F484423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 396 | 857 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_11367166|Ga0105245_113671662 |
| Length | 104 |
| Sequence | MLMFDWMAWTLPVAVFFSAIVLMLAGMTVWELRSPTVLRKGWLPMATTRGDRLFIGLLVAAYVNLGFVAVSEKMVGWFGLEAEPSIWISFVVSMLVLGLILRKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 11 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 12 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 13 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 14 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 15 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 16 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 17 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 18 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 19 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 233 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 234 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 235 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 240 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 241 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 242 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 246 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 249 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 250 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 251 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 252 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 253 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 254 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 255 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 256 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 257 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 258 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 259 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 260 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 261 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 265 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 392 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 394 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 395 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 396 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.61 |
| Metatranscriptomes | 0 |
| Isolates | 2.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 0.68 |
| Rhizoplane | 3.53 |
| Rhizosphere | 84.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_622859 | 2162886007 | Bacteria | 2206 |
| 2 | JGI24034J26672_10092086 | 3300002239 | Bacteria | 564 |
| 3 | JGI25154J39366_1001328 | 3300002738 | Bacteria | 9141 |
| 4 | JGI25157J39369_1000174 | 3300002741 | Bacteria | 54162 |
| 5 | rootL2_10070942 | 3300003322 | Bacteria | 1057 |
| 6 | Ga0055539_1000945 | 3300003752 | Bacteria | 6475 |
| 7 | Ga0055524_1000382 | 3300003775 | Bacteria | 38462 |
| 8 | Ga0055524_1015212 | 3300003775 | Bacteria | 2816 |
| 9 | Ga0055530_10010753 | 3300003791 | Bacteria | 3345 |
| 10 | Ga0055530_10011777 | 3300003791 | Bacteria | 3108 |
| 11 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 12 | Ga0055531_10006835 | 3300003794 | Bacteria | 6365 |
| 13 | Ga0055543_1038120 | 3300004625 | Bacteria | 819 |
| 14 | Ga0065165_1000086 | 3300005262 | Bacteria | 154235 |
| 15 | Ga0065165_1000235 | 3300005262 | Bacteria | 96698 |
| 16 | Ga0065165_1002164 | 3300005262 | Bacteria | 17774 |
| 17 | Ga0065704_10018733 | 3300005289 | Bacteria | 2347 |
| 18 | Ga0065704_10073318 | 3300005289 | Bacteria | 7317 |
| 19 | Ga0065704_10079152 | 3300005289 | Bacteria | 4245 |
| 20 | Ga0065712_10163129 | 3300005290 | Bacteria | 1289 |
| 21 | Ga0065715_10031625 | 3300005293 | Bacteria | 1297 |
| 22 | Ga0065715_10153014 | 3300005293 | Bacteria | 1702 |
| 23 | Ga0070658_10203857 | 3300005327 | Bacteria | 1669 |
| 24 | Ga0070658_10491275 | 3300005327 | Bacteria | 1060 |
| 25 | Ga0070658_10669654 | 3300005327 | Bacteria | 900 |
| 26 | Ga0070658_11061572 | 3300005327 | Bacteria | 704 |
| 27 | Ga0070676_10048163 | 3300005328 | Bacteria | 2491 |
| 28 | Ga0070676_10194982 | 3300005328 | Bacteria | 1324 |
| 29 | Ga0070676_10973277 | 3300005328 | Bacteria | 635 |
| 30 | Ga0070683_101185393 | 3300005329 | Bacteria | 734 |
| 31 | Ga0070690_100128237 | 3300005330 | Bacteria | 1710 |
| 32 | Ga0070690_100253544 | 3300005330 | Bacteria | 1245 |
| 33 | Ga0070690_100368195 | 3300005330 | Bacteria | 1047 |
| 34 | Ga0070670_100052022 | 3300005331 | Bacteria | 3517 |
| 35 | Ga0070670_100307809 | 3300005331 | Bacteria | 1386 |
| 36 | Ga0070670_100912905 | 3300005331 | Bacteria | 796 |
| 37 | Ga0070677_10016375 | 3300005333 | Bacteria | 2638 |
| 38 | Ga0070677_10041064 | 3300005333 | Bacteria | 1824 |
| 39 | Ga0070677_10088814 | 3300005333 | Bacteria | 1340 |
| 40 | Ga0070677_10146526 | 3300005333 | Bacteria | 1094 |
| 41 | Ga0070677_10276150 | 3300005333 | Bacteria | 845 |
| 42 | Ga0070677_10423421 | 3300005333 | Bacteria | 706 |
| 43 | Ga0068869_100166463 | 3300005334 | Bacteria | 1719 |
| 44 | Ga0068869_100258495 | 3300005334 | Bacteria | 1393 |
| 45 | Ga0068869_100415755 | 3300005334 | Bacteria | 1109 |
| 46 | Ga0068869_100682419 | 3300005334 | Bacteria | 874 |
| 47 | Ga0070666_10015740 | 3300005335 | Bacteria | 4829 |
| 48 | Ga0070682_100403372 | 3300005337 | Bacteria | 1035 |
| 49 | Ga0070682_100523732 | 3300005337 | Bacteria | 923 |
| 50 | Ga0070682_100811867 | 3300005337 | Bacteria | 761 |
| 51 | Ga0068868_100018613 | 3300005338 | Bacteria | 5196 |
| 52 | Ga0068868_100148109 | 3300005338 | Bacteria | 1931 |
| 53 | Ga0068868_100299517 | 3300005338 | Bacteria | 1365 |
| 54 | Ga0068868_100303460 | 3300005338 | Bacteria | 1356 |
| 55 | Ga0070660_100364435 | 3300005339 | Bacteria | 1191 |
| 56 | Ga0070660_101588086 | 3300005339 | Bacteria | 557 |
| 57 | Ga0070689_100456834 | 3300005340 | Bacteria | 1088 |
| 58 | Ga0070687_100003481 | 3300005343 | Bacteria | 6122 |
| 59 | Ga0070687_100146873 | 3300005343 | Bacteria | 1379 |
| 60 | Ga0070687_100767905 | 3300005343 | Bacteria | 680 |
| 61 | Ga0070687_101459898 | 3300005343 | Bacteria | 513 |
| 62 | Ga0070661_100779258 | 3300005344 | Bacteria | 783 |
| 63 | Ga0070692_10172546 | 3300005345 | Bacteria | 1248 |
| 64 | Ga0070668_100071204 | 3300005347 | Bacteria | 2708 |
| 65 | Ga0070668_100102676 | 3300005347 | Bacteria | 2267 |
| 66 | Ga0070668_100747379 | 3300005347 | Bacteria | 865 |
| 67 | Ga0070669_100001506 | 3300005353 | Bacteria | 16829 |
| 68 | Ga0070669_100220474 | 3300005353 | Bacteria | 1499 |
| 69 | Ga0070669_100440320 | 3300005353 | Bacteria | 1072 |
| 70 | Ga0070669_100516458 | 3300005353 | Bacteria | 992 |
| 71 | Ga0070675_100003048 | 3300005354 | Bacteria | 12649 |
| 72 | Ga0070675_100009934 | 3300005354 | Bacteria | 7422 |
| 73 | Ga0070675_100253990 | 3300005354 | Bacteria | 1539 |
| 74 | Ga0070675_100394423 | 3300005354 | Bacteria | 1234 |
| 75 | Ga0070675_100905371 | 3300005354 | Bacteria | 809 |
| 76 | Ga0070671_100237680 | 3300005355 | Bacteria | 1546 |
| 77 | Ga0070671_100318425 | 3300005355 | Bacteria | 1325 |
| 78 | Ga0070671_100432731 | 3300005355 | Bacteria | 1127 |
| 79 | Ga0070671_100494677 | 3300005355 | Bacteria | 1052 |
| 80 | Ga0070671_100820366 | 3300005355 | Bacteria | 810 |
| 81 | Ga0070674_100027773 | 3300005356 | Bacteria | 3711 |
| 82 | Ga0070674_100107096 | 3300005356 | Bacteria | 2046 |
| 83 | Ga0070674_100453939 | 3300005356 | Bacteria | 1058 |
| 84 | Ga0070674_100863989 | 3300005356 | Bacteria | 785 |
| 85 | Ga0070673_100059360 | 3300005364 | Bacteria | 3027 |
| 86 | Ga0070673_100107956 | 3300005364 | Bacteria | 2303 |
| 87 | Ga0070673_100253974 | 3300005364 | Bacteria | 1533 |
| 88 | Ga0070673_100337151 | 3300005364 | Bacteria | 1335 |
| 89 | Ga0070673_100344921 | 3300005364 | Bacteria | 1320 |
| 90 | Ga0070673_100755709 | 3300005364 | Bacteria | 895 |
| 91 | Ga0070688_100154552 | 3300005365 | Bacteria | 1571 |
| 92 | Ga0070688_100360558 | 3300005365 | Bacteria | 1066 |
| 93 | Ga0070688_101644674 | 3300005365 | Bacteria | 525 |
| 94 | Ga0070659_101839304 | 3300005366 | Bacteria | 543 |
| 95 | Ga0070667_100000636 | 3300005367 | Bacteria | 34113 |
| 96 | Ga0070667_100069176 | 3300005367 | Bacteria | 3004 |
| 97 | Ga0070667_100482849 | 3300005367 | Bacteria | 1134 |
| 98 | Ga0070701_10121211 | 3300005438 | Bacteria | 1474 |
| 99 | Ga0070700_100209859 | 3300005441 | Bacteria | 1373 |
| 100 | Ga0070700_100455380 | 3300005441 | Bacteria | 974 |
| 101 | Ga0070700_101274356 | 3300005441 | Bacteria | 617 |
| 102 | Ga0070663_100300621 | 3300005455 | Bacteria | 1284 |
| 103 | Ga0070663_100521381 | 3300005455 | Bacteria | 989 |
| 104 | Ga0070663_100709399 | 3300005455 | Bacteria | 856 |
| 105 | Ga0070678_100062277 | 3300005456 | Bacteria | 2754 |
| 106 | Ga0070678_100198110 | 3300005456 | Bacteria | 1656 |
| 107 | Ga0070678_100218706 | 3300005456 | Bacteria | 1582 |
| 108 | Ga0070678_100257296 | 3300005456 | Bacteria | 1466 |
| 109 | Ga0070678_100826670 | 3300005456 | Bacteria | 843 |
| 110 | Ga0070678_100919308 | 3300005456 | Bacteria | 801 |
| 111 | Ga0070678_101058824 | 3300005456 | Bacteria | 747 |
| 112 | Ga0070662_100025582 | 3300005457 | Bacteria | 4077 |
| 113 | Ga0070662_100208630 | 3300005457 | Bacteria | 1553 |
| 114 | Ga0070662_100435297 | 3300005457 | Bacteria | 1087 |
| 115 | Ga0070662_100722567 | 3300005457 | Bacteria | 843 |
| 116 | Ga0070662_101220483 | 3300005457 | Bacteria | 647 |
| 117 | Ga0070681_11558058 | 3300005458 | Bacteria | 586 |
| 118 | Ga0068867_100043717 | 3300005459 | Bacteria | 3280 |
| 119 | Ga0068867_100156473 | 3300005459 | Bacteria | 1794 |
| 120 | Ga0068867_100205564 | 3300005459 | Bacteria | 1578 |
| 121 | Ga0068867_100261755 | 3300005459 | Bacteria | 1410 |
| 122 | Ga0068867_100514033 | 3300005459 | Bacteria | 1031 |
| 123 | Ga0068867_100546159 | 3300005459 | Bacteria | 1003 |
| 124 | Ga0070685_10621566 | 3300005466 | Bacteria | 780 |
| 125 | Ga0070685_10917188 | 3300005466 | Bacteria | 653 |
| 126 | Ga0070685_11064154 | 3300005466 | Bacteria | 610 |
| 127 | Ga0070706_101409192 | 3300005467 | Bacteria | 638 |
| 128 | Ga0070699_101220288 | 3300005518 | Bacteria | 690 |
| 129 | Ga0068853_100979768 | 3300005539 | Bacteria | 813 |
| 130 | Ga0070672_100113604 | 3300005543 | Bacteria | 2210 |
| 131 | Ga0070672_100123907 | 3300005543 | Bacteria | 2118 |
| 132 | Ga0070672_100136764 | 3300005543 | Bacteria | 2018 |
| 133 | Ga0070672_100334203 | 3300005543 | Bacteria | 1289 |
| 134 | Ga0070672_100405930 | 3300005543 | Bacteria | 1168 |
| 135 | Ga0070672_100602915 | 3300005543 | Bacteria | 956 |
| 136 | Ga0070672_100613309 | 3300005543 | Bacteria | 948 |
| 137 | Ga0070672_101583890 | 3300005543 | Bacteria | 587 |
| 138 | Ga0070686_100578765 | 3300005544 | Bacteria | 882 |
| 139 | Ga0070693_100066938 | 3300005547 | Bacteria | 2103 |
| 140 | Ga0070665_100367882 | 3300005548 | Bacteria | 1444 |
| 141 | Ga0070665_100827760 | 3300005548 | Bacteria | 939 |
| 142 | Ga0070665_100829676 | 3300005548 | Bacteria | 938 |
| 143 | Ga0070665_101191232 | 3300005548 | Bacteria | 773 |
| 144 | Ga0070665_102439554 | 3300005548 | Bacteria | 525 |
| 145 | Ga0068855_101115339 | 3300005563 | Bacteria | 824 |
| 146 | Ga0070664_100088261 | 3300005564 | Bacteria | 2681 |
| 147 | Ga0070664_100774111 | 3300005564 | Bacteria | 896 |
| 148 | Ga0070664_100943343 | 3300005564 | Bacteria | 810 |
| 149 | Ga0068857_100096958 | 3300005577 | Bacteria | 2643 |
| 150 | Ga0068857_100945877 | 3300005577 | Bacteria | 828 |
| 151 | Ga0068857_102403231 | 3300005577 | Bacteria | 517 |
| 152 | Ga0068854_100050348 | 3300005578 | Bacteria | 2980 |
| 153 | Ga0068854_100089851 | 3300005578 | Bacteria | 2283 |
| 154 | Ga0068854_101217028 | 3300005578 | Bacteria | 675 |
| 155 | Ga0068854_101279733 | 3300005578 | Bacteria | 659 |
| 156 | Ga0068856_100006961 | 3300005614 | Bacteria | 11051 |
| 157 | Ga0068856_101153095 | 3300005614 | Bacteria | 792 |
| 158 | Ga0068852_100033115 | 3300005616 | Bacteria | 4287 |
| 159 | Ga0068852_100238247 | 3300005616 | Bacteria | 1737 |
| 160 | Ga0068852_100589195 | 3300005616 | Bacteria | 1115 |
| 161 | Ga0068859_100428329 | 3300005617 | Bacteria | 1419 |
| 162 | Ga0068859_100470474 | 3300005617 | Bacteria | 1352 |
| 163 | Ga0068864_100011000 | 3300005618 | Bacteria | 7483 |
| 164 | Ga0068864_100110373 | 3300005618 | Bacteria | 2449 |
| 165 | Ga0068864_100734640 | 3300005618 | Bacteria | 966 |
| 166 | Ga0068864_100819805 | 3300005618 | Bacteria | 915 |
| 167 | Ga0068864_100835979 | 3300005618 | Bacteria | 907 |
| 168 | Ga0068866_10002802 | 3300005718 | Bacteria | 7184 |
| 169 | Ga0068866_10140780 | 3300005718 | Bacteria | 1384 |
| 170 | Ga0068861_100029369 | 3300005719 | Bacteria | 4022 |
| 171 | Ga0068861_100048999 | 3300005719 | Bacteria | 3197 |
| 172 | Ga0068861_100317165 | 3300005719 | Bacteria | 1356 |
| 173 | Ga0068861_100719556 | 3300005719 | Bacteria | 929 |
| 174 | Ga0068851_10022006 | 3300005834 | Bacteria | 3100 |
| 175 | Ga0068851_10044340 | 3300005834 | Bacteria | 2244 |
| 176 | Ga0068851_10138554 | 3300005834 | Bacteria | 1321 |
| 177 | Ga0068851_10687891 | 3300005834 | Bacteria | 629 |
| 178 | Ga0068870_10018727 | 3300005840 | Bacteria | 3348 |
| 179 | Ga0068870_10723962 | 3300005840 | Bacteria | 689 |
| 180 | Ga0068870_10742945 | 3300005840 | Bacteria | 681 |
| 181 | Ga0068863_100347175 | 3300005841 | Bacteria | 1444 |
| 182 | Ga0068863_100406994 | 3300005841 | Bacteria | 1331 |
| 183 | Ga0068863_100647952 | 3300005841 | Bacteria | 1047 |
| 184 | Ga0068863_100696704 | 3300005841 | Bacteria | 1009 |
| 185 | Ga0068858_100000721 | 3300005842 | Bacteria | 34455 |
| 186 | Ga0068858_100002624 | 3300005842 | Bacteria | 18113 |
| 187 | Ga0068860_100003703 | 3300005843 | Bacteria | 15733 |
| 188 | Ga0068860_100524590 | 3300005843 | Bacteria | 1184 |
| 189 | Ga0068860_101347548 | 3300005843 | Bacteria | 735 |
| 190 | Ga0068860_101968014 | 3300005843 | Bacteria | 606 |
| 191 | Ga0068862_100017098 | 3300005844 | Bacteria | 6034 |
| 192 | Ga0068862_100978976 | 3300005844 | Bacteria | 835 |
| 193 | Ga0068862_101527577 | 3300005844 | Bacteria | 673 |
| 194 | Ga0068862_101869952 | 3300005844 | Bacteria | 610 |
| 195 | Ga0068862_102632025 | 3300005844 | Bacteria | 515 |
| 196 | Ga0075432_10013205 | 3300006058 | Bacteria | 2805 |
| 197 | Ga0075432_10494639 | 3300006058 | Bacteria | 544 |
| 198 | Ga0075362_10110692 | 3300006177 | Bacteria | 1292 |
| 199 | Ga0075362_10235047 | 3300006177 | Bacteria | 898 |
| 200 | Ga0075369_10182526 | 3300006186 | Bacteria | 966 |
| 201 | Ga0075366_10062979 | 3300006195 | Bacteria | 2204 |
| 202 | Ga0075366_10091996 | 3300006195 | Bacteria | 1817 |
| 203 | Ga0075366_10227483 | 3300006195 | Bacteria | 1136 |
