R634	Isolate	Nodule
525	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
526	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
527	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
528	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
529	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
530	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
531	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
532	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
533	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
534	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
535	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
536	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
537	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
538	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
539	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
540	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
541	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
542	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
543	8018176218	Rhizobium sp. N122	Isolate	Nodule
544	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
545	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
546	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
547	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
548	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
549	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
550	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
551	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
552	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	68.75
Metatranscriptomes	0
Isolates	31.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0.45
Bulb	0
Endosphere	24.77
Nodule	20.68
Rhizoplane	3.18
Rhizosphere	27.84
Stem	0
Stem Tuber	0
Unclassified	23.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10007862	3300001979	Bacteria	4302
2	JGI25155J39150_1000014	3300002704	Bacteria	196159
3	JGI25156J39149_1000083	3300002705	Bacteria	70138
4	JGI25162J39368_1000217	3300002737	Bacteria	59945
5	JGI25162J39368_1000272	3300002737	Bacteria	49890
6	JGI25162J39368_1000416	3300002737	Bacteria	34791
7	JGI25154J39366_1000052	3300002738	Bacteria	120209
8	JGI25157J39369_1000110	3300002741	Bacteria	69643
9	JGI25152J39213_1001348	3300002773	Bacteria	10778
10	JGI25152J39213_1002158	3300002773	Bacteria	7716
11	JGI25152J39213_1002644	3300002773	Bacteria	6642
12	JGI25152J39213_1004295	3300002773	Bacteria	4541
13	JGI25152J39213_1004334	3300002773	Bacteria	4506
14	JGI25152J39213_1021598	3300002773	Bacteria	1126
15	JGI25150J39212_1000100	3300002774	Bacteria	49138
16	JGI25150J39212_1002765	3300002774	Bacteria	4262
17	JGI25150J39212_1003426	3300002774	Bacteria	3708
18	JGI25159J45721_1000832	3300002987	Bacteria	13465
19	JGI25159J45721_1002615	3300002987	Bacteria	6738
20	JGI25151J46595_10000146	3300003187	Bacteria	93373
21	JGI25151J46595_10002021	3300003187	Bacteria	12689
22	JGI25151J46595_10003013	3300003187	Bacteria	9572
23	JGI25151J46595_10007505	3300003187	Bacteria	5334
24	JGI25151J46595_10043085	3300003187	Bacteria	1619
25	JGI25151J46595_10066878	3300003187	Bacteria	1110
26	JGI25165J46597_1000363	3300003214	Bacteria	50542
27	JGI25165J46597_1000767	3300003214	Bacteria	24591
28	JGI25165J46597_1005503	3300003214	Bacteria	2428
29	JGI25153J46596_10000764	3300003215	Bacteria	19680
30	JGI25153J46596_10002359	3300003215	Bacteria	10937
31	JGI25153J46596_10009056	3300003215	Bacteria	4677
32	JGI25153J46596_10009420	3300003215	Bacteria	4541
33	JGI25153J46596_10009505	3300003215	Bacteria	4506
34	JGI25153J46596_10052409	3300003215	Bacteria	1161
35	rootH1_10095586	3300003316	Bacteria	1605
36	rootL2_10044385	3300003322	Bacteria	6042
37	rootH1_10047163	3300003323	Bacteria	1504
38	JGI25160J50197_1000001	3300003354	Bacteria	782301
39	JGI25160J50197_1000351	3300003354	Bacteria	30617
40	JGI25160J50197_1013610	3300003354	Bacteria	2764
41	JGI25161J50226_1000001	3300003374	Bacteria	655036
42	JGI25161J50226_1000167	3300003374	Bacteria	45203
43	JGI25161J50226_1014399	3300003374	Bacteria	887
44	Ga0055526_1000842	3300003771	Bacteria	22899
45	Ga0055526_1003643	3300003771	Bacteria	9648
46	Ga0055526_1004423	3300003771	Bacteria	8446
47	Ga0055526_1018827	3300003771	Bacteria	2552
48	Ga0055524_1002425	3300003775	Bacteria	9616
49	Ga0055524_1003892	3300003775	Bacteria	7079
50	Ga0055524_1007700	3300003775	Bacteria	4549
51	Ga0055524_1012307	3300003775	Bacteria	3289
52	Ga0055524_1013955	3300003775	Bacteria	3002
53	Ga0055536_1006441	3300003781	Bacteria	5483
54	Ga0055528_1000158	3300003790	Bacteria	56769
55	Ga0055528_1000707	3300003790	Bacteria	23679
56	Ga0055528_1000749	3300003790	Bacteria	22632
57	Ga0055528_1003189	3300003790	Bacteria	8389
58	Ga0055528_1006485	3300003790	Bacteria	5304
59	Ga0055528_1009987	3300003790	Bacteria	3910
60	Ga0055530_10021732	3300003791	Bacteria	1883
61	Ga0055540_1000518	3300003792	Bacteria	29203
62	Ga0055540_1005724	3300003792	Bacteria	5129
63	Ga0055540_1006013	3300003792	Bacteria	4916
64	Ga0055540_1034552	3300003792	Bacteria	1137
65	Ga0055531_10010704	3300003794	Bacteria	4521
66	Ga0058692_1001431	3300003856	Bacteria	8783
67	Ga0055543_1000060	3300004625	Bacteria	98330
68	Ga0055543_1000216	3300004625	Bacteria	46311
69	Ga0055543_1000699	3300004625	Bacteria	17145
70	Ga0065165_1000008	3300005262	Bacteria	334429
71	Ga0065165_1004363	3300005262	Bacteria	8852
72	Ga0065165_1064875	3300005262	Bacteria	988
73	Ga0065165_1067950	3300005262	Bacteria	955
74	Ga0065704_10475575	3300005289	Bacteria	673
75	Ga0070666_10099735	3300005335	Bacteria	2000
76	Ga0070668_100017103	3300005347	Bacteria	5428
77	Ga0070668_101579046	3300005347	Bacteria	601
78	Ga0070669_100135042	3300005353	Bacteria	1897
79	Ga0070671_100033648	3300005355	Bacteria	4241
80	Ga0070663_100013668	3300005455	Bacteria	5186
81	Ga0070665_100007074	3300005548	Bacteria	11401
82	Ga0068855_100081851	3300005563	Bacteria	3742
83	Ga0068854_100040374	3300005578	Bacteria	3292
84	Ga0068854_100410685	3300005578	Bacteria	1122
85	Ga0068856_100190581	3300005614	Bacteria	2064
86	Ga0068861_100942699	3300005719	Bacteria	820
87	Ga0068851_10166693	3300005834	Bacteria	1213
88	Ga0068863_101719947	3300005841	Bacteria	637
89	Ga0075365_10007766	3300006038	Bacteria	6041
90	Ga0075365_10010140	3300006038	Bacteria	5469
91	Ga0075365_10095352	3300006038	Bacteria	2032
92	Ga0075368_10005974	3300006042	Bacteria	4220
93	Ga0075368_10317028	3300006042	Bacteria	675
94	Ga0075363_100015703	3300006048	Bacteria	3727
95	Ga0075363_100019422	3300006048	Bacteria	3398
96	Ga0075363_100055338	3300006048	Bacteria	2125
97	Ga0075364_10015660	3300006051	Bacteria	4706
98	Ga0075364_10349320	3300006051	Bacteria	1008
99	Ga0075364_11049827	3300006051	Bacteria	554
100	Ga0075362_10075178	3300006177	Bacteria	1549
101	Ga0075367_10000779	3300006178	Bacteria	12517
102	Ga0075367_10011013	3300006178	Bacteria	4769
103	Ga0075367_10102795	3300006178	Bacteria	1748
104	Ga0075369_10003894	3300006186	Bacteria	5473
105	Ga0075369_10013982	3300006186	Bacteria	3198
106	Ga0075369_10021466	3300006186	Bacteria	2655
107	Ga0075366_10003058	3300006195	Bacteria	8734
108	Ga0075370_10002851	3300006353	Bacteria	8118
109	Ga0075370_10003951	3300006353	Bacteria	7122
110	Ga0075370_10042620	3300006353	Bacteria	2564
111	Ga0075370_10479373	3300006353	Bacteria	750
112	Ga0079104_1000015	3300006946	Bacteria	321803
113	Ga0099826_10000102	3300006948	Bacteria	40381
114	Ga0099826_10018575	3300006948	Bacteria	5245
115	Ga0105251_10010023	3300009011	Bacteria	5538
116	Ga0105244_10097209	3300009036	Bacteria	1443
117	Ga0105244_10280460	3300009036	Bacteria	773
118	Ga0105250_10067011	3300009092	Bacteria	1448
119	Ga0105240_10000014	3300009093	Bacteria	482033
120	Ga0105243_10006869	3300009148	Bacteria	8774
121	Ga0105243_10111991	3300009148	Bacteria	2285
122	Ga0105248_10153015	3300009177	Bacteria	2602
123	Ga0105237_10002158	3300009545	Bacteria	24754
124	Ga0105249_10082826	3300009553	Bacteria	2985
125	Ga0123340_1049595	3300009763	Bacteria	1572
126	Ga0123341_1000035	3300009765	Bacteria	62072
127	Ga0123341_1061365	3300009765	Bacteria	1838
128	Ga0123341_1061371	3300009765	Bacteria	1838
129	Ga0123342_1009440	3300009766	Bacteria	11684
130	Ga0123342_1011443	3300009766	Bacteria	9682
131	Ga0157373_10055636	3300013100	Bacteria	2810
132	Ga0157373_10227511	3300013100	Bacteria	1316
133	Ga0157371_10000017	3300013102	Bacteria	320830
134	Ga0157370_10000329	3300013104	Bacteria	59662
135	Ga0157370_10001031	3300013104	Bacteria	35059
136	Ga0157369_10024034	3300013105	Bacteria	6781
137	Ga0157369_10522116	3300013105	Bacteria	1228
138	Ga0157369_10661880	3300013105	Bacteria	1076
139	Ga0182008_10047466	3300014497	Bacteria	2133
140	Ga0182008_10303399	3300014497	Bacteria	836
141	Ga0182007_10003468	3300015262	Bacteria	7427
142	Ga0182005_1000982	3300015265	Bacteria	12354
143	Ga0214542_1000268	3300021321	Bacteria	87082
144	Ga0214543_1000022	3300021327	Bacteria	241930
145	Ga0214543_1000219	3300021327	Bacteria	87102
146	Ga0209435_100027	3300025206	Bacteria	196217
147	Ga0209760_107985	3300025207	Bacteria	786
148	Ga0209436_100081	3300025208	Bacteria	48215
149	Ga0209437_100051	3300025233	Bacteria	392523
150	Ga0209437_100060	3300025233	Bacteria	355034
151	Ga0207425_1000046	3300025245	Bacteria	189433
152	Ga0207425_1002771	3300025245	Bacteria	5954
153	Ga0207425_1004453	3300025245	Bacteria	4198
154	Ga0207425_1005031	3300025245	Bacteria	3841
155	Ga0207425_1020267	3300025245	Bacteria	1423
156	Ga0209646_1000086	3300025246	Bacteria	196217
157	Ga0209026_1000082	3300025250	Bacteria	196315
158	Ga0209677_100540	3300025253	Bacteria	21044
159	Ga0209148_1022470	3300025254	Bacteria	1013
160	Ga0209759_1000063	3300025256	Bacteria	196315
161	Ga0209129_1000171	3300025258	Bacteria	95724
162	Ga0209129_1000283	3300025258	Bacteria	48305
163	Ga0209129_1000450	3300025258	Bacteria	30620
164	Ga0209129_1001443	3300025258	Bacteria	13284
165	Ga0209129_1001916	3300025258	Bacteria	10956
166	Ga0209129_1004411	3300025258	Bacteria	5500
167	Ga0209129_1005600	3300025258	Bacteria	4373
168	Ga0209233_1000095	3300025261	Bacteria	303783
169	Ga0209233_1000190	3300025261	Bacteria	130713
170	Ga0209233_1000228	3300025261	Bacteria	100100
171	Ga0209673_1000010	3300025273	Bacteria	596656
172	Ga0209673_1000025	3300025273	Bacteria	404572
173	Ga0209673_1000112	3300025273	Bacteria	179676
174	Ga0209673_1000637	3300025273	Bacteria	53013
175	Ga0209673_1004043	3300025273	Bacteria	8113