| 204 | Ga0097621_100028049 | 3300006237 | Bacteria | 4434 |
| 205 | Ga0097621_100165746 | 3300006237 | Bacteria | 1902 |
| 206 | Ga0097621_100327733 | 3300006237 | Bacteria | 1357 |
| 207 | Ga0097621_100714484 | 3300006237 | Bacteria | 923 |
| 208 | Ga0075370_10012364 | 3300006353 | Bacteria | 4510 |
| 209 | Ga0075370_10403310 | 3300006353 | Bacteria | 820 |
| 210 | Ga0068871_100077610 | 3300006358 | Bacteria | 2745 |
| 211 | Ga0068871_100244764 | 3300006358 | Bacteria | 1560 |
| 212 | Ga0068871_100483152 | 3300006358 | Bacteria | 1114 |
| 213 | Ga0068871_100940012 | 3300006358 | Bacteria | 803 |
| 214 | Ga0068865_100016659 | 3300006881 | Bacteria | 4708 |
| 215 | Ga0068865_100054153 | 3300006881 | Bacteria | 2786 |
| 216 | Ga0068865_100288289 | 3300006881 | Bacteria | 1309 |
| 217 | Ga0068865_100450009 | 3300006881 | Bacteria | 1064 |
| 218 | Ga0068865_101090221 | 3300006881 | Bacteria | 703 |
| 219 | Ga0097620_100428333 | 3300006931 | Bacteria | 1419 |
| 220 | Ga0097620_100470479 | 3300006931 | Bacteria | 1352 |
| 221 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 222 | Ga0079104_1000027 | 3300006946 | Bacteria | 212641 |
| 223 | Ga0099794_10048468 | 3300007265 | Bacteria | 2039 |
| 224 | Ga0105251_10052712 | 3300009011 | Bacteria | 1936 |
| 225 | Ga0105251_10072590 | 3300009011 | Bacteria | 1600 |
| 226 | Ga0105244_10012038 | 3300009036 | Bacteria | 5143 |
| 227 | Ga0105244_10033396 | 3300009036 | Bacteria | 2713 |
| 228 | Ga0105244_10581851 | 3300009036 | Bacteria | 514 |
| 229 | Ga0105250_10000154 | 3300009092 | Bacteria | 59676 |
| 230 | Ga0105250_10019226 | 3300009092 | Bacteria | 2762 |
| 231 | Ga0105240_11185733 | 3300009093 | Bacteria | 809 |
| 232 | Ga0111539_11390303 | 3300009094 | Bacteria | 814 |
| 233 | Ga0111539_11445126 | 3300009094 | Bacteria | 798 |
| 234 | Ga0105245_10184159 | 3300009098 | Bacteria | 1997 |
| 235 | Ga0105245_10857767 | 3300009098 | Bacteria | 948 |
| 236 | Ga0105245_11367166 | 3300009098 | Bacteria | 758 |
| 237 | Ga0105243_10003470 | 3300009148 | Bacteria | 12726 |
| 238 | Ga0105243_10025635 | 3300009148 | Bacteria | 4508 |
| 239 | Ga0105243_10038716 | 3300009148 | Bacteria | 3714 |
| 240 | Ga0105243_10236538 | 3300009148 | Bacteria | 1623 |
| 241 | Ga0105243_10748371 | 3300009148 | Bacteria | 958 |
| 242 | Ga0105243_10935658 | 3300009148 | Bacteria | 865 |
| 243 | Ga0105241_10368179 | 3300009174 | Bacteria | 1252 |
| 244 | Ga0105242_10298386 | 3300009176 | Bacteria | 1470 |
| 245 | Ga0105242_10531949 | 3300009176 | Bacteria | 1124 |
| 246 | Ga0105242_12760961 | 3300009176 | Bacteria | 541 |
| 247 | Ga0105248_10217274 | 3300009177 | Bacteria | 2153 |
| 248 | Ga0105248_10439125 | 3300009177 | Bacteria | 1470 |
| 249 | Ga0105248_10579278 | 3300009177 | Bacteria | 1266 |
| 250 | Ga0105248_10710399 | 3300009177 | Bacteria | 1134 |
| 251 | Ga0105248_11737017 | 3300009177 | Bacteria | 707 |
| 252 | Ga0105248_11793542 | 3300009177 | Bacteria | 696 |
| 253 | Ga0105237_10563789 | 3300009545 | Bacteria | 1146 |
| 254 | Ga0105237_11156416 | 3300009545 | Bacteria | 780 |
| 255 | Ga0105238_10053271 | 3300009551 | Bacteria | 4066 |
| 256 | Ga0105238_13002724 | 3300009551 | Bacteria | 507 |
| 257 | Ga0105249_10050703 | 3300009553 | Bacteria | 3784 |
| 258 | Ga0105249_10060370 | 3300009553 | Bacteria | 3478 |
| 259 | Ga0105249_12660977 | 3300009553 | Bacteria | 572 |
| 260 | Ga0105246_10112314 | 3300011119 | Bacteria | 2004 |
| 261 | Ga0105246_10229796 | 3300011119 | Bacteria | 1460 |
| 262 | Ga0105246_10318705 | 3300011119 | Bacteria | 1262 |
| 263 | Ga0105246_10345022 | 3300011119 | Bacteria | 1218 |
| 264 | Ga0105246_10995853 | 3300011119 | Bacteria | 758 |
| 265 | Ga0157317_1008933 | 3300012475 | Bacteria | 744 |
| 266 | Ga0157373_10327042 | 3300013100 | Bacteria | 1091 |
| 267 | Ga0157371_10091369 | 3300013102 | Bacteria | 2156 |
| 268 | Ga0157370_10093734 | 3300013104 | Bacteria | 2818 |
| 269 | Ga0157370_11360677 | 3300013104 | Bacteria | 639 |
| 270 | Ga0157369_10093152 | 3300013105 | Bacteria | 3216 |
| 271 | Ga0157369_10227370 | 3300013105 | Bacteria | 1951 |
| 272 | Ga0157374_10182770 | 3300013296 | Bacteria | 2049 |
| 273 | Ga0157374_10488085 | 3300013296 | Bacteria | 1235 |
| 274 | Ga0157374_10903412 | 3300013296 | Bacteria | 901 |
| 275 | Ga0157378_10127654 | 3300013297 | Bacteria | 2351 |
| 276 | Ga0157378_10214102 | 3300013297 | Bacteria | 1828 |
| 277 | Ga0157378_10464615 | 3300013297 | Bacteria | 1258 |
| 278 | Ga0157378_10602115 | 3300013297 | Bacteria | 1110 |
| 279 | Ga0157378_10649221 | 3300013297 | Bacteria | 1071 |
| 280 | Ga0163162_10009904 | 3300013306 | Bacteria | 9269 |
| 281 | Ga0163162_10491909 | 3300013306 | Bacteria | 1357 |
| 282 | Ga0163162_10647169 | 3300013306 | Bacteria | 1181 |
| 283 | Ga0163162_10828502 | 3300013306 | Bacteria | 1041 |
| 284 | Ga0163162_13201861 | 3300013306 | Bacteria | 525 |
| 285 | Ga0157372_10921801 | 3300013307 | Bacteria | 1013 |
| 286 | Ga0157372_11053777 | 3300013307 | Bacteria | 941 |
| 287 | Ga0157375_10006157 | 3300013308 | Bacteria | 10454 |
| 288 | Ga0157375_10658984 | 3300013308 | Bacteria | 1202 |
| 289 | Ga0157375_10734816 | 3300013308 | Bacteria | 1139 |
| 290 | Ga0157375_10996008 | 3300013308 | Bacteria | 978 |
| 291 | Ga0157375_11057321 | 3300013308 | Bacteria | 949 |
| 292 | Ga0157375_11151019 | 3300013308 | Bacteria | 909 |
| 293 | Ga0157375_11392442 | 3300013308 | Bacteria | 826 |
| 294 | Ga0157375_11514486 | 3300013308 | Bacteria | 792 |
| 295 | Ga0163163_10039730 | 3300014325 | Bacteria | 4593 |
| 296 | Ga0163163_10738912 | 3300014325 | Bacteria | 1047 |
| 297 | Ga0157380_10014459 | 3300014326 | Bacteria | 5774 |
| 298 | Ga0157380_10422523 | 3300014326 | Bacteria | 1272 |
| 299 | Ga0157380_10609058 | 3300014326 | Bacteria | 1082 |
| 300 | Ga0157380_11501333 | 3300014326 | Bacteria | 727 |
| 301 | Ga0182008_10660699 | 3300014497 | Bacteria | 593 |
| 302 | Ga0157377_10574370 | 3300014745 | Bacteria | 800 |
| 303 | Ga0157379_10042622 | 3300014968 | Bacteria | 4052 |
| 304 | Ga0157379_10399680 | 3300014968 | Bacteria | 1263 |
| 305 | Ga0157379_10598042 | 3300014968 | Bacteria | 1029 |
| 306 | Ga0157379_10936175 | 3300014968 | Bacteria | 823 |
| 307 | Ga0157379_11188861 | 3300014968 | Bacteria | 733 |
| 308 | Ga0157376_10103351 | 3300014969 | Bacteria | 2494 |
| 309 | Ga0157376_10348138 | 3300014969 | Bacteria | 1417 |
| 310 | Ga0157376_10473703 | 3300014969 | Bacteria | 1226 |
| 311 | Ga0157376_10511515 | 3300014969 | Bacteria | 1182 |
| 312 | Ga0157376_10714935 | 3300014969 | Bacteria | 1008 |
| 313 | Ga0182007_10121101 | 3300015262 | Bacteria | 876 |
| 314 | Ga0163161_10044212 | 3300017792 | Bacteria | 3208 |
| 315 | Ga0163161_10246998 | 3300017792 | Bacteria | 1390 |
| 316 | Ga0163161_10328373 | 3300017792 | Bacteria | 1211 |
| 317 | Ga0163161_10408614 | 3300017792 | Bacteria | 1090 |
| 318 | Ga0163161_10853685 | 3300017792 | Bacteria | 768 |
| 319 | Ga0207427_100729 | 3300025231 | Bacteria | 15297 |
| 320 | Ga0209258_100773 | 3300025242 | Bacteria | 19494 |
| 321 | Ga0209646_1000066 | 3300025246 | Bacteria | 244823 |
| 322 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 323 | Ga0209677_102663 | 3300025253 | Bacteria | 6464 |
| 324 | Ga0209759_1000082 | 3300025256 | Bacteria | 169562 |
| 325 | Ga0209759_1000131 | 3300025256 | Bacteria | 130014 |
| 326 | Ga0209759_1012126 | 3300025256 | Bacteria | 2406 |
| 327 | Ga0209233_1073407 | 3300025261 | Bacteria | 627 |
| 328 | Ga0209565_1033593 | 3300025263 | Bacteria | 987 |
| 329 | Ga0209565_1043230 | 3300025263 | Bacteria | 832 |
| 330 | Ga0207666_1004820 | 3300025271 | Bacteria | 1705 |
| 331 | Ga0209455_1015512 | 3300025272 | Bacteria | 1671 |
| 332 | Ga0209673_1009232 | 3300025273 | Bacteria | 4298 |
| 333 | Ga0207673_1025987 | 3300025290 | Bacteria | 802 |
| 334 | Ga0209675_1004224 | 3300025291 | Bacteria | 6482 |
| 335 | Ga0209675_1021084 | 3300025291 | Bacteria | 1746 |
| 336 | Ga0209025_1002951 | 3300025294 | Bacteria | 16913 |
| 337 | Ga0209050_1001570 | 3300025298 | Bacteria | 23744 |
| 338 | Ga0209050_1002504 | 3300025298 | Bacteria | 15481 |
| 339 | Ga0209050_1005060 | 3300025298 | Bacteria | 8522 |
| 340 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 341 | Ga0209256_1000468 | 3300025299 | Bacteria | 60770 |
| 342 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 343 | Ga0209051_1035232 | 3300025303 | Bacteria | 1865 |
| 344 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 345 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 346 | Ga0207697_10177441 | 3300025315 | Bacteria | 933 |
| 347 | Ga0207697_10228982 | 3300025315 | Bacteria | 821 |
| 348 | Ga0207656_10068933 | 3300025321 | Bacteria | 1568 |
| 349 | Ga0207656_10299040 | 3300025321 | Bacteria | 796 |
| 350 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 351 | Ga0207696_1000388 | 3300025711 | Bacteria | 42044 |
| 352 | Ga0207696_1009529 | 3300025711 | Bacteria | 3617 |
| 353 | Ga0207655_1012271 | 3300025728 | Bacteria | 5023 |
| 354 | Ga0207655_1060337 | 3300025728 | Bacteria | 1471 |
| 355 | Ga0207713_1007575 | 3300025735 | Bacteria | 6373 |
| 356 | Ga0207713_1041352 | 3300025735 | Bacteria | 1924 |
| 357 | Ga0207682_10025426 | 3300025893 | Bacteria | 2348 |
| 358 | Ga0207682_10028376 | 3300025893 | Bacteria | 2233 |
| 359 | Ga0207682_10043637 | 3300025893 | Bacteria | 1836 |
| 360 | Ga0207682_10114007 | 3300025893 | Bacteria | 1192 |
| 361 | Ga0207682_10122081 | 3300025893 | Bacteria | 1156 |
| 362 | Ga0207682_10319624 | 3300025893 | Bacteria | 729 |
| 363 | Ga0207642_10155369 | 3300025899 | Bacteria | 1222 |
| 364 | Ga0207642_10267637 | 3300025899 | Bacteria | 977 |
| 365 | Ga0207642_10360036 | 3300025899 | Bacteria | 861 |
| 366 | Ga0207688_10260773 | 3300025901 | Bacteria | 1052 |
| 367 | Ga0207645_10160656 | 3300025907 | Bacteria | 1470 |
| 368 | Ga0207645_10200627 | 3300025907 | Bacteria | 1312 |
| 369 | Ga0207645_10273214 | 3300025907 | Bacteria | 1121 |
| 370 | Ga0207645_10497654 | 3300025907 | Bacteria | 825 |
| 371 | Ga0207645_10539898 | 3300025907 | Bacteria | 791 |
| 372 | Ga0207643_10043732 | 3300025908 | Bacteria | 2528 |
| 373 | Ga0207643_10166981 | 3300025908 | Bacteria | 1326 |
| 374 | Ga0207643_10404359 | 3300025908 | Bacteria | 863 |
| 375 | Ga0207643_10807544 | 3300025908 | Bacteria | 608 |
| 376 | Ga0207643_10876025 | 3300025908 | Bacteria | 582 |
| 377 | Ga0207705_10394423 | 3300025909 | Bacteria | 1070 |
| 378 | Ga0207705_10403274 | 3300025909 | Bacteria | 1058 |
| 379 | Ga0207705_10470124 | 3300025909 | Bacteria | 976 |
| 380 | Ga0207705_10761401 | 3300025909 | Bacteria | 752 |
| 381 | Ga0207654_11304631 | 3300025911 | Bacteria | 529 |
| 382 | Ga0207707_11099585 | 3300025912 | Bacteria | 648 |
| 383 | Ga0207695_10281430 | 3300025913 | Bacteria | 1557 |
| 384 | Ga0207695_11375810 | 3300025913 | Bacteria | 586 |
| 385 | Ga0207671_10157381 | 3300025914 | Bacteria | 1758 |
| 386 | Ga0207662_10075082 | 3300025918 | Bacteria | 2053 |
| 387 | Ga0207662_10171702 | 3300025918 | Bacteria | 1391 |
| 388 | Ga0207657_10184391 | 3300025919 | Bacteria | 1686 |
| 389 | Ga0207657_10577211 | 3300025919 | Bacteria | 878 |
| 390 | Ga0207657_11129387 | 3300025919 | Bacteria | 598 |
| 391 | Ga0207649_10234531 | 3300025920 | Bacteria | 1314 |
| 392 | Ga0207649_10285361 | 3300025920 | Bacteria | 1202 |
| 393 | Ga0207681_10001265 | 3300025923 | Bacteria | 16303 |
| 394 | Ga0207681_10061029 | 3300025923 | Bacteria | 2590 |
| 395 | Ga0207681_10626523 | 3300025923 | Bacteria | 890 |
| 396 | Ga0207681_10801055 | 3300025923 | Bacteria | 787 |
| 397 | Ga0207650_10027888 | 3300025925 | Bacteria | 4044 |
| 398 | Ga0207650_10033574 | 3300025925 | Bacteria | 3717 |
| 399 | Ga0207650_10123901 | 3300025925 | Bacteria | 2015 |
| 400 | Ga0207650_10151021 | 3300025925 | Bacteria | 1833 |
| 401 | Ga0207650_10600944 | 3300025925 | Bacteria | 925 |
| 402 | Ga0207659_10000404 | 3300025926 | Bacteria | 26034 |
| 403 | Ga0207659_10020879 | 3300025926 | Bacteria | 4337 |
| 404 | Ga0207659_10051122 | 3300025926 | Bacteria | 2938 |
| 405 | Ga0207659_10225781 | 3300025926 | Bacteria | 1508 |
| 406 | Ga0207659_10393978 | 3300025926 | Bacteria | 1157 |
| 407 | Ga0207687_10175537 | 3300025927 | Bacteria | 1656 |
| 408 | Ga0207687_10546540 | 3300025927 | Bacteria | 971 |
| 409 | Ga0207644_10001638 | 3300025931 | Bacteria | 14428 |
| 410 | Ga0207644_10257495 | 3300025931 | Bacteria | 1394 |
| 411 | Ga0207644_10332113 | 3300025931 | Bacteria | 1231 |
| 412 | Ga0207644_10666430 | 3300025931 | Bacteria | 866 |
| 413 | Ga0207644_10802138 | 3300025931 | Bacteria | 787 |
| 414 | Ga0207690_10220595 | 3300025932 | Bacteria | 1451 |
| 415 | Ga0207706_10074957 | 3300025933 | Bacteria | 2975 |
| 416 | Ga0207706_10279326 | 3300025933 | Bacteria | 1456 |
| 417 | Ga0207706_10465713 | 3300025933 | Bacteria | 1092 |
| 418 | Ga0207686_10165372 | 3300025934 | Bacteria | 1555 |
| 419 | Ga0207709_10000862 | 3300025935 | Bacteria | 23149 |
| 420 | Ga0207709_10015406 | 3300025935 | Bacteria | 4238 |
| 421 | Ga0207709_10230020 | 3300025935 | Bacteria | 1343 |
| 422 | Ga0207709_10676048 | 3300025935 | Bacteria | 824 |
| 423 | Ga0207670_10008848 | 3300025936 | Bacteria | 5706 |
| 424 | Ga0207670_10542006 | 3300025936 | Bacteria | 950 |
| 425 | Ga0207669_10071825 | 3300025937 | Bacteria | 2176 |
| 426 | Ga0207669_10574969 | 3300025937 | Bacteria | 912 |
| 427 | Ga0207669_10594578 | 3300025937 | Bacteria | 898 |
| 428 | Ga0207669_10755276 | 3300025937 | Bacteria | 803 |
| 429 | Ga0207669_10899012 | 3300025937 | Bacteria | 739 |
| 430 | Ga0207704_10067950 | 3300025938 | Bacteria | 2245 |
| 431 | Ga0207704_10253452 | 3300025938 | Bacteria | 1323 |
| 432 | Ga0207691_10156403 | 3300025940 | Bacteria | 2002 |
| 433 | Ga0207691_10300137 | 3300025940 | Bacteria | 1380 |
| 434 | Ga0207691_10314775 | 3300025940 | Bacteria | 1343 |
| 435 | Ga0207691_10371972 | 3300025940 | Bacteria | 1221 |
| 436 | Ga0207691_10371973 | 3300025940 | Bacteria | 1221 |
| 437 | Ga0207691_10559784 | 3300025940 | Bacteria | 969 |
| 438 | Ga0207691_11176543 | 3300025940 | Bacteria | 636 |
| 439 | Ga0207711_10071991 | 3300025941 | Bacteria | 3001 |
| 440 | Ga0207711_10107753 | 3300025941 | Bacteria | 2474 |
| 441 | Ga0207711_10150535 | 3300025941 | Bacteria | 2099 |
| 442 | Ga0207689_10092580 | 3300025942 | Bacteria | 2483 |
| 443 | Ga0207689_10182276 | 3300025942 | Bacteria | 1731 |
| 444 | Ga0207689_10250095 | 3300025942 | Bacteria | 1466 |
| 445 | Ga0207689_10323587 | 3300025942 | Bacteria | 1280 |
| 446 | Ga0207689_11140421 | 3300025942 | Bacteria | 657 |
| 447 | Ga0207679_11003892 | 3300025945 | Bacteria | 765 |
| 448 | Ga0207667_10188551 | 3300025949 | Bacteria | 2116 |
| 449 | Ga0207667_11012782 | 3300025949 | Bacteria | 817 |