176	Ga0209130_1000003	3300025284	Bacteria	677988
177	Ga0209130_1000023	3300025284	Bacteria	359355
178	Ga0209130_1010464	3300025284	Bacteria	2552
179	Ga0209675_1034800	3300025291	Bacteria	1155
180	Ga0209676_1002751	3300025292	Bacteria	11779
181	Ga0209025_1000091	3300025294	Bacteria	250401
182	Ga0209025_1000137	3300025294	Bacteria	190136
183	Ga0209025_1000152	3300025294	Bacteria	171558
184	Ga0209025_1000154	3300025294	Bacteria	170288
185	Ga0209025_1000545	3300025294	Bacteria	70608
186	Ga0209025_1001424	3300025294	Bacteria	31618
187	Ga0209025_1005945	3300025294	Bacteria	9717
188	Ga0209025_1006114	3300025294	Bacteria	9496
189	Ga0209025_1011337	3300025294	Bacteria	5889
190	Ga0209025_1022784	3300025294	Bacteria	3305
191	Ga0209025_1047100	3300025294	Bacteria	1765
192	Ga0209564_1000564	3300025295	Bacteria	58801
193	Ga0209564_1000672	3300025295	Bacteria	50497
194	Ga0209564_1001566	3300025295	Bacteria	22444
195	Ga0209564_1003798	3300025295	Bacteria	9803
196	Ga0209564_1012665	3300025295	Bacteria	3654
197	Ga0209758_1000058	3300025297	Bacteria	331603
198	Ga0209758_1000123	3300025297	Bacteria	190136
199	Ga0209758_1000725	3300025297	Bacteria	48331
200	Ga0209758_1000863	3300025297	Bacteria	41967
201	Ga0209758_1001901	3300025297	Bacteria	22797
202	Ga0209758_1001960	3300025297	Bacteria	22253
203	Ga0209758_1006925	3300025297	Bacteria	7909
204	Ga0209758_1008712	3300025297	Bacteria	6487
205	Ga0209050_1002725	3300025298	Bacteria	14282
206	Ga0209050_1016627	3300025298	Bacteria	2994
207	Ga0209256_1000914	3300025299	Bacteria	36121
208	Ga0209256_1001132	3300025299	Bacteria	30392
209	Ga0209256_1001499	3300025299	Bacteria	23682
210	Ga0209256_1003097	3300025299	Bacteria	12188
211	Ga0209256_1007950	3300025299	Bacteria	5056
212	Ga0207426_1000008	3300025302	Bacteria	848730
213	Ga0207426_1000011	3300025302	Bacteria	791203
214	Ga0207426_1000228	3300025302	Bacteria	129261
215	Ga0207426_1006647	3300025302	Bacteria	4975
216	Ga0209051_1000462	3300025303	Bacteria	53349
217	Ga0209051_1000785	3300025303	Bacteria	33541
218	Ga0209051_1001635	3300025303	Bacteria	18178
219	Ga0209051_1007538	3300025303	Bacteria	5929
220	Ga0209051_1015498	3300025303	Bacteria	3502
221	Ga0209257_1003221	3300025304	Bacteria	14390
222	Ga0209257_1005494	3300025304	Bacteria	8860
223	Ga0209257_1036976	3300025304	Bacteria	1493
224	Ga0209257_1037140	3300025304	Bacteria	1488
225	Ga0207713_1041996	3300025735	Bacteria	1902
226	Ga0207680_10183137	3300025903	Bacteria	1418
227	Ga0207695_10000037	3300025913	Bacteria	476303
228	Ga0207671_10001228	3300025914	Bacteria	30331
229	Ga0207681_10127084	3300025923	Bacteria	1879
230	Ga0207650_10001248	3300025925	Bacteria	18474
231	Ga0207644_10058528	3300025931	Bacteria	2785
232	Ga0207706_10295850	3300025933	Bacteria	1411
233	Ga0207709_10199828	3300025935	Bacteria	1427
234	Ga0207711_10061404	3300025941	Bacteria	3240
235	Ga0207712_10070189	3300025961	Bacteria	2516
236	Ga0207658_10318477	3300025986	Bacteria	1346
237	Ga0207639_10735315	3300026041	Bacteria	917
238	Ga0207678_10025462	3300026067	Bacteria	5164
239	Ga0207702_10034211	3300026078	Bacteria	4248
240	Ga0207702_10184423	3300026078	Bacteria	1924
241	Ga0207641_11160395	3300026088	Bacteria	772
242	Ga0207675_101047242	3300026118	Bacteria	835
243	Ga0209281_1000034	3300027111	Bacteria	382562
244	Ga0209371_1000022	3300027312	Bacteria	536342
245	Ga0209371_1000341	3300027312	Bacteria	50975
246	Ga0209371_1003792	3300027312	Bacteria	7034
247	Ga0209282_1002798	3300027666	Bacteria	10209
248	Ga0209282_1017894	3300027666	Bacteria	4503
249	Ga0209813_10004580	3300027866	Bacteria	3310
250	Ga0209813_10184410	3300027866	Bacteria	765
251	Ga0268266_10005469	3300028379	Bacteria	11831
252	Ga0268266_10113508	3300028379	Bacteria	2403
253	Ga0307515_10000017	3300028794	Bacteria	550465
254	Ga0307515_10029550	3300028794	Bacteria	9255
255	Ga0268256_1000019	3300030500	Bacteria	587949
256	Ga0268256_1001403	3300030500	Bacteria	14620
257	Ga0268256_1004051	3300030500	Bacteria	6289
258	Ga0268256_1043464	3300030500	Bacteria	991
259	Ga0316181_1107412	3300030744	Bacteria	2647
260	Ga0316182_1174290	3300030745	Bacteria	741
261	Ga0307513_10001095	3300031456	Bacteria	39184
262	Ga0307513_10009210	3300031456	Bacteria	12501
263	Ga0307408_100836973	3300031548	Bacteria	838
264	Ga0307405_10017156	3300031731	Bacteria	3966
265	Ga0307412_10004052	3300031911	Bacteria	8165
266	Ga0307412_10703297	3300031911	Bacteria	868
267	Ga0307510_10526875	3300033180	Bacteria	626
268	Ga0373927_0000419	3300035695	Bacteria	32608
269	Ga0439436_0010510	3300041404	Bacteria	2821
270	Ga0439466_0025917	3300041411	Bacteria	2043
271	Ga0439465_0050912	3300041413	Bacteria	1356
272	Ga0439465_0076364	3300041413	Bacteria	1129
273	Ga0451795_0647420	3300041456	Bacteria	1159
274	Ga0451807_1773350	3300041486	Bacteria	1113
275	Ga0451833_0575078	3300041491	Bacteria	1063
276	Ga0451835_0487282	3300041492	Bacteria	892
277	Ga0451837_0448786	3300041494	Bacteria	920
278	Ga0451839_0351025	3300041496	Bacteria	1236
279	Ga0451841_0429116	3300041498	Bacteria	2017
280	Ga0451845_0704804	3300041501	Bacteria	1275
281	Ga0451847_0545907	3300041503	Bacteria	1063
282	Ga0451847_0607285	3300041503	Bacteria	2584
283	Ga0451849_0971194	3300041505	Bacteria	1109
284	Ga0451851_0559086	3300041507	Bacteria	1338
285	Ga0451855_0815820	3300041511	Bacteria	4040
286	Ga0451855_1183387	3300041511	Bacteria	743
287	Ga0439432_026777	3300042006	Bacteria	1887
288	Ga0439449_0080579	3300042007	Bacteria	1200
289	Ga0439462_0021294	3300042015	Bacteria	1693
290	Ga0450909_006211	3300042185	Bacteria	1724
291	Ga0450918_012682	3300042531	Bacteria	1468
292	Ga0466982_0343227	3300044672	Bacteria	832
293	Ga0466966_0074592	3300044684	Bacteria	2120
294	Ga0466963_0018270	3300044694	Bacteria	4380
295	Ga0466964_0101026	3300044706	Bacteria	1272
296	Ga0466970_0000872	3300044765	Bacteria	14575
297	Ga0466957_0176279	3300044842	Bacteria	1394
298	Ga0466967_0060709	3300045976	Bacteria	3352
299	Ga0466967_0099658	3300045976	Bacteria	2654
300	Ga0495617_117724	3300046452	Bacteria	857
301	Ga0495617_145929	3300046452	Bacteria	754
302	Ga0495627_101476	3300046453	Bacteria	821
303	Ga0495592_0042081	3300046454	Bacteria	3422
304	Ga0495590_0321806	3300046457	Bacteria	584
305	Ga0495638_0000953	3300046460	Bacteria	29358
306	Ga0495651_0022780	3300046462	Bacteria	4870
307	Ga0495650_0086473	3300046471	Bacteria	1200
308	Ga0495605_0001474	3300046474	Bacteria	15363
309	Ga0495605_0097803	3300046474	Bacteria	1352
310	Ga0495662_0003309	3300046476	Bacteria	8162
311	Ga0495585_0011346	3300046492	Bacteria	5275
312	Ga0495585_0025457	3300046492	Bacteria	3388
313	Ga0495585_0071440	3300046492	Bacteria	1892
314	Ga0495585_0106941	3300046492	Bacteria	1491
315	Ga0495596_0122860	3300046500	Bacteria	1008
316	Ga0495607_0025745	3300046501	Bacteria	3657
317	Ga0495583_0003748	3300046506	Bacteria	11302
318	Ga0495583_0012759	3300046506	Bacteria	4732
319	Ga0495583_0103731	3300046506	Bacteria	1211
320	Ga0495606_0002168	3300046507	Bacteria	23621
321	Ga0495606_0110593	3300046507	Bacteria	1658
322	Ga0495610_0012771	3300046512	Bacteria	5027
323	Ga0495610_0063587	3300046512	Bacteria	1747
324	Ga0495610_0297126	3300046512	Bacteria	624
325	Ga0495616_0112151	3300046513	Bacteria	1266
326	Ga0495618_0214161	3300046514	Bacteria	1217
327	Ga0495620_0013879	3300046515	Bacteria	4112
328	Ga0495620_0049847	3300046515	Bacteria	1789
329	Ga0495620_0064131	3300046515	Bacteria	1520
330	Ga0495631_0012885	3300046518	Bacteria	4071
331	Ga0495631_0081293	3300046518	Bacteria	1398
332	Ga0495632_0013526	3300046519	Bacteria	4654
333	Ga0495632_0044287	3300046519	Bacteria	2221
334	Ga0495632_0148593	3300046519	Bacteria	1084
335	Ga0495643_0088887	3300046522	Bacteria	1596
336	Ga0495643_0219943	3300046522	Bacteria	901
337	Ga0495648_0024217	3300046524	Bacteria	4140
338	Ga0495648_0297118	3300046524	Bacteria	758
339	Ga0495652_0344343	3300046529	Bacteria	1070
340	Ga0495654_0000758	3300046530	Bacteria	24982
341	Ga0495654_0053584	3300046530	Bacteria	1960
342	Ga0495640_0122447	3300046533	Bacteria	1689
343	Ga0495609_0008203	3300046538	Bacteria	5126
344	Ga0495622_0030020	3300046557	Bacteria	2540
345	Ga0495633_0021557	3300046558	Bacteria	3221
346	Ga0495633_0049675	3300046558	Bacteria	1979
347	Ga0495633_0120220	3300046558	Bacteria	1217
348	Ga0495633_0204623	3300046558	Bacteria	905
349	Ga0495656_0066770	3300046615	Bacteria	1586
350	Ga0495668_0003159	3300046616	Bacteria	12699
351	Ga0495668_0080778	3300046616	Bacteria	1784
352	Ga0495611_0111483	3300046648	Bacteria	1274
353	Ga0495625_0005331	3300046660	Bacteria	11778
354	Ga0495625_0062307	3300046660	Bacteria	2636
355	Ga0495625_0491495	3300046660	Bacteria	752
356	Ga0495635_0088343	3300046663	Bacteria	2121
357	Ga0495661_0167154	3300046665	Bacteria	1176
358	Ga0495588_0001565	3300046674	Bacteria	9801
359	Ga0495588_0149404	3300046674	Bacteria	1235
360	Ga0495657_0015576	3300046675	Bacteria	5558
361	Ga0495658_0040425	3300046683	Bacteria	2593
362	Ga0495624_0053180	3300046690	Bacteria	2557
363	Ga0495670_0003394	3300046691	Bacteria	7829
364	Ga0495670_0148823	3300046691	Bacteria	1227
365	Ga0495671_0052719	3300046692	Bacteria	2021
366	Ga0495671_0103852	3300046692	Bacteria	1388
367	Ga0495671_0306891	3300046692	Bacteria	763
368	Ga0495649_0049124	3300046694	Bacteria	2292
369	Ga0495600_0141875	3300046809	Bacteria	1558
370	Ga0495660_0032206	3300046810	Bacteria	2944
371	Ga0495660_0045004	3300046810	Bacteria	2425
372	Ga0495604_0031909	3300047317	Bacteria	4176
373	Ga0495672_0003408	3300047320	Bacteria	13639
374	Ga0495683_0129898	3300047323	Bacteria	1189
375	Ga0495681_0010603	3300047470	Bacteria	5569
376	Ga0495681_0335685	3300047470	Bacteria	578
377	Ga0495686_0007900	3300047472	Bacteria	7901
378	Ga0495686_0016439	3300047472	Bacteria	5017
379	Ga0495686_0018844	3300047472	Bacteria	4622
380	Ga0495615_0016963	3300048090	Bacteria	1579
381	Ga0495615_0029692	3300048090	Bacteria	1299
382	Ga0496101_0152268	3300048904	Bacteria	1769
383	Ga0496101_0205390	3300048904	Bacteria	1524
384	Ga0496101_0284143	3300048904	Bacteria	1294
385	Ga0496101_0734581	3300048904	Bacteria	779
386	Ga0496102_0004330	3300048905	Bacteria	12011
387	Ga0496102_0060372	3300048905	Bacteria	3467
388	Ga0496103_0036078	3300048906	Bacteria	3027
389	Ga0496103_0067827	3300048906	Bacteria	2228
390	Ga0496104_0049484	3300048907	Bacteria	3963
391	Ga0496104_0554104	3300048907	Bacteria	1060
392	Ga0496105_0029943	3300048908	Bacteria	4457
393	Ga0496106_0001496	3300048909	Bacteria	17571
394	Ga0496110_0135447	3300048913	Bacteria	2225
395	Ga0496112_0487960	3300048915	Bacteria	1168
396	Ga0496113_0029675	3300048916	Bacteria	3953
397	Ga0496113_0130856	3300048916	Bacteria	1969
398	Ga0496113_0252125	3300048916	Bacteria	1409
399	Ga0496113_0754236	3300048916	Bacteria	775
400	Ga0496114_0296181	3300048917	Bacteria	1428
401	Ga0496114_0995822	3300048917	Bacteria	721
402	Ga0496116_0010698	3300048919	Bacteria	7660
403	Ga0496116_0016794	3300048919	Bacteria	5712
404	Ga0496116_0022826	3300048919	Bacteria	4676
405	Ga0496116_0033222	3300048919	Bacteria	3663
406	Ga0496116_0081123	3300048919	Bacteria	2012
407	Ga0496116_0088663	3300048919	Bacteria	1889
408	Ga0496116_0125237	3300048919	Bacteria	1477
409	Ga0496116_0150895	3300048919	Bacteria	1291
410	Ga0496116_0162805	3300048919	Bacteria	1221
411	Ga0496116_0168676	3300048919	Bacteria	1189
412	Ga0496116_0459327	3300048919	Bacteria	542
413	Ga0496117_0000002	3300048920	Bacteria	2483758
414	Ga0496117_0002241	3300048920	Bacteria	24957
415	Ga0496117_0003292	3300048920	Bacteria	18915
416	Ga0496117_0020448	3300048920	Bacteria	5395
417	Ga0496117_0025317	3300048920	Bacteria	4668
418	Ga0496117_0026153	3300048920	Bacteria	4571
419	Ga0496117_0026472	3300048920	Bacteria	4538
420	Ga0496117_0077801	3300048920	Bacteria	2193
421	Ga0496117_0219603	3300048920	Bacteria	1059
422	Ga0496118_0000566	3300048921	Bacteria	61208
423	Ga0496118_0001388	3300048921	Bacteria	36504
424	Ga0496118_0004636	3300048921	Bacteria	16127
425	Ga0496118_0023728	3300048921	Bacteria	5316
426	Ga0496118_0027341	3300048921	Bacteria	4830
427	Ga0496118_0078264	3300048921	Bacteria	2341
428	Ga0496119_0012920	3300048922	Bacteria	6720
429	Ga0496119_0024130	3300048922	Bacteria	4288
430	Ga0496119_0041712	3300048922	Bacteria	2918
431	Ga0496119_0046892	3300048922	Bacteria	2693
432	Ga0496119_0066220	3300048922	Bacteria	2136
433	Ga0496119_0069863	3300048922	Bacteria	2062
434	Ga0496119_0090750	3300048922	Bacteria	1736
435	Ga0496119_0241108	3300048922	Bacteria	916
436	Ga0496120_0000309	3300048923	Bacteria	81375
437	Ga0496120_0024822	3300048923	Bacteria	3731
438	Ga0496120_0061705	3300048923	Bacteria	2091
439	Ga0496120_0126591	3300048923	Bacteria	1314
440	Ga0496120_0156937	3300048923	Bacteria	1138
441	Ga0496120_0163707	3300048923	Bacteria	1106
442	Ga0496120_0197631	3300048923	Bacteria	975
443	Ga0496121_0001287	3300048924	Bacteria	43216
444	Ga0496121_0002836	3300048924	Bacteria	25580
445	Ga0496121_0009257	3300048924	Bacteria	11372
446	Ga0496121_0014795	3300048924	Bacteria	8242
447	Ga0496121_0019082	3300048924	Bacteria	6878
448	Ga0496121_0020642	3300048924	Bacteria	6505
449	Ga0496121_0023780	3300048924	Bacteria	5884
450	Ga0496121_0025505	3300048924	Bacteria	5606
451	Ga0496121_0034993	3300048924	Bacteria	4508
452	Ga0496121_0044494	3300048924	Bacteria	3828
453	Ga0496121_0075202	3300048924	Bacteria	2699
454	Ga0496121_0128385	3300048924	Bacteria	1902
455	Ga0496121_0129721	3300048924	Bacteria	1889
456	Ga0496121_0223713	3300048924	Bacteria	1323
457	Ga0496122_0000004	3300048925	Bacteria	645283
458	Ga0496122_0000414	3300048925	Bacteria	90664
459	Ga0496122_0004472	3300048925	Bacteria	17302
460	Ga0496122_0016318	3300048925	Bacteria	7039
461	Ga0496122_0027013	3300048925	Bacteria	4925
462	Ga0496122_0027041	3300048925	Bacteria	4920
463	Ga0496122_0038145	3300048925	Bacteria	3855
464	Ga0496122_0078425	3300048925	Bacteria	2313
465	Ga0496122_0083743	3300048925	Bacteria	2209
466	Ga0496122_0090029	3300048925	Bacteria	2095
467	Ga0496122_0093356	3300048925	Bacteria	2041
468	Ga0496122_0103890	3300048925	Bacteria	1889
469	Ga0496122_0133124	3300048925	Bacteria	1574
470	Ga0496122_0148042	3300048925	Bacteria	1455
471	Ga0496122_0218112	3300048925	Bacteria	1097
472	Ga0496123_0000007	3300048926	Bacteria	645283
473	Ga0496123_0000147	3300048926	Bacteria	143834
474	Ga0496123_0004704	3300048926	Bacteria	14130
475	Ga0496123_0009287	3300048926	Bacteria	8877
476	Ga0496123_0035340	3300048926	Bacteria	3562
477	Ga0496123_0037920	3300048926	Bacteria	3396
478	Ga0496123_0072249	3300048926	Bacteria	2147
479	Ga0496123_0076381	3300048926	Bacteria	2062
480	Ga0496123_0176583	3300048926	Bacteria	1120
481	Ga0496123_0185765	3300048926	Bacteria	1080
482	Ga0496123_0214230	3300048926	Bacteria	976
483	Ga0496123_0237938	3300048926	Bacteria	906
484	Ga0496123_0286424	3300048926	Bacteria	793
485	Ga0496124_0000348	3300048927	Bacteria	84728
486	Ga0496124_0006920	3300048927	Bacteria	12188
487	Ga0496124_0014287	3300048927	Bacteria	7685
488	Ga0496124_0016689	3300048927	Bacteria	6966
489	Ga0496124_0016988	3300048927	Bacteria	6887
490	Ga0496124_0024351	3300048927	Bacteria	5506
491	Ga0496124_0033989	3300048927	Bacteria	4480
492	Ga0496124_0060381	3300048927	Bacteria	3180
493	Ga0496124_0065366	3300048927	Bacteria	3033
494	Ga0496124_0086611	3300048927	Bacteria	2563
495	Ga0496124_0087575	3300048927	Bacteria	2547
496	Ga0496124_0090792	3300048927	Bacteria	2490
497	Ga0496124_0121346	3300048927	Bacteria	2088
498	Ga0496124_0189057	3300048927	Bacteria	1578
499	Ga0496124_0256330	3300048927	Bacteria	1290
500	Ga0496124_0333557	3300048927	Bacteria	1080
501	Ga0496124_0539301	3300048927	Bacteria	773
502	Ga0496125_0001144	3300048928	Bacteria	40287
503	Ga0496125_0001465	3300048928	Bacteria	34178
504	Ga0496125_0022507	3300048928	Bacteria	5849
505	Ga0496125_0029569	3300048928	Bacteria	4921
506	Ga0496125_0035651	3300048928	Bacteria	4358
507	Ga0496125_0051306	3300048928	Bacteria	3403
508	Ga0496125_0088459	3300048928	Bacteria	2334
509	Ga0496125_0390359	3300048928	Bacteria	817
510	Ga0496125_0438870	3300048928	Bacteria	751
511	Ga0496126_0000188	3300048929	Bacteria	139625
512	Ga0496126_0000879	3300048929	Bacteria	52860
513	Ga0496126_0012445	3300048929	Bacteria	8714
514	Ga0496126_0026789	3300048929	Bacteria	5520
515	Ga0496126_0063420	3300048929	Bacteria	3312
516	Ga0496126_0105356	3300048929	Bacteria	2462
517	Ga0496126_0176748	3300048929	Bacteria	1815
518	Ga0496126_0205108	3300048929	Bacteria	1662
519	Ga0496126_0286753	3300048929	Bacteria	1362
520	Ga0496126_0479075	3300048929	Bacteria	997
521	Ga0496126_0909609	3300048929	Bacteria	666
522	Ga0496126_0992794	3300048929	Bacteria	630
523	Ga0495678_008240	3300049459	Bacteria	5284
524	Ga0495678_030026	3300049459	Bacteria	2278
525	Ga0495678_124410	3300049459	Bacteria	862
526	Ga0495682_0131299	3300049460	Bacteria	896
527	Ga0501032_0055328	3300049569	Bacteria	2669
528	Ga0501032_0083701	3300049569	Bacteria	2121
529	Ga0501033_0002870	3300049570	Bacteria	14437
530	Ga0501033_0088013	3300049570	Bacteria	2272
531	Ga0501034_0056607	3300049571	Bacteria	3944
532	Ga0501034_0233824	3300049571	Bacteria	1786
533	Ga0501036_0050174	3300049572	Bacteria	3534
534	Ga0501036_0144141	3300049572	Bacteria	2009
535	Ga0501037_0068354	3300049573	Bacteria	2586
536	Ga0501038_0106209	3300049574	Bacteria	2331
537	Ga0501039_0040985	3300049575	Bacteria	3575
538	Ga0501043_0042912	3300049579	Bacteria	3555
539	Ga0501043_0219572	3300049579	Bacteria	1471
540	Ga0501047_0213966	3300049581	Bacteria	1785
541	Ga0501048_0124339	3300049582	Bacteria	1824
542	Ga0501073_0371548	3300049589	Bacteria	988
543	Ga0501080_0110220	3300049742	Bacteria	2551
544	Ga0501083_0347377	3300049744	Bacteria	964
545	Ga0501280_006841	3300049776	Bacteria	1602
546	Ga0501280_018903	3300049776	Bacteria	1011
547	Ga0501035_0006588	3300049822	Bacteria	10874
548	Ga0501035_0046668	3300049822	Bacteria	3896
549	Ga0501044_0051657	3300049823	Bacteria	4238
550	Ga0501045_0247987	3300049824	Bacteria	1326
551	nmdc:mga03683_5823_c1	3300050489	Bacteria	4185
552	nmdc:mga03n38_167739_c1	3300050490	Bacteria	1116
553	nmdc:mga03n38_62536_c1	3300050490	Bacteria	1699
554	nmdc:mga03n38_670868_c1	3300050490	Bacteria	595
555	nmdc:mga00v17_144_c1	3300050491	Bacteria	41064
556	nmdc:mga00v17_19824_c1	3300050491	Bacteria	3846
557	nmdc:mga00v17_7_c1	3300050491	Bacteria	167228
558	nmdc:mga0yw44_19943_c1	3300050492	Bacteria	3709
559	nmdc:mga0yw44_40104_c1	3300050492	Bacteria	2780
560	nmdc:mga0yw44_61836_c1	3300050492	Bacteria	2299
561	nmdc:mga0k408_14201_c1	3300050493	Bacteria	4384
562	nmdc:mga0k408_44480_c1	3300050493	Bacteria	2561
563	nmdc:mga06z11_20051_c1	3300050494	Bacteria	3085
564	nmdc:mga06z11_253717_c1	3300050494	Bacteria	1036
565	nmdc:mga04h51_147569_c1	3300050495	Bacteria	897
566	nmdc:mga07m45_296705_c1	3300050496	Bacteria	940
567	nmdc:mga07m45_435_c1	3300050496	Bacteria	17361
568	nmdc:mga0sz30_12651_c1	3300050516	Bacteria	3286
569	nmdc:mga0sz30_1942_c1	3300050516	Bacteria	7387
570	nmdc:mga0sz30_20686_c1	3300050516	Bacteria	2656
571	nmdc:mga0sz30_4853_c1	3300050516	Bacteria	2849
572	nmdc:mga0sz30_55891_c1	3300050516	Bacteria	1680
573	Ga0495601_0072051	3300053077	Bacteria	2207
574	Ga0500610_0086482	3300053079	Bacteria	1631
575	Ga0500578_0060936	3300053086	Bacteria	2410
576	Ga0500583_0476743	3300053092	Bacteria	589
577	Ga0500651_0094771	3300053093	Bacteria	1835
578	Ga0500557_003467	3300053105	Bacteria	3135
579	Ga0500560_096910	3300053107	Bacteria	987
580	Ga0500569_007398	3300053109	Bacteria	2462
581	Ga0500594_0001767	3300053118	Bacteria	4704
582	Ga0500607_248561	3300053121	Bacteria	710
583	Ga0500618_000056	3300053125	Bacteria	98509
584	Ga0500618_008675	3300053125	Bacteria	2821
585	Ga0500618_040706	3300053125	Bacteria	1067
586	Ga0500658_0113569	3300053134	Bacteria	1194
587	Ga0500658_0123087	3300053134	Bacteria	1151
588	Ga0500561_0000236	3300053137	Bacteria	9886
589	Ga0500568_0001459	3300053139	Bacteria	15147
590	Ga0500568_0007906	3300053139	Bacteria	5176
591	Ga0500573_0032288	3300053140	Bacteria	3021
592	Ga0500588_0013233	3300053146	Bacteria	2066
593	Ga0500604_0048553	3300053151	Bacteria	1303
594	Ga0500616_0000363	3300053153	Bacteria	64277
595	Ga0500616_0005056	3300053153	Bacteria	9116
596	Ga0500620_040580	3300053155	Bacteria	1525
597	Ga0500622_0001665	3300053156	Bacteria	17370
598	Ga0500624_049336	3300053157	Bacteria	779
599	Ga0500633_0001402	3300053160	Bacteria	4517
600	Ga0500634_0019481	3300053161	Bacteria	3656
601	Ga0500634_0100106	3300053161	Bacteria	1452
602	Ga0500636_0000003	3300053177	Bacteria	240189
603	Ga0500636_0001041	3300053177	Bacteria	14876
604	Ga0500636_0231095	3300053177	Bacteria	957
605	Ga0500645_025193	3300053730	Bacteria	1816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2791355253	2793280072	157
2	iso_pu_bacteria	643692032	643826592	159
3	iso_pu_bacteria	8055431914	8055432349	159
4	iso_pu_bacteria	2509276019	2509376714	160
5	iso_pu_bacteria	2510461069	2510840614	160
6	iso_pu_bacteria	2513237159	2513997630	160
7	iso_pu_bacteria	2558860100	2558863921	160
8	iso_pu_bacteria	2558860983	2561469241	160