| 450 | Ga0207651_10001391 | 3300025960 | Bacteria | 10965 |
| 451 | Ga0207651_10237856 | 3300025960 | Bacteria | 1482 |
| 452 | Ga0207651_10459673 | 3300025960 | Bacteria | 1093 |
| 453 | Ga0207651_10695255 | 3300025960 | Bacteria | 895 |
| 454 | Ga0207651_10701669 | 3300025960 | Bacteria | 891 |
| 455 | Ga0207651_10711587 | 3300025960 | Bacteria | 885 |
| 456 | Ga0207712_10013757 | 3300025961 | Bacteria | 5190 |
| 457 | Ga0207712_10135754 | 3300025961 | Bacteria | 1881 |
| 458 | Ga0207712_10638326 | 3300025961 | Bacteria | 924 |
| 459 | Ga0207712_11580209 | 3300025961 | Bacteria | 588 |
| 460 | Ga0207668_10002813 | 3300025972 | Bacteria | 10173 |
| 461 | Ga0207668_10309632 | 3300025972 | Bacteria | 1306 |
| 462 | Ga0207640_10001221 | 3300025981 | Bacteria | 14006 |
| 463 | Ga0207640_10318596 | 3300025981 | Bacteria | 1237 |
| 464 | Ga0207658_10001266 | 3300025986 | Bacteria | 19959 |
| 465 | Ga0207658_10002165 | 3300025986 | Bacteria | 14600 |
| 466 | Ga0207658_10273364 | 3300025986 | Bacteria | 1445 |
| 467 | Ga0207658_11933204 | 3300025986 | Bacteria | 537 |
| 468 | Ga0207677_10000556 | 3300026023 | Bacteria | 23580 |
| 469 | Ga0207677_10241558 | 3300026023 | Bacteria | 1461 |
| 470 | Ga0207703_10000375 | 3300026035 | Bacteria | 47699 |
| 471 | Ga0207703_10001182 | 3300026035 | Bacteria | 24519 |
| 472 | Ga0207703_12338057 | 3300026035 | Bacteria | 510 |
| 473 | Ga0207639_10412918 | 3300026041 | Bacteria | 1219 |
| 474 | Ga0207639_11618081 | 3300026041 | Bacteria | 607 |
| 475 | Ga0207678_10271186 | 3300026067 | Bacteria | 1455 |
| 476 | Ga0207678_10531028 | 3300026067 | Bacteria | 1027 |
| 477 | Ga0207678_10580097 | 3300026067 | Bacteria | 982 |
| 478 | Ga0207708_10271989 | 3300026075 | Bacteria | 1371 |
| 479 | Ga0207708_10274816 | 3300026075 | Bacteria | 1364 |
| 480 | Ga0207708_10514537 | 3300026075 | Bacteria | 1005 |
| 481 | Ga0207708_10992373 | 3300026075 | Bacteria | 729 |
| 482 | Ga0207702_10000220 | 3300026078 | Bacteria | 66634 |
| 483 | Ga0207702_10354780 | 3300026078 | Bacteria | 1404 |
| 484 | Ga0207641_10001389 | 3300026088 | Bacteria | 23861 |
| 485 | Ga0207641_10015650 | 3300026088 | Bacteria | 6215 |
| 486 | Ga0207641_10155476 | 3300026088 | Bacteria | 2074 |
| 487 | Ga0207641_10230682 | 3300026088 | Bacteria | 1720 |
| 488 | Ga0207641_11128566 | 3300026088 | Bacteria | 783 |
| 489 | Ga0207648_10071443 | 3300026089 | Bacteria | 3025 |
| 490 | Ga0207648_10144968 | 3300026089 | Bacteria | 2094 |
| 491 | Ga0207648_10273669 | 3300026089 | Bacteria | 1509 |
| 492 | Ga0207648_10445134 | 3300026089 | Bacteria | 1179 |
| 493 | Ga0207648_10528642 | 3300026089 | Bacteria | 1081 |
| 494 | Ga0207648_10753889 | 3300026089 | Bacteria | 904 |
| 495 | Ga0207648_10967562 | 3300026089 | Bacteria | 797 |
| 496 | Ga0207676_10007765 | 3300026095 | Bacteria | 7629 |
| 497 | Ga0207676_10009753 | 3300026095 | Bacteria | 6829 |
| 498 | Ga0207676_10126996 | 3300026095 | Bacteria | 2161 |
| 499 | Ga0207676_10390708 | 3300026095 | Bacteria | 1297 |
| 500 | Ga0207676_10650208 | 3300026095 | Bacteria | 1017 |
| 501 | Ga0207676_10701541 | 3300026095 | Bacteria | 980 |
| 502 | Ga0207674_10015784 | 3300026116 | Bacteria | 8284 |
| 503 | Ga0207674_10267170 | 3300026116 | Bacteria | 1658 |
| 504 | Ga0207674_10343010 | 3300026116 | Bacteria | 1444 |
| 505 | Ga0207674_12298017 | 3300026116 | Bacteria | 501 |
| 506 | Ga0207675_100010033 | 3300026118 | Bacteria | 8877 |
| 507 | Ga0207675_100072780 | 3300026118 | Bacteria | 3215 |
| 508 | Ga0207675_100093076 | 3300026118 | Bacteria | 2835 |
| 509 | Ga0207675_100872119 | 3300026118 | Bacteria | 915 |
| 510 | Ga0207683_10015084 | 3300026121 | Bacteria | 6576 |
| 511 | Ga0207683_10201766 | 3300026121 | Bacteria | 1808 |
| 512 | Ga0207683_10388597 | 3300026121 | Bacteria | 1283 |
| 513 | Ga0207683_10554502 | 3300026121 | Bacteria | 1063 |
| 514 | Ga0207683_10577132 | 3300026121 | Bacteria | 1040 |
| 515 | Ga0207683_10791529 | 3300026121 | Bacteria | 880 |
| 516 | Ga0207683_11453939 | 3300026121 | Bacteria | 633 |
| 517 | Ga0207683_11964736 | 3300026121 | Bacteria | 533 |
| 518 | Ga0207698_10567686 | 3300026142 | Bacteria | 1114 |
| 519 | Ga0207698_10633467 | 3300026142 | Bacteria | 1057 |
| 520 | Ga0207698_10962223 | 3300026142 | Bacteria | 863 |
| 521 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 522 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 523 | Ga0209371_1000567 | 3300027312 | Bacteria | 33537 |
| 524 | Ga0209588_1048670 | 3300027671 | Bacteria | 1372 |
| 525 | Ga0207428_10462720 | 3300027907 | Bacteria | 924 |
| 526 | Ga0268266_10395823 | 3300028379 | Bacteria | 1305 |
| 527 | Ga0268266_10774927 | 3300028379 | Bacteria | 926 |
| 528 | Ga0268266_10984066 | 3300028379 | Bacteria | 816 |
| 529 | Ga0268266_11735854 | 3300028379 | Bacteria | 599 |
| 530 | Ga0268266_12117663 | 3300028379 | Bacteria | 535 |
| 531 | Ga0268265_10015027 | 3300028380 | Bacteria | 5287 |
| 532 | Ga0268265_10828996 | 3300028380 | Bacteria | 903 |
| 533 | Ga0268265_11059099 | 3300028380 | Bacteria | 803 |
| 534 | Ga0268264_10000629 | 3300028381 | Bacteria | 41961 |
| 535 | Ga0268264_10513528 | 3300028381 | Bacteria | 1170 |
| 536 | Ga0268264_10602181 | 3300028381 | Bacteria | 1083 |
| 537 | Ga0307515_10085570 | 3300028794 | Bacteria | 4032 |
| 538 | Ga0268256_1000495 | 3300030500 | Bacteria | 33537 |
| 539 | Ga0316181_1076746 | 3300030744 | Bacteria | 1778 |
| 540 | Ga0307513_10365774 | 3300031456 | Bacteria | 1186 |
| 541 | Ga0307513_10636128 | 3300031456 | Bacteria | 774 |
| 542 | Ga0307408_100085590 | 3300031548 | Bacteria | 2367 |
| 543 | Ga0307405_10110892 | 3300031731 | Bacteria | 1858 |
| 544 | Ga0307406_10538670 | 3300031901 | Bacteria | 953 |
| 545 | Ga0307406_10792006 | 3300031901 | Bacteria | 799 |
| 546 | Ga0307412_10115569 | 3300031911 | Bacteria | 1923 |
| 547 | Ga0307412_11552640 | 3300031911 | Bacteria | 603 |
| 548 | Ga0307416_100251162 | 3300032002 | Bacteria | 1721 |
| 549 | Ga0307414_10810740 | 3300032004 | Bacteria | 854 |
| 550 | Ga0307414_11284787 | 3300032004 | Bacteria | 679 |
| 551 | Ga0307414_11299823 | 3300032004 | Bacteria | 675 |
| 552 | Ga0307411_10339617 | 3300032005 | Bacteria | 1220 |
| 553 | Ga0307510_10310335 | 3300033180 | Bacteria | 1037 |
| 554 | Ga0373959_0146182 | 3300034820 | Bacteria | 595 |
| 555 | Ga0373940_0218166 | 3300035088 | Bacteria | 633 |
| 556 | Ga0373944_0304086 | 3300035089 | Bacteria | 599 |
| 557 | Ga0373939_0300578 | 3300035114 | Bacteria | 640 |
| 558 | Ga0373962_0084891 | 3300035242 | Bacteria | 967 |
| 559 | Ga0373931_0018196 | 3300035691 | Bacteria | 3491 |
| 560 | Ga0373931_0328093 | 3300035691 | Bacteria | 952 |
| 561 | Ga0373925_0233329 | 3300037068 | Bacteria | 1472 |
| 562 | Ga0395905_0850675 | 3300037471 | Bacteria | 815 |
| 563 | Ga0439436_0088996 | 3300041404 | Bacteria | 859 |
| 564 | Ga0439436_0108575 | 3300041404 | Bacteria | 774 |
| 565 | Ga0439439_0072902 | 3300041406 | Bacteria | 921 |
| 566 | Ga0439447_080670 | 3300041407 | Bacteria | 751 |
| 567 | Ga0439461_0050852 | 3300041410 | Bacteria | 919 |
| 568 | Ga0439466_0105340 | 3300041411 | Bacteria | 877 |
| 569 | Ga0451791_0820966 | 3300041451 | Bacteria | 770 |
| 570 | Ga0451795_0110025 | 3300041456 | Bacteria | 1139 |
| 571 | Ga0451800_1635194 | 3300041459 | Bacteria | 749 |
| 572 | Ga0451807_0092976 | 3300041486 | Bacteria | 512 |
| 573 | Ga0451807_1440418 | 3300041486 | Bacteria | 745 |
| 574 | Ga0451833_0628873 | 3300041491 | Bacteria | 1360 |
| 575 | Ga0451833_1068306 | 3300041491 | Bacteria | 520 |
| 576 | Ga0451837_1224846 | 3300041494 | Bacteria | 630 |
| 577 | Ga0451841_0665083 | 3300041498 | Bacteria | 888 |
| 578 | Ga0451845_0046243 | 3300041501 | Bacteria | 824 |
| 579 | Ga0451849_1060825 | 3300041505 | Bacteria | 925 |
| 580 | Ga0451843_1015190 | 3300041509 | Bacteria | 629 |
| 581 | Ga0439433_0055605 | 3300041999 | Bacteria | 937 |
| 582 | Ga0439442_043273 | 3300042002 | Bacteria | 948 |
| 583 | Ga0439449_0089343 | 3300042007 | Bacteria | 1137 |
| 584 | Ga0439450_202093 | 3300042008 | Bacteria | 532 |
| 585 | Ga0439452_031061 | 3300042010 | Bacteria | 1312 |
| 586 | Ga0439456_000087 | 3300042013 | Bacteria | 31983 |
| 587 | Ga0450921_014977 | 3300042123 | Bacteria | 693 |
| 588 | Ga0450923_131820 | 3300042125 | Bacteria | 595 |
| 589 | Ga0450897_026987 | 3300042128 | Bacteria | 638 |
| 590 | Ga0450896_030770 | 3300042133 | Bacteria | 812 |
| 591 | Ga0450898_046371 | 3300042134 | Bacteria | 831 |
| 592 | Ga0450900_048441 | 3300042136 | Bacteria | 647 |
| 593 | Ga0450902_004852 | 3300042137 | Bacteria | 2012 |
| 594 | Ga0450905_001945 | 3300042142 | Bacteria | 2634 |
| 595 | Ga0450905_035734 | 3300042142 | Bacteria | 778 |
| 596 | Ga0439446_0006447 | 3300042156 | Bacteria | 3060 |
| 597 | Ga0450908_025170 | 3300042184 | Bacteria | 1040 |
| 598 | Ga0450909_030550 | 3300042185 | Bacteria | 817 |
| 599 | Ga0439434_0028081 | 3300042435 | Bacteria | 1703 |
| 600 | Ga0450918_005653 | 3300042531 | Bacteria | 2242 |
| 601 | Ga0450893_0019521 | 3300042532 | Bacteria | 1160 |
| 602 | Ga0450901_000127 | 3300042533 | Bacteria | 8432 |
| 603 | Ga0451576_0606710 | 3300045051 | Bacteria | 1150 |
| 604 | Ga0495603_0001129 | 3300046455 | Bacteria | 15561 |
| 605 | Ga0495603_0258559 | 3300046455 | Bacteria | 1002 |
| 606 | Ga0495590_0010561 | 3300046457 | Bacteria | 3466 |
| 607 | Ga0495591_007319 | 3300046458 | Bacteria | 4712 |
| 608 | Ga0495629_0000046 | 3300046459 | Bacteria | 109841 |
| 609 | Ga0495629_0002117 | 3300046459 | Bacteria | 15382 |
| 610 | Ga0495629_0005492 | 3300046459 | Bacteria | 9466 |
| 611 | Ga0495638_0037707 | 3300046460 | Bacteria | 3074 |
| 612 | Ga0495638_0124044 | 3300046460 | Bacteria | 1523 |
| 613 | Ga0495641_0012627 | 3300046461 | Bacteria | 4708 |
| 614 | Ga0495641_0579940 | 3300046461 | Bacteria | 513 |
| 615 | Ga0495651_0046369 | 3300046462 | Bacteria | 3363 |
| 616 | Ga0495651_0360423 | 3300046462 | Bacteria | 958 |
| 617 | Ga0495653_0000053 | 3300046463 | Bacteria | 105257 |
| 618 | Ga0495653_0024223 | 3300046463 | Bacteria | 4894 |
| 619 | Ga0495653_0044688 | 3300046463 | Bacteria | 3437 |
| 620 | Ga0495650_0004791 | 3300046471 | Bacteria | 9082 |
| 621 | Ga0495580_0002825 | 3300046472 | Bacteria | 14927 |
| 622 | Ga0495580_0003244 | 3300046472 | Bacteria | 13909 |
| 623 | Ga0495580_0007032 | 3300046472 | Bacteria | 9074 |
| 624 | Ga0495580_0037613 | 3300046472 | Bacteria | 3470 |
| 625 | Ga0495582_0002427 | 3300046473 | Bacteria | 10401 |
| 626 | Ga0495582_0013291 | 3300046473 | Bacteria | 4533 |
| 627 | Ga0495582_0495175 | 3300046473 | Bacteria | 706 |
| 628 | Ga0495605_0073106 | 3300046474 | Bacteria | 1615 |
| 629 | Ga0495639_0265691 | 3300046475 | Bacteria | 851 |
| 630 | Ga0495662_0076088 | 3300046476 | Bacteria | 1629 |
| 631 | Ga0495664_0000578 | 3300046477 | Bacteria | 18433 |
| 632 | Ga0495664_0198380 | 3300046477 | Bacteria | 1216 |
| 633 | Ga0495584_0454412 | 3300046491 | Bacteria | 652 |
| 634 | Ga0495594_0047018 | 3300046499 | Bacteria | 2370 |
| 635 | Ga0495594_0136797 | 3300046499 | Bacteria | 1389 |
| 636 | Ga0495596_0004472 | 3300046500 | Bacteria | 6798 |
| 637 | Ga0495596_0021183 | 3300046500 | Bacteria | 2655 |
| 638 | Ga0495596_0305303 | 3300046500 | Bacteria | 619 |
| 639 | Ga0495607_0179418 | 3300046501 | Bacteria | 1063 |
| 640 | Ga0495607_0483428 | 3300046501 | Bacteria | 551 |
| 641 | Ga0495583_0016518 | 3300046506 | Bacteria | 3963 |
| 642 | Ga0495606_0011355 | 3300046507 | Bacteria | 7273 |
| 643 | Ga0495606_0224200 | 3300046507 | Bacteria | 1057 |
| 644 | Ga0495606_0408580 | 3300046507 | Bacteria | 705 |
| 645 | Ga0495608_0003715 | 3300046511 | Bacteria | 10965 |
| 646 | Ga0495608_0486417 | 3300046511 | Bacteria | 748 |
| 647 | Ga0495618_0001589 | 3300046514 | Bacteria | 15169 |
| 648 | Ga0495618_0201568 | 3300046514 | Bacteria | 1259 |
| 649 | Ga0495620_0000004 | 3300046515 | Bacteria | 344148 |
| 650 | Ga0495620_0005253 | 3300046515 | Bacteria | 7245 |
| 651 | Ga0495620_0244235 | 3300046515 | Bacteria | 685 |
| 652 | Ga0495628_0002469 | 3300046516 | Bacteria | 16678 |
| 653 | Ga0495628_0147679 | 3300046516 | Bacteria | 1791 |
| 654 | Ga0495628_0396131 | 3300046516 | Bacteria | 1009 |
| 655 | Ga0495630_0001504 | 3300046517 | Bacteria | 16125 |
| 656 | Ga0495630_0004308 | 3300046517 | Bacteria | 9984 |
| 657 | Ga0495630_0015798 | 3300046517 | Bacteria | 5517 |
| 658 | Ga0495630_0277057 | 3300046517 | Bacteria | 1281 |
| 659 | Ga0495630_0481248 | 3300046517 | Bacteria | 952 |
| 660 | Ga0495631_0466788 | 3300046518 | Bacteria | 538 |
| 661 | Ga0495632_0077127 | 3300046519 | Bacteria | 1593 |
| 662 | Ga0495643_0008674 | 3300046522 | Bacteria | 6412 |
| 663 | Ga0495648_0000188 | 3300046524 | Bacteria | 71222 |
| 664 | Ga0495648_0001267 | 3300046524 | Bacteria | 25187 |
| 665 | Ga0495648_0025833 | 3300046524 | Bacteria | 3966 |
| 666 | Ga0495648_0031657 | 3300046524 | Bacteria | 3480 |
| 667 | Ga0495648_0105277 | 3300046524 | Bacteria | 1547 |
| 668 | Ga0495666_0000123 | 3300046526 | Bacteria | 32371 |
| 669 | Ga0495666_0008098 | 3300046526 | Bacteria | 5268 |
| 670 | Ga0495666_0026370 | 3300046526 | Bacteria | 2865 |
| 671 | Ga0495642_0194566 | 3300046528 | Bacteria | 883 |
| 672 | Ga0495642_0479144 | 3300046528 | Bacteria | 550 |
| 673 | Ga0495652_0008947 | 3300046529 | Bacteria | 9111 |
| 674 | Ga0495652_0151601 | 3300046529 | Bacteria | 1810 |
| 675 | Ga0495652_0406030 | 3300046529 | Bacteria | 963 |
| 676 | Ga0495654_0039152 | 3300046530 | Bacteria | 2367 |
| 677 | Ga0495665_0007567 | 3300046531 | Bacteria | 5881 |
| 678 | Ga0495665_0015295 | 3300046531 | Bacteria | 4133 |
| 679 | Ga0495640_0006070 | 3300046533 | Bacteria | 9581 |
| 680 | Ga0495640_0010088 | 3300046533 | Bacteria | 7321 |
| 681 | Ga0495640_0224264 | 3300046533 | Bacteria | 1184 |
| 682 | Ga0495586_0008313 | 3300046535 | Bacteria | 5524 |
| 683 | Ga0495586_0129280 | 3300046535 | Bacteria | 1414 |
| 684 | Ga0495586_0316726 | 3300046535 | Bacteria | 894 |
| 685 | Ga0495587_0002127 | 3300046536 | Bacteria | 13241 |
| 686 | Ga0495587_0012279 | 3300046536 | Bacteria | 5401 |
| 687 | Ga0495598_0016577 | 3300046537 | Bacteria | 1883 |
| 688 | Ga0495598_0457738 | 3300046537 | Bacteria | 506 |
| 689 | Ga0495609_0291757 | 3300046538 | Bacteria | 665 |
| 690 | Ga0495621_0069838 | 3300046539 | Bacteria | 1292 |
| 691 | Ga0495621_0108696 | 3300046539 | Bacteria | 1062 |
| 692 | Ga0495621_0148361 | 3300046539 | Bacteria | 921 |
| 693 | Ga0495645_0010203 | 3300046543 | Bacteria | 6581 |
| 694 | Ga0495622_0001070 | 3300046557 | Bacteria | 14421 |
| 695 | Ga0495622_0312353 | 3300046557 | Bacteria | 684 |
| 696 | Ga0495667_0077461 | 3300046559 | Bacteria | 2163 |
| 697 | Ga0495656_0785132 | 3300046615 | Bacteria | 514 |