9	iso_pu_bacteria	2582581299	2585228580	160
10	iso_pu_bacteria	2643221558	2643811265	160
11	iso_pu_bacteria	2643221634	2644191760	160
12	iso_pu_bacteria	2643221653	2644298964	160
13	iso_pu_bacteria	2643221719	2644657192	160
14	iso_pu_bacteria	2818991272	2819241025	160
15	iso_pu_bacteria	2842521101	2842522127	160
16	iso_pu_bacteria	2850079185	2850081716	160
17	iso_pu_bacteria	2891048133	2891051202	160
18	iso_pu_bacteria	2989771324	2989773254	160
19	iso_pu_bacteria	2989776772	2989779530	160
20	iso_pu_bacteria	2995392953	2995396539	160
21	iso_pu_bacteria	3005409236	3005414268	160
22	iso_pu_bacteria	639633055	639649462	160
23	iso_pu_bacteria	8005246636	8005249861	160
24	iso_pu_bacteria	8018150411	8018151280	160
25	iso_pu_bacteria	8054460903	8054463193	160
26	iso_pu_bacteria	2509276021	2509391734	161
27	iso_pu_bacteria	2509276033	2509447405	161
28	iso_pu_bacteria	2510065019	2510134242	161
29	iso_pu_bacteria	2510461076	2510895678	161
30	iso_pu_bacteria	2510917022	2511134085	161
31	iso_pu_bacteria	2510917026	2511169894	161
32	iso_pu_bacteria	2510917028	2511182416	161
33	iso_pu_bacteria	2510917030	2511199321	161
34	iso_pu_bacteria	2513237084	2513567681	161
35	iso_pu_bacteria	2513237088	2513597609	161
36	iso_pu_bacteria	2513237093	2513631884	161
37	iso_pu_bacteria	2513237103	2513707912	161
38	iso_pu_bacteria	2513237138	2513870172	161
39	iso_pu_bacteria	2513237162	2514018011	161
40	iso_pu_bacteria	2515075009	2515113404	161
41	iso_pu_bacteria	2515154113	2515635126	161
42	iso_pu_bacteria	2515154114	2515645568	161
43	iso_pu_bacteria	2515154116	2515655051	161
44	iso_pu_bacteria	2516653077	2517037007	161
45	iso_pu_bacteria	2517093000	2517096130	161
46	iso_pu_bacteria	2517287029	2517407751	161
47	iso_pu_bacteria	2524023209	2524458915	161
48	iso_pu_bacteria	2529292951	2530646507	161
49	iso_pu_bacteria	2534681796	2535517162	161
50	iso_pu_bacteria	2537561587	2537877202	161
51	iso_pu_bacteria	2554235003	2554248446	161
52	iso_pu_bacteria	2558860242	2559295562	161
53	iso_pu_bacteria	2582581294	2585201943	161
54	iso_pu_bacteria	2582581298	2585225342	161
55	iso_pu_bacteria	2582581304	2585258206	161
56	iso_pu_bacteria	2582581307	2585271404	161
57	iso_pu_bacteria	2582581308	2585279342	161
58	iso_pu_bacteria	2582581315	2585323053	161
59	iso_pu_bacteria	2582581316	2585331165	161
60	iso_pu_bacteria	2582581867	2585401019	161
61	iso_pu_bacteria	2585427527	2585531173	161
62	iso_pu_bacteria	2585427528	2585538480	161
63	iso_pu_bacteria	2585427529	2585547898	161
64	iso_pu_bacteria	2585427530	2585552903	161
65	iso_pu_bacteria	2585427531	2585559147	161
66	iso_pu_bacteria	2585427590	2585822080	161
67	iso_pu_bacteria	2585427593	2585836433	161
68	iso_pu_bacteria	2585427594	2585843541	161
69	iso_pu_bacteria	2585427609	2585903907	161
70	iso_pu_bacteria	2585427633	2585996762	161
71	iso_pu_bacteria	2585427634	2586001347	161
72	iso_pu_bacteria	2585428125	2587980975	161
73	iso_pu_bacteria	2599185210	2599601885	161
74	iso_pu_bacteria	2600255279	2601609861	161
75	iso_pu_bacteria	2600255308	2601746636	161
76	iso_pu_bacteria	2615840624	2616293075	161
77	iso_pu_bacteria	2615840626	2616311085	161
78	iso_pu_bacteria	2615840698	2616554522	161
79	iso_pu_bacteria	2617270742	2617385411	161
80	iso_pu_bacteria	2643221568	2643856530	161
81	iso_pu_bacteria	2643221582	2643920120	161
82	iso_pu_bacteria	2643221599	2644006979	161
83	iso_pu_bacteria	2643221643	2644242613	161
84	iso_pu_bacteria	2643221693	2644521743	161
85	iso_pu_bacteria	2718217882	2719182077	161
86	iso_pu_bacteria	2718217927	2719386694	161
87	iso_pu_bacteria	2718217997	2719666447	161
88	iso_pu_bacteria	2718218009	2719732793	161
89	iso_pu_bacteria	2718218199	2720492867	161
90	iso_pu_bacteria	2718218232	2720614328	161
91	iso_pu_bacteria	2718218233	2720621100	161
92	iso_pu_bacteria	2718218235	2720632426	161
93	iso_pu_bacteria	2718218269	2720776151	161
94	iso_pu_bacteria	2718218363	2721148168	161
95	iso_pu_bacteria	2718218365	2721159621	161
96	iso_pu_bacteria	2718218366	2721165004	161
97	iso_pu_bacteria	2718218423	2721400400	161
98	iso_pu_bacteria	2721755514	2722841174	161
99	iso_pu_bacteria	2721755556	2723027748	161
100	iso_pu_bacteria	2721755684	2723561378	161
101	iso_pu_bacteria	2721755685	2723568001	161
102	iso_pu_bacteria	2721755809	2724039213	161
103	iso_pu_bacteria	2721755810	2724045549	161
104	iso_pu_bacteria	2721755819	2724090758	161
105	iso_pu_bacteria	2721755822	2724105266	161
106	iso_pu_bacteria	2721755823	2724111093	161
107	iso_pu_bacteria	2724679232	2725950359	161
108	iso_pu_bacteria	2728369352	2730108684	161
109	iso_pu_bacteria	2728369365	2730165312	161
110	iso_pu_bacteria	2728369397	2730299253	161
111	iso_pu_bacteria	2738541293	2738804972	161
112	iso_pu_bacteria	2738541333	2739033122	161
113	iso_pu_bacteria	2765235942	2766066166	161
114	iso_pu_bacteria	2775507266	2778175704	161
115	iso_pu_bacteria	2791355259	2793318146	161
116	iso_pu_bacteria	2791355260	2793319461	161
117	iso_pu_bacteria	2791355261	2793328912	161
118	iso_pu_bacteria	2791355263	2793339559	161
119	iso_pu_bacteria	2791355266	2793362485	161
120	iso_pu_bacteria	2791355267	2793367608	161
121	iso_pu_bacteria	2802429605	2805926786	161
122	iso_pu_bacteria	2802429633	2806045261	161
123	iso_pu_bacteria	2802429634	2806049944	161
124	iso_pu_bacteria	2802429635	2806056782	161
125	iso_pu_bacteria	2802429636	2806064164	161
126	iso_pu_bacteria	2802429637	2806071432	161
127	iso_pu_bacteria	2808606387	2808987705	161
128	iso_pu_bacteria	2818991439	2819559278	161
129	iso_pu_bacteria	2818991448	2819609410	161
130	iso_pu_bacteria	2818991453	2819641278	161
131	iso_pu_bacteria	2821123053	2821125829	161
132	iso_pu_bacteria	2838016132	2838020065	161
133	iso_pu_bacteria	2838022645	2838023567	161
134	iso_pu_bacteria	2838029111	2838033327	161
135	iso_pu_bacteria	2838042994	2838045257	161
136	iso_pu_bacteria	2838048938	2838053267	161
137	iso_pu_bacteria	2838061910	2838065383	161
138	iso_pu_bacteria	2838068647	2838069860	161
139	iso_pu_bacteria	2838675328	2838675551	161
140	iso_pu_bacteria	2838680041	2838683158	161
141	iso_pu_bacteria	2838694306	2838697898	161
142	iso_pu_bacteria	2838707686	2838711013	161
143	iso_pu_bacteria	2838714209	2838714432	161
144	iso_pu_bacteria	2838719591	2838721766	161
145	iso_pu_bacteria	2838724970	2838725193	161
146	iso_pu_bacteria	2838736955	2838737721	161
147	iso_pu_bacteria	2841840854	2841841910	161
148	iso_pu_bacteria	2841846520	2841848750	161
149	iso_pu_bacteria	2841859092	2841862352	161
150	iso_pu_bacteria	2841864319	2841867251	161
151	iso_pu_bacteria	2842077413	2842079188	161
152	iso_pu_bacteria	2842110456	2842112974	161
153	iso_pu_bacteria	2842118031	2842118301	161
154	iso_pu_bacteria	2842124991	2842125219	161
155	iso_pu_bacteria	2842130223	2842130446	161
156	iso_pu_bacteria	2842140634	2842141689	161
157	iso_pu_bacteria	2842152218	2842154384	161
158	iso_pu_bacteria	2842170452	2842170675	161
159	iso_pu_bacteria	2842175837	2842178004	161
160	iso_pu_bacteria	2842187318	2842187541	161
161	iso_pu_bacteria	2842198810	2842199081	161
162	iso_pu_bacteria	2842211629	2842211852	161
163	iso_pu_bacteria	2842217011	2842218238	161
164	iso_pu_bacteria	2842224351	2842226528	161
165	iso_pu_bacteria	2842237096	2842240215	161
166	iso_pu_bacteria	2842264693	2842267783	161
167	iso_pu_bacteria	2842285085	2842285321	161
168	iso_pu_bacteria	2842291075	2842292850	161
169	iso_pu_bacteria	2842298080	2842298267	161
170	iso_pu_bacteria	2842311132	2842313933	161
171	iso_pu_bacteria	2842317721	2842319830	161
172	iso_pu_bacteria	2842341865	2842348139	161
173	iso_pu_bacteria	2842357229	2842360133	161
174	iso_pu_bacteria	2842363717	2842368385	161
175	iso_pu_bacteria	2842370503	2842373788	161
176	iso_pu_bacteria	2842377471	2842379247	161
177	iso_pu_bacteria	2842384541	2842384812	161
178	iso_pu_bacteria	2842395702	2842400051	161
179	iso_pu_bacteria	2842402390	2842402681	161
180	iso_pu_bacteria	2842409023	2842409948	161
181	iso_pu_bacteria	2842415677	2842416596	161
182	iso_pu_bacteria	2842422224	2842423474	161
183	iso_pu_bacteria	2842428310	2842430427	161
184	iso_pu_bacteria	2842434925	2842436761	161
185	iso_pu_bacteria	2842441272	2842443397	161
186	iso_pu_bacteria	2842447887	2842449268	161
187	iso_pu_bacteria	2842462802	2842466681	161
188	iso_pu_bacteria	2842469257	2842471369	161
189	iso_pu_bacteria	2842475841	2842480008	161
190	iso_pu_bacteria	2842482326	2842483797	161
191	iso_pu_bacteria	2842489311	2842493629	161
192	iso_pu_bacteria	2842495871	2842497780	161
193	iso_pu_bacteria	2842502639	2842505207	161
194	iso_pu_bacteria	2842509118	2842514216	161
195	iso_pu_bacteria	2842515876	2842519136	161
196	iso_pu_bacteria	2852387548	2852390549	161
197	iso_pu_bacteria	2854896431	2854901427	161
198	iso_pu_bacteria	2854916844	2854918960	161
199	iso_pu_bacteria	2857516855	2857517129	161
200	iso_pu_bacteria	2857531043	2857532390	161
201	iso_pu_bacteria	2891373044	2891373629	161
202	iso_pu_bacteria	2899792073	2899794048	161
203	iso_pu_bacteria	2899803654	2899806749	161
204	iso_pu_bacteria	2899845264	2899848822	161
205	iso_pu_bacteria	2919100787	2919106161	161
206	iso_pu_bacteria	2919114240	2919114469	161
207	iso_pu_bacteria	2919171160	2919173056	161
208	iso_pu_bacteria	2919408235	2919410273	161
209	iso_pu_bacteria	2923556063	2923561151	161
210	iso_pu_bacteria	2926754445	2926755483	161
211	iso_pu_bacteria	2926760298	2926762614	161
212	iso_pu_bacteria	2929138655	2929141076	161
213	iso_pu_bacteria	2933006813	2933009029	161
214	iso_pu_bacteria	2933011516	2933014690	161
215	iso_pu_bacteria	2933586486	2933588969	161
216	iso_pu_bacteria	2933594066	2933596372	161
217	iso_pu_bacteria	2933599457	2933600666	161
218	iso_pu_bacteria	2935894831	2935896717	161
219	iso_pu_bacteria	2936367885	2936371752	161
220	iso_pu_bacteria	2936375103	2936379587	161
221	iso_pu_bacteria	2936381700	2936388144	161
222	iso_pu_bacteria	2979089926	2979092074	161
223	iso_pu_bacteria	2979095461	2979100537	161
224	iso_pu_bacteria	2979100975	2979104133	161
225	iso_pu_bacteria	2984509177	2984511297	161
226	iso_pu_bacteria	2984518228	2984522342	161
227	iso_pu_bacteria	2984537506	2984541644	161
228	iso_pu_bacteria	2984601300	2984603917	161
229	iso_pu_bacteria	2989349275	2989350109	161
230	iso_pu_bacteria	2996887358	2996892756	161
231	iso_pu_bacteria	2996893221	2996897932	161
232	iso_pu_bacteria	3003930520	3003934516	161
233	iso_pu_bacteria	3005416602	3005418906	161
234	iso_pu_bacteria	3005445848	3005448743	161
235	iso_pu_bacteria	3005452660	3005454978	161
236	iso_pu_bacteria	650716007	650740771	161
237	iso_pu_bacteria	8003570095	8003571847	161
238	iso_pu_bacteria	8005258706	8005259477	161
239	iso_pu_bacteria	8005275841	8005281504	161
240	iso_pu_bacteria	8005282627	8005284527	161
241	iso_pu_bacteria	8005301065	8005303411	161
242	iso_pu_bacteria	8005314921	8005318202	161
243	iso_pu_bacteria	8005321885	8005327283	161
244	iso_pu_bacteria	8005376324	8005381215	161
245	iso_pu_bacteria	8005382845	8005388824	161
246	iso_pu_bacteria	8005430974	8005437570	161
247	iso_pu_bacteria	8005460587	8005464088	161
248	iso_pu_bacteria	8005484373	8005488921	161
249	iso_pu_bacteria	8005497431	8005501184	161
250	iso_pu_bacteria	8005542996	8005545977	161
251	iso_pu_bacteria	8005556819	8005561509	161
252	iso_pu_bacteria	8005563573	8005568287	161
253	iso_pu_bacteria	8005570704	8005573173	161
254	iso_pu_bacteria	8005619151	8005622551	161
255	iso_pu_bacteria	8005626139	8005630053	161
256	iso_pu_bacteria	8005645114	8005646003	161
257	iso_pu_bacteria	8005668836	8005672602	161
258	iso_pu_bacteria	8005688590	8005691817	161
259	iso_pu_bacteria	8005695170	8005697703	161
260	iso_pu_bacteria	8018127388	8018127426	161
261	iso_pu_bacteria	8018163183	8018164279	161
262	iso_pu_bacteria	8018176218	8018179524	161
263	iso_pu_bacteria	8024479707	8024486288	161
264	iso_pu_bacteria	8024486573	8024488323	161
265	iso_pu_bacteria	8046767195	8046772361	161
266	iso_pu_bacteria	8056375014	8056377553	161
267	iso_pu_bacteria	8056875544	8056875850	161
268	iso_pu_bacteria	8057575449	8057576683	161
269	iso_pu_bacteria	8057874678	8057882065	161
270	3300035695	Ga0373927_0000419	Ga0373927_0000419_8788_9276	162
271	3300049570	Ga0501033_0002870	Ga0501033_0002870_6301_6795	163
272	3300049822	Ga0501035_0006588	Ga0501035_0006588_5275_5769	163
273	3300005289	Ga0065704_10475575	Ga0065704_104755751	164
274	3300009148	Ga0105243_10111991	Ga0105243_101119913	164
275	3300021321	Ga0214542_1000268	Ga0214542_100026815	164
276	3300021327	Ga0214543_1000022	Ga0214543_1000022139	164
277	3300021327	Ga0214543_1000219	Ga0214543_100021916	164
278	3300028794	Ga0307515_10000017	Ga0307515_10000017142	164
279	3300031456	Ga0307513_10001095	Ga0307513_1000109520	164
280	3300031911	Ga0307412_10703297	Ga0307412_107032972	164
281	3300041404	Ga0439436_0010510	Ga0439436_0010510_1496_1999	164
282	3300041411	Ga0439466_0025917	Ga0439466_0025917_34_537	164
283	3300042015	Ga0439462_0021294	Ga0439462_0021294_589_1092	164
284	3300042185	Ga0450909_006211	Ga0450909_006211_150_653	164
285	3300042531	Ga0450918_012682	Ga0450918_012682_937_1440	164
286	3300046452	Ga0495617_117724	Ga0495617_117724_26_520	164
287	3300046453	Ga0495627_101476	Ga0495627_101476_134_628	164
288	3300046492	Ga0495585_0071440	Ga0495585_0071440_1067_1561	164
289	3300046492	Ga0495585_0106941	Ga0495585_0106941_332_826	164
290	3300046506	Ga0495583_0003748	Ga0495583_0003748_7762_8256	164
291	3300046507	Ga0495606_0110593	Ga0495606_0110593_756_1250	164
292	3300046512	Ga0495610_0297126	Ga0495610_0297126_79_573	164
293	3300046558	Ga0495633_0049675	Ga0495633_0049675_192_686	164
294	3300046615	Ga0495656_0066770	Ga0495656_0066770_273_767	164
295	3300046648	Ga0495611_0111483	Ga0495611_0111483_645_1139	164
296	3300046692	Ga0495671_0306891	Ga0495671_0306891_52_546	164
297	3300047470	Ga0495681_0335685	Ga0495681_0335685_64_558	164
298	3300048090	Ga0495615_0016963	Ga0495615_0016963_589_1083	164
299	3300048904	Ga0496101_0734581	Ga0496101_0734581_59_553	164
300	3300048917	Ga0496114_0995822	Ga0496114_0995822_207_701	164
301	3300049776	Ga0501280_018903	Ga0501280_018903_139_636	164
302	3300053161	Ga0500634_0100106	Ga0500634_0100106_336_830	164
303	3300002704	JGI25155J39150_1000014	JGI25155J39150_1000014145	165
304	3300002705	JGI25156J39149_1000083	JGI25156J39149_100008315	165
305	3300002737	JGI25162J39368_1000217	JGI25162J39368_10002176	165
306	3300002738	JGI25154J39366_1000052	JGI25154J39366_100005221	165
307	3300002741	JGI25157J39369_1000110	JGI25157J39369_100011064	165
308	3300002773	JGI25152J39213_1001348	JGI25152J39213_10013484	165
309	3300002773	JGI25152J39213_1002158	JGI25152J39213_10021585	165
310	3300002773	JGI25152J39213_1002644	JGI25152J39213_10026443	165
311	3300002773	JGI25152J39213_1004295	JGI25152J39213_10042958	165
312	3300002773	JGI25152J39213_1004334	JGI25152J39213_10043348	165
313	3300002773	JGI25152J39213_1021598	JGI25152J39213_10215982	165
314	3300002774	JGI25150J39212_1000100	JGI25150J39212_100010044	165
315	3300002774	JGI25150J39212_1002765	JGI25150J39212_10027653	165
316	3300002774	JGI25150J39212_1003426	JGI25150J39212_10034267	165
317	3300002987	JGI25159J45721_1000832	JGI25159J45721_10008323	165
318	3300002987	JGI25159J45721_1002615	JGI25159J45721_10026152	165
319	3300003187	JGI25151J46595_10000146	JGI25151J46595_1000014686	165
320	3300003187	JGI25151J46595_10002021	JGI25151J46595_100020214	165
321	3300003187	JGI25151J46595_10003013	JGI25151J46595_100030137	165
322	3300003187	JGI25151J46595_10007505	JGI25151J46595_100075058	165
323	3300003187	JGI25151J46595_10043085	JGI25151J46595_100430852	165
324	3300003187	JGI25151J46595_10066878	JGI25151J46595_100668781	165
325	3300003214	JGI25165J46597_1000767	JGI25165J46597_100076716	165
326	3300003214	JGI25165J46597_1005503	JGI25165J46597_10055032	165
327	3300003215	JGI25153J46596_10000764	JGI25153J46596_100007647	165
328	3300003215	JGI25153J46596_10002359	JGI25153J46596_1000235910	165
329	3300003215	JGI25153J46596_10009056	JGI25153J46596_100090564	165
330	3300003215	JGI25153J46596_10009420	JGI25153J46596_100094208	165
331	3300003215	JGI25153J46596_10009505	JGI25153J46596_100095058	165
332	3300003215	JGI25153J46596_10052409	JGI25153J46596_100524092	165
333	3300003316	rootH1_10095586	rootH1_100955862	165
334	3300003322	rootL2_10044385	rootL2_100443854	165
335	3300003323	rootH1_10047163	rootH1_100471632	165
336	3300003354	JGI25160J50197_1000001	JGI25160J50197_1000001330	165
337	3300003354	JGI25160J50197_1000351	JGI25160J50197_100035113	165
338	3300003354	JGI25160J50197_1013610	JGI25160J50197_10136103	165
339	3300003374	JGI25161J50226_1000001	JGI25161J50226_1000001430	165
340	3300003374	JGI25161J50226_1000167	JGI25161J50226_100016721	165
341	3300003374	JGI25161J50226_1014399	JGI25161J50226_10143992	165
342	3300003771	Ga0055526_1000842	Ga0055526_100084212	165
343	3300003771	Ga0055526_1003643	Ga0055526_10036438	165
344	3300003771	Ga0055526_1004423	Ga0055526_10044237	165
345	3300003771	Ga0055526_1018827	Ga0055526_10188272	165
346	3300003775	Ga0055524_1002425	Ga0055524_10024256	165
347	3300003775	Ga0055524_1003892	Ga0055524_10038925	165
348	3300003775	Ga0055524_1007700	Ga0055524_10077007	165
349	3300003775	Ga0055524_1012307	Ga0055524_10123075	165
350	3300003775	Ga0055524_1013955	Ga0055524_10139553	165
351	3300003781	Ga0055536_1006441	Ga0055536_10064414	165
352	3300003790	Ga0055528_1000158	Ga0055528_100015856	165
353	3300003790	Ga0055528_1000707	Ga0055528_10007078	165
354	3300003790	Ga0055528_1000749	Ga0055528_100074914	165
355	3300003790	Ga0055528_1003189	Ga0055528_10031896	165
356	3300003790	Ga0055528_1006485	Ga0055528_10064856	165
357	3300003790	Ga0055528_1009987	Ga0055528_10099874	165
358	3300003791	Ga0055530_10021732	Ga0055530_100217322	165
359	3300003792	Ga0055540_1000518	Ga0055540_100051821	165
360	3300003792	Ga0055540_1005724	Ga0055540_10057247	165
361	3300003792	Ga0055540_1006013	Ga0055540_10060134	165
362	3300003792	Ga0055540_1034552	Ga0055540_10345522	165
363	3300003794	Ga0055531_10010704	Ga0055531_100107049	165
364	3300003856	Ga0058692_1001431	Ga0058692_100143113	165
365	3300004625	Ga0055543_1000060	Ga0055543_10000609	165
366	3300004625	Ga0055543_1000216	Ga0055543_10002167	165
367	3300004625	Ga0055543_1000699	Ga0055543_10006994	165
368	3300005262	Ga0065165_1000008	Ga0065165_1000008125	165
369	3300005262	Ga0065165_1004363	Ga0065165_10043635	165
370	3300005262	Ga0065165_1064875	Ga0065165_10648752	165
371	3300005262	Ga0065165_1067950	Ga0065165_10679502	165
372	3300005335	Ga0070666_10099735	Ga0070666_100997352	165
373	3300005347	Ga0070668_100017103	Ga0070668_1000171031	165
374	3300005347	Ga0070668_101579046	Ga0070668_1015790461	165
375	3300005353	Ga0070669_100135042	Ga0070669_1001350422	165
376	3300005355	Ga0070671_100033648	Ga0070671_1000336482	165
377	3300005455	Ga0070663_100013668	Ga0070663_1000136685	165
378	3300005548	Ga0070665_100007074	Ga0070665_1000070746	165
379	3300005563	Ga0068855_100081851	Ga0068855_1000818513	165
380	3300005578	Ga0068854_100040374	Ga0068854_1000403744	165
381	3300005578	Ga0068854_100410685	Ga0068854_1004106852	165
382	3300005614	Ga0068856_100190581	Ga0068856_1001905812	165
383	3300005719	Ga0068861_100942699	Ga0068861_1009426992	165
384	3300005834	Ga0068851_10166693	Ga0068851_101666931	165
385	3300005841	Ga0068863_101719947	Ga0068863_1017199471	165
386	3300006038	Ga0075365_10007766	Ga0075365_100077664	165
387	3300006038	Ga0075365_10010140	Ga0075365_100101404	165
388	3300006038	Ga0075365_10095352	Ga0075365_100953521	165
389	3300006042	Ga0075368_10005974	Ga0075368_100059744	165
390	3300006042	Ga0075368_10317028	Ga0075368_103170282	165
391	3300006048	Ga0075363_100015703	Ga0075363_1000157037	165
392	3300006048	Ga0075363_100019422	Ga0075363_1000194222	165
393	3300006048	Ga0075363_100055338	Ga0075363_1000553384	165
394	3300006051	Ga0075364_10015660	Ga0075364_100156605	165
395	3300006051	Ga0075364_10349320	Ga0075364_103493201	165
396	3300006051	Ga0075364_11049827	Ga0075364_110498271	165
397	3300006177	Ga0075362_10075178	Ga0075362_100751782	165
398	3300006178	Ga0075367_10000779	Ga0075367_100007798	165
399	3300006178	Ga0075367_10011013	Ga0075367_100110134	165
400	3300006178	Ga0075367_10102795	Ga0075367_101027953	165
401	3300006186	Ga0075369_10003894	Ga0075369_100038946	165
402	3300006186	Ga0075369_10013982	Ga0075369_100139826	165
403	3300006186	Ga0075369_10021466	Ga0075369_100214666	165
404	3300006195	Ga0075366_10003058	Ga0075366_100030586	165
405	3300006353	Ga0075370_10002851	Ga0075370_1000285110	165
406	3300006353	Ga0075370_10003951	Ga0075370_100039516	165
407	3300006353	Ga0075370_10042620	Ga0075370_100426204	165
408	3300006353	Ga0075370_10479373	Ga0075370_104793731	165
409	3300006946	Ga0079104_1000015	Ga0079104_100001586	165
410	3300006948	Ga0099826_10000102	Ga0099826_1000010241	165
411	3300006948	Ga0099826_10018575	Ga0099826_100185757	165
412	3300009011	Ga0105251_10010023	Ga0105251_100100233	165
413	3300009036	Ga0105244_10097209	Ga0105244_100972091	165
414	3300009036	Ga0105244_10280460	Ga0105244_102804601	165