| 698 | Ga0495634_0005673 | 3300046642 | Bacteria | 9555 |
| 699 | Ga0495634_0062582 | 3300046642 | Bacteria | 2470 |
| 700 | Ga0495634_0521333 | 3300046642 | Bacteria | 695 |
| 701 | Ga0495611_0020256 | 3300046648 | Bacteria | 2862 |
| 702 | Ga0495611_0376876 | 3300046648 | Bacteria | 650 |
| 703 | Ga0495635_0002302 | 3300046663 | Bacteria | 12987 |
| 704 | Ga0495635_0006261 | 3300046663 | Bacteria | 8289 |
| 705 | Ga0495661_0004226 | 3300046665 | Bacteria | 10435 |
| 706 | Ga0495661_0052568 | 3300046665 | Bacteria | 2454 |
| 707 | Ga0495661_0349381 | 3300046665 | Bacteria | 728 |
| 708 | Ga0495661_0422510 | 3300046665 | Bacteria | 645 |
| 709 | Ga0495588_0230473 | 3300046674 | Bacteria | 977 |
| 710 | Ga0495657_0300059 | 3300046675 | Bacteria | 958 |
| 711 | Ga0495599_0001469 | 3300046678 | Bacteria | 13517 |
| 712 | Ga0495599_0459083 | 3300046678 | Bacteria | 753 |
| 713 | Ga0495623_0030891 | 3300046679 | Bacteria | 3446 |
| 714 | Ga0495623_0032693 | 3300046679 | Bacteria | 3342 |
| 715 | Ga0495646_0000978 | 3300046680 | Bacteria | 16398 |
| 716 | Ga0495646_0004334 | 3300046680 | Bacteria | 8940 |
| 717 | Ga0495646_0013259 | 3300046680 | Bacteria | 5238 |
| 718 | Ga0495647_0525736 | 3300046681 | Bacteria | 552 |
| 719 | Ga0495658_0568727 | 3300046683 | Bacteria | 726 |
| 720 | Ga0495669_0180984 | 3300046684 | Bacteria | 1005 |
| 721 | Ga0495613_0002923 | 3300046689 | Bacteria | 12810 |
| 722 | Ga0495613_0051577 | 3300046689 | Bacteria | 3031 |
| 723 | Ga0495613_0502239 | 3300046689 | Bacteria | 816 |
| 724 | Ga0495624_0004798 | 3300046690 | Bacteria | 9830 |
| 725 | Ga0495624_0005326 | 3300046690 | Bacteria | 9292 |
| 726 | Ga0495624_0075211 | 3300046690 | Bacteria | 2097 |
| 727 | Ga0495624_0784956 | 3300046690 | Bacteria | 563 |
| 728 | Ga0495671_0053277 | 3300046692 | Bacteria | 2008 |
| 729 | Ga0495671_0071040 | 3300046692 | Bacteria | 1710 |
| 730 | Ga0495671_0101982 | 3300046692 | Bacteria | 1402 |
| 731 | Ga0495671_0386221 | 3300046692 | Bacteria | 671 |
| 732 | Ga0495649_0096544 | 3300046694 | Bacteria | 1572 |
| 733 | Ga0495649_0413144 | 3300046694 | Bacteria | 676 |
| 734 | Ga0495649_0466451 | 3300046694 | Bacteria | 630 |
| 735 | Ga0495649_0499554 | 3300046694 | Bacteria | 605 |
| 736 | Ga0495589_0028436 | 3300046794 | Bacteria | 2821 |
| 737 | Ga0495589_0117511 | 3300046794 | Bacteria | 1281 |
| 738 | Ga0495600_0202987 | 3300046809 | Bacteria | 1272 |
| 739 | Ga0495660_0375801 | 3300046810 | Bacteria | 627 |
| 740 | Ga0495581_0000244 | 3300047315 | Bacteria | 25900 |
| 741 | Ga0495581_0791107 | 3300047315 | Bacteria | 544 |
| 742 | Ga0495604_0001507 | 3300047317 | Bacteria | 19150 |
| 743 | Ga0495604_0004672 | 3300047317 | Bacteria | 10860 |
| 744 | Ga0495636_0067072 | 3300047318 | Bacteria | 1527 |
| 745 | Ga0495674_0020575 | 3300047319 | Bacteria | 6107 |
| 746 | Ga0495674_0105054 | 3300047319 | Bacteria | 2400 |
| 747 | Ga0495674_0892608 | 3300047319 | Bacteria | 686 |
| 748 | Ga0495674_1344268 | 3300047319 | Bacteria | 534 |
| 749 | Ga0495676_0002425 | 3300047321 | Bacteria | 16559 |
| 750 | Ga0495676_0022410 | 3300047321 | Bacteria | 5494 |
| 751 | Ga0495676_0172814 | 3300047321 | Bacteria | 1519 |
| 752 | Ga0495676_0285923 | 3300047321 | Bacteria | 1115 |
| 753 | Ga0495680_0025471 | 3300047322 | Bacteria | 4894 |
| 754 | Ga0495680_0045485 | 3300047322 | Bacteria | 3465 |
| 755 | Ga0495683_0050311 | 3300047323 | Bacteria | 2085 |
| 756 | Ga0495683_0101151 | 3300047323 | Bacteria | 1385 |
| 757 | Ga0495675_0027108 | 3300047444 | Bacteria | 3651 |
| 758 | Ga0495675_0047060 | 3300047444 | Bacteria | 2745 |
| 759 | Ga0495679_000065 | 3300047446 | Bacteria | 101084 |
| 760 | Ga0495679_001198 | 3300047446 | Bacteria | 15417 |
| 761 | Ga0495679_002373 | 3300047446 | Bacteria | 9653 |
| 762 | Ga0495673_0008483 | 3300047469 | Bacteria | 5774 |
| 763 | Ga0495673_0028904 | 3300047469 | Bacteria | 2620 |
| 764 | Ga0495681_0052360 | 3300047470 | Bacteria | 1916 |
| 765 | Ga0495684_0274580 | 3300047471 | Bacteria | 1218 |
| 766 | Ga0495686_0016574 | 3300047472 | Bacteria | 4995 |
| 767 | Ga0495686_0083614 | 3300047472 | Bacteria | 1946 |
| 768 | Ga0495686_0094880 | 3300047472 | Bacteria | 1807 |
| 769 | Ga0495593_0003459 | 3300047673 | Bacteria | 9455 |
| 770 | Ga0495593_0014956 | 3300047673 | Bacteria | 4405 |
| 771 | Ga0495593_0061357 | 3300047673 | Bacteria | 1966 |
| 772 | Ga0495593_0273153 | 3300047673 | Bacteria | 846 |
| 773 | Ga0495593_0597266 | 3300047673 | Bacteria | 554 |
| 774 | Ga0495602_0023808 | 3300048088 | Bacteria | 5956 |
| 775 | Ga0495602_0173866 | 3300048088 | Bacteria | 1669 |
| 776 | Ga0495602_0969245 | 3300048088 | Bacteria | 562 |
| 777 | Ga0495614_0002154 | 3300048089 | Bacteria | 8716 |
| 778 | Ga0495614_0077954 | 3300048089 | Bacteria | 1433 |
| 779 | Ga0495614_0146034 | 3300048089 | Bacteria | 1053 |
| 780 | Ga0495615_0022151 | 3300048090 | Bacteria | 1442 |
| 781 | Ga0495626_0048540 | 3300048091 | Bacteria | 1969 |
| 782 | Ga0496100_0725736 | 3300048903 | Bacteria | 776 |
| 783 | Ga0496100_0778933 | 3300048903 | Bacteria | 749 |
| 784 | Ga0496100_0894055 | 3300048903 | Bacteria | 697 |
| 785 | Ga0496101_0963725 | 3300048904 | Bacteria | 671 |
| 786 | Ga0496102_0842229 | 3300048905 | Bacteria | 839 |
| 787 | Ga0496102_1188668 | 3300048905 | Bacteria | 682 |
| 788 | Ga0496102_1519068 | 3300048905 | Bacteria | 588 |
| 789 | Ga0496103_0007544 | 3300048906 | Bacteria | 6483 |
| 790 | Ga0496104_1843638 | 3300048907 | Bacteria | 507 |
| 791 | Ga0496105_0529932 | 3300048908 | Bacteria | 922 |
| 792 | Ga0496106_0381094 | 3300048909 | Bacteria | 1133 |
| 793 | Ga0496106_0736619 | 3300048909 | Bacteria | 784 |
| 794 | Ga0496107_1341744 | 3300048910 | Bacteria | 511 |
| 795 | Ga0496108_0218362 | 3300048911 | Bacteria | 1656 |
| 796 | Ga0496108_0975001 | 3300048911 | Bacteria | 725 |
| 797 | Ga0496109_0956693 | 3300048912 | Bacteria | 794 |
| 798 | Ga0496109_1037375 | 3300048912 | Bacteria | 757 |
| 799 | Ga0496110_0641533 | 3300048913 | Bacteria | 961 |
| 800 | Ga0496110_0773287 | 3300048913 | Bacteria | 864 |
| 801 | Ga0496110_1295976 | 3300048913 | Bacteria | 638 |
| 802 | Ga0496111_0332248 | 3300048914 | Bacteria | 1125 |
| 803 | Ga0496111_0463712 | 3300048914 | Bacteria | 934 |
| 804 | Ga0496111_0948148 | 3300048914 | Bacteria | 618 |
| 805 | Ga0496114_0086972 | 3300048917 | Bacteria | 2649 |
| 806 | Ga0496114_0831038 | 3300048917 | Bacteria | 803 |
| 807 | Ga0496114_1247846 | 3300048917 | Bacteria | 630 |
| 808 | Ga0496116_0272728 | 3300048919 | Bacteria | 825 |
| 809 | Ga0496117_0001021 | 3300048920 | Bacteria | 42741 |
| 810 | Ga0496117_0041773 | 3300048920 | Bacteria | 3354 |
| 811 | Ga0496117_0057181 | 3300048920 | Bacteria | 2711 |
| 812 | Ga0496117_0228042 | 3300048920 | Bacteria | 1031 |
| 813 | Ga0496118_0001077 | 3300048921 | Bacteria | 42600 |
| 814 | Ga0496118_0017661 | 3300048921 | Bacteria | 6478 |
| 815 | Ga0496118_0017738 | 3300048921 | Bacteria | 6462 |
| 816 | Ga0496119_0147824 | 3300048922 | Bacteria | 1262 |
| 817 | Ga0496121_0180827 | 3300048924 | Bacteria | 1522 |
| 818 | Ga0496121_0203656 | 3300048924 | Bacteria | 1408 |
| 819 | Ga0496121_0382457 | 3300048924 | Bacteria | 928 |
| 820 | Ga0496124_0066355 | 3300048927 | Bacteria | 3005 |
| 821 | Ga0496124_0089535 | 3300048927 | Bacteria | 2512 |
| 822 | Ga0496124_0165591 | 3300048927 | Bacteria | 1718 |
| 823 | Ga0496124_0168079 | 3300048927 | Bacteria | 1702 |
| 824 | Ga0496124_0961540 | 3300048927 | Bacteria | 512 |
| 825 | Ga0496125_0000944 | 3300048928 | Bacteria | 45671 |
| 826 | Ga0496126_0404954 | 3300048929 | Bacteria | 1106 |
| 827 | Ga0496126_0665230 | 3300048929 | Bacteria | 813 |
| 828 | Ga0495678_018945 | 3300049459 | Bacteria | 3082 |
| 829 | Ga0495682_0174475 | 3300049460 | Bacteria | 764 |
| 830 | Ga0501031_0158504 | 3300049568 | Bacteria | 1479 |
| 831 | Ga0501031_0467790 | 3300049568 | Bacteria | 814 |
| 832 | Ga0501032_0048350 | 3300049569 | Bacteria | 2872 |
| 833 | Ga0501033_0004494 | 3300049570 | Bacteria | 11160 |
| 834 | Ga0501034_0042556 | 3300049571 | Bacteria | 4598 |
| 835 | Ga0501034_0057365 | 3300049571 | Bacteria | 3915 |
| 836 | Ga0501036_0019618 | 3300049572 | Bacteria | 5676 |
| 837 | Ga0501036_1362178 | 3300049572 | Bacteria | 576 |
| 838 | Ga0501037_0001825 | 3300049573 | Bacteria | 15467 |
| 839 | Ga0501037_0164248 | 3300049573 | Bacteria | 1581 |
| 840 | Ga0501038_0006856 | 3300049574 | Bacteria | 10523 |
| 841 | Ga0501043_0013981 | 3300049579 | Bacteria | 6281 |
| 842 | Ga0501046_0006266 | 3300049580 | Bacteria | 10552 |
| 843 | Ga0501047_0005968 | 3300049581 | Bacteria | 11448 |
| 844 | Ga0501035_0231493 | 3300049822 | Bacteria | 1574 |
| 845 | Ga0501044_0000916 | 3300049823 | Bacteria | 35511 |
| 846 | nmdc:mga03683_700497_c1 | 3300050489 | Bacteria | 501 |
| 847 | nmdc:mga0k408_142935_c1 | 3300050493 | Bacteria | 1136 |
| 848 | nmdc:mga0k408_572625_c1 | 3300050493 | Bacteria | 667 |
| 849 | nmdc:mga07m45_155785_c1 | 3300050496 | Bacteria | 700 |
| 850 | nmdc:mga07m45_191071_c1 | 3300050496 | Bacteria | 1191 |
| 851 | nmdc:mga08y16_839244_c1 | 3300050511 | Bacteria | 909 |
| 852 | Ga0500578_0284588 | 3300053086 | Bacteria | 985 |
| 853 | Ga0500644_0078629 | 3300053088 | Bacteria | 1207 |
| 854 | Ga0500555_132582 | 3300053103 | Bacteria | 617 |
| 855 | Ga0500562_042950 | 3300053108 | Bacteria | 1203 |
| 856 | Ga0500593_175569 | 3300053117 | Bacteria | 802 |
| 857 | Ga0500568_0348680 | 3300053139 | Bacteria | 537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_10542006 | Ga0207670_105420062 | 75 |
| 2 | 3300050496 | nmdc:mga07m45_155785_c1 | nmdc:mga07m45_155785_c1_198_494 | 80 |
| 3 | 3300046518 | Ga0495631_0466788 | Ga0495631_0466788_17_295 | 81 |
| 4 | 3300005293 | Ga0065715_10153014 | Ga0065715_101530143 | 82 |
| 5 | 3300005328 | Ga0070676_10194982 | Ga0070676_101949822 | 82 |
| 6 | 3300005330 | Ga0070690_100368195 | Ga0070690_1003681952 | 82 |
| 7 | 3300005333 | Ga0070677_10041064 | Ga0070677_100410642 | 82 |
| 8 | 3300005334 | Ga0068869_100258495 | Ga0068869_1002584951 | 82 |
| 9 | 3300005338 | Ga0068868_100018613 | Ga0068868_1000186133 | 82 |
| 10 | 3300005340 | Ga0070689_100456834 | Ga0070689_1004568342 | 82 |
| 11 | 3300005353 | Ga0070669_100516458 | Ga0070669_1005164582 | 82 |
| 12 | 3300005354 | Ga0070675_100003048 | Ga0070675_10000304811 | 82 |
| 13 | 3300005355 | Ga0070671_100318425 | Ga0070671_1003184252 | 82 |
| 14 | 3300005356 | Ga0070674_100863989 | Ga0070674_1008639892 | 82 |
| 15 | 3300005364 | Ga0070673_100344921 | Ga0070673_1003449212 | 82 |
| 16 | 3300005365 | Ga0070688_100360558 | Ga0070688_1003605581 | 82 |
| 17 | 3300005367 | Ga0070667_100069176 | Ga0070667_1000691763 | 82 |
| 18 | 3300005456 | Ga0070678_100062277 | Ga0070678_1000622773 | 82 |
| 19 | 3300005457 | Ga0070662_100435297 | Ga0070662_1004352972 | 82 |
| 20 | 3300005466 | Ga0070685_10917188 | Ga0070685_109171881 | 82 |
| 21 | 3300005543 | Ga0070672_100113604 | Ga0070672_1001136042 | 82 |
| 22 | 3300005544 | Ga0070686_100578765 | Ga0070686_1005787652 | 82 |
| 23 | 3300005548 | Ga0070665_100829676 | Ga0070665_1008296762 | 82 |
| 24 | 3300005578 | Ga0068854_101279733 | Ga0068854_1012797331 | 82 |
| 25 | 3300005617 | Ga0068859_100470474 | Ga0068859_1004704742 | 82 |
| 26 | 3300005618 | Ga0068864_100011000 | Ga0068864_1000110007 | 82 |
| 27 | 3300005719 | Ga0068861_100719556 | Ga0068861_1007195562 | 82 |
| 28 | 3300005834 | Ga0068851_10687891 | Ga0068851_106878912 | 82 |
| 29 | 3300005840 | Ga0068870_10018727 | Ga0068870_100187274 | 82 |
| 30 | 3300005841 | Ga0068863_100406994 | Ga0068863_1004069942 | 82 |
| 31 | 3300005842 | Ga0068858_100000721 | Ga0068858_10000072120 | 82 |
| 32 | 3300005844 | Ga0068862_101527577 | Ga0068862_1015275772 | 82 |
| 33 | 3300006237 | Ga0097621_100028049 | Ga0097621_1000280495 | 82 |
| 34 | 3300006931 | Ga0097620_100470479 | Ga0097620_1004704792 | 82 |
| 35 | 3300009098 | Ga0105245_10857767 | Ga0105245_108577672 | 82 |
| 36 | 3300009177 | Ga0105248_10217274 | Ga0105248_102172743 | 82 |
| 37 | 3300009553 | Ga0105249_12660977 | Ga0105249_126609772 | 82 |
| 38 | 3300011119 | Ga0105246_10318705 | Ga0105246_103187052 | 82 |
| 39 | 3300013296 | Ga0157374_10182770 | Ga0157374_101827703 | 82 |
| 40 | 3300013297 | Ga0157378_10602115 | Ga0157378_106021152 | 82 |
| 41 | 3300013306 | Ga0163162_10491909 | Ga0163162_104919092 | 82 |
| 42 | 3300013308 | Ga0157375_11151019 | Ga0157375_111510192 | 82 |
| 43 | 3300014325 | Ga0163163_10039730 | Ga0163163_100397304 | 82 |
| 44 | 3300014326 | Ga0157380_11501333 | Ga0157380_115013332 | 82 |
| 45 | 3300014968 | Ga0157379_11188861 | Ga0157379_111888612 | 82 |
| 46 | 3300014969 | Ga0157376_10103351 | Ga0157376_101033512 | 82 |
| 47 | 3300017792 | Ga0163161_10328373 | Ga0163161_103283732 | 82 |
| 48 | 3300025893 | Ga0207682_10025426 | Ga0207682_100254262 | 82 |
| 49 | 3300025907 | Ga0207645_10200627 | Ga0207645_102006272 | 82 |
| 50 | 3300025908 | Ga0207643_10166981 | Ga0207643_101669812 | 82 |
| 51 | 3300025923 | Ga0207681_10626523 | Ga0207681_106265232 | 82 |
| 52 | 3300025926 | Ga0207659_10000404 | Ga0207659_1000040417 | 82 |
| 53 | 3300025927 | Ga0207687_10546540 | Ga0207687_105465402 | 82 |
| 54 | 3300025931 | Ga0207644_10001638 | Ga0207644_1000163813 | 82 |
| 55 | 3300025936 | Ga0207670_10008848 | Ga0207670_100088482 | 82 |
| 56 | 3300025937 | Ga0207669_10755276 | Ga0207669_107552762 | 82 |
| 57 | 3300025940 | Ga0207691_10371972 | Ga0207691_103719722 | 82 |
| 58 | 3300025941 | Ga0207711_10150535 | Ga0207711_101505353 | 82 |
| 59 | 3300025942 | Ga0207689_11140421 | Ga0207689_111404212 | 82 |
| 60 | 3300025960 | Ga0207651_10001391 | Ga0207651_100013912 | 82 |
| 61 | 3300025961 | Ga0207712_10638326 | Ga0207712_106383262 | 82 |
| 62 | 3300025986 | Ga0207658_10001266 | Ga0207658_1000126617 | 82 |
| 63 | 3300026023 | Ga0207677_10000556 | Ga0207677_1000055616 | 82 |
| 64 | 3300026035 | Ga0207703_10000375 | Ga0207703_1000037516 | 82 |
| 65 | 3300026088 | Ga0207641_10015650 | Ga0207641_100156506 | 82 |
| 66 | 3300026089 | Ga0207648_10967562 | Ga0207648_109675622 | 82 |
| 67 | 3300026095 | Ga0207676_10126996 | Ga0207676_101269963 | 82 |
| 68 | 3300026118 | Ga0207675_100872119 | Ga0207675_1008721192 | 82 |
| 69 | 3300026121 | Ga0207683_10015084 | Ga0207683_100150842 | 82 |
| 70 | 3300026142 | Ga0207698_10633467 | Ga0207698_106334672 | 82 |
| 71 | 3300028379 | Ga0268266_10984066 | Ga0268266_109840661 | 82 |
| 72 | 3300028380 | Ga0268265_10828996 | Ga0268265_108289962 | 82 |
| 73 | 3300028381 | Ga0268264_10513528 | Ga0268264_105135282 | 82 |
| 74 | 3300031901 | Ga0307406_10792006 | Ga0307406_107920061 | 82 |
| 75 | 3300048909 | Ga0496106_0736619 | Ga0496106_0736619_124_432 | 82 |
| 76 | 3300005343 | Ga0070687_100146873 | Ga0070687_1001468731 | 83 |
| 77 | 3300005347 | Ga0070668_100071204 | Ga0070668_1000712043 | 83 |
| 78 | 3300005353 | Ga0070669_100220474 | Ga0070669_1002204742 | 83 |
| 79 | 3300005441 | Ga0070700_101274356 | Ga0070700_1012743562 | 83 |
| 80 | 3300005457 | Ga0070662_100208630 | Ga0070662_1002086302 | 83 |
| 81 | 3300005459 | Ga0068867_100261755 | Ga0068867_1002617552 | 83 |
| 82 | 3300005467 | Ga0070706_101409192 | Ga0070706_1014091921 | 83 |
| 83 | 3300005543 | Ga0070672_100334203 | Ga0070672_1003342032 | 83 |
| 84 | 3300005719 | Ga0068861_100317165 | Ga0068861_1003171652 | 83 |
| 85 | 3300005843 | Ga0068860_100524590 | Ga0068860_1005245902 | 83 |
| 86 | 3300005844 | Ga0068862_100978976 | Ga0068862_1009789762 | 83 |
| 87 | 3300006881 | Ga0068865_100054153 | Ga0068865_1000541533 | 83 |
| 88 | 3300009176 | Ga0105242_10531949 | Ga0105242_105319492 | 83 |
| 89 | 3300009553 | Ga0105249_10060370 | Ga0105249_100603702 | 83 |
| 90 | 3300013104 | Ga0157370_11360677 | Ga0157370_113606772 | 83 |
| 91 | 3300013306 | Ga0163162_10647169 | Ga0163162_106471692 | 83 |
| 92 | 3300013308 | Ga0157375_11392442 | Ga0157375_113924422 | 83 |
| 93 | 3300014326 | Ga0157380_10422523 | Ga0157380_104225232 | 83 |
| 94 | 3300017792 | Ga0163161_10246998 | Ga0163161_102469982 | 83 |
| 95 | 3300025271 | Ga0207666_1004820 | Ga0207666_10048202 | 83 |
| 96 | 3300025923 | Ga0207681_10061029 | Ga0207681_100610292 | 83 |
| 97 | 3300025933 | Ga0207706_10279326 | Ga0207706_102793262 | 83 |
| 98 | 3300025937 | Ga0207669_10574969 | Ga0207669_105749692 | 83 |
| 99 | 3300025940 | Ga0207691_10371973 | Ga0207691_103719732 | 83 |
| 100 | 3300025961 | Ga0207712_10135754 | Ga0207712_101357542 | 83 |
| 101 | 3300025972 | Ga0207668_10309632 | Ga0207668_103096322 | 83 |
| 102 | 3300025986 | Ga0207658_11933204 | Ga0207658_119332042 | 83 |
| 103 | 3300026041 | Ga0207639_10412918 | Ga0207639_104129181 | 83 |
| 104 | 3300026075 | Ga0207708_10992373 | Ga0207708_109923731 | 83 |
| 105 | 3300026089 | Ga0207648_10528642 | Ga0207648_105286422 | 83 |
| 106 | 3300026118 | Ga0207675_100072780 | Ga0207675_1000727804 | 83 |
| 107 | 3300028380 | Ga0268265_11059099 | Ga0268265_110590992 | 83 |
| 108 | 3300035089 | Ga0373944_0304086 | Ga0373944_0304086_251_559 | 83 |
| 109 | 3300046537 | Ga0495598_0016577 | Ga0495598_0016577_494_802 | 83 |
| 110 | 3300046665 | Ga0495661_0422510 | Ga0495661_0422510_263_571 | 83 |
| 111 | 3300047318 | Ga0495636_0067072 | Ga0495636_0067072_982_1290 | 83 |
| 112 | 3300048090 | Ga0495615_0022151 | Ga0495615_0022151_912_1220 | 83 |
| 113 | 3300041501 | Ga0451845_0046243 | Ga0451845_0046243_91_399 | 84 |
| 114 | 3300048914 | Ga0496111_0948148 | Ga0496111_0948148_13_276 | 84 |
| 115 | 3300003775 | Ga0055524_1015212 | Ga0055524_10152123 | 86 |
| 116 | 3300025263 | Ga0209565_1033593 | Ga0209565_10335932 | 86 |
| 117 | 3300025291 | Ga0209675_1004224 | Ga0209675_10042245 | 86 |
| 118 | 3300025294 | Ga0209025_1002951 | Ga0209025_10029512 | 86 |
| 119 | 3300025299 | Ga0209256_1000468 | Ga0209256_100046854 | 86 |
| 120 | 3300025920 | Ga0207649_10285361 | Ga0207649_102853612 | 86 |
| 121 | 3300046455 | Ga0495603_0001129 | Ga0495603_0001129_2865_3134 | 86 |
| 122 | 3300046458 | Ga0495591_007319 | Ga0495591_007319_4138_4407 | 86 |
| 123 | 3300046459 | Ga0495629_0002117 | Ga0495629_0002117_12346_12615 | 86 |
| 124 | 3300046459 | Ga0495629_0005492 | Ga0495629_0005492_7386_7655 | 86 |
| 125 | 3300046461 | Ga0495641_0012627 | Ga0495641_0012627_728_997 | 86 |
| 126 | 3300046461 | Ga0495641_0579940 | Ga0495641_0579940_219_488 | 86 |
| 127 | 3300046462 | Ga0495651_0046369 | Ga0495651_0046369_843_1112 | 86 |
| 128 | 3300046462 | Ga0495651_0360423 | Ga0495651_0360423_602_871 | 86 |
| 129 | 3300046463 | Ga0495653_0024223 | Ga0495653_0024223_2348_2617 | 86 |
| 130 | 3300046463 | Ga0495653_0044688 | Ga0495653_0044688_1744_2013 | 86 |
| 131 | 3300046471 | Ga0495650_0004791 | Ga0495650_0004791_5749_6018 | 86 |
| 132 | 3300046472 | Ga0495580_0002825 | Ga0495580_0002825_5029_5298 | 86 |
| 133 | 3300046472 | Ga0495580_0003244 | Ga0495580_0003244_1639_1908 | 86 |
| 134 | 3300046473 | Ga0495582_0002427 | Ga0495582_0002427_10071_10340 | 86 |
| 135 | 3300046473 | Ga0495582_0013291 | Ga0495582_0013291_528_797 | 86 |
| 136 | 3300046476 | Ga0495662_0076088 | Ga0495662_0076088_940_1209 | 86 |
| 137 | 3300046477 | Ga0495664_0000578 | Ga0495664_0000578_1441_1710 | 86 |
| 138 | 3300046477 | Ga0495664_0198380 | Ga0495664_0198380_885_1154 | 86 |
| 139 | 3300046499 | Ga0495594_0047018 | Ga0495594_0047018_1842_2111 | 86 |
| 140 | 3300046500 | Ga0495596_0004472 | Ga0495596_0004472_1528_1797 | 86 |
| 141 | 3300046501 | Ga0495607_0179418 | Ga0495607_0179418_328_597 | 86 |
| 142 | 3300046507 | Ga0495606_0224200 | Ga0495606_0224200_323_592 | 86 |
| 143 | 3300046507 | Ga0495606_0408580 | Ga0495606_0408580_210_479 | 86 |
| 144 | 3300046511 | Ga0495608_0003715 | Ga0495608_0003715_3605_3874 | 86 |
| 145 | 3300046511 | Ga0495608_0486417 | Ga0495608_0486417_181_450 | 86 |
| 146 | 3300046514 | Ga0495618_0001589 | Ga0495618_0001589_211_480 | 86 |
| 147 | 3300046514 | Ga0495618_0201568 | Ga0495618_0201568_327_596 | 86 |
| 148 | 3300046516 | Ga0495628_0002469 | Ga0495628_0002469_13545_13814 | 86 |
| 149 | 3300046516 | Ga0495628_0147679 | Ga0495628_0147679_1079_1348 | 86 |
| 150 | 3300046517 | Ga0495630_0001504 | Ga0495630_0001504_12435_12704 | 86 |
| 151 | 3300046517 | Ga0495630_0277057 | Ga0495630_0277057_403_672 | 86 |
| 152 | 3300046524 | Ga0495648_0001267 | Ga0495648_0001267_11862_12131 | 86 |
| 153 | 3300046524 | Ga0495648_0025833 | Ga0495648_0025833_1137_1406 | 86 |
| 154 | 3300046524 | Ga0495648_0105277 | Ga0495648_0105277_992_1261 | 86 |
| 155 | 3300046526 | Ga0495666_0000123 | Ga0495666_0000123_2278_2547 | 86 |
| 156 | 3300046526 | Ga0495666_0008098 | Ga0495666_0008098_2957_3226 | 86 |
| 157 | 3300046529 | Ga0495652_0008947 | Ga0495652_0008947_2278_2547 | 86 |
| 158 | 3300046529 | Ga0495652_0151601 | Ga0495652_0151601_1079_1348 | 86 |
| 159 | 3300046531 | Ga0495665_0007567 | Ga0495665_0007567_498_767 | 86 |
| 160 | 3300046531 | Ga0495665_0015295 | Ga0495665_0015295_2261_2530 | 86 |
| 161 | 3300046533 | Ga0495640_0006070 | Ga0495640_0006070_8768_9037 | 86 |
| 162 | 3300046533 | Ga0495640_0010088 | Ga0495640_0010088_2052_2321 | 86 |
| 163 | 3300046535 | Ga0495586_0008313 | Ga0495586_0008313_3036_3305 | 86 |
| 164 | 3300046535 | Ga0495586_0129280 | Ga0495586_0129280_882_1151 | 86 |
| 165 | 3300046536 | Ga0495587_0002127 | Ga0495587_0002127_454_723 | 86 |
| 166 | 3300046536 | Ga0495587_0012279 | Ga0495587_0012279_2905_3174 | 86 |
| 167 | 3300046543 | Ga0495645_0010203 | Ga0495645_0010203_2823_3092 | 86 |
| 168 | 3300046557 | Ga0495622_0001070 | Ga0495622_0001070_12538_12807 | 86 |
| 169 | 3300046559 | Ga0495667_0077461 | Ga0495667_0077461_22_291 | 86 |
| 170 | 3300046642 | Ga0495634_0005673 | Ga0495634_0005673_6769_7038 | 86 |
| 171 | 3300046642 | Ga0495634_0062582 | Ga0495634_0062582_1322_1591 | 86 |
| 172 | 3300046663 | Ga0495635_0002302 | Ga0495635_0002302_12491_12760 | 86 |
| 173 | 3300046663 | Ga0495635_0006261 | Ga0495635_0006261_2262_2531 | 86 |
| 174 | 3300046665 | Ga0495661_0004226 | Ga0495661_0004226_7048_7317 | 86 |
| 175 | 3300046665 | Ga0495661_0052568 | Ga0495661_0052568_290_559 | 86 |
| 176 | 3300046674 | Ga0495588_0230473 | Ga0495588_0230473_656_925 | 86 |
| 177 | 3300046675 | Ga0495657_0300059 | Ga0495657_0300059_122_391 | 86 |
| 178 | 3300046678 | Ga0495599_0001469 | Ga0495599_0001469_10590_10859 | 86 |
| 179 | 3300046678 | Ga0495599_0459083 | Ga0495599_0459083_328_597 | 86 |
| 180 | 3300046679 | Ga0495623_0030891 | Ga0495623_0030891_3116_3385 | 86 |
| 181 | 3300046679 | Ga0495623_0032693 | Ga0495623_0032693_2453_2722 | 86 |
| 182 | 3300046680 | Ga0495646_0000978 | Ga0495646_0000978_6565_6834 | 86 |
| 183 | 3300046680 | Ga0495646_0004334 | Ga0495646_0004334_403_672 | 86 |
| 184 | 3300046689 | Ga0495613_0002923 | Ga0495613_0002923_2444_2713 | 86 |
| 185 | 3300046689 | Ga0495613_0051577 | Ga0495613_0051577_485_754 | 86 |
| 186 | 3300046690 | Ga0495624_0004798 | Ga0495624_0004798_9356_9625 | 86 |
| 187 | 3300046690 | Ga0495624_0075211 | Ga0495624_0075211_1553_1822 | 86 |
| 188 | 3300046690 | Ga0495624_0784956 | Ga0495624_0784956_87_356 | 86 |
| 189 | 3300046692 | Ga0495671_0053277 | Ga0495671_0053277_264_533 | 86 |
| 190 | 3300046694 | Ga0495649_0466451 | Ga0495649_0466451_310_579 | 86 |
| 191 | 3300046794 | Ga0495589_0028436 | Ga0495589_0028436_411_680 | 86 |
| 192 | 3300046809 | Ga0495600_0202987 | Ga0495600_0202987_688_957 | 86 |
| 193 | 3300047315 | Ga0495581_0000244 | Ga0495581_0000244_13545_13814 | 86 |
| 194 | 3300047315 | Ga0495581_0791107 | Ga0495581_0791107_44_313 | 86 |
| 195 | 3300047317 | Ga0495604_0001507 | Ga0495604_0001507_12241_12510 | 86 |
| 196 | 3300047317 | Ga0495604_0004672 | Ga0495604_0004672_571_840 | 86 |
| 197 | 3300047319 | Ga0495674_0020575 | Ga0495674_0020575_2348_2617 | 86 |
| 198 | 3300047319 | Ga0495674_0105054 | Ga0495674_0105054_893_1162 | 86 |
| 199 | 3300047321 | Ga0495676_0002425 | Ga0495676_0002425_2264_2533 | 86 |
| 200 | 3300047321 | Ga0495676_0022410 | Ga0495676_0022410_480_749 | 86 |
| 201 | 3300047322 | Ga0495680_0025471 | Ga0495680_0025471_2348_2617 | 86 |
| 202 | 3300047322 | Ga0495680_0045485 | Ga0495680_0045485_1644_1913 | 86 |
| 203 | 3300047323 | Ga0495683_0050311 | Ga0495683_0050311_579_848 | 86 |
| 204 | 3300047444 | Ga0495675_0027108 | Ga0495675_0027108_568_837 | 86 |
| 205 | 3300047444 | Ga0495675_0047060 | Ga0495675_0047060_2383_2652 | 86 |
| 206 | 3300047446 | Ga0495679_001198 | Ga0495679_001198_14578_14847 | 86 |
| 207 | 3300047446 | Ga0495679_002373 | Ga0495679_002373_6307_6576 | 86 |
| 208 | 3300047469 | Ga0495673_0008483 | Ga0495673_0008483_2772_3041 | 86 |
| 209 | 3300047470 | Ga0495681_0052360 | Ga0495681_0052360_301_570 | 86 |
| 210 | 3300047471 | Ga0495684_0274580 | Ga0495684_0274580_68_337 | 86 |
| 211 | 3300047673 | Ga0495593_0003459 | Ga0495593_0003459_6920_7189 | 86 |
| 212 | 3300047673 | Ga0495593_0061357 | Ga0495593_0061357_1443_1712 | 86 |
| 213 | 3300048088 | Ga0495602_0023808 | Ga0495602_0023808_2865_3134 | 86 |
| 214 | 3300048088 | Ga0495602_0969245 | Ga0495602_0969245_126_395 | 86 |
| 215 | 3300048089 | Ga0495614_0002154 | Ga0495614_0002154_6179_6448 | 86 |
| 216 | 3300048089 | Ga0495614_0077954 | Ga0495614_0077954_188_457 | 86 |
| 217 | 3300048905 | Ga0496102_1188668 | Ga0496102_1188668_270_539 | 86 |
| 218 | 3300048906 | Ga0496103_0007544 | Ga0496103_0007544_192_461 | 86 |
| 219 | 3300048920 | Ga0496117_0057181 | Ga0496117_0057181_462_731 | 86 |
| 220 | 3300048921 | Ga0496118_0001077 | Ga0496118_0001077_17795_18064 | 86 |
| 221 | 3300049460 | Ga0495682_0174475 | Ga0495682_0174475_141_410 | 86 |
| 222 | iso_pu_bacteria | 2511231024 | 2511372880 | 86 |
| 223 | iso_pu_bacteria | 2900634093 | 2900639533 | 86 |
| 224 | iso_pu_bacteria | 2912963787 | 2912965532 | 86 |
| 225 | iso_pu_bacteria | 2939651529 | 2939655448 | 86 |
| 226 | iso_pu_bacteria | 642555112 | 642597092 | 86 |
| 227 | iso_pu_bacteria | 642555113 | 642617754 | 86 |
| 228 | iso_pu_bacteria | 8056137416 | 8056139319 | 86 |
| 229 | 3300005844 | Ga0068862_102632025 | Ga0068862_1026320252 | 87 |
| 230 | 3300046460 | Ga0495638_0124044 | Ga0495638_0124044_532_804 | 87 |
| 231 | 3300046499 | Ga0495594_0136797 | Ga0495594_0136797_378_671 | 87 |
| 232 | 3300046517 | Ga0495630_0015798 | Ga0495630_0015798_4392_4685 | 87 |
| 233 | 3300046642 | Ga0495634_0521333 | Ga0495634_0521333_91_384 | 87 |
| 234 | 3300046648 | Ga0495611_0376876 | Ga0495611_0376876_366_638 | 87 |
| 235 | iso_pu_bacteria | 2585428057 | 2587726103 | 87 |
| 236 | iso_pu_bacteria | 2643221569 | 2643859552 | 87 |
| 237 | iso_pu_bacteria | 2643221592 | 2643967456 | 87 |
| 238 | iso_pu_bacteria | 2643221603 | 2644027318 | 87 |
| 239 | iso_pu_bacteria | 2643221625 | 2644140279 | 87 |
| 240 | iso_pu_bacteria | 2643221644 | 2644245142 | 87 |
| 241 | iso_pu_bacteria | 2643221648 | 2644271518 | 87 |
| 242 | iso_pu_bacteria | 2721755523 | 2722886135 | 87 |
| 243 | iso_pu_bacteria | 2739367655 | 2739613380 | 87 |
| 244 | iso_pu_bacteria | 2839138175 | 2839144223 | 87 |
| 245 | iso_pu_bacteria | 2887375801 | 2887378027 | 87 |
| 246 | iso_pu_bacteria | 2929160207 | 2929164240 | 87 |
| 247 | iso_pu_bacteria | 2932410948 | 2932411384 | 87 |
| 248 | iso_pu_bacteria | 2932416698 | 2932419049 | 87 |
| 249 | 3300025256 | Ga0209759_1000082 | Ga0209759_100008254 | 89 |
| 250 | 3300025261 | Ga0209233_1073407 | Ga0209233_10734072 | 89 |
| 251 | 3300046457 | Ga0495590_0010561 | Ga0495590_0010561_1106_1387 | 89 |
| 252 | 3300046459 | Ga0495629_0000046 | Ga0495629_0000046_55113_55394 | 89 |
| 253 | 3300046460 | Ga0495638_0037707 | Ga0495638_0037707_14_295 | 89 |
| 254 | 3300046463 | Ga0495653_0000053 | Ga0495653_0000053_54593_54874 | 89 |
| 255 | 3300046472 | Ga0495580_0007032 | Ga0495580_0007032_1316_1597 | 89 |
| 256 | 3300046472 | Ga0495580_0037613 | Ga0495580_0037613_3157_3438 | 89 |
| 257 | 3300046473 | Ga0495582_0495175 | Ga0495582_0495175_210_491 | 89 |
| 258 | 3300046474 | Ga0495605_0073106 | Ga0495605_0073106_814_1095 | 89 |
| 259 | 3300046491 | Ga0495584_0454412 | Ga0495584_0454412_163_444 | 89 |
| 260 | 3300046500 | Ga0495596_0021183 | Ga0495596_0021183_1601_1882 | 89 |
| 261 | 3300046506 | Ga0495583_0016518 | Ga0495583_0016518_78_359 | 89 |
| 262 | 3300046507 | Ga0495606_0011355 | Ga0495606_0011355_3646_3927 | 89 |
| 263 | 3300046515 | Ga0495620_0005253 | Ga0495620_0005253_6293_6574 | 89 |
| 264 | 3300046516 | Ga0495628_0396131 | Ga0495628_0396131_630_911 | 89 |
| 265 | 3300046517 | Ga0495630_0004308 | Ga0495630_0004308_222_503 | 89 |
| 266 | 3300046524 | Ga0495648_0031657 | Ga0495648_0031657_573_854 | 89 |
| 267 | 3300046526 | Ga0495666_0026370 | Ga0495666_0026370_307_588 | 89 |
| 268 | 3300046528 | Ga0495642_0194566 | Ga0495642_0194566_333_614 | 89 |
| 269 | 3300046529 | Ga0495652_0406030 | Ga0495652_0406030_145_426 | 89 |
| 270 | 3300046533 | Ga0495640_0224264 | Ga0495640_0224264_600_881 | 89 |
| 271 | 3300046535 | Ga0495586_0316726 | Ga0495586_0316726_297_578 | 89 |
| 272 | 3300046538 | Ga0495609_0291757 | Ga0495609_0291757_197_478 | 89 |
| 273 | 3300046648 | Ga0495611_0020256 | Ga0495611_0020256_1948_2229 | 89 |
| 274 | 3300046665 | Ga0495661_0349381 | Ga0495661_0349381_163_444 | 89 |
| 275 | 3300046680 | Ga0495646_0013259 | Ga0495646_0013259_44_325 | 89 |
| 276 | 3300046689 | Ga0495613_0502239 | Ga0495613_0502239_224_505 | 89 |
| 277 | 3300046690 | Ga0495624_0005326 | Ga0495624_0005326_3932_4213 | 89 |
| 278 | 3300046692 | Ga0495671_0101982 | Ga0495671_0101982_638_919 | 89 |
| 279 | 3300046694 | Ga0495649_0096544 | Ga0495649_0096544_1241_1522 | 89 |
| 280 | 3300046694 | Ga0495649_0413144 | Ga0495649_0413144_74_355 | 89 |