415	3300009092	Ga0105250_10067011	Ga0105250_100670114	165
416	3300009093	Ga0105240_10000014	Ga0105240_10000014243	165
417	3300009148	Ga0105243_10006869	Ga0105243_100068693	165
418	3300009177	Ga0105248_10153015	Ga0105248_101530153	165
419	3300009545	Ga0105237_10002158	Ga0105237_100021585	165
420	3300009553	Ga0105249_10082826	Ga0105249_100828263	165
421	3300009763	Ga0123340_1049595	Ga0123340_10495951	165
422	3300009765	Ga0123341_1000035	Ga0123341_100003530	165
423	3300009765	Ga0123341_1061365	Ga0123341_10613651	165
424	3300009765	Ga0123341_1061371	Ga0123341_10613711	165
425	3300009766	Ga0123342_1009440	Ga0123342_10094408	165
426	3300009766	Ga0123342_1011443	Ga0123342_10114432	165
427	3300013100	Ga0157373_10055636	Ga0157373_100556363	165
428	3300013100	Ga0157373_10227511	Ga0157373_102275112	165
429	3300013102	Ga0157371_10000017	Ga0157371_10000017277	165
430	3300013104	Ga0157370_10000329	Ga0157370_1000032950	165
431	3300013104	Ga0157370_10001031	Ga0157370_1000103122	165
432	3300013105	Ga0157369_10024034	Ga0157369_100240345	165
433	3300013105	Ga0157369_10522116	Ga0157369_105221163	165
434	3300013105	Ga0157369_10661880	Ga0157369_106618802	165
435	3300014497	Ga0182008_10047466	Ga0182008_100474664	165
436	3300014497	Ga0182008_10303399	Ga0182008_103033992	165
437	3300015262	Ga0182007_10003468	Ga0182007_100034682	165
438	3300015265	Ga0182005_1000982	Ga0182005_10009827	165
439	3300025206	Ga0209435_100027	Ga0209435_100027141	165
440	3300025207	Ga0209760_107985	Ga0209760_1079851	165
441	3300025208	Ga0209436_100081	Ga0209436_10008141	165
442	3300025233	Ga0209437_100051	Ga0209437_10005120	165
443	3300025245	Ga0207425_1000046	Ga0207425_100004682	165
444	3300025245	Ga0207425_1002771	Ga0207425_10027713	165
445	3300025245	Ga0207425_1004453	Ga0207425_10044534	165
446	3300025245	Ga0207425_1005031	Ga0207425_10050312	165
447	3300025245	Ga0207425_1020267	Ga0207425_10202672	165
448	3300025246	Ga0209646_1000086	Ga0209646_1000086141	165
449	3300025250	Ga0209026_1000082	Ga0209026_1000082141	165
450	3300025253	Ga0209677_100540	Ga0209677_1005405	165
451	3300025256	Ga0209759_1000063	Ga0209759_100006360	165
452	3300025258	Ga0209129_1000171	Ga0209129_100017120	165
453	3300025258	Ga0209129_1000283	Ga0209129_100028321	165
454	3300025258	Ga0209129_1000450	Ga0209129_100045021	165
455	3300025258	Ga0209129_1001443	Ga0209129_10014435	165
456	3300025258	Ga0209129_1001916	Ga0209129_10019164	165
457	3300025258	Ga0209129_1004411	Ga0209129_10044116	165
458	3300025258	Ga0209129_1005600	Ga0209129_10056005	165
459	3300025261	Ga0209233_1000190	Ga0209233_1000190119	165
460	3300025261	Ga0209233_1000228	Ga0209233_100022868	165
461	3300025273	Ga0209673_1000010	Ga0209673_1000010568	165
462	3300025273	Ga0209673_1000025	Ga0209673_1000025146	165
463	3300025273	Ga0209673_1000112	Ga0209673_100011275	165
464	3300025273	Ga0209673_1000637	Ga0209673_100063747	165
465	3300025273	Ga0209673_1004043	Ga0209673_10040438	165
466	3300025284	Ga0209130_1000003	Ga0209130_1000003445	165
467	3300025284	Ga0209130_1000023	Ga0209130_100002349	165
468	3300025284	Ga0209130_1010464	Ga0209130_10104644	165
469	3300025291	Ga0209675_1034800	Ga0209675_10348003	165
470	3300025292	Ga0209676_1002751	Ga0209676_100275115	165
471	3300025294	Ga0209025_1000091	Ga0209025_1000091189	165
472	3300025294	Ga0209025_1000137	Ga0209025_1000137109	165
473	3300025294	Ga0209025_1000154	Ga0209025_100015487	165
474	3300025294	Ga0209025_1000545	Ga0209025_10005456	165
475	3300025294	Ga0209025_1001424	Ga0209025_100142420	165
476	3300025294	Ga0209025_1005945	Ga0209025_10059453	165
477	3300025294	Ga0209025_1006114	Ga0209025_10061142	165
478	3300025294	Ga0209025_1011337	Ga0209025_10113373	165
479	3300025294	Ga0209025_1022784	Ga0209025_10227842	165
480	3300025294	Ga0209025_1047100	Ga0209025_10471002	165
481	3300025295	Ga0209564_1000564	Ga0209564_100056437	165
482	3300025295	Ga0209564_1000672	Ga0209564_100067217	165
483	3300025295	Ga0209564_1001566	Ga0209564_10015664	165
484	3300025295	Ga0209564_1003798	Ga0209564_10037986	165
485	3300025295	Ga0209564_1012665	Ga0209564_10126652	165
486	3300025297	Ga0209758_1000058	Ga0209758_1000058146	165
487	3300025297	Ga0209758_1000123	Ga0209758_1000123109	165
488	3300025297	Ga0209758_1000725	Ga0209758_100072528	165
489	3300025297	Ga0209758_1000863	Ga0209758_100086319	165
490	3300025297	Ga0209758_1001901	Ga0209758_100190111	165
491	3300025297	Ga0209758_1001960	Ga0209758_100196013	165
492	3300025297	Ga0209758_1006925	Ga0209758_10069257	165
493	3300025298	Ga0209050_1002725	Ga0209050_100272512	165
494	3300025298	Ga0209050_1016627	Ga0209050_10166274	165
495	3300025299	Ga0209256_1000914	Ga0209256_10009146	165
496	3300025299	Ga0209256_1001132	Ga0209256_100113219	165
497	3300025299	Ga0209256_1001499	Ga0209256_10014996	165
498	3300025299	Ga0209256_1003097	Ga0209256_10030977	165
499	3300025299	Ga0209256_1007950	Ga0209256_10079504	165
500	3300025302	Ga0207426_1000008	Ga0207426_100000821	165
501	3300025302	Ga0207426_1000011	Ga0207426_1000011331	165
502	3300025302	Ga0207426_1000228	Ga0207426_1000228101	165
503	3300025302	Ga0207426_1006647	Ga0207426_10066476	165
504	3300025303	Ga0209051_1000462	Ga0209051_100046243	165
505	3300025303	Ga0209051_1000785	Ga0209051_10007859	165
506	3300025303	Ga0209051_1001635	Ga0209051_100163512	165
507	3300025303	Ga0209051_1007538	Ga0209051_10075385	165
508	3300025303	Ga0209051_1015498	Ga0209051_10154982	165
509	3300025304	Ga0209257_1003221	Ga0209257_10032218	165
510	3300025304	Ga0209257_1005494	Ga0209257_10054947	165
511	3300025304	Ga0209257_1036976	Ga0209257_10369762	165
512	3300025304	Ga0209257_1037140	Ga0209257_10371402	165
513	3300025735	Ga0207713_1041996	Ga0207713_10419961	165
514	3300025903	Ga0207680_10183137	Ga0207680_101831373	165
515	3300025913	Ga0207695_10000037	Ga0207695_10000037244	165
516	3300025914	Ga0207671_10001228	Ga0207671_100012288	165
517	3300025923	Ga0207681_10127084	Ga0207681_101270842	165
518	3300025925	Ga0207650_10001248	Ga0207650_1000124814	165
519	3300025931	Ga0207644_10058528	Ga0207644_100585286	165
520	3300025933	Ga0207706_10295850	Ga0207706_102958503	165
521	3300025935	Ga0207709_10199828	Ga0207709_101998282	165
522	3300025941	Ga0207711_10061404	Ga0207711_100614045	165
523	3300025961	Ga0207712_10070189	Ga0207712_100701892	165
524	3300025986	Ga0207658_10318477	Ga0207658_103184772	165
525	3300026041	Ga0207639_10735315	Ga0207639_107353152	165
526	3300026067	Ga0207678_10025462	Ga0207678_100254625	165
527	3300026078	Ga0207702_10184423	Ga0207702_101844233	165
528	3300026088	Ga0207641_11160395	Ga0207641_111603952	165
529	3300026118	Ga0207675_101047242	Ga0207675_1010472422	165
530	3300027111	Ga0209281_1000034	Ga0209281_1000034361	165
531	3300027312	Ga0209371_1000022	Ga0209371_1000022305	165
532	3300027312	Ga0209371_1000341	Ga0209371_100034143	165
533	3300027312	Ga0209371_1003792	Ga0209371_10037924	165
534	3300027666	Ga0209282_1002798	Ga0209282_10027987	165
535	3300027666	Ga0209282_1017894	Ga0209282_10178944	165
536	3300027866	Ga0209813_10004580	Ga0209813_100045803	165
537	3300027866	Ga0209813_10184410	Ga0209813_101844101	165
538	3300028379	Ga0268266_10005469	Ga0268266_100054696	165
539	3300028379	Ga0268266_10113508	Ga0268266_101135085	165
540	3300028794	Ga0307515_10029550	Ga0307515_100295505	165
541	3300030500	Ga0268256_1000019	Ga0268256_1000019215	165
542	3300030500	Ga0268256_1001403	Ga0268256_10014036	165
543	3300030500	Ga0268256_1004051	Ga0268256_10040514	165
544	3300030500	Ga0268256_1043464	Ga0268256_10434642	165
545	3300030744	Ga0316181_1107412	Ga0316181_11074125	165
546	3300030745	Ga0316182_1174290	Ga0316182_11742901	165
547	3300031456	Ga0307513_10009210	Ga0307513_1000921016	165
548	3300031548	Ga0307408_100836973	Ga0307408_1008369732	165
549	3300031731	Ga0307405_10017156	Ga0307405_100171567	165
550	3300031911	Ga0307412_10004052	Ga0307412_100040527	165
551	3300033180	Ga0307510_10526875	Ga0307510_105268752	165
552	3300041413	Ga0439465_0050912	Ga0439465_0050912_334_831	165
553	3300041413	Ga0439465_0076364	Ga0439465_0076364_70_567	165
554	3300041456	Ga0451795_0647420	Ga0451795_0647420_564_1061	165
555	3300041486	Ga0451807_1773350	Ga0451807_1773350_64_564	165
556	3300041491	Ga0451833_0575078	Ga0451833_0575078_239_739	165
557	3300041492	Ga0451835_0487282	Ga0451835_0487282_194_694	165
558	3300041494	Ga0451837_0448786	Ga0451837_0448786_182_682	165
559	3300041496	Ga0451839_0351025	Ga0451839_0351025_631_1131	165
560	3300041498	Ga0451841_0429116	Ga0451841_0429116_57_557	165
561	3300041501	Ga0451845_0704804	Ga0451845_0704804_48_548	165
562	3300041503	Ga0451847_0545907	Ga0451847_0545907_471_971	165
563	3300041503	Ga0451847_0607285	Ga0451847_0607285_471_971	165
564	3300041505	Ga0451849_0971194	Ga0451849_0971194_39_539	165
565	3300041507	Ga0451851_0559086	Ga0451851_0559086_368_868	165
566	3300041511	Ga0451855_0815820	Ga0451855_0815820_2043_2543	165
567	3300041511	Ga0451855_1183387	Ga0451855_1183387_187_687	165
568	3300042006	Ga0439432_026777	Ga0439432_026777_928_1428	165
569	3300042007	Ga0439449_0080579	Ga0439449_0080579_387_887	165
570	3300044672	Ga0466982_0343227	Ga0466982_0343227_250_747	165
571	3300044684	Ga0466966_0074592	Ga0466966_0074592_608_1105	165
572	3300044694	Ga0466963_0018270	Ga0466963_0018270_681_1178	165
573	3300044706	Ga0466964_0101026	Ga0466964_0101026_328_825	165
574	3300044765	Ga0466970_0000872	Ga0466970_0000872_9892_10389	165
575	3300044842	Ga0466957_0176279	Ga0466957_0176279_290_787	165
576	3300045976	Ga0466967_0099658	Ga0466967_0099658_1938_2435	165
577	3300046452	Ga0495617_145929	Ga0495617_145929_167_667	165
578	3300046454	Ga0495592_0042081	Ga0495592_0042081_2690_3187	165
579	3300046457	Ga0495590_0321806	Ga0495590_0321806_27_524	165
580	3300046460	Ga0495638_0000953	Ga0495638_0000953_8912_9409	165
581	3300046462	Ga0495651_0022780	Ga0495651_0022780_1682_2179	165
582	3300046471	Ga0495650_0086473	Ga0495650_0086473_120_620	165
583	3300046474	Ga0495605_0001474	Ga0495605_0001474_3332_3829	165
584	3300046474	Ga0495605_0097803	Ga0495605_0097803_398_898	165
585	3300046476	Ga0495662_0003309	Ga0495662_0003309_6604_7101	165
586	3300046492	Ga0495585_0011346	Ga0495585_0011346_3923_4420	165
587	3300046492	Ga0495585_0025457	Ga0495585_0025457_686_1186	165
588	3300046500	Ga0495596_0122860	Ga0495596_0122860_35_535	165
589	3300046501	Ga0495607_0025745	Ga0495607_0025745_2280_2777	165
590	3300046506	Ga0495583_0012759	Ga0495583_0012759_1120_1617	165
591	3300046506	Ga0495583_0103731	Ga0495583_0103731_81_578	165
592	3300046507	Ga0495606_0002168	Ga0495606_0002168_7619_8116	165
593	3300046512	Ga0495610_0012771	Ga0495610_0012771_3994_4491	165
594	3300046512	Ga0495610_0063587	Ga0495610_0063587_915_1412	165
595	3300046513	Ga0495616_0112151	Ga0495616_0112151_169_666	165
596	3300046514	Ga0495618_0214161	Ga0495618_0214161_50_547	165
597	3300046515	Ga0495620_0013879	Ga0495620_0013879_3086_3583	165
598	3300046515	Ga0495620_0049847	Ga0495620_0049847_730_1227	165
599	3300046515	Ga0495620_0064131	Ga0495620_0064131_202_702	165
600	3300046518	Ga0495631_0012885	Ga0495631_0012885_2511_3008	165
601	3300046518	Ga0495631_0081293	Ga0495631_0081293_497_997	165
602	3300046519	Ga0495632_0013526	Ga0495632_0013526_1036_1533	165
603	3300046519	Ga0495632_0044287	Ga0495632_0044287_530_1027	165
604	3300046519	Ga0495632_0148593	Ga0495632_0148593_491_991	165
605	3300046522	Ga0495643_0088887	Ga0495643_0088887_648_1145	165
606	3300046522	Ga0495643_0219943	Ga0495643_0219943_266_763	165
607	3300046524	Ga0495648_0024217	Ga0495648_0024217_3352_3852	165
608	3300046524	Ga0495648_0297118	Ga0495648_0297118_196_693	165
609	3300046529	Ga0495652_0344343	Ga0495652_0344343_258_755	165
610	3300046530	Ga0495654_0000758	Ga0495654_0000758_9556_10053	165
611	3300046530	Ga0495654_0053584	Ga0495654_0053584_1070_1567	165
612	3300046533	Ga0495640_0122447	Ga0495640_0122447_417_914	165
613	3300046538	Ga0495609_0008203	Ga0495609_0008203_3742_4239	165
614	3300046557	Ga0495622_0030020	Ga0495622_0030020_96_593	165
615	3300046558	Ga0495633_0021557	Ga0495633_0021557_591_1091	165
616	3300046558	Ga0495633_0120220	Ga0495633_0120220_419_916	165
617	3300046558	Ga0495633_0204623	Ga0495633_0204623_91_588	165
618	3300046616	Ga0495668_0003159	Ga0495668_0003159_7378_7875	165
619	3300046616	Ga0495668_0080778	Ga0495668_0080778_1251_1751	165
620	3300046660	Ga0495625_0005331	Ga0495625_0005331_5440_5937	165
621	3300046660	Ga0495625_0062307	Ga0495625_0062307_403_903	165
622	3300046660	Ga0495625_0491495	Ga0495625_0491495_201_698	165
623	3300046663	Ga0495635_0088343	Ga0495635_0088343_344_841	165
624	3300046665	Ga0495661_0167154	Ga0495661_0167154_512_1012	165
625	3300046674	Ga0495588_0001565	Ga0495588_0001565_8636_9133	165
626	3300046674	Ga0495588_0149404	Ga0495588_0149404_125_622	165
627	3300046675	Ga0495657_0015576	Ga0495657_0015576_2085_2582	165
628	3300046683	Ga0495658_0040425	Ga0495658_0040425_1940_2437	165
629	3300046690	Ga0495624_0053180	Ga0495624_0053180_659_1156	165
630	3300046691	Ga0495670_0003394	Ga0495670_0003394_3943_4440	165
631	3300046691	Ga0495670_0148823	Ga0495670_0148823_87_587	165
632	3300046692	Ga0495671_0052719	Ga0495671_0052719_75_575	165
633	3300046692	Ga0495671_0103852	Ga0495671_0103852_362_859	165
634	3300046694	Ga0495649_0049124	Ga0495649_0049124_350_847	165
635	3300046809	Ga0495600_0141875	Ga0495600_0141875_83_580	165
636	3300046810	Ga0495660_0032206	Ga0495660_0032206_1729_2226	165
637	3300046810	Ga0495660_0045004	Ga0495660_0045004_1907_2407	165
638	3300047317	Ga0495604_0031909	Ga0495604_0031909_484_981	165
639	3300047320	Ga0495672_0003408	Ga0495672_0003408_6352_6849	165
640	3300047323	Ga0495683_0129898	Ga0495683_0129898_450_947	165
641	3300047470	Ga0495681_0010603	Ga0495681_0010603_4381_4878	165
642	3300047472	Ga0495686_0007900	Ga0495686_0007900_536_1033	165
643	3300047472	Ga0495686_0016439	Ga0495686_0016439_3944_4441	165
644	3300047472	Ga0495686_0018844	Ga0495686_0018844_564_1061	165
645	3300048090	Ga0495615_0029692	Ga0495615_0029692_197_697	165
646	3300048904	Ga0496101_0152268	Ga0496101_0152268_1194_1691	165
647	3300048904	Ga0496101_0205390	Ga0496101_0205390_109_606	165
648	3300048904	Ga0496101_0284143	Ga0496101_0284143_322_819	165
649	3300048905	Ga0496102_0004330	Ga0496102_0004330_3599_4096	165
650	3300048905	Ga0496102_0060372	Ga0496102_0060372_2909_3406	165
651	3300048906	Ga0496103_0036078	Ga0496103_0036078_2447_2944	165
652	3300048906	Ga0496103_0067827	Ga0496103_0067827_262_759	165
653	3300048907	Ga0496104_0049484	Ga0496104_0049484_2692_3189	165
654	3300048907	Ga0496104_0554104	Ga0496104_0554104_380_877	165
655	3300048908	Ga0496105_0029943	Ga0496105_0029943_2917_3414	165
656	3300048909	Ga0496106_0001496	Ga0496106_0001496_5468_5965	165
657	3300048913	Ga0496110_0135447	Ga0496110_0135447_978_1475	165
658	3300048915	Ga0496112_0487960	Ga0496112_0487960_177_674	165
659	3300048916	Ga0496113_0029675	Ga0496113_0029675_763_1260	165
660	3300048916	Ga0496113_0130856	Ga0496113_0130856_189_686	165
661	3300048916	Ga0496113_0252125	Ga0496113_0252125_458_955	165
662	3300048916	Ga0496113_0754236	Ga0496113_0754236_247_744	165
663	3300048917	Ga0496114_0296181	Ga0496114_0296181_260_757	165
664	3300048919	Ga0496116_0010698	Ga0496116_0010698_6751_7248	165
665	3300048919	Ga0496116_0016794	Ga0496116_0016794_576_1073	165
666	3300048919	Ga0496116_0022826	Ga0496116_0022826_3306_3803	165
667	3300048919	Ga0496116_0033222	Ga0496116_0033222_2542_3039	165
668	3300048919	Ga0496116_0081123	Ga0496116_0081123_109_606	165
669	3300048919	Ga0496116_0088663	Ga0496116_0088663_769_1266	165
670	3300048919	Ga0496116_0125237	Ga0496116_0125237_569_1066	165
671	3300048919	Ga0496116_0150895	Ga0496116_0150895_367_864	165
672	3300048919	Ga0496116_0168676	Ga0496116_0168676_31_528	165
673	3300048919	Ga0496116_0459327	Ga0496116_0459327_27_524	165
674	3300048920	Ga0496117_0000002	Ga0496117_0000002_242674_243171	165
675	3300048920	Ga0496117_0002241	Ga0496117_0002241_7928_8425	165
676	3300048920	Ga0496117_0003292	Ga0496117_0003292_8478_8975	165
677	3300048920	Ga0496117_0020448	Ga0496117_0020448_3086_3583	165
678	3300048920	Ga0496117_0025317	Ga0496117_0025317_488_988	165
679	3300048920	Ga0496117_0026153	Ga0496117_0026153_3828_4325	165
680	3300048920	Ga0496117_0026472	Ga0496117_0026472_278_775	165
681	3300048920	Ga0496117_0077801	Ga0496117_0077801_1224_1721	165
682	3300048920	Ga0496117_0219603	Ga0496117_0219603_538_1035	165
683	3300048921	Ga0496118_0000566	Ga0496118_0000566_57_554	165
684	3300048921	Ga0496118_0001388	Ga0496118_0001388_26228_26725	165
685	3300048921	Ga0496118_0004636	Ga0496118_0004636_10923_11423	165
686	3300048921	Ga0496118_0023728	Ga0496118_0023728_624_1121	165
687	3300048921	Ga0496118_0027341	Ga0496118_0027341_3390_3887	165
688	3300048921	Ga0496118_0078264	Ga0496118_0078264_677_1174	165
689	3300048922	Ga0496119_0012920	Ga0496119_0012920_6158_6655	165
690	3300048922	Ga0496119_0024130	Ga0496119_0024130_3562_4059	165
691	3300048922	Ga0496119_0041712	Ga0496119_0041712_2076_2573	165
692	3300048922	Ga0496119_0046892	Ga0496119_0046892_1661_2158	165
693	3300048922	Ga0496119_0066220	Ga0496119_0066220_1269_1766	165
694	3300048922	Ga0496119_0069863	Ga0496119_0069863_142_639	165
695	3300048922	Ga0496119_0090750	Ga0496119_0090750_999_1496	165
696	3300048922	Ga0496119_0241108	Ga0496119_0241108_390_893	165
697	3300048923	Ga0496120_0000309	Ga0496120_0000309_22226_22723	165
698	3300048923	Ga0496120_0024822	Ga0496120_0024822_695_1192	165
699	3300048923	Ga0496120_0061705	Ga0496120_0061705_604_1101	165
700	3300048923	Ga0496120_0126591	Ga0496120_0126591_202_699	165
701	3300048923	Ga0496120_0156937	Ga0496120_0156937_392_889	165
702	3300048923	Ga0496120_0197631	Ga0496120_0197631_283_780	165
703	3300048924	Ga0496121_0001287	Ga0496121_0001287_10086_10583	165
704	3300048924	Ga0496121_0002836	Ga0496121_0002836_9419_9916	165
705	3300048924	Ga0496121_0009257	Ga0496121_0009257_5462_5959	165
706	3300048924	Ga0496121_0014795	Ga0496121_0014795_677_1174	165
707	3300048924	Ga0496121_0019082	Ga0496121_0019082_2730_3227	165
708	3300048924	Ga0496121_0020642	Ga0496121_0020642_5801_6298	165
709	3300048924	Ga0496121_0023780	Ga0496121_0023780_593_1090	165
710	3300048924	Ga0496121_0025505	Ga0496121_0025505_2129_2626	165
711	3300048924	Ga0496121_0034993	Ga0496121_0034993_127_624	165
712	3300048924	Ga0496121_0044494	Ga0496121_0044494_2746_3243	165
713	3300048924	Ga0496121_0075202	Ga0496121_0075202_1388_1885	165
714	3300048924	Ga0496121_0128385	Ga0496121_0128385_977_1474	165
715	3300048924	Ga0496121_0129721	Ga0496121_0129721_1172_1669	165
716	3300048924	Ga0496121_0223713	Ga0496121_0223713_27_524	165
717	3300048925	Ga0496122_0000004	Ga0496122_0000004_402505_403002	165
718	3300048925	Ga0496122_0000414	Ga0496122_0000414_50939_51436	165
719	3300048925	Ga0496122_0004472	Ga0496122_0004472_979_1476	165
720	3300048925	Ga0496122_0016318	Ga0496122_0016318_388_885	165
721	3300048925	Ga0496122_0027013	Ga0496122_0027013_405_902	165
722	3300048925	Ga0496122_0027041	Ga0496122_0027041_3950_4447	165
723	3300048925	Ga0496122_0038145	Ga0496122_0038145_2279_2776	165
724	3300048925	Ga0496122_0078425	Ga0496122_0078425_563_1060	165
725	3300048925	Ga0496122_0083743	Ga0496122_0083743_634_1131	165
726	3300048925	Ga0496122_0090029	Ga0496122_0090029_298_795	165
727	3300048925	Ga0496122_0093356	Ga0496122_0093356_920_1417	165
728	3300048925	Ga0496122_0103890	Ga0496122_0103890_525_1022	165
729	3300048925	Ga0496122_0133124	Ga0496122_0133124_363_866	165
730	3300048925	Ga0496122_0148042	Ga0496122_0148042_483_980	165
731	3300048925	Ga0496122_0218112	Ga0496122_0218112_259_756	165
732	3300048926	Ga0496123_0000007	Ga0496123_0000007_402505_403002	165
733	3300048926	Ga0496123_0000147	Ga0496123_0000147_127209_127706	165
734	3300048926	Ga0496123_0004704	Ga0496123_0004704_5237_5734	165
735	3300048926	Ga0496123_0009287	Ga0496123_0009287_516_1013	165
736	3300048926	Ga0496123_0035340	Ga0496123_0035340_564_1061	165
737	3300048926	Ga0496123_0037920	Ga0496123_0037920_2562_3059	165
738	3300048926	Ga0496123_0072249	Ga0496123_0072249_1107_1604	165
739	3300048926	Ga0496123_0076381	Ga0496123_0076381_1186_1683	165
740	3300048926	Ga0496123_0176583	Ga0496123_0176583_80_577	165
741	3300048926	Ga0496123_0185765	Ga0496123_0185765_412_909	165
742	3300048926	Ga0496123_0214230	Ga0496123_0214230_402_899	165
743	3300048926	Ga0496123_0237938	Ga0496123_0237938_382_879	165
744	3300048926	Ga0496123_0286424	Ga0496123_0286424_62_559	165
745	3300048927	Ga0496124_0000348	Ga0496124_0000348_57220_57717	165
746	3300048927	Ga0496124_0006920	Ga0496124_0006920_8110_8607	165
747	3300048927	Ga0496124_0014287	Ga0496124_0014287_594_1091	165
748	3300048927	Ga0496124_0016689	Ga0496124_0016689_1986_2483	165
749	3300048927	Ga0496124_0016988	Ga0496124_0016988_5727_6224	165
750	3300048927	Ga0496124_0024351	Ga0496124_0024351_572_1069	165
751	3300048927	Ga0496124_0033989	Ga0496124_0033989_3615_4112	165
752	3300048927	Ga0496124_0060381	Ga0496124_0060381_1069_1566	165