| 281 | 3300046794 | Ga0495589_0117511 | Ga0495589_0117511_580_861 | 89 |
| 282 | 3300046810 | Ga0495660_0375801 | Ga0495660_0375801_162_443 | 89 |
| 283 | 3300047319 | Ga0495674_0892608 | Ga0495674_0892608_226_507 | 89 |
| 284 | 3300047319 | Ga0495674_1344268 | Ga0495674_1344268_164_445 | 89 |
| 285 | 3300047321 | Ga0495676_0172814 | Ga0495676_0172814_545_826 | 89 |
| 286 | 3300047323 | Ga0495683_0101151 | Ga0495683_0101151_628_909 | 89 |
| 287 | 3300047446 | Ga0495679_000065 | Ga0495679_000065_27261_27542 | 89 |
| 288 | 3300047469 | Ga0495673_0028904 | Ga0495673_0028904_285_566 | 89 |
| 289 | 3300047472 | Ga0495686_0016574 | Ga0495686_0016574_4133_4414 | 89 |
| 290 | 3300047472 | Ga0495686_0094880 | Ga0495686_0094880_894_1175 | 89 |
| 291 | 3300047673 | Ga0495593_0014956 | Ga0495593_0014956_693_974 | 89 |
| 292 | 3300048089 | Ga0495614_0146034 | Ga0495614_0146034_376_657 | 89 |
| 293 | 3300048091 | Ga0495626_0048540 | Ga0495626_0048540_556_837 | 89 |
| 294 | 3300048905 | Ga0496102_0842229 | Ga0496102_0842229_501_782 | 89 |
| 295 | 3300048920 | Ga0496117_0228042 | Ga0496117_0228042_207_488 | 89 |
| 296 | 3300048921 | Ga0496118_0017738 | Ga0496118_0017738_1959_2240 | 89 |
| 297 | 3300048924 | Ga0496121_0180827 | Ga0496121_0180827_932_1213 | 89 |
| 298 | 3300048929 | Ga0496126_0404954 | Ga0496126_0404954_85_366 | 89 |
| 299 | 3300049459 | Ga0495678_018945 | Ga0495678_018945_2578_2859 | 89 |
| 300 | 2162886007 | SwRhRL2b_contig_622859 | SwRhRL2b_0154.00004850 | 90 |
| 301 | 3300002239 | JGI24034J26672_10092086 | JGI24034J26672_100920862 | 90 |
| 302 | 3300002738 | JGI25154J39366_1001328 | JGI25154J39366_10013284 | 90 |
| 303 | 3300002741 | JGI25157J39369_1000174 | JGI25157J39369_100017430 | 90 |
| 304 | 3300003322 | rootL2_10070942 | rootL2_100709423 | 90 |
| 305 | 3300003752 | Ga0055539_1000945 | Ga0055539_10009456 | 90 |
| 306 | 3300003775 | Ga0055524_1000382 | Ga0055524_10003822 | 90 |
| 307 | 3300003791 | Ga0055530_10010753 | Ga0055530_100107533 | 90 |
| 308 | 3300003791 | Ga0055530_10011777 | Ga0055530_100117772 | 90 |
| 309 | 3300003792 | Ga0055540_1000007 | Ga0055540_1000007167 | 90 |
| 310 | 3300003794 | Ga0055531_10006835 | Ga0055531_100068352 | 90 |
| 311 | 3300004625 | Ga0055543_1038120 | Ga0055543_10381202 | 90 |
| 312 | 3300005262 | Ga0065165_1000086 | Ga0065165_1000086123 | 90 |
| 313 | 3300005262 | Ga0065165_1000235 | Ga0065165_100023555 | 90 |
| 314 | 3300005262 | Ga0065165_1002164 | Ga0065165_10021649 | 90 |
| 315 | 3300005289 | Ga0065704_10018733 | Ga0065704_100187332 | 90 |
| 316 | 3300005289 | Ga0065704_10073318 | Ga0065704_100733183 | 90 |
| 317 | 3300005289 | Ga0065704_10079152 | Ga0065704_100791523 | 90 |
| 318 | 3300005290 | Ga0065712_10163129 | Ga0065712_101631292 | 90 |
| 319 | 3300005293 | Ga0065715_10031625 | Ga0065715_100316252 | 90 |
| 320 | 3300005327 | Ga0070658_10203857 | Ga0070658_102038572 | 90 |
| 321 | 3300005327 | Ga0070658_10491275 | Ga0070658_104912752 | 90 |
| 322 | 3300005327 | Ga0070658_10669654 | Ga0070658_106696542 | 90 |
| 323 | 3300005327 | Ga0070658_11061572 | Ga0070658_110615721 | 90 |
| 324 | 3300005328 | Ga0070676_10048163 | Ga0070676_100481633 | 90 |
| 325 | 3300005328 | Ga0070676_10973277 | Ga0070676_109732772 | 90 |
| 326 | 3300005329 | Ga0070683_101185393 | Ga0070683_1011853932 | 90 |
| 327 | 3300005330 | Ga0070690_100128237 | Ga0070690_1001282371 | 90 |
| 328 | 3300005330 | Ga0070690_100253544 | Ga0070690_1002535442 | 90 |
| 329 | 3300005331 | Ga0070670_100052022 | Ga0070670_1000520222 | 90 |
| 330 | 3300005331 | Ga0070670_100307809 | Ga0070670_1003078092 | 90 |
| 331 | 3300005331 | Ga0070670_100912905 | Ga0070670_1009129052 | 90 |
| 332 | 3300005333 | Ga0070677_10016375 | Ga0070677_100163752 | 90 |
| 333 | 3300005333 | Ga0070677_10088814 | Ga0070677_100888142 | 90 |
| 334 | 3300005333 | Ga0070677_10146526 | Ga0070677_101465262 | 90 |
| 335 | 3300005333 | Ga0070677_10276150 | Ga0070677_102761502 | 90 |
| 336 | 3300005333 | Ga0070677_10423421 | Ga0070677_104234212 | 90 |
| 337 | 3300005334 | Ga0068869_100166463 | Ga0068869_1001664632 | 90 |
| 338 | 3300005334 | Ga0068869_100415755 | Ga0068869_1004157552 | 90 |
| 339 | 3300005334 | Ga0068869_100682419 | Ga0068869_1006824191 | 90 |
| 340 | 3300005335 | Ga0070666_10015740 | Ga0070666_100157403 | 90 |
| 341 | 3300005337 | Ga0070682_100403372 | Ga0070682_1004033721 | 90 |
| 342 | 3300005337 | Ga0070682_100523732 | Ga0070682_1005237322 | 90 |
| 343 | 3300005337 | Ga0070682_100811867 | Ga0070682_1008118672 | 90 |
| 344 | 3300005338 | Ga0068868_100148109 | Ga0068868_1001481092 | 90 |
| 345 | 3300005338 | Ga0068868_100299517 | Ga0068868_1002995172 | 90 |
| 346 | 3300005338 | Ga0068868_100303460 | Ga0068868_1003034602 | 90 |
| 347 | 3300005339 | Ga0070660_100364435 | Ga0070660_1003644351 | 90 |
| 348 | 3300005339 | Ga0070660_101588086 | Ga0070660_1015880861 | 90 |
| 349 | 3300005343 | Ga0070687_100003481 | Ga0070687_1000034812 | 90 |
| 350 | 3300005343 | Ga0070687_100767905 | Ga0070687_1007679052 | 90 |
| 351 | 3300005343 | Ga0070687_101459898 | Ga0070687_1014598981 | 90 |
| 352 | 3300005344 | Ga0070661_100779258 | Ga0070661_1007792582 | 90 |
| 353 | 3300005345 | Ga0070692_10172546 | Ga0070692_101725462 | 90 |
| 354 | 3300005347 | Ga0070668_100102676 | Ga0070668_1001026762 | 90 |
| 355 | 3300005347 | Ga0070668_100747379 | Ga0070668_1007473792 | 90 |
| 356 | 3300005353 | Ga0070669_100001506 | Ga0070669_10000150614 | 90 |
| 357 | 3300005353 | Ga0070669_100440320 | Ga0070669_1004403202 | 90 |
| 358 | 3300005354 | Ga0070675_100009934 | Ga0070675_1000099346 | 90 |
| 359 | 3300005354 | Ga0070675_100253990 | Ga0070675_1002539902 | 90 |
| 360 | 3300005354 | Ga0070675_100394423 | Ga0070675_1003944232 | 90 |
| 361 | 3300005354 | Ga0070675_100905371 | Ga0070675_1009053712 | 90 |
| 362 | 3300005355 | Ga0070671_100237680 | Ga0070671_1002376801 | 90 |
| 363 | 3300005355 | Ga0070671_100432731 | Ga0070671_1004327312 | 90 |
| 364 | 3300005355 | Ga0070671_100494677 | Ga0070671_1004946772 | 90 |
| 365 | 3300005355 | Ga0070671_100820366 | Ga0070671_1008203662 | 90 |
| 366 | 3300005356 | Ga0070674_100027773 | Ga0070674_1000277732 | 90 |
| 367 | 3300005356 | Ga0070674_100107096 | Ga0070674_1001070961 | 90 |
| 368 | 3300005356 | Ga0070674_100453939 | Ga0070674_1004539392 | 90 |
| 369 | 3300005364 | Ga0070673_100059360 | Ga0070673_1000593602 | 90 |
| 370 | 3300005364 | Ga0070673_100107956 | Ga0070673_1001079562 | 90 |
| 371 | 3300005364 | Ga0070673_100253974 | Ga0070673_1002539742 | 90 |
| 372 | 3300005364 | Ga0070673_100337151 | Ga0070673_1003371512 | 90 |
| 373 | 3300005364 | Ga0070673_100755709 | Ga0070673_1007557092 | 90 |
| 374 | 3300005365 | Ga0070688_100154552 | Ga0070688_1001545523 | 90 |
| 375 | 3300005365 | Ga0070688_101644674 | Ga0070688_1016446741 | 90 |
| 376 | 3300005366 | Ga0070659_101839304 | Ga0070659_1018393041 | 90 |
| 377 | 3300005367 | Ga0070667_100000636 | Ga0070667_10000063614 | 90 |
| 378 | 3300005367 | Ga0070667_100482849 | Ga0070667_1004828491 | 90 |
| 379 | 3300005438 | Ga0070701_10121211 | Ga0070701_101212112 | 90 |
| 380 | 3300005441 | Ga0070700_100209859 | Ga0070700_1002098592 | 90 |
| 381 | 3300005441 | Ga0070700_100455380 | Ga0070700_1004553802 | 90 |
| 382 | 3300005455 | Ga0070663_100300621 | Ga0070663_1003006212 | 90 |
| 383 | 3300005455 | Ga0070663_100521381 | Ga0070663_1005213812 | 90 |
| 384 | 3300005455 | Ga0070663_100709399 | Ga0070663_1007093992 | 90 |
| 385 | 3300005456 | Ga0070678_100198110 | Ga0070678_1001981102 | 90 |
| 386 | 3300005456 | Ga0070678_100218706 | Ga0070678_1002187062 | 90 |
| 387 | 3300005456 | Ga0070678_100257296 | Ga0070678_1002572962 | 90 |
| 388 | 3300005456 | Ga0070678_100826670 | Ga0070678_1008266702 | 90 |
| 389 | 3300005456 | Ga0070678_100919308 | Ga0070678_1009193081 | 90 |
| 390 | 3300005456 | Ga0070678_101058824 | Ga0070678_1010588241 | 90 |
| 391 | 3300005457 | Ga0070662_100025582 | Ga0070662_1000255822 | 90 |
| 392 | 3300005457 | Ga0070662_100722567 | Ga0070662_1007225672 | 90 |
| 393 | 3300005457 | Ga0070662_101220483 | Ga0070662_1012204831 | 90 |
| 394 | 3300005458 | Ga0070681_11558058 | Ga0070681_115580581 | 90 |
| 395 | 3300005459 | Ga0068867_100043717 | Ga0068867_1000437172 | 90 |
| 396 | 3300005459 | Ga0068867_100156473 | Ga0068867_1001564732 | 90 |
| 397 | 3300005459 | Ga0068867_100205564 | Ga0068867_1002055642 | 90 |
| 398 | 3300005459 | Ga0068867_100514033 | Ga0068867_1005140332 | 90 |
| 399 | 3300005459 | Ga0068867_100546159 | Ga0068867_1005461592 | 90 |
| 400 | 3300005466 | Ga0070685_10621566 | Ga0070685_106215662 | 90 |
| 401 | 3300005466 | Ga0070685_11064154 | Ga0070685_110641541 | 90 |
| 402 | 3300005518 | Ga0070699_101220288 | Ga0070699_1012202881 | 90 |
| 403 | 3300005539 | Ga0068853_100979768 | Ga0068853_1009797682 | 90 |
| 404 | 3300005543 | Ga0070672_100123907 | Ga0070672_1001239073 | 90 |
| 405 | 3300005543 | Ga0070672_100136764 | Ga0070672_1001367643 | 90 |
| 406 | 3300005543 | Ga0070672_100405930 | Ga0070672_1004059302 | 90 |
| 407 | 3300005543 | Ga0070672_100602915 | Ga0070672_1006029152 | 90 |
| 408 | 3300005543 | Ga0070672_100613309 | Ga0070672_1006133092 | 90 |
| 409 | 3300005543 | Ga0070672_101583890 | Ga0070672_1015838901 | 90 |
| 410 | 3300005547 | Ga0070693_100066938 | Ga0070693_1000669382 | 90 |
| 411 | 3300005548 | Ga0070665_100367882 | Ga0070665_1003678821 | 90 |
| 412 | 3300005548 | Ga0070665_100827760 | Ga0070665_1008277602 | 90 |
| 413 | 3300005548 | Ga0070665_101191232 | Ga0070665_1011912322 | 90 |
| 414 | 3300005548 | Ga0070665_102439554 | Ga0070665_1024395541 | 90 |
| 415 | 3300005563 | Ga0068855_101115339 | Ga0068855_1011153392 | 90 |
| 416 | 3300005564 | Ga0070664_100088261 | Ga0070664_1000882612 | 90 |
| 417 | 3300005564 | Ga0070664_100774111 | Ga0070664_1007741112 | 90 |
| 418 | 3300005564 | Ga0070664_100943343 | Ga0070664_1009433432 | 90 |
| 419 | 3300005577 | Ga0068857_100096958 | Ga0068857_1000969582 | 90 |
| 420 | 3300005577 | Ga0068857_100945877 | Ga0068857_1009458772 | 90 |
| 421 | 3300005577 | Ga0068857_102403231 | Ga0068857_1024032311 | 90 |
| 422 | 3300005578 | Ga0068854_100050348 | Ga0068854_1000503482 | 90 |
| 423 | 3300005578 | Ga0068854_100089851 | Ga0068854_1000898512 | 90 |
| 424 | 3300005578 | Ga0068854_101217028 | Ga0068854_1012170282 | 90 |
| 425 | 3300005614 | Ga0068856_100006961 | Ga0068856_1000069614 | 90 |
| 426 | 3300005614 | Ga0068856_101153095 | Ga0068856_1011530952 | 90 |
| 427 | 3300005616 | Ga0068852_100033115 | Ga0068852_1000331152 | 90 |
| 428 | 3300005616 | Ga0068852_100238247 | Ga0068852_1002382472 | 90 |
| 429 | 3300005616 | Ga0068852_100589195 | Ga0068852_1005891952 | 90 |
| 430 | 3300005617 | Ga0068859_100428329 | Ga0068859_1004283292 | 90 |
| 431 | 3300005618 | Ga0068864_100110373 | Ga0068864_1001103732 | 90 |
| 432 | 3300005618 | Ga0068864_100734640 | Ga0068864_1007346402 | 90 |
| 433 | 3300005618 | Ga0068864_100819805 | Ga0068864_1008198052 | 90 |
| 434 | 3300005618 | Ga0068864_100835979 | Ga0068864_1008359792 | 90 |
| 435 | 3300005718 | Ga0068866_10002802 | Ga0068866_100028026 | 90 |
| 436 | 3300005718 | Ga0068866_10140780 | Ga0068866_101407801 | 90 |
| 437 | 3300005719 | Ga0068861_100029369 | Ga0068861_1000293693 | 90 |
| 438 | 3300005719 | Ga0068861_100048999 | Ga0068861_1000489994 | 90 |
| 439 | 3300005834 | Ga0068851_10022006 | Ga0068851_100220062 | 90 |
| 440 | 3300005834 | Ga0068851_10044340 | Ga0068851_100443402 | 90 |
| 441 | 3300005834 | Ga0068851_10138554 | Ga0068851_101385541 | 90 |
| 442 | 3300005840 | Ga0068870_10723962 | Ga0068870_107239622 | 90 |
| 443 | 3300005840 | Ga0068870_10742945 | Ga0068870_107429452 | 90 |
| 444 | 3300005841 | Ga0068863_100347175 | Ga0068863_1003471752 | 90 |
| 445 | 3300005841 | Ga0068863_100647952 | Ga0068863_1006479522 | 90 |
| 446 | 3300005841 | Ga0068863_100696704 | Ga0068863_1006967042 | 90 |
| 447 | 3300005842 | Ga0068858_100002624 | Ga0068858_1000026249 | 90 |
| 448 | 3300005843 | Ga0068860_100003703 | Ga0068860_10000370314 | 90 |
| 449 | 3300005843 | Ga0068860_101347548 | Ga0068860_1013475482 | 90 |
| 450 | 3300005843 | Ga0068860_101968014 | Ga0068860_1019680142 | 90 |
| 451 | 3300005844 | Ga0068862_100017098 | Ga0068862_1000170985 | 90 |
| 452 | 3300005844 | Ga0068862_101869952 | Ga0068862_1018699522 | 90 |
| 453 | 3300006058 | Ga0075432_10013205 | Ga0075432_100132052 | 90 |
| 454 | 3300006058 | Ga0075432_10494639 | Ga0075432_104946391 | 90 |
| 455 | 3300006177 | Ga0075362_10110692 | Ga0075362_101106922 | 90 |
| 456 | 3300006177 | Ga0075362_10235047 | Ga0075362_102350472 | 90 |
| 457 | 3300006186 | Ga0075369_10182526 | Ga0075369_101825261 | 90 |
| 458 | 3300006195 | Ga0075366_10062979 | Ga0075366_100629792 | 90 |
| 459 | 3300006195 | Ga0075366_10091996 | Ga0075366_100919962 | 90 |
| 460 | 3300006195 | Ga0075366_10227483 | Ga0075366_102274831 | 90 |
| 461 | 3300006237 | Ga0097621_100165746 | Ga0097621_1001657462 | 90 |
| 462 | 3300006237 | Ga0097621_100327733 | Ga0097621_1003277332 | 90 |
| 463 | 3300006237 | Ga0097621_100714484 | Ga0097621_1007144842 | 90 |
| 464 | 3300006353 | Ga0075370_10012364 | Ga0075370_100123643 | 90 |
| 465 | 3300006353 | Ga0075370_10403310 | Ga0075370_104033101 | 90 |
| 466 | 3300006358 | Ga0068871_100077610 | Ga0068871_1000776103 | 90 |
| 467 | 3300006358 | Ga0068871_100244764 | Ga0068871_1002447642 | 90 |
| 468 | 3300006358 | Ga0068871_100483152 | Ga0068871_1004831522 | 90 |
| 469 | 3300006358 | Ga0068871_100940012 | Ga0068871_1009400122 | 90 |
| 470 | 3300006881 | Ga0068865_100016659 | Ga0068865_1000166595 | 90 |
| 471 | 3300006881 | Ga0068865_100288289 | Ga0068865_1002882892 | 90 |
| 472 | 3300006881 | Ga0068865_100450009 | Ga0068865_1004500092 | 90 |
| 473 | 3300006881 | Ga0068865_101090221 | Ga0068865_1010902212 | 90 |
| 474 | 3300006931 | Ga0097620_100428333 | Ga0097620_1004283332 | 90 |
| 475 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009134 | 90 |
| 476 | 3300006946 | Ga0079104_1000027 | Ga0079104_1000027115 | 90 |
| 477 | 3300007265 | Ga0099794_10048468 | Ga0099794_100484682 | 90 |
| 478 | 3300009011 | Ga0105251_10052712 | Ga0105251_100527122 | 90 |
| 479 | 3300009011 | Ga0105251_10072590 | Ga0105251_100725902 | 90 |
| 480 | 3300009036 | Ga0105244_10012038 | Ga0105244_100120384 | 90 |
| 481 | 3300009036 | Ga0105244_10033396 | Ga0105244_100333962 | 90 |
| 482 | 3300009036 | Ga0105244_10581851 | Ga0105244_105818512 | 90 |
| 483 | 3300009092 | Ga0105250_10000154 | Ga0105250_1000015434 | 90 |
| 484 | 3300009092 | Ga0105250_10019226 | Ga0105250_100192264 | 90 |
| 485 | 3300009093 | Ga0105240_11185733 | Ga0105240_111857332 | 90 |
| 486 | 3300009094 | Ga0111539_11390303 | Ga0111539_113903032 | 90 |
| 487 | 3300009094 | Ga0111539_11445126 | Ga0111539_114451262 | 90 |