753	3300048927	Ga0496124_0065366	Ga0496124_0065366_441_938	165
754	3300048927	Ga0496124_0086611	Ga0496124_0086611_580_1077	165
755	3300048927	Ga0496124_0087575	Ga0496124_0087575_259_756	165
756	3300048927	Ga0496124_0090792	Ga0496124_0090792_1652_2149	165
757	3300048927	Ga0496124_0121346	Ga0496124_0121346_1153_1650	165
758	3300048927	Ga0496124_0189057	Ga0496124_0189057_822_1325	165
759	3300048927	Ga0496124_0256330	Ga0496124_0256330_47_550	165
760	3300048927	Ga0496124_0333557	Ga0496124_0333557_438_935	165
761	3300048927	Ga0496124_0539301	Ga0496124_0539301_234_731	165
762	3300048928	Ga0496125_0001144	Ga0496125_0001144_14418_14915	165
763	3300048928	Ga0496125_0001465	Ga0496125_0001465_2785_3282	165
764	3300048928	Ga0496125_0022507	Ga0496125_0022507_298_795	165
765	3300048928	Ga0496125_0029569	Ga0496125_0029569_632_1129	165
766	3300048928	Ga0496125_0035651	Ga0496125_0035651_3606_4103	165
767	3300048928	Ga0496125_0051306	Ga0496125_0051306_1936_2433	165
768	3300048928	Ga0496125_0088459	Ga0496125_0088459_398_895	165
769	3300048928	Ga0496125_0390359	Ga0496125_0390359_40_537	165
770	3300048928	Ga0496125_0438870	Ga0496125_0438870_56_553	165
771	3300048929	Ga0496126_0000188	Ga0496126_0000188_73471_73974	165
772	3300048929	Ga0496126_0000879	Ga0496126_0000879_36585_37082	165
773	3300048929	Ga0496126_0012445	Ga0496126_0012445_2286_2783	165
774	3300048929	Ga0496126_0026789	Ga0496126_0026789_84_581	165
775	3300048929	Ga0496126_0063420	Ga0496126_0063420_2696_3193	165
776	3300048929	Ga0496126_0105356	Ga0496126_0105356_1926_2423	165
777	3300048929	Ga0496126_0176748	Ga0496126_0176748_907_1404	165
778	3300048929	Ga0496126_0205108	Ga0496126_0205108_604_1101	165
779	3300048929	Ga0496126_0286753	Ga0496126_0286753_504_1001	165
780	3300048929	Ga0496126_0479075	Ga0496126_0479075_324_821	165
781	3300048929	Ga0496126_0909609	Ga0496126_0909609_45_542	165
782	3300048929	Ga0496126_0992794	Ga0496126_0992794_45_542	165
783	3300049459	Ga0495678_008240	Ga0495678_008240_3895_4392	165
784	3300049459	Ga0495678_030026	Ga0495678_030026_1367_1864	165
785	3300049459	Ga0495678_124410	Ga0495678_124410_238_735	165
786	3300049460	Ga0495682_0131299	Ga0495682_0131299_70_567	165
787	3300049569	Ga0501032_0055328	Ga0501032_0055328_319_816	165
788	3300049569	Ga0501032_0083701	Ga0501032_0083701_1302_1799	165
789	3300049570	Ga0501033_0088013	Ga0501033_0088013_227_724	165
790	3300049571	Ga0501034_0056607	Ga0501034_0056607_664_1161	165
791	3300049571	Ga0501034_0233824	Ga0501034_0233824_294_791	165
792	3300049572	Ga0501036_0050174	Ga0501036_0050174_2717_3214	165
793	3300049572	Ga0501036_0144141	Ga0501036_0144141_1356_1853	165
794	3300049573	Ga0501037_0068354	Ga0501037_0068354_1594_2091	165
795	3300049574	Ga0501038_0106209	Ga0501038_0106209_1367_1864	165
796	3300049575	Ga0501039_0040985	Ga0501039_0040985_72_569	165
797	3300049579	Ga0501043_0042912	Ga0501043_0042912_1363_1860	165
798	3300049579	Ga0501043_0219572	Ga0501043_0219572_269_766	165
799	3300049581	Ga0501047_0213966	Ga0501047_0213966_1100_1597	165
800	3300049582	Ga0501048_0124339	Ga0501048_0124339_640_1137	165
801	3300049589	Ga0501073_0371548	Ga0501073_0371548_80_577	165
802	3300049742	Ga0501080_0110220	Ga0501080_0110220_322_819	165
803	3300049744	Ga0501083_0347377	Ga0501083_0347377_29_526	165
804	3300049822	Ga0501035_0046668	Ga0501035_0046668_1478_1975	165
805	3300049823	Ga0501044_0051657	Ga0501044_0051657_3354_3851	165
806	3300049824	Ga0501045_0247987	Ga0501045_0247987_452_949	165
807	3300050489	nmdc:mga03683_5823_c1	nmdc:mga03683_5823_c1_2699_3199	165
808	3300050490	nmdc:mga03n38_167739_c1	nmdc:mga03n38_167739_c1_488_988	165
809	3300050490	nmdc:mga03n38_62536_c1	nmdc:mga03n38_62536_c1_978_1475	165
810	3300050490	nmdc:mga03n38_670868_c1	nmdc:mga03n38_670868_c1_65_562	165
811	3300050491	nmdc:mga00v17_144_c1	nmdc:mga00v17_144_c1_31645_32142	165
812	3300050491	nmdc:mga00v17_19824_c1	nmdc:mga00v17_19824_c1_1099_1596	165
813	3300050491	nmdc:mga00v17_7_c1	nmdc:mga00v17_7_c1_27782_28279	165
814	3300050492	nmdc:mga0yw44_19943_c1	nmdc:mga0yw44_19943_c1_325_825	165
815	3300050492	nmdc:mga0yw44_40104_c1	nmdc:mga0yw44_40104_c1_2005_2502	165
816	3300050492	nmdc:mga0yw44_61836_c1	nmdc:mga0yw44_61836_c1_1782_2279	165
817	3300050493	nmdc:mga0k408_14201_c1	nmdc:mga0k408_14201_c1_2577_3074	165
818	3300050493	nmdc:mga0k408_44480_c1	nmdc:mga0k408_44480_c1_527_1027	165
819	3300050494	nmdc:mga06z11_20051_c1	nmdc:mga06z11_20051_c1_462_959	165
820	3300050494	nmdc:mga06z11_253717_c1	nmdc:mga06z11_253717_c1_444_941	165
821	3300050495	nmdc:mga04h51_147569_c1	nmdc:mga04h51_147569_c1_335_832	165
822	3300050496	nmdc:mga07m45_296705_c1	nmdc:mga07m45_296705_c1_99_596	165
823	3300050496	nmdc:mga07m45_435_c1	nmdc:mga07m45_435_c1_4898_5398	165
824	3300050516	nmdc:mga0sz30_12651_c1	nmdc:mga0sz30_12651_c1_1681_2181	165
825	3300050516	nmdc:mga0sz30_1942_c1	nmdc:mga0sz30_1942_c1_3104_3601	165
826	3300050516	nmdc:mga0sz30_20686_c1	nmdc:mga0sz30_20686_c1_302_799	165
827	3300050516	nmdc:mga0sz30_4853_c1	nmdc:mga0sz30_4853_c1_445_942	165
828	3300050516	nmdc:mga0sz30_55891_c1	nmdc:mga0sz30_55891_c1_313_810	165
829	3300053077	Ga0495601_0072051	Ga0495601_0072051_705_1202	165
830	3300053079	Ga0500610_0086482	Ga0500610_0086482_557_1054	165
831	3300053086	Ga0500578_0060936	Ga0500578_0060936_1824_2321	165
832	3300053092	Ga0500583_0476743	Ga0500583_0476743_40_537	165
833	3300053093	Ga0500651_0094771	Ga0500651_0094771_121_618	165
834	3300053105	Ga0500557_003467	Ga0500557_003467_1955_2452	165
835	3300053107	Ga0500560_096910	Ga0500560_096910_337_834	165
836	3300053109	Ga0500569_007398	Ga0500569_007398_1828_2325	165
837	3300053118	Ga0500594_0001767	Ga0500594_0001767_3236_3733	165
838	3300053121	Ga0500607_248561	Ga0500607_248561_72_569	165
839	3300053125	Ga0500618_000056	Ga0500618_000056_11699_12196	165
840	3300053125	Ga0500618_008675	Ga0500618_008675_2182_2679	165
841	3300053125	Ga0500618_040706	Ga0500618_040706_181_678	165
842	3300053134	Ga0500658_0113569	Ga0500658_0113569_502_999	165
843	3300053134	Ga0500658_0123087	Ga0500658_0123087_65_565	165
844	3300053137	Ga0500561_0000236	Ga0500561_0000236_3934_4431	165
845	3300053139	Ga0500568_0001459	Ga0500568_0001459_4952_5449	165
846	3300053139	Ga0500568_0007906	Ga0500568_0007906_411_908	165
847	3300053140	Ga0500573_0032288	Ga0500573_0032288_259_756	165
848	3300053146	Ga0500588_0013233	Ga0500588_0013233_1108_1605	165
849	3300053151	Ga0500604_0048553	Ga0500604_0048553_361_858	165
850	3300053153	Ga0500616_0000363	Ga0500616_0000363_44543_45040	165
851	3300053153	Ga0500616_0005056	Ga0500616_0005056_3034_3531	165
852	3300053155	Ga0500620_040580	Ga0500620_040580_843_1340	165
853	3300053156	Ga0500622_0001665	Ga0500622_0001665_5301_5798	165
854	3300053157	Ga0500624_049336	Ga0500624_049336_107_604	165
855	3300053160	Ga0500633_0001402	Ga0500633_0001402_183_680	165
856	3300053161	Ga0500634_0019481	Ga0500634_0019481_304_801	165
857	3300053177	Ga0500636_0000003	Ga0500636_0000003_19104_19601	165
858	3300053177	Ga0500636_0001041	Ga0500636_0001041_4604_5101	165
859	3300053177	Ga0500636_0231095	Ga0500636_0231095_376_873	165
860	3300053730	Ga0500645_025193	Ga0500645_025193_1147_1644	165
861	iso_pu_bacteria	2599185156	2599332042	166
862	iso_pu_bacteria	2842922631	2842924377	166
863	3300049776	Ga0501280_006841	Ga0501280_006841_129_638	168
864	iso_pu_bacteria	2757320392	2757571573	168
865	3300025294	Ga0209025_1000152	Ga0209025_100015233	170
866	3300025297	Ga0209758_1008712	Ga0209758_10087128	170
867	iso_pu_bacteria	2585427608	2585898530	172
868	iso_pu_bacteria	2667528174	2671111160	172
869	iso_pu_bacteria	8005682033	8005682613	172
870	3300048919	Ga0496116_0162805	Ga0496116_0162805_148_675	175
871	3300048923	Ga0496120_0163707	Ga0496120_0163707_127_654	175
872	3300001979	JGI24740J21852_10007862	JGI24740J21852_100078622	176
873	3300002737	JGI25162J39368_1000272	JGI25162J39368_100027239	176
874	3300002737	JGI25162J39368_1000416	JGI25162J39368_10004169	176
875	3300003214	JGI25165J46597_1000363	JGI25165J46597_100036337	176
876	3300025233	Ga0209437_100060	Ga0209437_100060241	176
877	3300025254	Ga0209148_1022470	Ga0209148_10224701	176
878	3300025261	Ga0209233_1000095	Ga0209233_100009513	176
879	3300026078	Ga0207702_10034211	Ga0207702_100342116	176
880	3300045976	Ga0466967_0060709	Ga0466967_0060709_625_1155	176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

11

170

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5z5m-assembly1.cif.gz_D	crystal structure of (s)-allantoin synthase	0.9364	14	173
5z5m-assembly1.cif.gz_A	crystal structure of (s)-allantoin synthase	0.9346	14	173
5z5m-assembly1.cif.gz_B	crystal structure of (s)-allantoin synthase	0.9094	14	173
2o8i-assembly1.cif.gz_A-2	crystal structure of protein atu2327 from agrobacterium tumefaciens str. c58	0.8955	12	176
2o8i-assembly1.cif.gz_A-2	crystal structure of protein atu2327 from agrobacterium tumefaciens str. c58	0.8901	12	176

ID	Description	Score	Start	End	Superfamily
2o8iA00	Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	0.8965	13	176	1.10.3330.10
2o8iA00	Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	0.891	13	176	1.10.3330.10
2o70F00	Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	0.8688	13	172	1.10.3330.10
2o70F00	Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	0.8118	13	172	1.10.3330.10
3o7iB00	Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	0.7947	13	173	1.10.3330.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q3YCL0-F1-model_v4	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97)	0.9879	104	175	GO:0005777 GO:0006144 GO:0019628 GO:0051997
AF-A0A4Q3YCL0-F1-model_v4	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97)	0.9745	104	175	GO:0005777 GO:0006144 GO:0019628 GO:0051997
AF-A0A644V0B9-F1-model_v4	NodB homology domain-containing protein	0.9396	12	174	GO:0000255 GO:0005975 GO:0006144 GO:0016810 GO:0019628 GO:0051997
AF-A0A2T5B185-F1-model_v4	Ureidoglycolate lyase (EC 4.3.2.3) (Ureidoglycolatase)	0.9353	13	176	GO:0000256 GO:0004848 GO:0005777 GO:0006145 GO:0019628 GO:0050385 GO:0051997
AF-A0A259D081-F1-model_v4	Chitooligosaccharide deacetylase (Nodulation protein B)	0.9335	12	174	GO:0000255 GO:0005975 GO:0006144 GO:0016810 GO:0019628 GO:0051997

Feature Viewer

pLDDT	pTM	Quality
86.59	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F484475

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF09349

OHCU_decarbox

OHCU decarboxylase

11

170

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map