| 488 | 3300009098 | Ga0105245_10184159 | Ga0105245_101841592 | 90 |
| 489 | 3300009098 | Ga0105245_11367166 | Ga0105245_113671662 | 90 |
| 490 | 3300009148 | Ga0105243_10003470 | Ga0105243_1000347011 | 90 |
| 491 | 3300009148 | Ga0105243_10025635 | Ga0105243_100256352 | 90 |
| 492 | 3300009148 | Ga0105243_10038716 | Ga0105243_100387163 | 90 |
| 493 | 3300009148 | Ga0105243_10236538 | Ga0105243_102365382 | 90 |
| 494 | 3300009148 | Ga0105243_10748371 | Ga0105243_107483712 | 90 |
| 495 | 3300009148 | Ga0105243_10935658 | Ga0105243_109356582 | 90 |
| 496 | 3300009174 | Ga0105241_10368179 | Ga0105241_103681791 | 90 |
| 497 | 3300009176 | Ga0105242_10298386 | Ga0105242_102983862 | 90 |
| 498 | 3300009176 | Ga0105242_12760961 | Ga0105242_127609611 | 90 |
| 499 | 3300009177 | Ga0105248_10439125 | Ga0105248_104391252 | 90 |
| 500 | 3300009177 | Ga0105248_10579278 | Ga0105248_105792782 | 90 |
| 501 | 3300009177 | Ga0105248_10710399 | Ga0105248_107103992 | 90 |
| 502 | 3300009177 | Ga0105248_11737017 | Ga0105248_117370171 | 90 |
| 503 | 3300009177 | Ga0105248_11793542 | Ga0105248_117935421 | 90 |
| 504 | 3300009545 | Ga0105237_10563789 | Ga0105237_105637891 | 90 |
| 505 | 3300009545 | Ga0105237_11156416 | Ga0105237_111564162 | 90 |
| 506 | 3300009551 | Ga0105238_10053271 | Ga0105238_100532713 | 90 |
| 507 | 3300009551 | Ga0105238_13002724 | Ga0105238_130027242 | 90 |
| 508 | 3300009553 | Ga0105249_10050703 | Ga0105249_100507034 | 90 |
| 509 | 3300011119 | Ga0105246_10112314 | Ga0105246_101123143 | 90 |
| 510 | 3300011119 | Ga0105246_10229796 | Ga0105246_102297962 | 90 |
| 511 | 3300011119 | Ga0105246_10345022 | Ga0105246_103450222 | 90 |
| 512 | 3300011119 | Ga0105246_10995853 | Ga0105246_109958532 | 90 |
| 513 | 3300012475 | Ga0157317_1008933 | Ga0157317_10089331 | 90 |
| 514 | 3300013100 | Ga0157373_10327042 | Ga0157373_103270422 | 90 |
| 515 | 3300013102 | Ga0157371_10091369 | Ga0157371_100913693 | 90 |
| 516 | 3300013104 | Ga0157370_10093734 | Ga0157370_100937342 | 90 |
| 517 | 3300013105 | Ga0157369_10093152 | Ga0157369_100931524 | 90 |
| 518 | 3300013105 | Ga0157369_10227370 | Ga0157369_102273702 | 90 |
| 519 | 3300013296 | Ga0157374_10488085 | Ga0157374_104880852 | 90 |
| 520 | 3300013296 | Ga0157374_10903412 | Ga0157374_109034122 | 90 |
| 521 | 3300013297 | Ga0157378_10127654 | Ga0157378_101276542 | 90 |
| 522 | 3300013297 | Ga0157378_10214102 | Ga0157378_102141022 | 90 |
| 523 | 3300013297 | Ga0157378_10464615 | Ga0157378_104646152 | 90 |
| 524 | 3300013297 | Ga0157378_10649221 | Ga0157378_106492212 | 90 |
| 525 | 3300013306 | Ga0163162_10009904 | Ga0163162_100099047 | 90 |
| 526 | 3300013306 | Ga0163162_10828502 | Ga0163162_108285022 | 90 |
| 527 | 3300013306 | Ga0163162_13201861 | Ga0163162_132018611 | 90 |
| 528 | 3300013307 | Ga0157372_10921801 | Ga0157372_109218011 | 90 |
| 529 | 3300013307 | Ga0157372_11053777 | Ga0157372_110537772 | 90 |
| 530 | 3300013308 | Ga0157375_10006157 | Ga0157375_1000615711 | 90 |
| 531 | 3300013308 | Ga0157375_10658984 | Ga0157375_106589842 | 90 |
| 532 | 3300013308 | Ga0157375_10734816 | Ga0157375_107348161 | 90 |
| 533 | 3300013308 | Ga0157375_10996008 | Ga0157375_109960082 | 90 |
| 534 | 3300013308 | Ga0157375_11057321 | Ga0157375_110573212 | 90 |
| 535 | 3300013308 | Ga0157375_11514486 | Ga0157375_115144862 | 90 |
| 536 | 3300014325 | Ga0163163_10738912 | Ga0163163_107389122 | 90 |
| 537 | 3300014326 | Ga0157380_10014459 | Ga0157380_100144597 | 90 |
| 538 | 3300014326 | Ga0157380_10609058 | Ga0157380_106090582 | 90 |
| 539 | 3300014497 | Ga0182008_10660699 | Ga0182008_106606991 | 90 |
| 540 | 3300014745 | Ga0157377_10574370 | Ga0157377_105743702 | 90 |
| 541 | 3300014968 | Ga0157379_10042622 | Ga0157379_100426223 | 90 |
| 542 | 3300014968 | Ga0157379_10399680 | Ga0157379_103996802 | 90 |
| 543 | 3300014968 | Ga0157379_10598042 | Ga0157379_105980422 | 90 |
| 544 | 3300014968 | Ga0157379_10936175 | Ga0157379_109361752 | 90 |
| 545 | 3300014969 | Ga0157376_10348138 | Ga0157376_103481382 | 90 |
| 546 | 3300014969 | Ga0157376_10473703 | Ga0157376_104737032 | 90 |
| 547 | 3300014969 | Ga0157376_10511515 | Ga0157376_105115152 | 90 |
| 548 | 3300014969 | Ga0157376_10714935 | Ga0157376_107149352 | 90 |
| 549 | 3300015262 | Ga0182007_10121101 | Ga0182007_101211012 | 90 |
| 550 | 3300017792 | Ga0163161_10044212 | Ga0163161_100442122 | 90 |
| 551 | 3300017792 | Ga0163161_10408614 | Ga0163161_104086142 | 90 |
| 552 | 3300017792 | Ga0163161_10853685 | Ga0163161_108536852 | 90 |
| 553 | 3300025231 | Ga0207427_100729 | Ga0207427_1007297 | 90 |
| 554 | 3300025242 | Ga0209258_100773 | Ga0209258_1007739 | 90 |
| 555 | 3300025246 | Ga0209646_1000066 | Ga0209646_1000066140 | 90 |
| 556 | 3300025250 | Ga0209026_1000027 | Ga0209026_1000027189 | 90 |
| 557 | 3300025253 | Ga0209677_102663 | Ga0209677_1026632 | 90 |
| 558 | 3300025256 | Ga0209759_1000131 | Ga0209759_100013135 | 90 |
| 559 | 3300025256 | Ga0209759_1012126 | Ga0209759_10121262 | 90 |
| 560 | 3300025263 | Ga0209565_1043230 | Ga0209565_10432302 | 90 |
| 561 | 3300025272 | Ga0209455_1015512 | Ga0209455_10155122 | 90 |
| 562 | 3300025273 | Ga0209673_1009232 | Ga0209673_10092324 | 90 |
| 563 | 3300025290 | Ga0207673_1025987 | Ga0207673_10259872 | 90 |
| 564 | 3300025291 | Ga0209675_1021084 | Ga0209675_10210843 | 90 |
| 565 | 3300025298 | Ga0209050_1001570 | Ga0209050_10015701 | 90 |
| 566 | 3300025298 | Ga0209050_1002504 | Ga0209050_10025049 | 90 |
| 567 | 3300025298 | Ga0209050_1005060 | Ga0209050_10050609 | 90 |
| 568 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019190 | 90 |
| 569 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004220 | 90 |
| 570 | 3300025303 | Ga0209051_1035232 | Ga0209051_10352322 | 90 |
| 571 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038354 | 90 |
| 572 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044205 | 90 |
| 573 | 3300025315 | Ga0207697_10177441 | Ga0207697_101774412 | 90 |
| 574 | 3300025315 | Ga0207697_10228982 | Ga0207697_102289822 | 90 |
| 575 | 3300025321 | Ga0207656_10068933 | Ga0207656_100689332 | 90 |
| 576 | 3300025321 | Ga0207656_10299040 | Ga0207656_102990402 | 90 |
| 577 | 3300025711 | Ga0207696_1000023 | Ga0207696_1000023319 | 90 |
| 578 | 3300025711 | Ga0207696_1000388 | Ga0207696_100038827 | 90 |
| 579 | 3300025711 | Ga0207696_1009529 | Ga0207696_10095292 | 90 |
| 580 | 3300025728 | Ga0207655_1012271 | Ga0207655_10122713 | 90 |
| 581 | 3300025728 | Ga0207655_1060337 | Ga0207655_10603372 | 90 |
| 582 | 3300025735 | Ga0207713_1007575 | Ga0207713_10075758 | 90 |
| 583 | 3300025735 | Ga0207713_1041352 | Ga0207713_10413522 | 90 |
| 584 | 3300025893 | Ga0207682_10028376 | Ga0207682_100283762 | 90 |
| 585 | 3300025893 | Ga0207682_10043637 | Ga0207682_100436372 | 90 |
| 586 | 3300025893 | Ga0207682_10114007 | Ga0207682_101140072 | 90 |
| 587 | 3300025893 | Ga0207682_10122081 | Ga0207682_101220812 | 90 |
| 588 | 3300025893 | Ga0207682_10319624 | Ga0207682_103196242 | 90 |
| 589 | 3300025899 | Ga0207642_10155369 | Ga0207642_101553692 | 90 |
| 590 | 3300025899 | Ga0207642_10267637 | Ga0207642_102676372 | 90 |
| 591 | 3300025899 | Ga0207642_10360036 | Ga0207642_103600362 | 90 |
| 592 | 3300025901 | Ga0207688_10260773 | Ga0207688_102607732 | 90 |
| 593 | 3300025907 | Ga0207645_10160656 | Ga0207645_101606562 | 90 |
| 594 | 3300025907 | Ga0207645_10273214 | Ga0207645_102732142 | 90 |
| 595 | 3300025907 | Ga0207645_10497654 | Ga0207645_104976542 | 90 |
| 596 | 3300025907 | Ga0207645_10539898 | Ga0207645_105398982 | 90 |
| 597 | 3300025908 | Ga0207643_10043732 | Ga0207643_100437324 | 90 |
| 598 | 3300025908 | Ga0207643_10404359 | Ga0207643_104043592 | 90 |
| 599 | 3300025908 | Ga0207643_10807544 | Ga0207643_108075442 | 90 |
| 600 | 3300025908 | Ga0207643_10876025 | Ga0207643_108760251 | 90 |
| 601 | 3300025909 | Ga0207705_10394423 | Ga0207705_103944231 | 90 |
| 602 | 3300025909 | Ga0207705_10403274 | Ga0207705_104032742 | 90 |
| 603 | 3300025909 | Ga0207705_10470124 | Ga0207705_104701242 | 90 |
| 604 | 3300025909 | Ga0207705_10761401 | Ga0207705_107614012 | 90 |
| 605 | 3300025911 | Ga0207654_11304631 | Ga0207654_113046311 | 90 |
| 606 | 3300025912 | Ga0207707_11099585 | Ga0207707_110995851 | 90 |
| 607 | 3300025913 | Ga0207695_10281430 | Ga0207695_102814302 | 90 |
| 608 | 3300025913 | Ga0207695_11375810 | Ga0207695_113758102 | 90 |
| 609 | 3300025914 | Ga0207671_10157381 | Ga0207671_101573813 | 90 |
| 610 | 3300025918 | Ga0207662_10075082 | Ga0207662_100750822 | 90 |
| 611 | 3300025918 | Ga0207662_10171702 | Ga0207662_101717021 | 90 |
| 612 | 3300025919 | Ga0207657_10184391 | Ga0207657_101843912 | 90 |
| 613 | 3300025919 | Ga0207657_10577211 | Ga0207657_105772112 | 90 |
| 614 | 3300025919 | Ga0207657_11129387 | Ga0207657_111293871 | 90 |
| 615 | 3300025920 | Ga0207649_10234531 | Ga0207649_102345312 | 90 |
| 616 | 3300025923 | Ga0207681_10001265 | Ga0207681_1000126510 | 90 |
| 617 | 3300025923 | Ga0207681_10801055 | Ga0207681_108010552 | 90 |
| 618 | 3300025925 | Ga0207650_10027888 | Ga0207650_100278882 | 90 |
| 619 | 3300025925 | Ga0207650_10033574 | Ga0207650_100335742 | 90 |
| 620 | 3300025925 | Ga0207650_10123901 | Ga0207650_101239013 | 90 |
| 621 | 3300025925 | Ga0207650_10151021 | Ga0207650_101510211 | 90 |
| 622 | 3300025925 | Ga0207650_10600944 | Ga0207650_106009442 | 90 |
| 623 | 3300025926 | Ga0207659_10020879 | Ga0207659_100208794 | 90 |
| 624 | 3300025926 | Ga0207659_10051122 | Ga0207659_100511223 | 90 |
| 625 | 3300025926 | Ga0207659_10225781 | Ga0207659_102257811 | 90 |
| 626 | 3300025926 | Ga0207659_10393978 | Ga0207659_103939782 | 90 |
| 627 | 3300025927 | Ga0207687_10175537 | Ga0207687_101755372 | 90 |
| 628 | 3300025931 | Ga0207644_10257495 | Ga0207644_102574952 | 90 |
| 629 | 3300025931 | Ga0207644_10332113 | Ga0207644_103321132 | 90 |
| 630 | 3300025931 | Ga0207644_10666430 | Ga0207644_106664302 | 90 |
| 631 | 3300025931 | Ga0207644_10802138 | Ga0207644_108021381 | 90 |
| 632 | 3300025932 | Ga0207690_10220595 | Ga0207690_102205951 | 90 |
| 633 | 3300025933 | Ga0207706_10074957 | Ga0207706_100749572 | 90 |
| 634 | 3300025933 | Ga0207706_10465713 | Ga0207706_104657132 | 90 |
| 635 | 3300025934 | Ga0207686_10165372 | Ga0207686_101653722 | 90 |
| 636 | 3300025935 | Ga0207709_10000862 | Ga0207709_100008623 | 90 |
| 637 | 3300025935 | Ga0207709_10015406 | Ga0207709_100154062 | 90 |
| 638 | 3300025935 | Ga0207709_10230020 | Ga0207709_102300202 | 90 |
| 639 | 3300025935 | Ga0207709_10676048 | Ga0207709_106760482 | 90 |
| 640 | 3300025937 | Ga0207669_10071825 | Ga0207669_100718252 | 90 |
| 641 | 3300025937 | Ga0207669_10594578 | Ga0207669_105945782 | 90 |
| 642 | 3300025937 | Ga0207669_10899012 | Ga0207669_108990121 | 90 |
| 643 | 3300025938 | Ga0207704_10067950 | Ga0207704_100679503 | 90 |
| 644 | 3300025938 | Ga0207704_10253452 | Ga0207704_102534522 | 90 |
| 645 | 3300025940 | Ga0207691_10156403 | Ga0207691_101564032 | 90 |
| 646 | 3300025940 | Ga0207691_10300137 | Ga0207691_103001372 | 90 |
| 647 | 3300025940 | Ga0207691_10314775 | Ga0207691_103147752 | 90 |
| 648 | 3300025940 | Ga0207691_10559784 | Ga0207691_105597842 | 90 |
| 649 | 3300025940 | Ga0207691_11176543 | Ga0207691_111765432 | 90 |
| 650 | 3300025941 | Ga0207711_10071991 | Ga0207711_100719912 | 90 |
| 651 | 3300025941 | Ga0207711_10107753 | Ga0207711_101077533 | 90 |
| 652 | 3300025942 | Ga0207689_10092580 | Ga0207689_100925802 | 90 |
| 653 | 3300025942 | Ga0207689_10182276 | Ga0207689_101822762 | 90 |
| 654 | 3300025942 | Ga0207689_10250095 | Ga0207689_102500952 | 90 |
| 655 | 3300025942 | Ga0207689_10323587 | Ga0207689_103235872 | 90 |
| 656 | 3300025945 | Ga0207679_11003892 | Ga0207679_110038922 | 90 |
| 657 | 3300025949 | Ga0207667_10188551 | Ga0207667_101885512 | 90 |
| 658 | 3300025949 | Ga0207667_11012782 | Ga0207667_110127822 | 90 |
| 659 | 3300025960 | Ga0207651_10237856 | Ga0207651_102378562 | 90 |
| 660 | 3300025960 | Ga0207651_10459673 | Ga0207651_104596732 | 90 |
| 661 | 3300025960 | Ga0207651_10695255 | Ga0207651_106952552 | 90 |
| 662 | 3300025960 | Ga0207651_10701669 | Ga0207651_107016692 | 90 |
| 663 | 3300025960 | Ga0207651_10711587 | Ga0207651_107115872 | 90 |
| 664 | 3300025961 | Ga0207712_10013757 | Ga0207712_100137574 | 90 |
| 665 | 3300025961 | Ga0207712_11580209 | Ga0207712_115802091 | 90 |
| 666 | 3300025972 | Ga0207668_10002813 | Ga0207668_100028132 | 90 |
| 667 | 3300025981 | Ga0207640_10001221 | Ga0207640_100012212 | 90 |
| 668 | 3300025981 | Ga0207640_10318596 | Ga0207640_103185962 | 90 |
| 669 | 3300025986 | Ga0207658_10002165 | Ga0207658_100021659 | 90 |
| 670 | 3300025986 | Ga0207658_10273364 | Ga0207658_102733642 | 90 |
| 671 | 3300026023 | Ga0207677_10241558 | Ga0207677_102415582 | 90 |
| 672 | 3300026035 | Ga0207703_10001182 | Ga0207703_100011829 | 90 |
| 673 | 3300026035 | Ga0207703_12338057 | Ga0207703_123380572 | 90 |
| 674 | 3300026041 | Ga0207639_11618081 | Ga0207639_116180811 | 90 |
| 675 | 3300026067 | Ga0207678_10271186 | Ga0207678_102711862 | 90 |
| 676 | 3300026067 | Ga0207678_10531028 | Ga0207678_105310282 | 90 |
| 677 | 3300026067 | Ga0207678_10580097 | Ga0207678_105800972 | 90 |
| 678 | 3300026075 | Ga0207708_10271989 | Ga0207708_102719892 | 90 |
| 679 | 3300026075 | Ga0207708_10274816 | Ga0207708_102748162 | 90 |
| 680 | 3300026075 | Ga0207708_10514537 | Ga0207708_105145372 | 90 |
| 681 | 3300026078 | Ga0207702_10000220 | Ga0207702_1000022053 | 90 |
| 682 | 3300026078 | Ga0207702_10354780 | Ga0207702_103547802 | 90 |
| 683 | 3300026088 | Ga0207641_10001389 | Ga0207641_1000138921 | 90 |
| 684 | 3300026088 | Ga0207641_10155476 | Ga0207641_101554762 | 90 |
| 685 | 3300026088 | Ga0207641_10230682 | Ga0207641_102306822 | 90 |
| 686 | 3300026088 | Ga0207641_11128566 | Ga0207641_111285662 | 90 |
| 687 | 3300026089 | Ga0207648_10071443 | Ga0207648_100714432 | 90 |
| 688 | 3300026089 | Ga0207648_10144968 | Ga0207648_101449682 | 90 |
| 689 | 3300026089 | Ga0207648_10273669 | Ga0207648_102736692 | 90 |
| 690 | 3300026089 | Ga0207648_10445134 | Ga0207648_104451342 | 90 |
| 691 | 3300026089 | Ga0207648_10753889 | Ga0207648_107538892 | 90 |
| 692 | 3300026095 | Ga0207676_10007765 | Ga0207676_100077653 | 90 |
| 693 | 3300026095 | Ga0207676_10009753 | Ga0207676_100097532 | 90 |
| 694 | 3300026095 | Ga0207676_10390708 | Ga0207676_103907082 | 90 |
| 695 | 3300026095 | Ga0207676_10650208 | Ga0207676_106502082 | 90 |
| 696 | 3300026095 | Ga0207676_10701541 | Ga0207676_107015412 | 90 |
| 697 | 3300026116 | Ga0207674_10015784 | Ga0207674_100157842 | 90 |
| 698 | 3300026116 | Ga0207674_10267170 | Ga0207674_102671702 | 90 |
| 699 | 3300026116 | Ga0207674_10343010 | Ga0207674_103430102 | 90 |
| 700 | 3300026116 | Ga0207674_12298017 | Ga0207674_122980172 | 90 |
| 701 | 3300026118 | Ga0207675_100010033 | Ga0207675_1000100333 | 90 |
| 702 | 3300026118 | Ga0207675_100093076 | Ga0207675_1000930763 | 90 |
| 703 | 3300026121 | Ga0207683_10201766 | Ga0207683_102017662 | 90 |
| 704 | 3300026121 | Ga0207683_10388597 | Ga0207683_103885972 | 90 |
| 705 | 3300026121 | Ga0207683_10554502 | Ga0207683_105545022 | 90 |
| 706 | 3300026121 | Ga0207683_10577132 | Ga0207683_105771322 | 90 |
| 707 | 3300026121 | Ga0207683_10791529 | Ga0207683_107915291 | 90 |
| 708 | 3300026121 | Ga0207683_11453939 | Ga0207683_114539392 | 90 |
| 709 | 3300026121 | Ga0207683_11964736 | Ga0207683_119647362 | 90 |
| 710 | 3300026142 | Ga0207698_10567686 | Ga0207698_105676862 | 90 |
| 711 | 3300026142 | Ga0207698_10962223 | Ga0207698_109622232 | 90 |
| 712 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002392 | 90 |
| 713 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023253 | 90 |
| 714 | 3300027312 | Ga0209371_1000567 | Ga0209371_100056723 | 90 |
| 715 | 3300027671 | Ga0209588_1048670 | Ga0209588_10486702 | 90 |
| 716 | 3300027907 | Ga0207428_10462720 | Ga0207428_104627202 | 90 |
| 717 | 3300028379 | Ga0268266_10395823 | Ga0268266_103958232 | 90 |
| 718 | 3300028379 | Ga0268266_10774927 | Ga0268266_107749271 | 90 |
| 719 | 3300028379 | Ga0268266_11735854 | Ga0268266_117358542 | 90 |
| 720 | 3300028379 | Ga0268266_12117663 | Ga0268266_121176631 | 90 |
| 721 | 3300028380 | Ga0268265_10015027 | Ga0268265_100150274 | 90 |
| 722 | 3300028381 | Ga0268264_10000629 | Ga0268264_1000062920 | 90 |
| 723 | 3300028381 | Ga0268264_10602181 | Ga0268264_106021812 | 90 |
| 724 | 3300028794 | Ga0307515_10085570 | Ga0307515_100855703 | 90 |
| 725 | 3300030500 | Ga0268256_1000495 | Ga0268256_100049523 | 90 |
| 726 | 3300030744 | Ga0316181_1076746 | Ga0316181_10767461 | 90 |
| 727 | 3300031456 | Ga0307513_10365774 | Ga0307513_103657742 | 90 |
| 728 | 3300031456 | Ga0307513_10636128 | Ga0307513_106361281 | 90 |
| 729 | 3300031548 | Ga0307408_100085590 | Ga0307408_1000855902 | 90 |
| 730 | 3300031731 | Ga0307405_10110892 | Ga0307405_101108922 | 90 |
| 731 | 3300031901 | Ga0307406_10538670 | Ga0307406_105386702 | 90 |
| 732 | 3300031911 | Ga0307412_10115569 | Ga0307412_101155693 | 90 |
| 733 | 3300031911 | Ga0307412_11552640 | Ga0307412_115526402 | 90 |
| 734 | 3300032002 | Ga0307416_100251162 | Ga0307416_1002511622 | 90 |
| 735 | 3300032004 | Ga0307414_10810740 | Ga0307414_108107402 | 90 |
| 736 | 3300032004 | Ga0307414_11284787 | Ga0307414_112847871 | 90 |
| 737 | 3300032004 | Ga0307414_11299823 | Ga0307414_112998232 | 90 |
| 738 | 3300032005 | Ga0307411_10339617 | Ga0307411_103396172 | 90 |
| 739 | 3300033180 | Ga0307510_10310335 | Ga0307510_103103352 | 90 |
| 740 | 3300034820 | Ga0373959_0146182 | Ga0373959_0146182_177_485 | 90 |
| 741 | 3300035088 | Ga0373940_0218166 | Ga0373940_0218166_244_552 | 90 |
| 742 | 3300035114 | Ga0373939_0300578 | Ga0373939_0300578_130_438 | 90 |
| 743 | 3300035242 | Ga0373962_0084891 | Ga0373962_0084891_351_659 | 90 |
| 744 | 3300035691 | Ga0373931_0018196 | Ga0373931_0018196_42_350 | 90 |
| 745 | 3300035691 | Ga0373931_0328093 | Ga0373931_0328093_176_484 | 90 |
| 746 | 3300037068 | Ga0373925_0233329 | Ga0373925_0233329_673_981 | 90 |
| 747 | 3300037471 | Ga0395905_0850675 | Ga0395905_0850675_457_765 | 90 |
| 748 | 3300041404 | Ga0439436_0088996 | Ga0439436_0088996_292_600 | 90 |
| 749 | 3300041404 | Ga0439436_0108575 | Ga0439436_0108575_74_382 | 90 |
| 750 | 3300041406 | Ga0439439_0072902 | Ga0439439_0072902_417_725 | 90 |
| 751 | 3300041407 | Ga0439447_080670 | Ga0439447_080670_152_460 | 90 |
| 752 | 3300041410 | Ga0439461_0050852 | Ga0439461_0050852_267_575 | 90 |
| 753 | 3300041411 | Ga0439466_0105340 | Ga0439466_0105340_268_576 | 90 |
| 754 | 3300041451 | Ga0451791_0820966 | Ga0451791_0820966_154_462 | 90 |
| 755 | 3300041456 | Ga0451795_0110025 | Ga0451795_0110025_392_700 | 90 |
| 756 | 3300041459 | Ga0451800_1635194 | Ga0451800_1635194_200_508 | 90 |
| 757 | 3300041486 | Ga0451807_0092976 | Ga0451807_0092976_143_451 | 90 |
| 758 | 3300041486 | Ga0451807_1440418 | Ga0451807_1440418_158_466 | 90 |
| 759 | 3300041491 | Ga0451833_0628873 | Ga0451833_0628873_260_568 | 90 |
| 760 | 3300041491 | Ga0451833_1068306 | Ga0451833_1068306_37_348 | 90 |
| 761 | 3300041494 | Ga0451837_1224846 | Ga0451837_1224846_64_372 | 90 |
| 762 | 3300041498 | Ga0451841_0665083 | Ga0451841_0665083_334_642 | 90 |
| 763 | 3300041505 | Ga0451849_1060825 | Ga0451849_1060825_584_892 | 90 |
| 764 | 3300041509 | Ga0451843_1015190 | Ga0451843_1015190_81_389 | 90 |
| 765 | 3300041999 | Ga0439433_0055605 | Ga0439433_0055605_295_603 | 90 |
| 766 | 3300042002 | Ga0439442_043273 | Ga0439442_043273_153_461 | 90 |
| 767 | 3300042007 | Ga0439449_0089343 | Ga0439449_0089343_308_616 | 90 |
| 768 | 3300042008 | Ga0439450_202093 | Ga0439450_202093_213_521 | 90 |
| 769 | 3300042010 | Ga0439452_031061 | Ga0439452_031061_612_920 | 90 |
| 770 | 3300042013 | Ga0439456_000087 | Ga0439456_000087_6238_6510 | 90 |
| 771 | 3300042123 | Ga0450921_014977 | Ga0450921_014977_223_531 | 90 |
| 772 | 3300042125 | Ga0450923_131820 | Ga0450923_131820_27_335 | 90 |
| 773 | 3300042128 | Ga0450897_026987 | Ga0450897_026987_295_603 | 90 |
| 774 | 3300042133 | Ga0450896_030770 | Ga0450896_030770_466_774 | 90 |
| 775 | 3300042134 | Ga0450898_046371 | Ga0450898_046371_170_478 | 90 |
| 776 | 3300042136 | Ga0450900_048441 | Ga0450900_048441_60_332 | 90 |
| 777 | 3300042137 | Ga0450902_004852 | Ga0450902_004852_252_524 | 90 |
| 778 | 3300042142 | Ga0450905_001945 | Ga0450905_001945_2231_2503 | 90 |
| 779 | 3300042142 | Ga0450905_035734 | Ga0450905_035734_426_698 | 90 |
| 780 | 3300042156 | Ga0439446_0006447 | Ga0439446_0006447_2401_2709 | 90 |
| 781 | 3300042184 | Ga0450908_025170 | Ga0450908_025170_187_495 | 90 |
| 782 | 3300042185 | Ga0450909_030550 | Ga0450909_030550_154_462 | 90 |
| 783 | 3300042435 | Ga0439434_0028081 | Ga0439434_0028081_753_1061 | 90 |
| 784 | 3300042531 | Ga0450918_005653 | Ga0450918_005653_183_491 | 90 |
| 785 | 3300042532 | Ga0450893_0019521 | Ga0450893_0019521_712_1020 | 90 |
| 786 | 3300042533 | Ga0450901_000127 | Ga0450901_000127_7934_8206 | 90 |
| 787 | 3300045051 | Ga0451576_0606710 | Ga0451576_0606710_497_805 | 90 |
| 788 | 3300046455 | Ga0495603_0258559 | Ga0495603_0258559_62_370 | 90 |
| 789 | 3300046475 | Ga0495639_0265691 | Ga0495639_0265691_301_609 | 90 |
| 790 | 3300046500 | Ga0495596_0305303 | Ga0495596_0305303_204_518 | 90 |
| 791 | 3300046501 | Ga0495607_0483428 | Ga0495607_0483428_43_315 | 90 |
| 792 | 3300046515 | Ga0495620_0000004 | Ga0495620_0000004_50479_50751 | 90 |
| 793 | 3300046515 | Ga0495620_0244235 | Ga0495620_0244235_356_664 | 90 |
| 794 | 3300046517 | Ga0495630_0481248 | Ga0495630_0481248_228_536 | 90 |
| 795 | 3300046519 | Ga0495632_0077127 | Ga0495632_0077127_498_770 | 90 |
| 796 | 3300046522 | Ga0495643_0008674 | Ga0495643_0008674_5699_5971 | 90 |
| 797 | 3300046524 | Ga0495648_0000188 | Ga0495648_0000188_66019_66291 | 90 |
| 798 | 3300046528 | Ga0495642_0479144 | Ga0495642_0479144_164_472 | 90 |
| 799 | 3300046530 | Ga0495654_0039152 | Ga0495654_0039152_1398_1706 | 90 |
| 800 | 3300046537 | Ga0495598_0457738 | Ga0495598_0457738_186_494 | 90 |
| 801 | 3300046539 | Ga0495621_0069838 | Ga0495621_0069838_960_1268 | 90 |
| 802 | 3300046539 | Ga0495621_0108696 | Ga0495621_0108696_454_762 | 90 |
| 803 | 3300046539 | Ga0495621_0148361 | Ga0495621_0148361_70_384 | 90 |
| 804 | 3300046557 | Ga0495622_0312353 | Ga0495622_0312353_269_577 | 90 |
| 805 | 3300046615 | Ga0495656_0785132 | Ga0495656_0785132_39_347 | 90 |
| 806 | 3300046681 | Ga0495647_0525736 | Ga0495647_0525736_46_354 | 90 |
| 807 | 3300046683 | Ga0495658_0568727 | Ga0495658_0568727_46_354 | 90 |
| 808 | 3300046684 | Ga0495669_0180984 | Ga0495669_0180984_185_493 | 90 |
| 809 | 3300046692 | Ga0495671_0071040 | Ga0495671_0071040_847_1119 | 90 |
| 810 | 3300046692 | Ga0495671_0386221 | Ga0495671_0386221_61_369 | 90 |
| 811 | 3300046694 | Ga0495649_0499554 | Ga0495649_0499554_223_531 | 90 |
| 812 | 3300047321 | Ga0495676_0285923 | Ga0495676_0285923_161_469 | 90 |
| 813 | 3300047472 | Ga0495686_0083614 | Ga0495686_0083614_1034_1342 | 90 |
| 814 | 3300047673 | Ga0495593_0273153 | Ga0495593_0273153_47_355 | 90 |
| 815 | 3300047673 | Ga0495593_0597266 | Ga0495593_0597266_183_491 | 90 |
| 816 | 3300048088 | Ga0495602_0173866 | Ga0495602_0173866_1111_1419 | 90 |
| 817 | 3300048903 | Ga0496100_0725736 | Ga0496100_0725736_193_501 | 90 |
| 818 | 3300048903 | Ga0496100_0778933 | Ga0496100_0778933_155_463 | 90 |
| 819 | 3300048903 | Ga0496100_0894055 | Ga0496100_0894055_260_568 | 90 |
| 820 | 3300048904 | Ga0496101_0963725 | Ga0496101_0963725_332_640 | 90 |
| 821 | 3300048905 | Ga0496102_1519068 | Ga0496102_1519068_254_562 | 90 |
| 822 | 3300048907 | Ga0496104_1843638 | Ga0496104_1843638_134_442 | 90 |
| 823 | 3300048908 | Ga0496105_0529932 | Ga0496105_0529932_106_414 | 90 |
| 824 | 3300048909 | Ga0496106_0381094 | Ga0496106_0381094_414_722 | 90 |
| 825 | 3300048910 | Ga0496107_1341744 | Ga0496107_1341744_102_410 | 90 |
| 826 | 3300048911 | Ga0496108_0218362 | Ga0496108_0218362_1099_1407 | 90 |
| 827 | 3300048911 | Ga0496108_0975001 | Ga0496108_0975001_170_478 | 90 |
| 828 | 3300048912 | Ga0496109_0956693 | Ga0496109_0956693_192_500 | 90 |
| 829 | 3300048912 | Ga0496109_1037375 | Ga0496109_1037375_154_462 | 90 |
| 830 | 3300048913 | Ga0496110_0641533 | Ga0496110_0641533_432_740 | 90 |
| 831 | 3300048913 | Ga0496110_0773287 | Ga0496110_0773287_135_443 | 90 |
| 832 | 3300048913 | Ga0496110_1295976 | Ga0496110_1295976_119_391 | 90 |
| 833 | 3300048914 | Ga0496111_0332248 | Ga0496111_0332248_269_577 | 90 |
| 834 | 3300048914 | Ga0496111_0463712 | Ga0496111_0463712_441_713 | 90 |
| 835 | 3300048917 | Ga0496114_0086972 | Ga0496114_0086972_919_1191 | 90 |
| 836 | 3300048917 | Ga0496114_0831038 | Ga0496114_0831038_103_411 | 90 |
| 837 | 3300048917 | Ga0496114_1247846 | Ga0496114_1247846_301_609 | 90 |
| 838 | 3300048919 | Ga0496116_0272728 | Ga0496116_0272728_250_522 | 90 |
| 839 | 3300048920 | Ga0496117_0001021 | Ga0496117_0001021_40280_40552 | 90 |
| 840 | 3300048920 | Ga0496117_0041773 | Ga0496117_0041773_2755_3027 | 90 |
| 841 | 3300048921 | Ga0496118_0017661 | Ga0496118_0017661_427_699 | 90 |
| 842 | 3300048922 | Ga0496119_0147824 | Ga0496119_0147824_524_796 | 90 |
| 843 | 3300048924 | Ga0496121_0203656 | Ga0496121_0203656_679_951 | 90 |
| 844 | 3300048924 | Ga0496121_0382457 | Ga0496121_0382457_200_508 | 90 |
| 845 | 3300048927 | Ga0496124_0066355 | Ga0496124_0066355_2216_2524 | 90 |
| 846 | 3300048927 | Ga0496124_0089535 | Ga0496124_0089535_209_481 | 90 |
| 847 | 3300048927 | Ga0496124_0165591 | Ga0496124_0165591_659_931 | 90 |
| 848 | 3300048927 | Ga0496124_0168079 | Ga0496124_0168079_567_875 | 90 |
| 849 | 3300048927 | Ga0496124_0961540 | Ga0496124_0961540_169_477 | 90 |
| 850 | 3300048928 | Ga0496125_0000944 | Ga0496125_0000944_5119_5391 | 90 |
| 851 | 3300048929 | Ga0496126_0665230 | Ga0496126_0665230_221_493 | 90 |
| 852 | 3300049568 | Ga0501031_0158504 | Ga0501031_0158504_394_702 | 90 |
| 853 | 3300049568 | Ga0501031_0467790 | Ga0501031_0467790_34_342 | 90 |
| 854 | 3300049569 | Ga0501032_0048350 | Ga0501032_0048350_2403_2711 | 90 |
| 855 | 3300049570 | Ga0501033_0004494 | Ga0501033_0004494_640_948 | 90 |
| 856 | 3300049571 | Ga0501034_0042556 | Ga0501034_0042556_705_1013 | 90 |
| 857 | 3300049571 | Ga0501034_0057365 | Ga0501034_0057365_2436_2744 | 90 |
| 858 | 3300049572 | Ga0501036_0019618 | Ga0501036_0019618_689_997 | 90 |
| 859 | 3300049572 | Ga0501036_1362178 | Ga0501036_1362178_231_539 | 90 |
| 860 | 3300049573 | Ga0501037_0001825 | Ga0501037_0001825_766_1074 | 90 |
| 861 | 3300049573 | Ga0501037_0164248 | Ga0501037_0164248_1115_1423 | 90 |
| 862 | 3300049574 | Ga0501038_0006856 | Ga0501038_0006856_10106_10414 | 90 |
| 863 | 3300049579 | Ga0501043_0013981 | Ga0501043_0013981_4017_4325 | 90 |
| 864 | 3300049580 | Ga0501046_0006266 | Ga0501046_0006266_5004_5312 | 90 |
| 865 | 3300049581 | Ga0501047_0005968 | Ga0501047_0005968_8141_8449 | 90 |
| 866 | 3300049822 | Ga0501035_0231493 | Ga0501035_0231493_1110_1418 | 90 |
| 867 | 3300049823 | Ga0501044_0000916 | Ga0501044_0000916_3472_3780 | 90 |
| 868 | 3300050489 | nmdc:mga03683_700497_c1 | nmdc:mga03683_700497_c1_118_426 | 90 |
| 869 | 3300050493 | nmdc:mga0k408_142935_c1 | nmdc:mga0k408_142935_c1_580_888 | 90 |
| 870 | 3300050493 | nmdc:mga0k408_572625_c1 | nmdc:mga0k408_572625_c1_128_436 | 90 |
| 871 | 3300050496 | nmdc:mga07m45_191071_c1 | nmdc:mga07m45_191071_c1_291_599 | 90 |
| 872 | 3300050511 | nmdc:mga08y16_839244_c1 | nmdc:mga08y16_839244_c1_284_592 | 90 |
| 873 | 3300053086 | Ga0500578_0284588 | Ga0500578_0284588_470_778 | 90 |
| 874 | 3300053088 | Ga0500644_0078629 | Ga0500644_0078629_461_769 | 90 |
| 875 | 3300053103 | Ga0500555_132582 | Ga0500555_132582_86_394 | 90 |
| 876 | 3300053108 | Ga0500562_042950 | Ga0500562_042950_569_877 | 90 |
| 877 | 3300053117 | Ga0500593_175569 | Ga0500593_175569_401_709 | 90 |
| 878 | 3300053139 | Ga0500568_0348680 | Ga0500568_0348680_50_358 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4umw-assembly1.cif.gz_A | crystal structure of a zinc-transporting pib-type atpase in e2.pi state | 0.7305 | 43 | 89 |
| 5h5u-assembly1.cif.gz_4 | mechanistic insights into the alternative translation termination by arfa and rf2 | 0.5941 | 43 | 88 |
| 5zih-assembly1.cif.gz_B | crystal structure of the red light-activated channelrhodopsin chrimson. | 0.5336 | 38 | 86 |
| 5zih-assembly1.cif.gz_A | crystal structure of the red light-activated channelrhodopsin chrimson. | 0.5057 | 13 | 86 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.4976 | 34 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2m6uA00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein; | 0.7354 | 9 | 88 | 1.20.81.20 |
| 2m6uA00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein; | 0.643 | 9 | 88 | 1.20.81.20 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5947 | 9 | 90 | 1.20.1070.10 |
| af_Q7JQF1_6_190_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5915 | 43 | 86 | 1.20.1070.10 |
| af_Q5TZF3_164_242_1.20.1270.10 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.5732 | 6 | 88 | 1.20.1270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A495Q292-F1-model_v4 | deleted | 0.8422 | 1 | 90 |
|
| AF-A0A495Q292-F1-model_v4 | deleted | 0.834 | 1 | 90 |
|
| AF-A0A7W5V484-F1-model_v4 | Putative small integral membrane protein | 0.7584 | 1 | 90 |
GO:0016020
|
| AF-A0A7W5V484-F1-model_v4 | Putative small integral membrane protein | 0.7515 | 1 | 90 |
GO:0016020
|
| AF-A0A550FWU6-F1-model_v4 | deleted | 0.7506 | 1 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar