F484382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 393 | 864 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100161826|Ga0070713_1001618262 |
| Length | 141 |
| Sequence | VHIRAEDLINLRPRISNLSKMPVIAIVDDDESFRRATTSFVRSLGYGTAAFDSAEAFLKSERINDADCLITDVQMPGMTGIELQGRLIAQGHSLPVIFITAFPEMKARAQALADGAIGFLAKPFDDKGLIQCLDEALARAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 3 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 4 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 5 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 6 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 7 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 8 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 9 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 10 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 11 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 12 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 13 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 244 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 248 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 249 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 250 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 251 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 252 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 387 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 388 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0.46 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0.34 |
| Rhizoplane | 5.82 |
| Rhizosphere | 89.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214850756 | 2209111006 | Bacteria | 1649 |
| 2 | Ga0055530_10001135 | 3300003791 | Bacteria | 20743 |
| 3 | Ga0055540_1000008 | 3300003792 | Bacteria | 309635 |
| 4 | Ga0055531_10000242 | 3300003794 | Bacteria | 59638 |
| 5 | Ga0065714_10014890 | 3300005288 | Bacteria | 2397 |
| 6 | Ga0065714_10065188 | 3300005288 | Bacteria | 12118 |
| 7 | Ga0065704_10583659 | 3300005289 | Bacteria | 616 |
| 8 | Ga0070676_10162671 | 3300005328 | Bacteria | 1438 |
| 9 | Ga0070676_10401704 | 3300005328 | Bacteria | 953 |
| 10 | Ga0070683_100363425 | 3300005329 | Bacteria | 1378 |
| 11 | Ga0070690_100393593 | 3300005330 | Bacteria | 1016 |
| 12 | Ga0070670_100003347 | 3300005331 | Bacteria | 13269 |
| 13 | Ga0070670_100421784 | 3300005331 | Bacteria | 1179 |
| 14 | Ga0068869_101051392 | 3300005334 | Bacteria | 711 |
| 15 | Ga0068869_101751541 | 3300005334 | Bacteria | 555 |
| 16 | Ga0070666_10005529 | 3300005335 | Bacteria | 7752 |
| 17 | Ga0070666_10208862 | 3300005335 | Bacteria | 1375 |
| 18 | Ga0070680_100057430 | 3300005336 | Bacteria | 3182 |
| 19 | Ga0070680_101915847 | 3300005336 | Unclassified | 514 |
| 20 | Ga0070682_100020338 | 3300005337 | Bacteria | 3905 |
| 21 | Ga0070682_101473187 | 3300005337 | Bacteria | 584 |
| 22 | Ga0068868_100038627 | 3300005338 | Bacteria | 3706 |
| 23 | Ga0068868_100424460 | 3300005338 | Bacteria | 1152 |
| 24 | Ga0068868_100582735 | 3300005338 | Bacteria | 989 |
| 25 | Ga0070689_100023332 | 3300005340 | Bacteria | 4630 |
| 26 | Ga0070689_100255578 | 3300005340 | Bacteria | 1447 |
| 27 | Ga0070691_10636117 | 3300005341 | Bacteria | 634 |
| 28 | Ga0070661_100090445 | 3300005344 | Bacteria | 2267 |
| 29 | Ga0070661_100283490 | 3300005344 | Unclassified | 1286 |
| 30 | Ga0070661_100440372 | 3300005344 | Bacteria | 1035 |
| 31 | Ga0070692_10595238 | 3300005345 | Bacteria | 731 |
| 32 | Ga0070668_100166802 | 3300005347 | Bacteria | 1790 |
| 33 | Ga0070668_100177451 | 3300005347 | Bacteria | 1738 |
| 34 | Ga0070675_100028633 | 3300005354 | Bacteria | 4484 |
| 35 | Ga0070675_100040864 | 3300005354 | Bacteria | 3788 |
| 36 | Ga0070671_100006876 | 3300005355 | Bacteria | 9110 |
| 37 | Ga0070674_100242059 | 3300005356 | Bacteria | 1413 |
| 38 | Ga0070674_100500579 | 3300005356 | Bacteria | 1012 |
| 39 | Ga0070674_100508834 | 3300005356 | Bacteria | 1004 |
| 40 | Ga0070674_100680090 | 3300005356 | Unclassified | 878 |
| 41 | Ga0070673_100018919 | 3300005364 | Bacteria | 4936 |
| 42 | Ga0070673_100045737 | 3300005364 | Bacteria | 3396 |
| 43 | Ga0070673_100387190 | 3300005364 | Bacteria | 1248 |
| 44 | Ga0070673_100429997 | 3300005364 | Bacteria | 1185 |
| 45 | Ga0070673_101348922 | 3300005364 | Bacteria | 670 |
| 46 | Ga0070688_100011841 | 3300005365 | Bacteria | 4865 |
| 47 | Ga0070659_100077706 | 3300005366 | Bacteria | 2648 |
| 48 | Ga0070659_100225409 | 3300005366 | Bacteria | 1548 |
| 49 | Ga0070659_100468208 | 3300005366 | Bacteria | 1071 |
| 50 | Ga0070667_100109225 | 3300005367 | Bacteria | 2397 |
| 51 | Ga0070667_100331251 | 3300005367 | Unclassified | 1375 |
| 52 | Ga0070709_10001257 | 3300005434 | Bacteria | 13866 |
| 53 | Ga0070709_10138798 | 3300005434 | Bacteria | 1668 |
| 54 | Ga0070709_11118234 | 3300005434 | Bacteria | 631 |
| 55 | Ga0070714_100264708 | 3300005435 | Bacteria | 1593 |
| 56 | Ga0070714_100940867 | 3300005435 | Unclassified | 840 |
| 57 | Ga0070713_100000374 | 3300005436 | Bacteria | 28680 |
| 58 | Ga0070713_100161826 | 3300005436 | Unclassified | 1998 |
| 59 | Ga0070713_100193160 | 3300005436 | Bacteria | 1835 |
| 60 | Ga0070710_10022882 | 3300005437 | Bacteria | 3276 |
| 61 | Ga0070710_10089362 | 3300005437 | Bacteria | 1814 |
| 62 | Ga0070710_10271507 | 3300005437 | Bacteria | 1097 |
| 63 | Ga0070711_100025801 | 3300005439 | Bacteria | 3847 |
| 64 | Ga0070711_100117107 | 3300005439 | Bacteria | 1964 |
| 65 | Ga0070711_100164344 | 3300005439 | Bacteria | 1686 |
| 66 | Ga0070705_100025237 | 3300005440 | Bacteria | 3220 |
| 67 | Ga0070705_100198912 | 3300005440 | Unclassified | 1372 |
| 68 | Ga0070705_100375552 | 3300005440 | Bacteria | 1045 |
| 69 | Ga0070700_100520759 | 3300005441 | Unclassified | 918 |
| 70 | Ga0070694_100017044 | 3300005444 | Bacteria | 4585 |
| 71 | Ga0070694_100480475 | 3300005444 | Bacteria | 986 |
| 72 | Ga0070663_100004752 | 3300005455 | Bacteria | 8018 |
| 73 | Ga0070663_100006279 | 3300005455 | Bacteria | 7130 |
| 74 | Ga0070663_100120852 | 3300005455 | Bacteria | 1978 |
| 75 | Ga0070663_100497881 | 3300005455 | Bacteria | 1011 |
| 76 | Ga0070663_100771108 | 3300005455 | Bacteria | 823 |
| 77 | Ga0070678_100001680 | 3300005456 | Bacteria | 11863 |
| 78 | Ga0070678_100092383 | 3300005456 | Bacteria | 2325 |
| 79 | Ga0070678_100191340 | 3300005456 | Bacteria | 1682 |
| 80 | Ga0070678_100866919 | 3300005456 | Bacteria | 824 |
| 81 | Ga0070678_101667579 | 3300005456 | Unclassified | 599 |
| 82 | Ga0070662_100168705 | 3300005457 | Unclassified | 1717 |
| 83 | Ga0070662_100813318 | 3300005457 | Unclassified | 795 |
| 84 | Ga0070662_101342486 | 3300005457 | Bacteria | 616 |
| 85 | Ga0070662_101697874 | 3300005457 | Bacteria | 545 |
| 86 | Ga0070681_10087903 | 3300005458 | Bacteria | 3060 |
| 87 | Ga0070681_10211862 | 3300005458 | Bacteria | 1853 |
| 88 | Ga0068867_100286247 | 3300005459 | Bacteria | 1353 |
| 89 | Ga0070685_10045113 | 3300005466 | Bacteria | 2526 |
| 90 | Ga0070685_10923808 | 3300005466 | Unclassified | 651 |
| 91 | Ga0070707_100545061 | 3300005468 | Bacteria | 1122 |
| 92 | Ga0070679_100014128 | 3300005530 | Bacteria | 7658 |
| 93 | Ga0070679_100096085 | 3300005530 | Bacteria | 2951 |
| 94 | Ga0070684_100028831 | 3300005535 | Bacteria | 4698 |
| 95 | Ga0068853_100015623 | 3300005539 | Bacteria | 6236 |
| 96 | Ga0068853_101720981 | 3300005539 | Unclassified | 608 |
| 97 | Ga0070672_100469277 | 3300005543 | Bacteria | 1086 |
| 98 | Ga0070686_100008801 | 3300005544 | Bacteria | 5657 |
| 99 | Ga0070686_100884531 | 3300005544 | Unclassified | 726 |
| 100 | Ga0070686_101132796 | 3300005544 | Unclassified | 647 |
| 101 | Ga0070695_100386328 | 3300005545 | Bacteria | 1058 |
| 102 | Ga0070695_100735282 | 3300005545 | Unclassified | 786 |
| 103 | Ga0070696_100096185 | 3300005546 | Bacteria | 2116 |
| 104 | Ga0070693_100003700 | 3300005547 | Bacteria | 7150 |
| 105 | Ga0070693_100045294 | 3300005547 | Bacteria | 2493 |
| 106 | Ga0070665_100009597 | 3300005548 | Bacteria | 9789 |
| 107 | Ga0070665_100934358 | 3300005548 | Bacteria | 880 |
| 108 | Ga0070665_102066152 | 3300005548 | Unclassified | 574 |
| 109 | Ga0070704_100362004 | 3300005549 | Bacteria | 1227 |
| 110 | Ga0068855_100095497 | 3300005563 | Bacteria | 3426 |
| 111 | Ga0070664_100259116 | 3300005564 | Bacteria | 1565 |
| 112 | Ga0070664_100639438 | 3300005564 | Bacteria | 988 |
| 113 | Ga0070664_101553732 | 3300005564 | Bacteria | 626 |
| 114 | Ga0068854_100479261 | 3300005578 | Unclassified | 1044 |
| 115 | Ga0068856_100293887 | 3300005614 | Unclassified | 1642 |
| 116 | Ga0068856_100399720 | 3300005614 | Unclassified | 1394 |
| 117 | Ga0068856_100745133 | 3300005614 | Unclassified | 1000 |
| 118 | Ga0068856_101070301 | 3300005614 | Bacteria | 824 |
| 119 | Ga0070702_100015364 | 3300005615 | Bacteria | 3908 |
| 120 | Ga0068859_100156223 | 3300005617 | Bacteria | 2358 |
| 121 | Ga0068864_100059734 | 3300005618 | Bacteria | 3299 |
| 122 | Ga0068866_10053271 | 3300005718 | Bacteria | 2068 |
| 123 | Ga0068866_10407214 | 3300005718 | Bacteria | 879 |
| 124 | Ga0068866_11010074 | 3300005718 | Unclassified | 591 |
| 125 | Ga0068861_101251162 | 3300005719 | Bacteria | 720 |
| 126 | Ga0068870_10195448 | 3300005840 | Bacteria | 1223 |
| 127 | Ga0068858_100045177 | 3300005842 | Bacteria | 4082 |
| 128 | Ga0068858_100157469 | 3300005842 | Bacteria | 2137 |
| 129 | Ga0068858_100292027 | 3300005842 | Unclassified | 1554 |
| 130 | Ga0068858_100382227 | 3300005842 | Bacteria | 1351 |
| 131 | Ga0068860_100056891 | 3300005843 | Bacteria | 3717 |
| 132 | Ga0068862_102131832 | 3300005844 | Bacteria | 572 |
| 133 | Ga0081540_1076267 | 3300005983 | Bacteria | 1528 |
| 134 | Ga0070717_10007141 | 3300006028 | Bacteria | 8277 |
| 135 | Ga0070717_10273133 | 3300006028 | Bacteria | 1497 |
| 136 | Ga0070715_10517003 | 3300006163 | Unclassified | 686 |
| 137 | Ga0070716_100281784 | 3300006173 | Bacteria | 1147 |
| 138 | Ga0070716_100293371 | 3300006173 | Bacteria | 1128 |
| 139 | Ga0070712_100059255 | 3300006175 | Bacteria | 2696 |
| 140 | Ga0070712_100106363 | 3300006175 | Bacteria | 2085 |
| 141 | Ga0070712_100586280 | 3300006175 | Bacteria | 942 |
| 142 | Ga0097621_100015177 | 3300006237 | Bacteria | 5787 |
| 143 | Ga0097621_100071730 | 3300006237 | Bacteria | 2863 |
| 144 | Ga0097621_100410007 | 3300006237 | Bacteria | 1214 |
| 145 | Ga0068871_100005428 | 3300006358 | Bacteria | 8937 |
| 146 | Ga0068871_100095207 | 3300006358 | Bacteria | 2486 |
| 147 | Ga0068871_100216396 | 3300006358 | Bacteria | 1658 |
| 148 | Ga0075430_100000026 | 3300006846 | Bacteria | 78833 |
| 149 | Ga0075431_100000451 | 3300006847 | Bacteria | 33773 |
| 150 | Ga0075433_10007117 | 3300006852 | Bacteria | 8857 |
| 151 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 152 | Ga0075434_100208594 | 3300006871 | Bacteria | 1974 |
| 153 | Ga0075429_100000247 | 3300006880 | Bacteria | 37266 |
| 154 | Ga0068865_100067848 | 3300006881 | Bacteria | 2520 |
| 155 | Ga0068865_100427472 | 3300006881 | Bacteria | 1090 |
| 156 | Ga0068865_100780565 | 3300006881 | Bacteria | 823 |
| 157 | Ga0068865_100794996 | 3300006881 | Bacteria | 816 |
| 158 | Ga0068865_101062156 | 3300006881 | Unclassified | 712 |
| 159 | Ga0075436_100102335 | 3300006914 | Bacteria | 1995 |
| 160 | Ga0075436_100488962 | 3300006914 | Bacteria | 899 |
| 161 | Ga0075436_100939538 | 3300006914 | Bacteria | 648 |
| 162 | Ga0097620_100156229 | 3300006931 | Bacteria | 2358 |
| 163 | Ga0079104_1051120 | 3300006946 | Bacteria | 920 |
| 164 | Ga0075435_100039007 | 3300007076 | Bacteria | 3790 |
| 165 | Ga0075435_100105078 | 3300007076 | Bacteria | 2344 |
| 166 | Ga0105251_10003490 | 3300009011 | Bacteria | 11387 |
| 167 | Ga0105251_10076536 | 3300009011 | Bacteria | 1553 |
| 168 | Ga0105244_10111259 | 3300009036 | Bacteria | 1332 |
| 169 | Ga0105250_10001249 | 3300009092 | Bacteria | 14082 |
| 170 | Ga0105240_10256119 | 3300009093 | Bacteria | 2021 |
| 171 | Ga0105240_10278491 | 3300009093 | Bacteria | 1922 |
| 172 | Ga0105240_10820836 | 3300009093 | Bacteria | 1006 |
| 173 | Ga0111539_10000337 | 3300009094 | Bacteria | 57733 |
| 174 | Ga0105245_10046365 | 3300009098 | Bacteria | 3884 |
| 175 | Ga0105245_10595789 | 3300009098 | Bacteria | 1131 |
| 176 | Ga0105245_10768731 | 3300009098 | Bacteria | 1000 |
| 177 | Ga0105245_10909330 | 3300009098 | Bacteria | 922 |
| 178 | Ga0105247_10219702 | 3300009101 | Bacteria | 1286 |
| 179 | Ga0105247_10431733 | 3300009101 | Bacteria | 946 |
| 180 | Ga0105247_10512269 | 3300009101 | Bacteria | 876 |
| 181 | Ga0105247_10595158 | 3300009101 | Bacteria | 819 |
| 182 | Ga0114129_10028763 | 3300009147 | Bacteria | 7874 |
| 183 | Ga0105243_10084054 | 3300009148 | Bacteria | 2606 |
| 184 | Ga0105243_10377470 | 3300009148 | Bacteria | 1310 |
| 185 | Ga0105243_11495491 | 3300009148 | Bacteria | 699 |
| 186 | Ga0105241_10051739 | 3300009174 | Bacteria | 3133 |
| 187 | Ga0105241_10216234 | 3300009174 | Bacteria | 1608 |
| 188 | Ga0105241_10327163 | 3300009174 | Bacteria | 1323 |
| 189 | Ga0105242_10052542 | 3300009176 | Bacteria | 3325 |
| 190 | Ga0105242_10060494 | 3300009176 | Bacteria | 3112 |
| 191 | Ga0105242_10071848 | 3300009176 | Bacteria | 2873 |
| 192 | Ga0105242_10269012 | 3300009176 | Bacteria | 1543 |
| 193 | Ga0105242_10956899 | 3300009176 | Bacteria | 861 |
| 194 | Ga0105248_10198325 | 3300009177 | Unclassified | 2261 |
| 195 | Ga0105248_10458518 | 3300009177 | Bacteria | 1437 |
| 196 | Ga0105248_11752089 | 3300009177 | Bacteria | 704 |
| 197 | Ga0105237_10008020 | 3300009545 | Bacteria | 11493 |
| 198 | Ga0105237_10125972 | 3300009545 | Bacteria | 2556 |
| 199 | Ga0105237_10384688 | 3300009545 | Bacteria | 1408 |
| 200 | Ga0105238_10069394 | 3300009551 | Bacteria | 3525 |
| 201 | Ga0105238_10073909 | 3300009551 | Bacteria | 3402 |
| 202 | Ga0105238_10368596 | 3300009551 | Bacteria | 1426 |
| 203 | Ga0105238_10852742 | 3300009551 | Bacteria | 928 |
| 204 | Ga0105249_10077845 | 3300009553 | Unclassified | 3076 |
| 205 | Ga0105249_10187907 | 3300009553 | Bacteria | 2014 |
| 206 | Ga0105249_13491419 | 3300009553 | Bacteria | 506 |
| 207 | Ga0105239_10110277 | 3300010375 | Bacteria | 3050 |
| 208 | Ga0105239_10191679 | 3300010375 | Bacteria | 2288 |
| 209 | Ga0105239_10308607 | 3300010375 | Bacteria | 1783 |
| 210 | Ga0105239_10546437 | 3300010375 | Bacteria | 1319 |
| 211 | Ga0105239_12890599 | 3300010375 | Unclassified | 560 |
| 212 | Ga0105246_10032880 | 3300011119 | Bacteria | 3443 |
| 213 | Ga0105246_10205263 | 3300011119 | Unclassified | 1535 |
| 214 | Ga0105246_10732624 | 3300011119 | Bacteria | 870 |
| 215 | Ga0105246_10794292 | 3300011119 | Bacteria | 839 |
| 216 | Ga0157314_1005454 | 3300012500 | Bacteria | 965 |
| 217 | Ga0157373_10883073 | 3300013100 | Bacteria | 663 |
| 218 | Ga0157371_10226064 | 3300013102 | Bacteria | 1344 |
| 219 | Ga0157371_11368106 | 3300013102 | Bacteria | 549 |
| 220 | Ga0157370_10171945 | 3300013104 | Bacteria | 2014 |
| 221 | Ga0157370_10271641 | 3300013104 | Bacteria | 1566 |
| 222 | Ga0157369_10227818 | 3300013105 | Unclassified | 1949 |
| 223 | Ga0157374_10346892 | 3300013296 | Bacteria | 1475 |
| 224 | Ga0157374_10729637 | 3300013296 | Bacteria | 1005 |
| 225 | Ga0157378_10024975 | 3300013297 | Bacteria | 5263 |
| 226 | Ga0157378_10028933 | 3300013297 | Bacteria | 4891 |
| 227 | Ga0157378_10145600 | 3300013297 | Bacteria | 2203 |
| 228 | Ga0157378_10564098 | 3300013297 | Bacteria | 1146 |
| 229 | Ga0157378_11451341 | 3300013297 | Bacteria | 730 |
| 230 | Ga0163162_10214069 | 3300013306 | Bacteria | 2057 |
| 231 | Ga0163162_10476432 | 3300013306 | Bacteria | 1379 |
| 232 | Ga0163162_11752619 | 3300013306 | Unclassified | 710 |
| 233 | Ga0157372_10177133 | 3300013307 | Bacteria | 2468 |
| 234 | Ga0157375_10096569 | 3300013308 | Bacteria | 3028 |
| 235 | Ga0157375_10428019 | 3300013308 | Bacteria | 1489 |
| 236 | Ga0163163_10041194 | 3300014325 | Bacteria | 4515 |
| 237 | Ga0163163_10304120 | 3300014325 | Bacteria | 1647 |
| 238 | Ga0157380_10108544 | 3300014326 | Bacteria | 2327 |
| 239 | Ga0157380_10200476 | 3300014326 | Bacteria | 1770 |
| 240 | Ga0157380_10225731 | 3300014326 | Bacteria | 1679 |
| 241 | Ga0182008_10032593 | 3300014497 | Bacteria | 2617 |
| 242 | Ga0182008_10859436 | 3300014497 | Unclassified | 531 |
| 243 | Ga0157379_10069742 | 3300014968 | Bacteria | 3144 |
| 244 | Ga0157379_10158612 | 3300014968 | Bacteria | 2042 |
| 245 | Ga0157376_10014087 | 3300014969 | Bacteria | 5989 |
| 246 | Ga0157376_10109346 | 3300014969 | Bacteria | 2430 |
| 247 | Ga0157376_10288237 | 3300014969 | Bacteria | 1549 |
| 248 | Ga0157376_10410243 | 3300014969 | Unclassified | 1312 |
| 249 | Ga0157376_12588404 | 3300014969 | Bacteria | 547 |
| 250 | Ga0182005_1002145 | 3300015265 | Bacteria | 7297 |
| 251 | Ga0182005_1012712 | 3300015265 | Bacteria | 2374 |
| 252 | Ga0163161_10155334 | 3300017792 | Bacteria | 1741 |
| 253 | Ga0163161_10228167 | 3300017792 | Bacteria | 1444 |
| 254 | Ga0163161_10308462 | 3300017792 | Bacteria | 1248 |
| 255 | Ga0163161_10846124 | 3300017792 | Bacteria | 772 |
| 256 | Ga0206356_10275917 | 3300020070 | Unclassified | 537 |
| 257 | Ga0213872_10000200 | 3300021361 | Bacteria | 53095 |
| 258 | Ga0213872_10047353 | 3300021361 | Bacteria | 1955 |
| 259 | Ga0247553_112590 | 3300023672 | Unclassified | 501 |
| 260 | Ga0228598_1001577 | 3300024227 | Bacteria | 4988 |
| 261 | Ga0209675_1009397 | 3300025291 | Bacteria | 3460 |
| 262 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 263 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 264 | Ga0209256_1004316 | 3300025299 | Bacteria | 9043 |
| 265 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 266 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 267 | Ga0207696_1000830 | 3300025711 | Bacteria | 19705 |
| 268 | Ga0207696_1018347 | 3300025711 | Bacteria | 2299 |
| 269 | Ga0207655_1005592 | 3300025728 | Bacteria | 8508 |
| 270 | Ga0207713_1000243 | 3300025735 | Bacteria | 70146 |
| 271 | Ga0207713_1006378 | 3300025735 | Bacteria | 7195 |
| 272 | Ga0207713_1023423 | 3300025735 | Bacteria | 2905 |
| 273 | Ga0207713_1042265 | 3300025735 | Bacteria | 1894 |
| 274 | Ga0207713_1042280 | 3300025735 | Bacteria | 1894 |
| 275 | Ga0207692_10018584 | 3300025898 | Bacteria | 3123 |
| 276 | Ga0207692_10130373 | 3300025898 | Bacteria | 1419 |
| 277 | Ga0207642_10046105 | 3300025899 | Bacteria | 1940 |
| 278 | Ga0207710_10049105 | 3300025900 | Bacteria | 1890 |
| 279 | Ga0207710_10141056 | 3300025900 | Bacteria | 1163 |
| 280 | Ga0207688_10009920 | 3300025901 | Bacteria | 5183 |
| 281 | Ga0207680_10068729 | 3300025903 | Bacteria | 2186 |
| 282 | Ga0207680_10228328 | 3300025903 | Bacteria | 1278 |
| 283 | Ga0207647_10007334 | 3300025904 | Bacteria | 7974 |
| 284 | Ga0207685_10101510 | 3300025905 | Bacteria | 1231 |
| 285 | Ga0207699_10032006 | 3300025906 | Bacteria | 2959 |
| 286 | Ga0207699_10050300 | 3300025906 | Bacteria | 2457 |
| 287 | Ga0207699_10196074 | 3300025906 | Bacteria | 1365 |
| 288 | Ga0207645_10065079 | 3300025907 | Bacteria | 2329 |
| 289 | Ga0207645_10630041 | 3300025907 | Unclassified | 728 |
| 290 | Ga0207654_10131415 | 3300025911 | Bacteria | 1585 |
| 291 | Ga0207654_10204484 | 3300025911 | Bacteria | 1302 |
| 292 | Ga0207654_11229144 | 3300025911 | Unclassified | 546 |
| 293 | Ga0207707_10022287 | 3300025912 | Bacteria | 5538 |
| 294 | Ga0207707_10166213 | 3300025912 | Bacteria | 1928 |
| 295 | Ga0207695_10328974 | 3300025913 | Bacteria | 1417 |
| 296 | Ga0207695_10941615 | 3300025913 | Bacteria | 743 |
| 297 | Ga0207695_11094316 | 3300025913 | Bacteria | 677 |
| 298 | Ga0207671_10094841 | 3300025914 | Bacteria | 2252 |
| 299 | Ga0207671_10254540 | 3300025914 | Bacteria | 1381 |
| 300 | Ga0207671_10344692 | 3300025914 | Bacteria | 1181 |
| 301 | Ga0207693_10019086 | 3300025915 | Bacteria | 5457 |
| 302 | Ga0207693_10078213 | 3300025915 | Bacteria | 2589 |
| 303 | Ga0207693_10864050 | 3300025915 | Unclassified | 695 |
| 304 | Ga0207693_10922971 | 3300025915 | Bacteria | 669 |
| 305 | Ga0207663_10059650 | 3300025916 | Bacteria | 2415 |
| 306 | Ga0207663_10128641 | 3300025916 | Bacteria | 1746 |
| 307 | Ga0207663_10586118 | 3300025916 | Bacteria | 875 |
| 308 | Ga0207660_10113593 | 3300025917 | Bacteria | 2042 |
| 309 | Ga0207660_10190011 | 3300025917 | Bacteria | 1599 |
| 310 | Ga0207660_11322970 | 3300025917 | Unclassified | 585 |
| 311 | Ga0207657_10013452 | 3300025919 | Bacteria | 8027 |
| 312 | Ga0207649_10214582 | 3300025920 | Bacteria | 1367 |
| 313 | Ga0207649_10352910 | 3300025920 | Unclassified | 1089 |
| 314 | Ga0207652_10062545 | 3300025921 | Bacteria | 3216 |
| 315 | Ga0207646_10613360 | 3300025922 | Bacteria | 976 |
| 316 | Ga0207681_10907596 | 3300025923 | Bacteria | 738 |
| 317 | Ga0207694_10137815 | 3300025924 | Bacteria | 1961 |
| 318 | Ga0207694_10671011 | 3300025924 | Unclassified | 874 |
| 319 | Ga0207650_10003393 | 3300025925 | Bacteria | 10955 |
| 320 | Ga0207687_10015342 | 3300025927 | Bacteria | 5021 |
| 321 | Ga0207687_10062423 | 3300025927 | Bacteria | 2635 |
| 322 | Ga0207687_10485772 | 3300025927 | Unclassified | 1029 |
| 323 | Ga0207700_10004890 | 3300025928 | Bacteria | 7962 |
| 324 | Ga0207700_10219630 | 3300025928 | Unclassified | 1610 |
| 325 | Ga0207700_10587976 | 3300025928 | Unclassified | 990 |
| 326 | Ga0207664_10017822 | 3300025929 | Bacteria | 5217 |
| 327 | Ga0207644_10006011 | 3300025931 | Bacteria | 7913 |
| 328 | Ga0207644_10056236 | 3300025931 | Bacteria | 2838 |
| 329 | Ga0207690_10159609 | 3300025932 | Unclassified | 1680 |
| 330 | Ga0207706_10075392 | 3300025933 | Unclassified | 2966 |
| 331 | Ga0207706_10514818 | 3300025933 | Bacteria | 1032 |
| 332 | Ga0207706_10533288 | 3300025933 | Bacteria | 1012 |
| 333 | Ga0207686_10197940 | 3300025934 | Bacteria | 1437 |
| 334 | Ga0207686_10365618 | 3300025934 | Bacteria | 1090 |
| 335 | Ga0207686_11409547 | 3300025934 | Bacteria | 574 |
| 336 | Ga0207670_10050284 | 3300025936 | Bacteria | 2793 |
| 337 | Ga0207669_10129493 | 3300025937 | Bacteria | 1731 |
| 338 | Ga0207704_10339513 | 3300025938 | Bacteria | 1165 |
| 339 | Ga0207704_10629900 | 3300025938 | Bacteria | 881 |
| 340 | Ga0207704_11404798 | 3300025938 | Unclassified | 598 |
| 341 | Ga0207665_10009568 | 3300025939 | Bacteria | 6365 |
| 342 | Ga0207665_10047429 | 3300025939 | Bacteria | 2881 |
| 343 | Ga0207691_11719012 | 3300025940 | Bacteria | 507 |
| 344 | Ga0207711_10149269 | 3300025941 | Bacteria | 2108 |
| 345 | Ga0207711_10265132 | 3300025941 | Bacteria | 1580 |
| 346 | Ga0207711_10397571 | 3300025941 | Bacteria | 1280 |
| 347 | Ga0207711_11319315 | 3300025941 | Bacteria | 664 |
| 348 | Ga0207689_10063790 | 3300025942 | Bacteria | 3031 |
| 349 | Ga0207689_11097309 | 3300025942 | Bacteria | 671 |
| 350 | Ga0207661_10758085 | 3300025944 | Bacteria | 893 |
| 351 | Ga0207679_10037485 | 3300025945 | Bacteria | 3447 |
| 352 | Ga0207679_10123058 | 3300025945 | Bacteria | 2068 |
| 353 | Ga0207667_11460497 | 3300025949 | Bacteria | 656 |
| 354 | Ga0207651_10512526 | 3300025960 | Bacteria | 1038 |
| 355 | Ga0207712_10232519 | 3300025961 | Bacteria | 1481 |
| 356 | Ga0207712_11506306 | 3300025961 | Bacteria | 603 |
| 357 | Ga0207668_10126264 | 3300025972 | Bacteria | 1946 |
| 358 | Ga0207668_10314182 | 3300025972 | Bacteria | 1298 |
| 359 | Ga0207668_11098180 | 3300025972 | Bacteria | 713 |
| 360 | Ga0207640_10602058 | 3300025981 | Bacteria | 930 |
| 361 | Ga0207658_10049195 | 3300025986 | Bacteria | 3096 |
| 362 | Ga0207658_10312853 | 3300025986 | Bacteria | 1357 |
| 363 | Ga0207677_10032034 | 3300026023 | Bacteria | 3375 |
| 364 | Ga0207703_10045571 | 3300026035 | Bacteria | 3528 |
| 365 | Ga0207703_10356628 | 3300026035 | Unclassified | 1348 |
| 366 | Ga0207703_10567789 | 3300026035 | Unclassified | 1071 |
| 367 | Ga0207703_10651041 | 3300026035 | Unclassified | 999 |
| 368 | Ga0207639_10036106 | 3300026041 | Bacteria | 3660 |
| 369 | Ga0207639_11599415 | 3300026041 | Unclassified | 611 |
| 370 | Ga0207678_10000262 | 3300026067 | Bacteria | 47571 |
| 371 | Ga0207678_10003507 | 3300026067 | Bacteria | 14107 |
| 372 | Ga0207678_10028571 | 3300026067 | Bacteria | 4867 |
| 373 | Ga0207678_10230494 | 3300026067 | Bacteria | 1586 |
| 374 | Ga0207678_10683779 | 3300026067 | Bacteria | 902 |
| 375 | Ga0207708_10184872 | 3300026075 | Bacteria | 1656 |
| 376 | Ga0207702_10821172 | 3300026078 | Bacteria | 919 |
| 377 | Ga0207702_11118528 | 3300026078 | Bacteria | 782 |
| 378 | Ga0207641_10062948 | 3300026088 | Bacteria | 3167 |
| 379 | Ga0207641_10648662 | 3300026088 | Bacteria | 1037 |
| 380 | Ga0207648_10818418 | 3300026089 | Unclassified | 868 |
| 381 | Ga0207648_10906607 | 3300026089 | Unclassified | 824 |
| 382 | Ga0207676_11464389 | 3300026095 | Unclassified | 679 |
| 383 | Ga0207674_11044445 | 3300026116 | Bacteria | 786 |
| 384 | Ga0207683_10007540 | 3300026121 | Bacteria | 9324 |
| 385 | Ga0207683_10191881 | 3300026121 | Bacteria | 1855 |
| 386 | Ga0207683_10221434 | 3300026121 | Bacteria | 1724 |
| 387 | Ga0207683_10490671 | 3300026121 | Bacteria | 1134 |
| 388 | Ga0207683_10692815 | 3300026121 | Bacteria | 944 |
| 389 | Ga0209281_1032564 | 3300027111 | Bacteria | 921 |
| 390 | Ga0207428_10000140 | 3300027907 | Bacteria | 97818 |
| 391 | Ga0268266_10000419 | 3300028379 | Bacteria | 64526 |
| 392 | Ga0268266_10007719 | 3300028379 | Bacteria | 9656 |
| 393 | Ga0268266_10032170 | 3300028379 | Bacteria | 4457 |
| 394 | Ga0268266_10259075 | 3300028379 | Bacteria | 1611 |
| 395 | Ga0268264_10039627 | 3300028381 | Bacteria | 3892 |
| 396 | Ga0268264_10062262 | 3300028381 | Bacteria | 3132 |
| 397 | Ga0265337_1008064 | 3300028556 | Bacteria | 3871 |
| 398 | Ga0265338_10006825 | 3300028800 | Bacteria | 14384 |
| 399 | Ga0265769_122209 | 3300030888 | Unclassified | 510 |
| 400 | Ga0265760_10106519 | 3300031090 | Bacteria | 890 |
| 401 | Ga0265316_10728227 | 3300031344 | Unclassified | 698 |
| 402 | Ga0307508_10088081 | 3300031616 | Bacteria | 2688 |
| 403 | Ga0307507_10213162 | 3300033179 | Bacteria | 1313 |
| 404 | Ga0373930_0048085 | 3300034816 | Unclassified | 925 |
| 405 | Ga0373958_0023273 | 3300034819 | Bacteria | 1164 |
| 406 | Ga0373926_0054469 | 3300035083 | Bacteria | 1449 |
| 407 | Ga0373926_0143526 | 3300035083 | Unclassified | 907 |
| 408 | Ga0373928_0008886 | 3300035084 | Bacteria | 1959 |
| 409 | Ga0373928_0050631 | 3300035084 | Bacteria | 980 |
| 410 | Ga0373928_0228974 | 3300035084 | Bacteria | 546 |
| 411 | Ga0373934_0060202 | 3300035086 | Unclassified | 1512 |
| 412 | Ga0373940_0135916 | 3300035088 | Unclassified | 773 |
| 413 | Ga0373944_0002962 | 3300035089 | Bacteria | 4367 |
| 414 | Ga0373944_0003642 | 3300035089 | Bacteria | 3981 |
| 415 | Ga0373949_0007653 | 3300035090 | Bacteria | 2368 |
| 416 | Ga0373951_0026913 | 3300035091 | Bacteria | 1342 |
| 417 | Ga0373952_0073413 | 3300035092 | Unclassified | 860 |
| 418 | Ga0373923_0005750 | 3300035111 | Bacteria | 4230 |
| 419 | Ga0373923_0010927 | 3300035111 | Bacteria | 3318 |
| 420 | Ga0373932_0058629 | 3300035112 | Bacteria | 1164 |
| 421 | Ga0373936_0092759 | 3300035113 | Bacteria | 1267 |
| 422 | Ga0373936_0130984 | 3300035113 | Bacteria | 1078 |
| 423 | Ga0373939_0041966 | 3300035114 | Unclassified | 1381 |
| 424 | Ga0373941_0012175 | 3300035115 | Bacteria | 2243 |
| 425 | Ga0373945_0012871 | 3300035116 | Bacteria | 2785 |
| 426 | Ga0373945_0309630 | 3300035116 | Unclassified | 678 |
| 427 | Ga0373954_0007152 | 3300035118 | Bacteria | 4874 |
| 428 | Ga0373956_0088696 | 3300035119 | Bacteria | 1425 |
| 429 | Ga0373957_0005746 | 3300035120 | Bacteria | 3866 |
| 430 | Ga0373960_0242430 | 3300035121 | Bacteria | 652 |
| 431 | Ga0373943_0001305 | 3300035170 | Bacteria | 11190 |
| 432 | Ga0373943_0010781 | 3300035170 | Bacteria | 4102 |
| 433 | Ga0373946_0017815 | 3300035171 | Bacteria | 2721 |
| 434 | Ga0373946_0245829 | 3300035171 | Bacteria | 871 |
| 435 | Ga0373955_0062239 | 3300035172 | Unclassified | 2063 |
| 436 | Ga0373955_0077459 | 3300035172 | Bacteria | 1872 |
| 437 | Ga0373955_0077543 | 3300035172 | Bacteria | 1871 |
| 438 | Ga0373961_0025714 | 3300035241 | Bacteria | 1603 |
| 439 | Ga0373924_0171588 | 3300035410 | Bacteria | 953 |
| 440 | Ga0373931_0018223 | 3300035691 | Bacteria | 3489 |
| 441 | Ga0373931_0064180 | 3300035691 | Bacteria | 1987 |
| 442 | Ga0373935_0003279 | 3300035692 | Bacteria | 9359 |
| 443 | Ga0373935_0162398 | 3300035692 | Bacteria | 1523 |
| 444 | Ga0373935_0316219 | 3300035692 | Bacteria | 1107 |
| 445 | Ga0373935_0420121 | 3300035692 | Unclassified | 962 |
| 446 | Ga0373927_0037544 | 3300035695 | Bacteria | 3148 |
| 447 | Ga0373927_0501566 | 3300035695 | Bacteria | 802 |
| 448 | Ga0373933_0011439 | 3300035724 | Bacteria | 4891 |
| 449 | Ga0373933_0085990 | 3300035724 | Unclassified | 1934 |
| 450 | Ga0373947_0000340 | 3300035725 | Bacteria | 26369 |
| 451 | Ga0373947_0092135 | 3300035725 | Bacteria | 1892 |
| 452 | Ga0373947_0118844 | 3300035725 | Bacteria | 1677 |
| 453 | Ga0373947_0438011 | 3300035725 | Unclassified | 884 |
| 454 | Ga0373937_0001302 | 3300036401 | Bacteria | 20904 |
| 455 | Ga0373937_0044446 | 3300036401 | Unclassified | 4057 |
| 456 | Ga0373937_0044652 | 3300036401 | Bacteria | 4048 |
| 457 | Ga0373925_0100828 | 3300037068 | Bacteria | 2219 |
| 458 | Ga0373925_1119472 | 3300037068 | Bacteria | 648 |
| 459 | Ga0436361_0136543 | 3300039447 | Bacteria | 15949 |
| 460 | Ga0436361_0446726 | 3300039447 | Bacteria | 4024 |
| 461 | Ga0436361_1020246 | 3300039447 | Bacteria | 8764 |
| 462 | Ga0436362_0236268 | 3300039453 | Bacteria | 1122 |
| 463 | Ga0439438_024115 | 3300041405 | Bacteria | 1669 |
| 464 | Ga0439447_009420 | 3300041407 | Bacteria | 2963 |
| 465 | Ga0439466_0020787 | 3300041411 | Bacteria | 2336 |
| 466 | Ga0439466_0070446 | 3300041411 | Bacteria | 1114 |
| 467 | Ga0439452_000239 | 3300042010 | Bacteria | 38013 |
| 468 | Ga0439456_006060 | 3300042013 | Bacteria | 2462 |
| 469 | Ga0439456_031600 | 3300042013 | Bacteria | 1135 |
| 470 | Ga0450911_001328 | 3300042115 | Bacteria | 5825 |
| 471 | Ga0450911_001897 | 3300042115 | Bacteria | 4399 |
| 472 | Ga0450902_007716 | 3300042137 | Bacteria | 1670 |
| 473 | Ga0450904_000079 | 3300042139 | Bacteria | 22089 |
| 474 | Ga0450905_015150 | 3300042142 | Bacteria | 1104 |
| 475 | Ga0495617_001653 | 3300046452 | Bacteria | 9584 |
| 476 | Ga0495617_011581 | 3300046452 | Bacteria | 3007 |
| 477 | Ga0495617_089138 | 3300046452 | Bacteria | 1008 |
| 478 | Ga0495627_009751 | 3300046453 | Bacteria | 3521 |
| 479 | Ga0495627_021912 | 3300046453 | Bacteria | 2110 |
| 480 | Ga0495592_0016424 | 3300046454 | Bacteria | 5615 |
| 481 | Ga0495592_0027610 | 3300046454 | Bacteria | 4301 |
| 482 | Ga0495592_0118353 | 3300046454 | Bacteria | 1866 |
| 483 | Ga0495603_0014210 | 3300046455 | Bacteria | 4816 |
| 484 | Ga0495603_0026165 | 3300046455 | Bacteria | 3526 |
| 485 | Ga0495603_0185935 | 3300046455 | Bacteria | 1202 |
| 486 | Ga0495603_0803066 | 3300046455 | Bacteria | 536 |
| 487 | Ga0495590_0003032 | 3300046457 | Bacteria | 6884 |
| 488 | Ga0495590_0005330 | 3300046457 | Bacteria | 5107 |
| 489 | Ga0495591_000049 | 3300046458 | Bacteria | 138951 |
| 490 | Ga0495591_005658 | 3300046458 | Bacteria | 5723 |
| 491 | Ga0495591_031438 | 3300046458 | Bacteria | 1592 |
| 492 | Ga0495629_0000253 | 3300046459 | Bacteria | 46595 |
| 493 | Ga0495629_0031625 | 3300046459 | Bacteria | 3746 |
| 494 | Ga0495629_0037747 | 3300046459 | Bacteria | 3404 |
| 495 | Ga0495629_0038826 | 3300046459 | Bacteria | 3353 |
| 496 | Ga0495638_0000842 | 3300046460 | Bacteria | 32131 |
| 497 | Ga0495638_0001095 | 3300046460 | Bacteria | 26399 |
| 498 | Ga0495638_0003569 | 3300046460 | Bacteria | 12184 |
| 499 | Ga0495638_0004165 | 3300046460 | Bacteria | 11029 |
| 500 | Ga0495638_0009019 | 3300046460 | Bacteria | 7033 |
| 501 | Ga0495638_0021382 | 3300046460 | Bacteria | 4265 |
| 502 | Ga0495638_0026703 | 3300046460 | Bacteria | 3741 |
| 503 | Ga0495641_0011612 | 3300046461 | Bacteria | 5000 |
| 504 | Ga0495651_0007189 | 3300046462 | Bacteria | 8514 |
| 505 | Ga0495651_0022459 | 3300046462 | Bacteria | 4903 |
| 506 | Ga0495653_0090847 | 3300046463 | Bacteria | 2233 |
| 507 | Ga0495653_0117173 | 3300046463 | Bacteria | 1903 |
| 508 | Ga0495650_0001581 | 3300046471 | Bacteria | 21346 |
| 509 | Ga0495650_0002179 | 3300046471 | Bacteria | 16563 |
| 510 | Ga0495650_0012440 | 3300046471 | Bacteria | 4579 |
| 511 | Ga0495650_0025453 | 3300046471 | Bacteria | 2773 |
| 512 | Ga0495580_0027657 | 3300046472 | Bacteria | 4125 |
| 513 | Ga0495580_0136359 | 3300046472 | Bacteria | 1701 |
| 514 | Ga0495580_0523913 | 3300046472 | Bacteria | 789 |
| 515 | Ga0495582_0010154 | 3300046473 | Bacteria | 5186 |
| 516 | Ga0495582_0489602 | 3300046473 | Bacteria | 711 |
| 517 | Ga0495605_0000047 | 3300046474 | Bacteria | 171270 |
| 518 | Ga0495605_0000054 | 3300046474 | Bacteria | 157560 |
| 519 | Ga0495605_0000447 | 3300046474 | Bacteria | 37007 |
| 520 | Ga0495605_0013312 | 3300046474 | Bacteria | 4540 |
| 521 | Ga0495605_0179597 | 3300046474 | Unclassified | 931 |
| 522 | Ga0495639_0109856 | 3300046475 | Bacteria | 1308 |
| 523 | Ga0495662_0003409 | 3300046476 | Bacteria | 8058 |
| 524 | Ga0495664_0006671 | 3300046477 | Bacteria | 6382 |
| 525 | Ga0495664_0060681 | 3300046477 | Bacteria | 2251 |
| 526 | Ga0495584_0000438 | 3300046491 | Bacteria | 28666 |
| 527 | Ga0495584_0006144 | 3300046491 | Bacteria | 6317 |
| 528 | Ga0495584_0013360 | 3300046491 | Bacteria | 4192 |
| 529 | Ga0495584_0015763 | 3300046491 | Bacteria | 3853 |
| 530 | Ga0495584_0025712 | 3300046491 | Bacteria | 2984 |
| 531 | Ga0495584_0144796 | 3300046491 | Bacteria | 1207 |
| 532 | Ga0495584_0183243 | 3300046491 | Bacteria | 1064 |
| 533 | Ga0495585_0000253 | 3300046492 | Bacteria | 55394 |
| 534 | Ga0495585_0000498 | 3300046492 | Bacteria | 37103 |
| 535 | Ga0495585_0073623 | 3300046492 | Bacteria | 1859 |
| 536 | Ga0495585_0080529 | 3300046492 | Bacteria | 1765 |
| 537 | Ga0495594_0007741 | 3300046499 | Bacteria | 5524 |
| 538 | Ga0495594_0049144 | 3300046499 | Bacteria | 2318 |
| 539 | Ga0495594_0364149 | 3300046499 | Bacteria | 823 |
| 540 | Ga0495596_0000087 | 3300046500 | Bacteria | 64252 |
| 541 | Ga0495607_0000036 | 3300046501 | Bacteria | 140259 |
| 542 | Ga0495607_0001995 | 3300046501 | Bacteria | 17168 |
| 543 | Ga0495607_0007777 | 3300046501 | Bacteria | 7379 |
| 544 | Ga0495607_0009931 | 3300046501 | Bacteria | 6410 |
| 545 | Ga0495607_0018731 | 3300046501 | Bacteria | 4404 |
| 546 | Ga0495607_0025255 | 3300046501 | Bacteria | 3697 |
| 547 | Ga0495607_0061864 | 3300046501 | Bacteria | 2125 |
| 548 | Ga0495583_0004007 | 3300046506 | Bacteria | 10854 |
| 549 | Ga0495606_0000199 | 3300046507 | Bacteria | 104847 |
| 550 | Ga0495606_0001473 | 3300046507 | Bacteria | 31418 |
| 551 | Ga0495606_0002612 | 3300046507 | Bacteria | 20576 |
| 552 | Ga0495606_0015401 | 3300046507 | Bacteria | 5893 |
| 553 | Ga0495606_0057983 | 3300046507 | Bacteria | 2491 |
| 554 | Ga0495608_0001048 | 3300046511 | Bacteria | 19467 |
| 555 | Ga0495608_0029862 | 3300046511 | Bacteria | 3695 |
| 556 | Ga0495608_0038316 | 3300046511 | Bacteria | 3220 |
| 557 | Ga0495608_0807682 | 3300046511 | Bacteria | 553 |
| 558 | Ga0495610_0003227 | 3300046512 | Bacteria | 12896 |
| 559 | Ga0495610_0006343 | 3300046512 | Bacteria | 8173 |
| 560 | Ga0495610_0011507 | 3300046512 | Bacteria | 5406 |
| 561 | Ga0495610_0078147 | 3300046512 | Bacteria | 1526 |
| 562 | Ga0495616_0009808 | 3300046513 | Bacteria | 5578 |
| 563 | Ga0495616_0024444 | 3300046513 | Bacteria | 3241 |
| 564 | Ga0495616_0024711 | 3300046513 | Bacteria | 3219 |
| 565 | Ga0495618_0008923 | 3300046514 | Bacteria | 6050 |
| 566 | Ga0495618_0242767 | 3300046514 | Bacteria | 1132 |
| 567 | Ga0495618_0489679 | 3300046514 | Bacteria | 742 |
| 568 | Ga0495620_0000095 | 3300046515 | Bacteria | 70152 |
| 569 | Ga0495620_0000136 | 3300046515 | Bacteria | 60464 |
| 570 | Ga0495620_0007747 | 3300046515 | Bacteria | 5801 |
| 571 | Ga0495628_0162504 | 3300046516 | Unclassified | 1696 |
| 572 | Ga0495630_0017170 | 3300046517 | Bacteria | 5299 |
| 573 | Ga0495630_0651559 | 3300046517 | Bacteria | 806 |
| 574 | Ga0495631_0001725 | 3300046518 | Bacteria | 12981 |
| 575 | Ga0495631_0001808 | 3300046518 | Bacteria | 12647 |
| 576 | Ga0495631_0027169 | 3300046518 | Bacteria | 2622 |
| 577 | Ga0495631_0151049 | 3300046518 | Bacteria | 997 |
| 578 | Ga0495632_0001145 | 3300046519 | Bacteria | 22647 |
| 579 | Ga0495632_0001397 | 3300046519 | Bacteria | 20236 |
| 580 | Ga0495632_0003535 | 3300046519 | Bacteria | 11051 |
| 581 | Ga0495632_0011016 | 3300046519 | Bacteria | 5301 |
| 582 | Ga0495632_0019238 | 3300046519 | Bacteria | 3725 |
| 583 | Ga0495637_0000200 | 3300046520 | Bacteria | 46589 |
| 584 | Ga0495637_0000363 | 3300046520 | Bacteria | 34565 |
| 585 | Ga0495637_0000401 | 3300046520 | Bacteria | 32143 |
| 586 | Ga0495637_0007836 | 3300046520 | Bacteria | 5270 |
| 587 | Ga0495637_0052548 | 3300046520 | Bacteria | 1700 |
| 588 | Ga0495643_0006541 | 3300046522 | Bacteria | 7667 |
| 589 | Ga0495643_0020020 | 3300046522 | Bacteria | 3865 |
| 590 | Ga0495643_0022355 | 3300046522 | Bacteria | 3609 |
| 591 | Ga0495643_0047189 | 3300046522 | Bacteria | 2333 |
| 592 | Ga0495643_0076959 | 3300046522 | Bacteria | 1744 |
| 593 | Ga0495643_0253479 | 3300046522 | Bacteria | 820 |
| 594 | Ga0495644_0000221 | 3300046523 | Bacteria | 26846 |
| 595 | Ga0495644_0001523 | 3300046523 | Bacteria | 9447 |
| 596 | Ga0495644_0002206 | 3300046523 | Bacteria | 7797 |
| 597 | Ga0495644_0093846 | 3300046523 | Bacteria | 1133 |
| 598 | Ga0495648_0009478 | 3300046524 | Bacteria | 7538 |
| 599 | Ga0495666_0004756 | 3300046526 | Bacteria | 6866 |
| 600 | Ga0495666_0295640 | 3300046526 | Bacteria | 733 |
| 601 | Ga0495652_0021402 | 3300046529 | Bacteria | 5749 |
| 602 | Ga0495652_0059356 | 3300046529 | Bacteria | 3236 |
| 603 | Ga0495652_0069898 | 3300046529 | Bacteria | 2937 |
| 604 | Ga0495652_0237092 | 3300046529 | Unclassified | 1360 |
| 605 | Ga0495654_0001853 | 3300046530 | Bacteria | 14074 |
| 606 | Ga0495654_0008687 | 3300046530 | Bacteria | 5600 |
| 607 | Ga0495654_0056029 | 3300046530 | Bacteria | 1906 |
| 608 | Ga0495654_0223394 | 3300046530 | Bacteria | 795 |
| 609 | Ga0495665_0008307 | 3300046531 | Bacteria | 5627 |
| 610 | Ga0495665_0067027 | 3300046531 | Bacteria | 1894 |
| 611 | Ga0495665_0215511 | 3300046531 | Bacteria | 993 |
| 612 | Ga0495640_0016874 | 3300046533 | Bacteria | 5456 |
| 613 | Ga0495640_0019059 | 3300046533 | Bacteria | 5072 |
| 614 | Ga0495640_0034262 | 3300046533 | Bacteria | 3602 |
| 615 | Ga0495640_0808386 | 3300046533 | Unclassified | 558 |
| 616 | Ga0495586_0031716 | 3300046535 | Bacteria | 2832 |
| 617 | Ga0495586_0324291 | 3300046535 | Unclassified | 883 |
| 618 | Ga0495587_0009102 | 3300046536 | Bacteria | 6371 |
| 619 | Ga0495587_0021008 | 3300046536 | Bacteria | 4027 |
| 620 | Ga0495587_0144041 | 3300046536 | Bacteria | 1359 |
| 621 | Ga0495609_0000149 | 3300046538 | Bacteria | 72309 |
| 622 | Ga0495609_0000160 | 3300046538 | Bacteria | 69846 |
| 623 | Ga0495609_0457562 | 3300046538 | Unclassified | 507 |
| 624 | Ga0495621_0039434 | 3300046539 | Bacteria | 1652 |
| 625 | Ga0495597_0000205 | 3300046542 | Bacteria | 54352 |
| 626 | Ga0495597_0002975 | 3300046542 | Bacteria | 10264 |
| 627 | Ga0495597_0005321 | 3300046542 | Bacteria | 6825 |
| 628 | Ga0495597_0015654 | 3300046542 | Bacteria | 3588 |
| 629 | Ga0495597_0030706 | 3300046542 | Bacteria | 2447 |
| 630 | Ga0495597_0030859 | 3300046542 | Bacteria | 2440 |
| 631 | Ga0495597_0147296 | 3300046542 | Bacteria | 967 |
| 632 | Ga0495645_0075417 | 3300046543 | Bacteria | 2427 |
| 633 | Ga0495645_0169284 | 3300046543 | Unclassified | 1504 |
| 634 | Ga0495622_0027785 | 3300046557 | Bacteria | 2640 |
| 635 | Ga0495622_0041666 | 3300046557 | Bacteria | 2135 |
| 636 | Ga0495622_0114093 | 3300046557 | Bacteria | 1236 |
| 637 | Ga0495633_0013957 | 3300046558 | Bacteria | 4213 |
| 638 | Ga0495667_0005768 | 3300046559 | Bacteria | 8384 |
| 639 | Ga0495667_0040977 | 3300046559 | Bacteria | 3073 |
| 640 | Ga0495667_0641098 | 3300046559 | Bacteria | 660 |
| 641 | Ga0495656_0001748 | 3300046615 | Bacteria | 7119 |
| 642 | Ga0495656_0026011 | 3300046615 | Bacteria | 2326 |
| 643 | Ga0495668_0001686 | 3300046616 | Bacteria | 20450 |
| 644 | Ga0495668_0006773 | 3300046616 | Bacteria | 7448 |
| 645 | Ga0495668_0352547 | 3300046616 | Bacteria | 807 |
| 646 | Ga0495634_0058021 | 3300046642 | Bacteria | 2581 |
| 647 | Ga0495634_0314599 | 3300046642 | Bacteria | 944 |
| 648 | Ga0495634_0594727 | 3300046642 | Bacteria | 642 |
| 649 | Ga0495611_0005933 | 3300046648 | Bacteria | 5211 |
| 650 | Ga0495611_0007091 | 3300046648 | Bacteria | 4760 |
| 651 | Ga0495625_0002208 | 3300046660 | Bacteria | 21531 |
| 652 | Ga0495625_0005523 | 3300046660 | Bacteria | 11493 |
| 653 | Ga0495625_0020820 | 3300046660 | Bacteria | 5056 |
| 654 | Ga0495625_0289544 | 3300046660 | Bacteria | 1051 |
| 655 | Ga0495635_0025275 | 3300046663 | Bacteria | 4136 |
| 656 | Ga0495635_0196896 | 3300046663 | Bacteria | 1367 |
| 657 | Ga0495635_0347652 | 3300046663 | Bacteria | 989 |
| 658 | Ga0495659_0013022 | 3300046664 | Unclassified | 2704 |
| 659 | Ga0495661_0003804 | 3300046665 | Bacteria | 11047 |
| 660 | Ga0495661_0004291 | 3300046665 | Bacteria | 10347 |
| 661 | Ga0495661_0007546 | 3300046665 | Bacteria | 7578 |
| 662 | Ga0495661_0008355 | 3300046665 | Bacteria | 7164 |
| 663 | Ga0495661_0013543 | 3300046665 | Bacteria | 5474 |
| 664 | Ga0495661_0101133 | 3300046665 | Bacteria | 1622 |
| 665 | Ga0495661_0150919 | 3300046665 | Bacteria | 1255 |
| 666 | Ga0495588_0002028 | 3300046674 | Bacteria | 8666 |
| 667 | Ga0495588_0103635 | 3300046674 | Unclassified | 1496 |
| 668 | Ga0495657_0040981 | 3300046675 | Bacteria | 3172 |
| 669 | Ga0495599_0020425 | 3300046678 | Unclassified | 4124 |
| 670 | Ga0495599_0050524 | 3300046678 | Unclassified | 2605 |
| 671 | Ga0495623_0027977 | 3300046679 | Bacteria | 3629 |
| 672 | Ga0495623_0086318 | 3300046679 | Unclassified | 1934 |
| 673 | Ga0495646_0010572 | 3300046680 | Bacteria | 5863 |
| 674 | Ga0495646_0017992 | 3300046680 | Unclassified | 4477 |
| 675 | Ga0495646_0350640 | 3300046680 | Bacteria | 773 |
| 676 | Ga0495647_0029072 | 3300046681 | Bacteria | 2041 |
| 677 | Ga0495658_0000473 | 3300046683 | Bacteria | 22266 |
| 678 | Ga0495658_0075779 | 3300046683 | Bacteria | 1964 |
| 679 | Ga0495658_0100072 | 3300046683 | Bacteria | 1729 |
| 680 | Ga0495613_0268002 | 3300046689 | Bacteria | 1188 |
| 681 | Ga0495613_0372036 | 3300046689 | Unclassified | 978 |
| 682 | Ga0495624_0005790 | 3300046690 | Bacteria | 8852 |
| 683 | Ga0495624_0059190 | 3300046690 | Bacteria | 2404 |
| 684 | Ga0495670_0005085 | 3300046691 | Bacteria | 6469 |
| 685 | Ga0495670_0113876 | 3300046691 | Bacteria | 1401 |
| 686 | Ga0495670_0214606 | 3300046691 | Bacteria | 1021 |
| 687 | Ga0495671_0016853 | 3300046692 | Bacteria | 3894 |
| 688 | Ga0495671_0063070 | 3300046692 | Bacteria | 1825 |
| 689 | Ga0495671_0165026 | 3300046692 | Bacteria | 1077 |
| 690 | Ga0495671_0196879 | 3300046692 | Bacteria | 978 |
| 691 | Ga0495649_0000495 | 3300046694 | Bacteria | 33735 |
| 692 | Ga0495649_0000752 | 3300046694 | Bacteria | 26113 |
| 693 | Ga0495649_0024812 | 3300046694 | Bacteria | 3343 |
| 694 | Ga0495649_0025265 | 3300046694 | Bacteria | 3309 |
| 695 | Ga0495589_0000239 | 3300046794 | Bacteria | 45943 |
| 696 | Ga0495589_0001694 | 3300046794 | Bacteria | 12587 |
| 697 | Ga0495589_0321341 | 3300046794 | Bacteria | 715 |
| 698 | Ga0495589_0520976 | 3300046794 | Bacteria | 542 |
| 699 | Ga0495600_0015219 | 3300046809 | Bacteria | 4860 |
| 700 | Ga0495600_0356527 | 3300046809 | Unclassified | 915 |
| 701 | Ga0495660_0004785 | 3300046810 | Bacteria | 8172 |
| 702 | Ga0495660_0005136 | 3300046810 | Bacteria | 7868 |
| 703 | Ga0495660_0006108 | 3300046810 | Bacteria | 7148 |
| 704 | Ga0495660_0009910 | 3300046810 | Bacteria | 5544 |
| 705 | Ga0495660_0022323 | 3300046810 | Bacteria | 3613 |
| 706 | Ga0495660_0036915 | 3300046810 | Bacteria | 2724 |
| 707 | Ga0495660_0040542 | 3300046810 | Bacteria | 2580 |
| 708 | Ga0495581_0376258 | 3300047315 | Bacteria | 829 |
| 709 | Ga0495604_0002235 | 3300047317 | Bacteria | 15508 |
| 710 | Ga0495604_0090150 | 3300047317 | Bacteria | 2278 |
| 711 | Ga0495674_0006763 | 3300047319 | Bacteria | 10975 |
| 712 | Ga0495674_0043756 | 3300047319 | Bacteria | 3983 |
| 713 | Ga0495674_0903933 | 3300047319 | Bacteria | 681 |
| 714 | Ga0495672_0005068 | 3300047320 | Bacteria | 10528 |
| 715 | Ga0495672_0007498 | 3300047320 | Bacteria | 8199 |
| 716 | Ga0495672_0079502 | 3300047320 | Bacteria | 1831 |
| 717 | Ga0495676_0656338 | 3300047321 | Bacteria | 680 |
| 718 | Ga0495680_0012645 | 3300047322 | Bacteria | 7415 |
| 719 | Ga0495680_0039115 | 3300047322 | Bacteria | 3785 |
| 720 | Ga0495680_0230314 | 3300047322 | Bacteria | 1319 |
| 721 | Ga0495680_0458416 | 3300047322 | Bacteria | 871 |
| 722 | Ga0495683_0013942 | 3300047323 | Bacteria | 4191 |
| 723 | Ga0495683_0019232 | 3300047323 | Bacteria | 3525 |
| 724 | Ga0495683_0295338 | 3300047323 | Bacteria | 697 |
| 725 | Ga0495675_0002904 | 3300047444 | Bacteria | 10293 |
| 726 | Ga0495677_0040783 | 3300047445 | Bacteria | 1698 |
| 727 | Ga0495679_000894 | 3300047446 | Bacteria | 18697 |
| 728 | Ga0495679_004604 | 3300047446 | Bacteria | 6293 |
| 729 | Ga0495679_028588 | 3300047446 | Bacteria | 1828 |
| 730 | Ga0495673_0001220 | 3300047469 | Bacteria | 21349 |
| 731 | Ga0495673_0002461 | 3300047469 | Bacteria | 13012 |
| 732 | Ga0495673_0006969 | 3300047469 | Bacteria | 6576 |
| 733 | Ga0495673_0009237 | 3300047469 | Bacteria | 5470 |
| 734 | Ga0495673_0009612 | 3300047469 | Bacteria | 5335 |
| 735 | Ga0495673_0016407 | 3300047469 | Bacteria | 3787 |
| 736 | Ga0495673_0022084 | 3300047469 | Bacteria | 3125 |
| 737 | Ga0495673_0033328 | 3300047469 | Bacteria | 2391 |
| 738 | Ga0495681_0000234 | 3300047470 | Bacteria | 45933 |
| 739 | Ga0495681_0000460 | 3300047470 | Bacteria | 31243 |
| 740 | Ga0495681_0003684 | 3300047470 | Bacteria | 10641 |
| 741 | Ga0495681_0012817 | 3300047470 | Bacteria | 4902 |
| 742 | Ga0495681_0022099 | 3300047470 | Bacteria | 3412 |
| 743 | Ga0495681_0120520 | 3300047470 | Unclassified | 1126 |
| 744 | Ga0495684_0146629 | 3300047471 | Unclassified | 1767 |
| 745 | Ga0495684_0152628 | 3300047471 | Bacteria | 1726 |
| 746 | Ga0495684_0643206 | 3300047471 | Unclassified | 710 |
| 747 | Ga0495686_0000636 | 3300047472 | Bacteria | 48321 |
| 748 | Ga0495686_0026767 | 3300047472 | Bacteria | 3772 |
| 749 | Ga0495686_0033044 | 3300047472 | Bacteria | 3342 |
| 750 | Ga0495686_0043400 | 3300047472 | Bacteria | 2851 |
| 751 | Ga0495593_0004020 | 3300047673 | Bacteria | 8768 |
| 752 | Ga0495593_0038512 | 3300047673 | Bacteria | 2582 |
| 753 | Ga0495593_0099094 | 3300047673 | Unclassified | 1496 |
| 754 | Ga0495602_0001451 | 3300048088 | Bacteria | 23534 |
| 755 | Ga0495602_0059231 | 3300048088 | Bacteria | 3344 |
| 756 | Ga0495614_0139729 | 3300048089 | Bacteria | 1076 |
| 757 | Ga0495626_0000057 | 3300048091 | Bacteria | 148288 |
| 758 | Ga0495626_0000065 | 3300048091 | Bacteria | 141689 |
| 759 | Ga0496100_0013607 | 3300048903 | Bacteria | 4699 |
| 760 | Ga0496100_0055226 | 3300048903 | Bacteria | 2594 |
| 761 | Ga0496100_0107976 | 3300048903 | Bacteria | 1929 |
| 762 | Ga0496100_0390232 | 3300048903 | Bacteria | 1058 |
| 763 | Ga0496101_0001165 | 3300048904 | Bacteria | 15728 |
| 764 | Ga0496101_0043061 | 3300048904 | Bacteria | 3225 |
| 765 | Ga0496101_0947373 | 3300048904 | Bacteria | 677 |
| 766 | Ga0496102_0005341 | 3300048905 | Bacteria | 10905 |
| 767 | Ga0496102_0061563 | 3300048905 | Bacteria | 3435 |
| 768 | Ga0496102_0115503 | 3300048905 | Bacteria | 2504 |
| 769 | Ga0496102_0475672 | 3300048905 | Bacteria | 1170 |
| 770 | Ga0496103_0157425 | 3300048906 | Bacteria | 1456 |
| 771 | Ga0496103_0259328 | 3300048906 | Bacteria | 1118 |
| 772 | Ga0496103_0262405 | 3300048906 | Bacteria | 1111 |
| 773 | Ga0496104_0015669 | 3300048907 | Bacteria | 6875 |
| 774 | Ga0496104_0688144 | 3300048907 | Bacteria | 930 |
| 775 | Ga0496105_0121713 | 3300048908 | Bacteria | 2151 |
| 776 | Ga0496105_0674625 | 3300048908 | Unclassified | 795 |
| 777 | Ga0496106_0015809 | 3300048909 | Bacteria | 5581 |
| 778 | Ga0496106_0032287 | 3300048909 | Bacteria | 3903 |
| 779 | Ga0496106_0184893 | 3300048909 | Bacteria | 1655 |
| 780 | Ga0496107_0023030 | 3300048910 | Bacteria | 4403 |
| 781 | Ga0496107_0035626 | 3300048910 | Bacteria | 3567 |
| 782 | Ga0496107_0049494 | 3300048910 | Bacteria | 3028 |
| 783 | Ga0496108_0229662 | 3300048911 | Bacteria | 1613 |
| 784 | Ga0496108_0567087 | 3300048911 | Bacteria | 990 |
| 785 | Ga0496109_0071006 | 3300048912 | Bacteria | 3196 |
| 786 | Ga0496109_0078310 | 3300048912 | Bacteria | 3043 |
| 787 | Ga0496109_0136382 | 3300048912 | Bacteria | 2293 |
| 788 | Ga0496109_0911732 | 3300048912 | Bacteria | 817 |
| 789 | Ga0496110_0019494 | 3300048913 | Bacteria | 5710 |
| 790 | Ga0496110_0096810 | 3300048913 | Bacteria | 2644 |
| 791 | Ga0496110_0215110 | 3300048913 | Bacteria | 1748 |
| 792 | Ga0496110_0247205 | 3300048913 | Bacteria | 1623 |
| 793 | Ga0496110_0578168 | 3300048913 | Bacteria | 1020 |
| 794 | Ga0496111_0020228 | 3300048914 | Bacteria | 4630 |
| 795 | Ga0496111_0637666 | 3300048914 | Bacteria | 778 |
| 796 | Ga0496111_0761448 | 3300048914 | Bacteria | 702 |
| 797 | Ga0496112_0011859 | 3300048915 | Bacteria | 7982 |
| 798 | Ga0496112_0087029 | 3300048915 | Bacteria | 3091 |
| 799 | Ga0496112_0802620 | 3300048915 | Bacteria | 866 |
| 800 | Ga0496112_1844484 | 3300048915 | Unclassified | 516 |
| 801 | Ga0496113_0163836 | 3300048916 | Bacteria | 1758 |
| 802 | Ga0496114_0200540 | 3300048917 | Bacteria | 1747 |
| 803 | Ga0496114_0374920 | 3300048917 | Bacteria | 1259 |
| 804 | Ga0496114_0693320 | 3300048917 | Bacteria | 893 |
| 805 | Ga0496115_0032424 | 3300048918 | Bacteria | 4121 |
| 806 | Ga0496115_0113999 | 3300048918 | Bacteria | 2221 |
| 807 | Ga0496117_0071323 | 3300048920 | Bacteria | 2328 |
| 808 | Ga0496117_0151355 | 3300048920 | Bacteria | 1373 |
| 809 | Ga0496118_0102888 | 3300048921 | Bacteria | 1923 |
| 810 | Ga0496121_0001087 | 3300048924 | Bacteria | 48027 |
| 811 | Ga0496121_0058560 | 3300048924 | Bacteria | 3183 |
| 812 | Ga0496121_0150175 | 3300048924 | Bacteria | 1715 |
| 813 | Ga0496121_0259666 | 3300048924 | Bacteria | 1200 |
| 814 | Ga0496122_0000043 | 3300048925 | Bacteria | 280333 |
| 815 | Ga0496122_0518336 | 3300048925 | Unclassified | 575 |
| 816 | Ga0496123_0000090 | 3300048926 | Bacteria | 179735 |
| 817 | Ga0496123_0063037 | 3300048926 | Bacteria | 2371 |
| 818 | Ga0496124_0000423 | 3300048927 | Bacteria | 75679 |
| 819 | Ga0496124_0005631 | 3300048927 | Bacteria | 14007 |
| 820 | Ga0496124_0015758 | 3300048927 | Bacteria | 7225 |
| 821 | Ga0496125_0203815 | 3300048928 | Bacteria | 1292 |
| 822 | Ga0496126_0607656 | 3300048929 | Bacteria | 861 |
| 823 | Ga0495678_000592 | 3300049459 | Bacteria | 34104 |
| 824 | Ga0495678_001121 | 3300049459 | Bacteria | 22234 |
| 825 | Ga0495678_001152 | 3300049459 | Bacteria | 21898 |
| 826 | Ga0495678_007757 | 3300049459 | Bacteria | 5528 |
| 827 | Ga0495678_029261 | 3300049459 | Bacteria | 2315 |
| 828 | Ga0495682_0000025 | 3300049460 | Bacteria | 147931 |
| 829 | Ga0495682_0101678 | 3300049460 | Bacteria | 1031 |
| 830 | Ga0501077_0472141 | 3300049593 | Bacteria | 804 |
| 831 | nmdc:mga07m45_449116_c1 | 3300050496 | Bacteria | 747 |
| 832 | nmdc:mga05p37_225_c1 | 3300050507 | Bacteria | 57238 |
| 833 | nmdc:mga09592_244_c1 | 3300050508 | Bacteria | 39424 |
| 834 | nmdc:mga0qj67_697_c1 | 3300050509 | Bacteria | 22881 |
| 835 | nmdc:mga06r32_731_c1 | 3300050510 | Bacteria | 28813 |
| 836 | nmdc:mga08y16_296601_c1 | 3300050511 | Bacteria | 1666 |
| 837 | nmdc:mga08y16_617_c1 | 3300050511 | Bacteria | 33261 |
| 838 | nmdc:mga0n895_329652_c1 | 3300050512 | Bacteria | 1547 |
| 839 | nmdc:mga0n895_48088_c1 | 3300050512 | Bacteria | 4174 |
| 840 | nmdc:mga0n895_877514_c1 | 3300050512 | Bacteria | 883 |
| 841 | nmdc:mga0rr50_61528_c1 | 3300050513 | Bacteria | 2829 |
| 842 | nmdc:mga0rr50_790_c1 | 3300050513 | Bacteria | 17055 |
| 843 | nmdc:mga08x19_1171203_c1 | 3300050514 | Bacteria | 545 |
| 844 | nmdc:mga08x19_58563_c1 | 3300050514 | Bacteria | 2492 |
| 845 | nmdc:mga0a205_1019_c1 | 3300050515 | Bacteria | 23295 |
| 846 | Ga0495601_0000413 | 3300053077 | Bacteria | 22423 |
| 847 | Ga0495601_0019631 | 3300053077 | Unclassified | 4124 |
| 848 | Ga0495601_0079895 | 3300053077 | Bacteria | 2097 |
| 849 | Ga0495612_0035714 | 3300053078 | Bacteria | 2014 |
| 850 | Ga0495612_0042296 | 3300053078 | Unclassified | 1859 |
| 851 | Ga0495595_0006073 | 3300053084 | Bacteria | 4907 |
| 852 | Ga0495595_0090096 | 3300053084 | Unclassified | 1470 |
| 853 | Ga0495595_0098869 | 3300053084 | Bacteria | 1406 |
| 854 | Ga0495619_0001679 | 3300053085 | Bacteria | 14639 |
| 855 | Ga0495619_0002856 | 3300053085 | Bacteria | 11246 |
| 856 | Ga0495619_0013291 | 3300053085 | Bacteria | 5186 |
| 857 | Ga0495619_0079002 | 3300053085 | Bacteria | 2212 |
| 858 | Ga0500646_0068953 | 3300053090 | Unclassified | 1057 |
| 859 | Ga0500594_0160864 | 3300053118 | Bacteria | 726 |
| 860 | Ga0500595_010770 | 3300053119 | Bacteria | 3615 |
| 861 | Ga0500658_0073758 | 3300053134 | Bacteria | 1446 |
| 862 | Ga0500568_0078911 | 3300053139 | Bacteria | 1252 |
| 863 | Ga0500577_0114797 | 3300053142 | Bacteria | 1115 |
| 864 | Ga0500616_0000964 | 3300053153 | Bacteria | 31200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1008064 | Ga0265337_10080643 | 104 |
| 2 | 3300028800 | Ga0265338_10006825 | Ga0265338_100068255 | 104 |
| 3 | iso_pu_bacteria | 2919385768 | 2919391063 | 114 |
| 4 | 3300025923 | Ga0207681_10907596 | Ga0207681_109075961 | 115 |
| 5 | 3300006914 | Ga0075436_100939538 | Ga0075436_1009395381 | 116 |
| 6 | 3300007076 | Ga0075435_100105078 | Ga0075435_1001050783 | 116 |
| 7 | 3300046507 | Ga0495606_0015401 | Ga0495606_0015401_5233_5583 | 116 |
| 8 | 3300046520 | Ga0495637_0000200 | Ga0495637_0000200_5618_5968 | 116 |
| 9 | 3300046616 | Ga0495668_0006773 | Ga0495668_0006773_1737_2087 | 116 |
| 10 | 3300046665 | Ga0495661_0007546 | Ga0495661_0007546_4267_4617 | 116 |
| 11 | 3300046810 | Ga0495660_0006108 | Ga0495660_0006108_2019_2369 | 116 |
| 12 | 3300047469 | Ga0495673_0009237 | Ga0495673_0009237_1239_1589 | 116 |
| 13 | 3300047469 | Ga0495673_0033328 | Ga0495673_0033328_1268_1618 | 116 |
| 14 | 3300048914 | Ga0496111_0761448 | Ga0496111_0761448_118_468 | 116 |
| 15 | 3300048927 | Ga0496124_0015758 | Ga0496124_0015758_217_567 | 116 |
| 16 | 3300049459 | Ga0495678_000592 | Ga0495678_000592_28000_28350 | 116 |
| 17 | 3300050512 | nmdc:mga0n895_877514_c1 | nmdc:mga0n895_877514_c1_40_393 | 116 |
| 18 | 3300050514 | nmdc:mga08x19_1171203_c1 | nmdc:mga08x19_1171203_c1_48_401 | 116 |
| 19 | 3300006846 | Ga0075430_100000026 | Ga0075430_10000002632 | 117 |
| 20 | 3300006847 | Ga0075431_100000451 | Ga0075431_10000045113 | 117 |
| 21 | 3300006852 | Ga0075433_10007117 | Ga0075433_100071177 | 117 |
| 22 | 3300006871 | Ga0075434_100000110 | Ga0075434_1000001103 | 117 |
| 23 | 3300006880 | Ga0075429_100000247 | Ga0075429_10000024717 | 117 |
| 24 | 3300007076 | Ga0075435_100039007 | Ga0075435_1000390072 | 117 |
| 25 | 3300009094 | Ga0111539_10000337 | Ga0111539_1000033735 | 117 |
| 26 | 3300027907 | Ga0207428_10000140 | Ga0207428_1000014072 | 117 |
| 27 | 3300047320 | Ga0495672_0079502 | Ga0495672_0079502_1450_1806 | 117 |
| 28 | 3300050507 | nmdc:mga05p37_225_c1 | nmdc:mga05p37_225_c1_33995_34348 | 117 |
| 29 | 3300050508 | nmdc:mga09592_244_c1 | nmdc:mga09592_244_c1_4762_5115 | 117 |
| 30 | 3300050509 | nmdc:mga0qj67_697_c1 | nmdc:mga0qj67_697_c1_21186_21539 | 117 |
| 31 | 3300050510 | nmdc:mga06r32_731_c1 | nmdc:mga06r32_731_c1_16548_16901 | 117 |
| 32 | 3300050511 | nmdc:mga08y16_617_c1 | nmdc:mga08y16_617_c1_27997_28350 | 117 |
| 33 | 3300050512 | nmdc:mga0n895_48088_c1 | nmdc:mga0n895_48088_c1_1062_1415 | 117 |
| 34 | 3300050513 | nmdc:mga0rr50_790_c1 | nmdc:mga0rr50_790_c1_16224_16577 | 117 |
| 35 | 3300050515 | nmdc:mga0a205_1019_c1 | nmdc:mga0a205_1019_c1_13124_13477 | 117 |
| 36 | 3300005548 | Ga0070665_100009597 | Ga0070665_1000095979 | 118 |
| 37 | 3300009093 | Ga0105240_10256119 | Ga0105240_102561193 | 118 |
| 38 | 3300013306 | Ga0163162_11752619 | Ga0163162_117526192 | 118 |
| 39 | 3300014325 | Ga0163163_10304120 | Ga0163163_103041202 | 118 |
| 40 | 3300025913 | Ga0207695_10941615 | Ga0207695_109416152 | 118 |
| 41 | 3300025927 | Ga0207687_10485772 | Ga0207687_104857722 | 118 |
| 42 | 3300030888 | Ga0265769_122209 | Ga0265769_1222091 | 118 |
| 43 | 3300039447 | Ga0436361_0136543 | Ga0436361_0136543_6858_7226 | 118 |
| 44 | 3300039453 | Ga0436362_0236268 | Ga0436362_0236268_374_742 | 118 |
| 45 | 3300046474 | Ga0495605_0000047 | Ga0495605_0000047_16610_16987 | 118 |
| 46 | 3300046474 | Ga0495605_0000447 | Ga0495605_0000447_23845_24246 | 118 |
| 47 | 3300046501 | Ga0495607_0007777 | Ga0495607_0007777_2058_2459 | 118 |
| 48 | 3300046506 | Ga0495583_0004007 | Ga0495583_0004007_7691_8092 | 118 |
| 49 | 3300046522 | Ga0495643_0020020 | Ga0495643_0020020_337_705 | 118 |
| 50 | 3300046538 | Ga0495609_0000149 | Ga0495609_0000149_58201_58602 | 118 |
| 51 | 3300046810 | Ga0495660_0040542 | Ga0495660_0040542_2181_2549 | 118 |
| 52 | 3300047469 | Ga0495673_0016407 | Ga0495673_0016407_2293_2670 | 118 |
| 53 | 3300047469 | Ga0495673_0022084 | Ga0495673_0022084_1836_2237 | 118 |
| 54 | 3300048929 | Ga0496126_0607656 | Ga0496126_0607656_331_699 | 118 |
| 55 | 3300053119 | Ga0500595_010770 | Ga0500595_010770_2918_3286 | 118 |
| 56 | 3300005434 | Ga0070709_10138798 | Ga0070709_101387982 | 119 |
| 57 | 3300005983 | Ga0081540_1076267 | Ga0081540_10762671 | 119 |
| 58 | 3300009098 | Ga0105245_10595789 | Ga0105245_105957892 | 119 |
| 59 | 3300009101 | Ga0105247_10431733 | Ga0105247_104317332 | 119 |
| 60 | 3300009147 | Ga0114129_10028763 | Ga0114129_100287637 | 119 |
| 61 | 3300009176 | Ga0105242_10269012 | Ga0105242_102690122 | 119 |
| 62 | 3300009545 | Ga0105237_10008020 | Ga0105237_100080205 | 119 |
| 63 | 3300009551 | Ga0105238_10069394 | Ga0105238_100693942 | 119 |
| 64 | 3300011119 | Ga0105246_10794292 | Ga0105246_107942922 | 119 |
| 65 | 3300013297 | Ga0157378_10145600 | Ga0157378_101456002 | 119 |
| 66 | 3300013297 | Ga0157378_11451341 | Ga0157378_114513411 | 119 |
| 67 | 3300014326 | Ga0157380_10108544 | Ga0157380_101085443 | 119 |
| 68 | 3300014326 | Ga0157380_10200476 | Ga0157380_102004761 | 119 |
| 69 | 3300014968 | Ga0157379_10069742 | Ga0157379_100697422 | 119 |
| 70 | 3300014969 | Ga0157376_10014087 | Ga0157376_100140875 | 119 |
| 71 | 3300023672 | Ga0247553_112590 | Ga0247553_1125901 | 119 |
| 72 | 3300024227 | Ga0228598_1001577 | Ga0228598_10015775 | 119 |
| 73 | 3300025299 | Ga0209256_1004316 | Ga0209256_10043164 | 119 |
| 74 | 3300031090 | Ga0265760_10106519 | Ga0265760_101065192 | 119 |
| 75 | 3300035111 | Ga0373923_0010927 | Ga0373923_0010927_894_1256 | 119 |
| 76 | 3300035113 | Ga0373936_0130984 | Ga0373936_0130984_130_492 | 119 |
| 77 | 3300035172 | Ga0373955_0077459 | Ga0373955_0077459_872_1234 | 119 |
| 78 | 3300035692 | Ga0373935_0316219 | Ga0373935_0316219_720_1082 | 119 |
| 79 | 3300035695 | Ga0373927_0501566 | Ga0373927_0501566_28_390 | 119 |
| 80 | 3300035725 | Ga0373947_0092135 | Ga0373947_0092135_208_570 | 119 |
| 81 | 3300036401 | Ga0373937_0044652 | Ga0373937_0044652_2088_2450 | 119 |
| 82 | 3300037068 | Ga0373925_1119472 | Ga0373925_1119472_220_582 | 119 |
| 83 | 3300046454 | Ga0495592_0118353 | Ga0495592_0118353_301_663 | 119 |
| 84 | 3300046455 | Ga0495603_0185935 | Ga0495603_0185935_264_626 | 119 |
| 85 | 3300046459 | Ga0495629_0038826 | Ga0495629_0038826_392_754 | 119 |
| 86 | 3300046462 | Ga0495651_0022459 | Ga0495651_0022459_1329_1691 | 119 |
| 87 | 3300046474 | Ga0495605_0000054 | Ga0495605_0000054_44405_44776 | 119 |
| 88 | 3300046491 | Ga0495584_0183243 | Ga0495584_0183243_520_891 | 119 |
| 89 | 3300046501 | Ga0495607_0000036 | Ga0495607_0000036_14831_15202 | 119 |
| 90 | 3300046507 | Ga0495606_0000199 | Ga0495606_0000199_74055_74435 | 119 |
| 91 | 3300046511 | Ga0495608_0038316 | Ga0495608_0038316_752_1114 | 119 |
| 92 | 3300046514 | Ga0495618_0242767 | Ga0495618_0242767_638_1000 | 119 |
| 93 | 3300046515 | Ga0495620_0000136 | Ga0495620_0000136_25353_25724 | 119 |
| 94 | 3300046529 | Ga0495652_0069898 | Ga0495652_0069898_1476_1838 | 119 |
| 95 | 3300046531 | Ga0495665_0067027 | Ga0495665_0067027_194_556 | 119 |
| 96 | 3300046533 | Ga0495640_0034262 | Ga0495640_0034262_2655_3017 | 119 |
| 97 | 3300046536 | Ga0495587_0144041 | Ga0495587_0144041_610_972 | 119 |
| 98 | 3300046543 | Ga0495645_0075417 | Ga0495645_0075417_1877_2239 | 119 |
| 99 | 3300046559 | Ga0495667_0040977 | Ga0495667_0040977_1400_1762 | 119 |
| 100 | 3300046642 | Ga0495634_0314599 | Ga0495634_0314599_409_771 | 119 |
| 101 | 3300046663 | Ga0495635_0196896 | Ga0495635_0196896_803_1165 | 119 |
| 102 | 3300046665 | Ga0495661_0004291 | Ga0495661_0004291_2546_2917 | 119 |
| 103 | 3300046679 | Ga0495623_0027977 | Ga0495623_0027977_195_557 | 119 |
| 104 | 3300046680 | Ga0495646_0350640 | Ga0495646_0350640_288_650 | 119 |
| 105 | 3300046683 | Ga0495658_0100072 | Ga0495658_0100072_64_426 | 119 |
| 106 | 3300046689 | Ga0495613_0268002 | Ga0495613_0268002_158_520 | 119 |
| 107 | 3300046809 | Ga0495600_0015219 | Ga0495600_0015219_2977_3339 | 119 |
| 108 | 3300047315 | Ga0495581_0376258 | Ga0495581_0376258_215_577 | 119 |
| 109 | 3300047317 | Ga0495604_0090150 | Ga0495604_0090150_1362_1724 | 119 |
| 110 | 3300047319 | Ga0495674_0903933 | Ga0495674_0903933_25_387 | 119 |
| 111 | 3300047322 | Ga0495680_0230314 | Ga0495680_0230314_86_448 | 119 |
| 112 | 3300047469 | Ga0495673_0009612 | Ga0495673_0009612_2371_2742 | 119 |
| 113 | 3300048088 | Ga0495602_0059231 | Ga0495602_0059231_2384_2746 | 119 |
| 114 | 3300048903 | Ga0496100_0055226 | Ga0496100_0055226_1690_2067 | 119 |
| 115 | 3300048904 | Ga0496101_0043061 | Ga0496101_0043061_299_676 | 119 |
| 116 | 3300048905 | Ga0496102_0061563 | Ga0496102_0061563_266_646 | 119 |
| 117 | 3300048905 | Ga0496102_0115503 | Ga0496102_0115503_496_873 | 119 |
| 118 | 3300048906 | Ga0496103_0259328 | Ga0496103_0259328_494_871 | 119 |
| 119 | 3300048909 | Ga0496106_0032287 | Ga0496106_0032287_2726_3103 | 119 |
| 120 | 3300048910 | Ga0496107_0023030 | Ga0496107_0023030_3394_3771 | 119 |
| 121 | 3300048912 | Ga0496109_0911732 | Ga0496109_0911732_81_458 | 119 |
| 122 | 3300048913 | Ga0496110_0247205 | Ga0496110_0247205_1248_1613 | 119 |
| 123 | 3300048917 | Ga0496114_0693320 | Ga0496114_0693320_82_459 | 119 |
| 124 | 3300048918 | Ga0496115_0032424 | Ga0496115_0032424_978_1355 | 119 |
| 125 | 3300048920 | Ga0496117_0151355 | Ga0496117_0151355_722_1102 | 119 |
| 126 | 3300048924 | Ga0496121_0001087 | Ga0496121_0001087_40202_40582 | 119 |
| 127 | 3300048925 | Ga0496122_0518336 | Ga0496122_0518336_94_474 | 119 |
| 128 | 3300048926 | Ga0496123_0063037 | Ga0496123_0063037_1629_2009 | 119 |
| 129 | 3300048927 | Ga0496124_0000423 | Ga0496124_0000423_31438_31818 | 119 |
| 130 | 3300049460 | Ga0495682_0000025 | Ga0495682_0000025_112895_113266 | 119 |
| 131 | 3300053077 | Ga0495601_0079895 | Ga0495601_0079895_920_1282 | 119 |
| 132 | 3300053084 | Ga0495595_0098869 | Ga0495595_0098869_902_1264 | 119 |
| 133 | 3300053085 | Ga0495619_0079002 | Ga0495619_0079002_1571_1933 | 119 |
| 134 | 3300053153 | Ga0500616_0000964 | Ga0500616_0000964_6204_6581 | 119 |
| 135 | iso_pu_bacteria | 2511231010 | 2511290283 | 119 |
| 136 | iso_pu_bacteria | 2600255318 | 2601799477 | 119 |
| 137 | iso_pu_bacteria | 2603880185 | 2606078289 | 119 |
| 138 | iso_pu_bacteria | 2603880199 | 2606130397 | 119 |
| 139 | iso_pu_bacteria | 2623620443 | 2624480448 | 119 |
| 140 | iso_pu_bacteria | 2713897149 | 2715759357 | 119 |
| 141 | iso_pu_bacteria | 2919063839 | 2919065260 | 119 |
| 142 | iso_pu_bacteria | 3007861166 | 3007861707 | 119 |
| 143 | iso_pu_bacteria | 8056177738 | 8056183938 | 119 |
| 144 | 3300003791 | Ga0055530_10001135 | Ga0055530_1000113512 | 120 |
| 145 | 3300003792 | Ga0055540_1000008 | Ga0055540_1000008228 | 120 |
| 146 | 3300003794 | Ga0055531_10000242 | Ga0055531_1000024210 | 120 |
| 147 | 3300005288 | Ga0065714_10065188 | Ga0065714_100651888 | 120 |
| 148 | 3300005441 | Ga0070700_100520759 | Ga0070700_1005207592 | 120 |
| 149 | 3300006946 | Ga0079104_1051120 | Ga0079104_10511202 | 120 |
| 150 | 3300009092 | Ga0105250_10001249 | Ga0105250_100012494 | 120 |
| 151 | 3300013104 | Ga0157370_10171945 | Ga0157370_101719451 | 120 |
| 152 | 3300013104 | Ga0157370_10271641 | Ga0157370_102716412 | 120 |
| 153 | 3300015265 | Ga0182005_1002145 | Ga0182005_10021453 | 120 |
| 154 | 3300017792 | Ga0163161_10228167 | Ga0163161_102281672 | 120 |
| 155 | 3300025291 | Ga0209675_1009397 | Ga0209675_10093972 | 120 |
| 156 | 3300025292 | Ga0209676_1000002 | Ga0209676_10000021344 | 120 |
| 157 | 3300025298 | Ga0209050_1000006 | Ga0209050_1000006226 | 120 |
| 158 | 3300025303 | Ga0209051_1000001 | Ga0209051_10000011344 | 120 |
| 159 | 3300025304 | Ga0209257_1000029 | Ga0209257_1000029226 | 120 |
| 160 | 3300025711 | Ga0207696_1000830 | Ga0207696_10008308 | 120 |
| 161 | 3300025711 | Ga0207696_1018347 | Ga0207696_10183474 | 120 |
| 162 | 3300025735 | Ga0207713_1023423 | Ga0207713_10234234 | 120 |
| 163 | 3300025735 | Ga0207713_1042265 | Ga0207713_10422652 | 120 |
| 164 | 3300025735 | Ga0207713_1042280 | Ga0207713_10422802 | 120 |
| 165 | 3300027111 | Ga0209281_1032564 | Ga0209281_10325641 | 120 |
| 166 | 3300031344 | Ga0265316_10728227 | Ga0265316_107282272 | 120 |
| 167 | 3300041407 | Ga0439447_009420 | Ga0439447_009420_2503_2895 | 120 |
| 168 | 3300041411 | Ga0439466_0070446 | Ga0439466_0070446_508_900 | 120 |
| 169 | 3300042013 | Ga0439456_006060 | Ga0439456_006060_1174_1566 | 120 |
| 170 | 3300042115 | Ga0450911_001328 | Ga0450911_001328_3303_3695 | 120 |
| 171 | 3300042139 | Ga0450904_000079 | Ga0450904_000079_9507_9899 | 120 |
| 172 | 3300046453 | Ga0495627_009751 | Ga0495627_009751_1620_2027 | 120 |
| 173 | 3300046460 | Ga0495638_0000842 | Ga0495638_0000842_4959_5351 | 120 |
| 174 | 3300046460 | Ga0495638_0001095 | Ga0495638_0001095_19029_19421 | 120 |
| 175 | 3300046471 | Ga0495650_0012440 | Ga0495650_0012440_3580_3987 | 120 |
| 176 | 3300046491 | Ga0495584_0000438 | Ga0495584_0000438_11402_11809 | 120 |
| 177 | 3300046491 | Ga0495584_0025712 | Ga0495584_0025712_2273_2665 | 120 |
| 178 | 3300046492 | Ga0495585_0000498 | Ga0495585_0000498_30677_31069 | 120 |
| 179 | 3300046507 | Ga0495606_0001473 | Ga0495606_0001473_12486_12893 | 120 |
| 180 | 3300046512 | Ga0495610_0078147 | Ga0495610_0078147_276_668 | 120 |
| 181 | 3300046513 | Ga0495616_0024711 | Ga0495616_0024711_333_725 | 120 |
| 182 | 3300046515 | Ga0495620_0000095 | Ga0495620_0000095_23305_23712 | 120 |
| 183 | 3300046518 | Ga0495631_0001725 | Ga0495631_0001725_12052_12459 | 120 |
| 184 | 3300046519 | Ga0495632_0001145 | Ga0495632_0001145_9774_10181 | 120 |
| 185 | 3300046519 | Ga0495632_0011016 | Ga0495632_0011016_4198_4590 | 120 |
| 186 | 3300046520 | Ga0495637_0000363 | Ga0495637_0000363_12222_12629 | 120 |
| 187 | 3300046520 | Ga0495637_0007836 | Ga0495637_0007836_1064_1456 | 120 |
| 188 | 3300046522 | Ga0495643_0076959 | Ga0495643_0076959_1268_1660 | 120 |
| 189 | 3300046530 | Ga0495654_0008687 | Ga0495654_0008687_904_1296 | 120 |
| 190 | 3300046530 | Ga0495654_0223394 | Ga0495654_0223394_336_728 | 120 |
| 191 | 3300046538 | Ga0495609_0000160 | Ga0495609_0000160_23010_23417 | 120 |
| 192 | 3300046542 | Ga0495597_0002975 | Ga0495597_0002975_5255_5647 | 120 |
| 193 | 3300046542 | Ga0495597_0015654 | Ga0495597_0015654_2629_3003 | 120 |
| 194 | 3300046557 | Ga0495622_0114093 | Ga0495622_0114093_718_1092 | 120 |
| 195 | 3300046616 | Ga0495668_0352547 | Ga0495668_0352547_316_723 | 120 |
| 196 | 3300046660 | Ga0495625_0002208 | Ga0495625_0002208_12273_12680 | 120 |
| 197 | 3300046660 | Ga0495625_0289544 | Ga0495625_0289544_75_467 | 120 |
| 198 | 3300046665 | Ga0495661_0013543 | Ga0495661_0013543_2319_2711 | 120 |
| 199 | 3300046694 | Ga0495649_0000495 | Ga0495649_0000495_21081_21488 | 120 |
| 200 | 3300046694 | Ga0495649_0024812 | Ga0495649_0024812_14_388 | 120 |
| 201 | 3300046794 | Ga0495589_0000239 | Ga0495589_0000239_23561_23968 | 120 |
| 202 | 3300046810 | Ga0495660_0004785 | Ga0495660_0004785_6398_6805 | 120 |
| 203 | 3300047470 | Ga0495681_0000234 | Ga0495681_0000234_23557_23964 | 120 |
| 204 | 3300047470 | Ga0495681_0022099 | Ga0495681_0022099_2570_2962 | 120 |
| 205 | 3300047472 | Ga0495686_0000636 | Ga0495686_0000636_29257_29649 | 120 |
| 206 | 3300048920 | Ga0496117_0071323 | Ga0496117_0071323_447_866 | 120 |
| 207 | 3300048921 | Ga0496118_0102888 | Ga0496118_0102888_128_547 | 120 |
| 208 | 3300048924 | Ga0496121_0150175 | Ga0496121_0150175_951_1325 | 120 |
| 209 | 3300049459 | Ga0495678_001152 | Ga0495678_001152_12177_12584 | 120 |
| 210 | 3300053139 | Ga0500568_0078911 | Ga0500568_0078911_510_902 | 120 |
| 211 | iso_pu_bacteria | 2643221565 | 2643846128 | 120 |
| 212 | iso_pu_bacteria | 2849560528 | 2849563506 | 120 |
| 213 | iso_pu_bacteria | 2851153111 | 2851157886 | 120 |
| 214 | 2209111006 | 2214850756 | 2213895385 | 121 |
| 215 | 3300005288 | Ga0065714_10014890 | Ga0065714_100148902 | 121 |
| 216 | 3300005289 | Ga0065704_10583659 | Ga0065704_105836591 | 121 |
| 217 | 3300005328 | Ga0070676_10162671 | Ga0070676_101626713 | 121 |
| 218 | 3300005328 | Ga0070676_10401704 | Ga0070676_104017041 | 121 |
| 219 | 3300005329 | Ga0070683_100363425 | Ga0070683_1003634252 | 121 |
| 220 | 3300005330 | Ga0070690_100393593 | Ga0070690_1003935931 | 121 |
| 221 | 3300005331 | Ga0070670_100003347 | Ga0070670_1000033476 | 121 |
| 222 | 3300005331 | Ga0070670_100421784 | Ga0070670_1004217841 | 121 |
| 223 | 3300005334 | Ga0068869_101051392 | Ga0068869_1010513921 | 121 |
| 224 | 3300005334 | Ga0068869_101751541 | Ga0068869_1017515411 | 121 |
| 225 | 3300005335 | Ga0070666_10005529 | Ga0070666_100055298 | 121 |
| 226 | 3300005335 | Ga0070666_10208862 | Ga0070666_102088621 | 121 |
| 227 | 3300005336 | Ga0070680_100057430 | Ga0070680_1000574304 | 121 |
| 228 | 3300005336 | Ga0070680_101915847 | Ga0070680_1019158471 | 121 |
| 229 | 3300005337 | Ga0070682_100020338 | Ga0070682_1000203382 | 121 |
| 230 | 3300005337 | Ga0070682_101473187 | Ga0070682_1014731871 | 121 |
| 231 | 3300005338 | Ga0068868_100038627 | Ga0068868_1000386273 | 121 |
| 232 | 3300005338 | Ga0068868_100424460 | Ga0068868_1004244601 | 121 |
| 233 | 3300005338 | Ga0068868_100582735 | Ga0068868_1005827352 | 121 |
| 234 | 3300005340 | Ga0070689_100023332 | Ga0070689_1000233322 | 121 |
| 235 | 3300005340 | Ga0070689_100255578 | Ga0070689_1002555782 | 121 |
| 236 | 3300005341 | Ga0070691_10636117 | Ga0070691_106361172 | 121 |
| 237 | 3300005344 | Ga0070661_100090445 | Ga0070661_1000904452 | 121 |
| 238 | 3300005344 | Ga0070661_100283490 | Ga0070661_1002834902 | 121 |
| 239 | 3300005344 | Ga0070661_100440372 | Ga0070661_1004403721 | 121 |
| 240 | 3300005345 | Ga0070692_10595238 | Ga0070692_105952382 | 121 |
| 241 | 3300005347 | Ga0070668_100166802 | Ga0070668_1001668023 | 121 |
| 242 | 3300005347 | Ga0070668_100177451 | Ga0070668_1001774512 | 121 |
| 243 | 3300005354 | Ga0070675_100028633 | Ga0070675_1000286333 | 121 |
| 244 | 3300005354 | Ga0070675_100040864 | Ga0070675_1000408643 | 121 |
| 245 | 3300005355 | Ga0070671_100006876 | Ga0070671_1000068763 | 121 |
| 246 | 3300005356 | Ga0070674_100242059 | Ga0070674_1002420592 | 121 |
| 247 | 3300005356 | Ga0070674_100500579 | Ga0070674_1005005791 | 121 |
| 248 | 3300005356 | Ga0070674_100508834 | Ga0070674_1005088342 | 121 |
| 249 | 3300005356 | Ga0070674_100680090 | Ga0070674_1006800902 | 121 |
| 250 | 3300005364 | Ga0070673_100018919 | Ga0070673_1000189191 | 121 |
| 251 | 3300005364 | Ga0070673_100045737 | Ga0070673_1000457373 | 121 |
| 252 | 3300005364 | Ga0070673_100387190 | Ga0070673_1003871902 | 121 |
| 253 | 3300005364 | Ga0070673_100429997 | Ga0070673_1004299972 | 121 |
| 254 | 3300005364 | Ga0070673_101348922 | Ga0070673_1013489222 | 121 |
| 255 | 3300005365 | Ga0070688_100011841 | Ga0070688_1000118411 | 121 |
| 256 | 3300005366 | Ga0070659_100077706 | Ga0070659_1000777063 | 121 |
| 257 | 3300005366 | Ga0070659_100225409 | Ga0070659_1002254092 | 121 |
| 258 | 3300005366 | Ga0070659_100468208 | Ga0070659_1004682082 | 121 |
| 259 | 3300005367 | Ga0070667_100109225 | Ga0070667_1001092252 | 121 |
| 260 | 3300005367 | Ga0070667_100331251 | Ga0070667_1003312512 | 121 |
| 261 | 3300005434 | Ga0070709_10001257 | Ga0070709_1000125711 | 121 |
| 262 | 3300005434 | Ga0070709_11118234 | Ga0070709_111182342 | 121 |
| 263 | 3300005435 | Ga0070714_100264708 | Ga0070714_1002647082 | 121 |
| 264 | 3300005435 | Ga0070714_100940867 | Ga0070714_1009408672 | 121 |
| 265 | 3300005436 | Ga0070713_100000374 | Ga0070713_10000037416 | 121 |
| 266 | 3300005436 | Ga0070713_100161826 | Ga0070713_1001618262 | 121 |
| 267 | 3300005436 | Ga0070713_100193160 | Ga0070713_1001931601 | 121 |
| 268 | 3300005437 | Ga0070710_10022882 | Ga0070710_100228822 | 121 |
| 269 | 3300005437 | Ga0070710_10089362 | Ga0070710_100893622 | 121 |
| 270 | 3300005437 | Ga0070710_10271507 | Ga0070710_102715071 | 121 |
| 271 | 3300005439 | Ga0070711_100025801 | Ga0070711_1000258011 | 121 |
| 272 | 3300005439 | Ga0070711_100117107 | Ga0070711_1001171072 | 121 |
| 273 | 3300005439 | Ga0070711_100164344 | Ga0070711_1001643442 | 121 |
| 274 | 3300005440 | Ga0070705_100025237 | Ga0070705_1000252373 | 121 |
| 275 | 3300005440 | Ga0070705_100198912 | Ga0070705_1001989122 | 121 |
| 276 | 3300005440 | Ga0070705_100375552 | Ga0070705_1003755522 | 121 |
| 277 | 3300005444 | Ga0070694_100017044 | Ga0070694_1000170445 | 121 |
| 278 | 3300005444 | Ga0070694_100480475 | Ga0070694_1004804751 | 121 |
| 279 | 3300005455 | Ga0070663_100004752 | Ga0070663_1000047524 | 121 |
| 280 | 3300005455 | Ga0070663_100006279 | Ga0070663_1000062795 | 121 |
| 281 | 3300005455 | Ga0070663_100120852 | Ga0070663_1001208522 | 121 |
| 282 | 3300005455 | Ga0070663_100497881 | Ga0070663_1004978812 | 121 |
| 283 | 3300005455 | Ga0070663_100771108 | Ga0070663_1007711081 | 121 |
| 284 | 3300005456 | Ga0070678_100001680 | Ga0070678_1000016808 | 121 |
| 285 | 3300005456 | Ga0070678_100092383 | Ga0070678_1000923832 | 121 |
| 286 | 3300005456 | Ga0070678_100191340 | Ga0070678_1001913402 | 121 |
| 287 | 3300005456 | Ga0070678_100866919 | Ga0070678_1008669192 | 121 |
| 288 | 3300005456 | Ga0070678_101667579 | Ga0070678_1016675791 | 121 |
| 289 | 3300005457 | Ga0070662_100168705 | Ga0070662_1001687051 | 121 |
| 290 | 3300005457 | Ga0070662_100813318 | Ga0070662_1008133181 | 121 |
| 291 | 3300005457 | Ga0070662_101342486 | Ga0070662_1013424861 | 121 |
| 292 | 3300005457 | Ga0070662_101697874 | Ga0070662_1016978741 | 121 |
| 293 | 3300005458 | Ga0070681_10087903 | Ga0070681_100879031 | 121 |
| 294 | 3300005458 | Ga0070681_10211862 | Ga0070681_102118622 | 121 |
| 295 | 3300005459 | Ga0068867_100286247 | Ga0068867_1002862472 | 121 |
| 296 | 3300005466 | Ga0070685_10045113 | Ga0070685_100451132 | 121 |
| 297 | 3300005466 | Ga0070685_10923808 | Ga0070685_109238081 | 121 |
| 298 | 3300005468 | Ga0070707_100545061 | Ga0070707_1005450611 | 121 |
| 299 | 3300005530 | Ga0070679_100014128 | Ga0070679_1000141287 | 121 |
| 300 | 3300005530 | Ga0070679_100096085 | Ga0070679_1000960852 | 121 |
| 301 | 3300005535 | Ga0070684_100028831 | Ga0070684_1000288315 | 121 |
| 302 | 3300005539 | Ga0068853_100015623 | Ga0068853_1000156234 | 121 |
| 303 | 3300005539 | Ga0068853_101720981 | Ga0068853_1017209811 | 121 |
| 304 | 3300005543 | Ga0070672_100469277 | Ga0070672_1004692771 | 121 |
| 305 | 3300005544 | Ga0070686_100008801 | Ga0070686_1000088017 | 121 |
| 306 | 3300005544 | Ga0070686_100884531 | Ga0070686_1008845311 | 121 |
| 307 | 3300005544 | Ga0070686_101132796 | Ga0070686_1011327962 | 121 |
| 308 | 3300005545 | Ga0070695_100386328 | Ga0070695_1003863281 | 121 |
| 309 | 3300005545 | Ga0070695_100735282 | Ga0070695_1007352822 | 121 |
| 310 | 3300005546 | Ga0070696_100096185 | Ga0070696_1000961853 | 121 |
| 311 | 3300005547 | Ga0070693_100003700 | Ga0070693_1000037003 | 121 |
| 312 | 3300005547 | Ga0070693_100045294 | Ga0070693_1000452942 | 121 |
| 313 | 3300005548 | Ga0070665_100934358 | Ga0070665_1009343582 | 121 |
| 314 | 3300005548 | Ga0070665_102066152 | Ga0070665_1020661521 | 121 |
| 315 | 3300005549 | Ga0070704_100362004 | Ga0070704_1003620042 | 121 |
| 316 | 3300005563 | Ga0068855_100095497 | Ga0068855_1000954974 | 121 |
| 317 | 3300005564 | Ga0070664_100259116 | Ga0070664_1002591162 | 121 |
| 318 | 3300005564 | Ga0070664_100639438 | Ga0070664_1006394382 | 121 |
| 319 | 3300005564 | Ga0070664_101553732 | Ga0070664_1015537321 | 121 |
| 320 | 3300005578 | Ga0068854_100479261 | Ga0068854_1004792612 | 121 |
| 321 | 3300005614 | Ga0068856_100293887 | Ga0068856_1002938872 | 121 |
| 322 | 3300005614 | Ga0068856_100399720 | Ga0068856_1003997202 | 121 |
| 323 | 3300005614 | Ga0068856_100745133 | Ga0068856_1007451332 | 121 |
| 324 | 3300005614 | Ga0068856_101070301 | Ga0068856_1010703012 | 121 |
| 325 | 3300005615 | Ga0070702_100015364 | Ga0070702_1000153643 | 121 |
| 326 | 3300005617 | Ga0068859_100156223 | Ga0068859_1001562232 | 121 |
| 327 | 3300005618 | Ga0068864_100059734 | Ga0068864_1000597342 | 121 |
| 328 | 3300005718 | Ga0068866_10053271 | Ga0068866_100532712 | 121 |
| 329 | 3300005718 | Ga0068866_10407214 | Ga0068866_104072142 | 121 |
| 330 | 3300005718 | Ga0068866_11010074 | Ga0068866_110100741 | 121 |
| 331 | 3300005719 | Ga0068861_101251162 | Ga0068861_1012511622 | 121 |
| 332 | 3300005840 | Ga0068870_10195448 | Ga0068870_101954482 | 121 |
| 333 | 3300005842 | Ga0068858_100045177 | Ga0068858_1000451771 | 121 |
| 334 | 3300005842 | Ga0068858_100157469 | Ga0068858_1001574692 | 121 |
| 335 | 3300005842 | Ga0068858_100292027 | Ga0068858_1002920272 | 121 |
| 336 | 3300005842 | Ga0068858_100382227 | Ga0068858_1003822272 | 121 |
| 337 | 3300005843 | Ga0068860_100056891 | Ga0068860_1000568913 | 121 |
| 338 | 3300005844 | Ga0068862_102131832 | Ga0068862_1021318321 | 121 |
| 339 | 3300006028 | Ga0070717_10007141 | Ga0070717_100071412 | 121 |
| 340 | 3300006028 | Ga0070717_10273133 | Ga0070717_102731333 | 121 |
| 341 | 3300006163 | Ga0070715_10517003 | Ga0070715_105170031 | 121 |
| 342 | 3300006173 | Ga0070716_100281784 | Ga0070716_1002817842 | 121 |
| 343 | 3300006173 | Ga0070716_100293371 | Ga0070716_1002933712 | 121 |
| 344 | 3300006175 | Ga0070712_100059255 | Ga0070712_1000592553 | 121 |
| 345 | 3300006175 | Ga0070712_100106363 | Ga0070712_1001063632 | 121 |
| 346 | 3300006175 | Ga0070712_100586280 | Ga0070712_1005862802 | 121 |
| 347 | 3300006237 | Ga0097621_100015177 | Ga0097621_1000151775 | 121 |
| 348 | 3300006237 | Ga0097621_100071730 | Ga0097621_1000717301 | 121 |
| 349 | 3300006237 | Ga0097621_100410007 | Ga0097621_1004100072 | 121 |
| 350 | 3300006358 | Ga0068871_100005428 | Ga0068871_1000054287 | 121 |
| 351 | 3300006358 | Ga0068871_100095207 | Ga0068871_1000952072 | 121 |
| 352 | 3300006358 | Ga0068871_100216396 | Ga0068871_1002163962 | 121 |
| 353 | 3300006871 | Ga0075434_100208594 | Ga0075434_1002085942 | 121 |
| 354 | 3300006881 | Ga0068865_100067848 | Ga0068865_1000678483 | 121 |
| 355 | 3300006881 | Ga0068865_100427472 | Ga0068865_1004274722 | 121 |
| 356 | 3300006881 | Ga0068865_100780565 | Ga0068865_1007805652 | 121 |
| 357 | 3300006881 | Ga0068865_100794996 | Ga0068865_1007949962 | 121 |
| 358 | 3300006881 | Ga0068865_101062156 | Ga0068865_1010621561 | 121 |
| 359 | 3300006914 | Ga0075436_100102335 | Ga0075436_1001023352 | 121 |
| 360 | 3300006914 | Ga0075436_100488962 | Ga0075436_1004889622 | 121 |
| 361 | 3300006931 | Ga0097620_100156229 | Ga0097620_1001562293 | 121 |
| 362 | 3300009011 | Ga0105251_10003490 | Ga0105251_100034908 | 121 |
| 363 | 3300009011 | Ga0105251_10076536 | Ga0105251_100765362 | 121 |
| 364 | 3300009036 | Ga0105244_10111259 | Ga0105244_101112592 | 121 |
| 365 | 3300009093 | Ga0105240_10278491 | Ga0105240_102784913 | 121 |
| 366 | 3300009093 | Ga0105240_10820836 | Ga0105240_108208362 | 121 |
| 367 | 3300009098 | Ga0105245_10046365 | Ga0105245_100463651 | 121 |
| 368 | 3300009098 | Ga0105245_10768731 | Ga0105245_107687311 | 121 |
| 369 | 3300009098 | Ga0105245_10909330 | Ga0105245_109093301 | 121 |
| 370 | 3300009101 | Ga0105247_10219702 | Ga0105247_102197022 | 121 |
| 371 | 3300009101 | Ga0105247_10512269 | Ga0105247_105122692 | 121 |
| 372 | 3300009101 | Ga0105247_10595158 | Ga0105247_105951581 | 121 |
| 373 | 3300009148 | Ga0105243_10084054 | Ga0105243_100840543 | 121 |
| 374 | 3300009148 | Ga0105243_10377470 | Ga0105243_103774703 | 121 |
| 375 | 3300009148 | Ga0105243_11495491 | Ga0105243_114954911 | 121 |
| 376 | 3300009174 | Ga0105241_10051739 | Ga0105241_100517393 | 121 |
| 377 | 3300009174 | Ga0105241_10216234 | Ga0105241_102162342 | 121 |
| 378 | 3300009174 | Ga0105241_10327163 | Ga0105241_103271631 | 121 |
| 379 | 3300009176 | Ga0105242_10052542 | Ga0105242_100525425 | 121 |
| 380 | 3300009176 | Ga0105242_10060494 | Ga0105242_100604942 | 121 |
| 381 | 3300009176 | Ga0105242_10071848 | Ga0105242_100718483 | 121 |
| 382 | 3300009176 | Ga0105242_10956899 | Ga0105242_109568992 | 121 |
| 383 | 3300009177 | Ga0105248_10198325 | Ga0105248_101983252 | 121 |
| 384 | 3300009177 | Ga0105248_10458518 | Ga0105248_104585182 | 121 |
| 385 | 3300009177 | Ga0105248_11752089 | Ga0105248_117520891 | 121 |
| 386 | 3300009545 | Ga0105237_10125972 | Ga0105237_101259723 | 121 |
| 387 | 3300009545 | Ga0105237_10384688 | Ga0105237_103846882 | 121 |
| 388 | 3300009551 | Ga0105238_10073909 | Ga0105238_100739093 | 121 |
| 389 | 3300009551 | Ga0105238_10368596 | Ga0105238_103685961 | 121 |
| 390 | 3300009551 | Ga0105238_10852742 | Ga0105238_108527422 | 121 |
| 391 | 3300009553 | Ga0105249_10077845 | Ga0105249_100778453 | 121 |
| 392 | 3300009553 | Ga0105249_10187907 | Ga0105249_101879073 | 121 |
| 393 | 3300009553 | Ga0105249_13491419 | Ga0105249_134914191 | 121 |
| 394 | 3300010375 | Ga0105239_10110277 | Ga0105239_101102772 | 121 |
| 395 | 3300010375 | Ga0105239_10191679 | Ga0105239_101916792 | 121 |
| 396 | 3300010375 | Ga0105239_10308607 | Ga0105239_103086072 | 121 |
| 397 | 3300010375 | Ga0105239_10546437 | Ga0105239_105464372 | 121 |
| 398 | 3300010375 | Ga0105239_12890599 | Ga0105239_128905991 | 121 |
| 399 | 3300011119 | Ga0105246_10032880 | Ga0105246_100328803 | 121 |
| 400 | 3300011119 | Ga0105246_10205263 | Ga0105246_102052632 | 121 |
| 401 | 3300011119 | Ga0105246_10732624 | Ga0105246_107326242 | 121 |
| 402 | 3300012500 | Ga0157314_1005454 | Ga0157314_10054542 | 121 |
| 403 | 3300013100 | Ga0157373_10883073 | Ga0157373_108830731 | 121 |
| 404 | 3300013102 | Ga0157371_10226064 | Ga0157371_102260642 | 121 |
| 405 | 3300013102 | Ga0157371_11368106 | Ga0157371_113681061 | 121 |
| 406 | 3300013105 | Ga0157369_10227818 | Ga0157369_102278183 | 121 |
| 407 | 3300013296 | Ga0157374_10346892 | Ga0157374_103468921 | 121 |
| 408 | 3300013296 | Ga0157374_10729637 | Ga0157374_107296372 | 121 |
| 409 | 3300013297 | Ga0157378_10024975 | Ga0157378_100249752 | 121 |
| 410 | 3300013297 | Ga0157378_10028933 | Ga0157378_100289334 | 121 |
| 411 | 3300013297 | Ga0157378_10564098 | Ga0157378_105640982 | 121 |
| 412 | 3300013306 | Ga0163162_10214069 | Ga0163162_102140693 | 121 |
| 413 | 3300013306 | Ga0163162_10476432 | Ga0163162_104764322 | 121 |
| 414 | 3300013307 | Ga0157372_10177133 | Ga0157372_101771332 | 121 |
| 415 | 3300013308 | Ga0157375_10096569 | Ga0157375_100965693 | 121 |
| 416 | 3300013308 | Ga0157375_10428019 | Ga0157375_104280192 | 121 |
| 417 | 3300014325 | Ga0163163_10041194 | Ga0163163_100411944 | 121 |
| 418 | 3300014326 | Ga0157380_10225731 | Ga0157380_102257312 | 121 |
| 419 | 3300014497 | Ga0182008_10032593 | Ga0182008_100325933 | 121 |
| 420 | 3300014497 | Ga0182008_10859436 | Ga0182008_108594362 | 121 |
| 421 | 3300014968 | Ga0157379_10158612 | Ga0157379_101586123 | 121 |
| 422 | 3300014969 | Ga0157376_10109346 | Ga0157376_101093463 | 121 |
| 423 | 3300014969 | Ga0157376_10288237 | Ga0157376_102882371 | 121 |
| 424 | 3300014969 | Ga0157376_10410243 | Ga0157376_104102432 | 121 |
| 425 | 3300014969 | Ga0157376_12588404 | Ga0157376_125884041 | 121 |
| 426 | 3300015265 | Ga0182005_1012712 | Ga0182005_10127123 | 121 |
| 427 | 3300017792 | Ga0163161_10155334 | Ga0163161_101553342 | 121 |
| 428 | 3300017792 | Ga0163161_10308462 | Ga0163161_103084621 | 121 |
| 429 | 3300017792 | Ga0163161_10846124 | Ga0163161_108461241 | 121 |
| 430 | 3300020070 | Ga0206356_10275917 | Ga0206356_102759171 | 121 |
| 431 | 3300021361 | Ga0213872_10000200 | Ga0213872_1000020022 | 121 |
| 432 | 3300021361 | Ga0213872_10047353 | Ga0213872_100473532 | 121 |
| 433 | 3300025728 | Ga0207655_1005592 | Ga0207655_10055922 | 121 |
| 434 | 3300025735 | Ga0207713_1000243 | Ga0207713_100024364 | 121 |
| 435 | 3300025735 | Ga0207713_1006378 | Ga0207713_10063788 | 121 |
| 436 | 3300025898 | Ga0207692_10018584 | Ga0207692_100185843 | 121 |
| 437 | 3300025898 | Ga0207692_10130373 | Ga0207692_101303732 | 121 |
| 438 | 3300025899 | Ga0207642_10046105 | Ga0207642_100461051 | 121 |
| 439 | 3300025900 | Ga0207710_10049105 | Ga0207710_100491053 | 121 |
| 440 | 3300025900 | Ga0207710_10141056 | Ga0207710_101410562 | 121 |
| 441 | 3300025901 | Ga0207688_10009920 | Ga0207688_100099204 | 121 |
| 442 | 3300025903 | Ga0207680_10068729 | Ga0207680_100687293 | 121 |
| 443 | 3300025903 | Ga0207680_10228328 | Ga0207680_102283283 | 121 |
| 444 | 3300025904 | Ga0207647_10007334 | Ga0207647_100073344 | 121 |
| 445 | 3300025905 | Ga0207685_10101510 | Ga0207685_101015102 | 121 |
| 446 | 3300025906 | Ga0207699_10032006 | Ga0207699_100320063 | 121 |
| 447 | 3300025906 | Ga0207699_10050300 | Ga0207699_100503003 | 121 |
| 448 | 3300025906 | Ga0207699_10196074 | Ga0207699_101960741 | 121 |
| 449 | 3300025907 | Ga0207645_10065079 | Ga0207645_100650793 | 121 |
| 450 | 3300025907 | Ga0207645_10630041 | Ga0207645_106300411 | 121 |
| 451 | 3300025911 | Ga0207654_10131415 | Ga0207654_101314152 | 121 |
| 452 | 3300025911 | Ga0207654_10204484 | Ga0207654_102044842 | 121 |
| 453 | 3300025911 | Ga0207654_11229144 | Ga0207654_112291441 | 121 |
| 454 | 3300025912 | Ga0207707_10022287 | Ga0207707_100222877 | 121 |
| 455 | 3300025912 | Ga0207707_10166213 | Ga0207707_101662132 | 121 |
| 456 | 3300025913 | Ga0207695_10328974 | Ga0207695_103289742 | 121 |
| 457 | 3300025913 | Ga0207695_11094316 | Ga0207695_110943162 | 121 |
| 458 | 3300025914 | Ga0207671_10094841 | Ga0207671_100948414 | 121 |
| 459 | 3300025914 | Ga0207671_10254540 | Ga0207671_102545402 | 121 |
| 460 | 3300025914 | Ga0207671_10344692 | Ga0207671_103446921 | 121 |
| 461 | 3300025915 | Ga0207693_10019086 | Ga0207693_100190862 | 121 |
| 462 | 3300025915 | Ga0207693_10078213 | Ga0207693_100782132 | 121 |
| 463 | 3300025915 | Ga0207693_10864050 | Ga0207693_108640501 | 121 |
| 464 | 3300025915 | Ga0207693_10922971 | Ga0207693_109229711 | 121 |
| 465 | 3300025916 | Ga0207663_10059650 | Ga0207663_100596503 | 121 |
| 466 | 3300025916 | Ga0207663_10128641 | Ga0207663_101286412 | 121 |
| 467 | 3300025916 | Ga0207663_10586118 | Ga0207663_105861182 | 121 |
| 468 | 3300025917 | Ga0207660_10113593 | Ga0207660_101135932 | 121 |
| 469 | 3300025917 | Ga0207660_10190011 | Ga0207660_101900111 | 121 |
| 470 | 3300025917 | Ga0207660_11322970 | Ga0207660_113229701 | 121 |
| 471 | 3300025919 | Ga0207657_10013452 | Ga0207657_100134524 | 121 |
| 472 | 3300025920 | Ga0207649_10214582 | Ga0207649_102145822 | 121 |
| 473 | 3300025920 | Ga0207649_10352910 | Ga0207649_103529101 | 121 |
| 474 | 3300025921 | Ga0207652_10062545 | Ga0207652_100625453 | 121 |
| 475 | 3300025922 | Ga0207646_10613360 | Ga0207646_106133601 | 121 |
| 476 | 3300025924 | Ga0207694_10137815 | Ga0207694_101378151 | 121 |
| 477 | 3300025924 | Ga0207694_10671011 | Ga0207694_106710112 | 121 |
| 478 | 3300025925 | Ga0207650_10003393 | Ga0207650_100033939 | 121 |
| 479 | 3300025927 | Ga0207687_10015342 | Ga0207687_100153421 | 121 |
| 480 | 3300025927 | Ga0207687_10062423 | Ga0207687_100624232 | 121 |
| 481 | 3300025928 | Ga0207700_10004890 | Ga0207700_100048902 | 121 |
| 482 | 3300025928 | Ga0207700_10219630 | Ga0207700_102196303 | 121 |
| 483 | 3300025928 | Ga0207700_10587976 | Ga0207700_105879762 | 121 |
| 484 | 3300025929 | Ga0207664_10017822 | Ga0207664_100178228 | 121 |
| 485 | 3300025931 | Ga0207644_10006011 | Ga0207644_100060112 | 121 |
| 486 | 3300025931 | Ga0207644_10056236 | Ga0207644_100562363 | 121 |
| 487 | 3300025932 | Ga0207690_10159609 | Ga0207690_101596092 | 121 |
| 488 | 3300025933 | Ga0207706_10075392 | Ga0207706_100753923 | 121 |
| 489 | 3300025933 | Ga0207706_10514818 | Ga0207706_105148182 | 121 |
| 490 | 3300025933 | Ga0207706_10533288 | Ga0207706_105332882 | 121 |
| 491 | 3300025934 | Ga0207686_10197940 | Ga0207686_101979402 | 121 |
| 492 | 3300025934 | Ga0207686_10365618 | Ga0207686_103656182 | 121 |
| 493 | 3300025934 | Ga0207686_11409547 | Ga0207686_114095471 | 121 |
| 494 | 3300025936 | Ga0207670_10050284 | Ga0207670_100502844 | 121 |
| 495 | 3300025937 | Ga0207669_10129493 | Ga0207669_101294931 | 121 |
| 496 | 3300025938 | Ga0207704_10339513 | Ga0207704_103395132 | 121 |
| 497 | 3300025938 | Ga0207704_10629900 | Ga0207704_106299002 | 121 |
| 498 | 3300025938 | Ga0207704_11404798 | Ga0207704_114047981 | 121 |
| 499 | 3300025939 | Ga0207665_10009568 | Ga0207665_100095682 | 121 |
| 500 | 3300025939 | Ga0207665_10047429 | Ga0207665_100474293 | 121 |
| 501 | 3300025940 | Ga0207691_11719012 | Ga0207691_117190121 | 121 |
| 502 | 3300025941 | Ga0207711_10149269 | Ga0207711_101492692 | 121 |
| 503 | 3300025941 | Ga0207711_10265132 | Ga0207711_102651323 | 121 |
| 504 | 3300025941 | Ga0207711_10397571 | Ga0207711_103975712 | 121 |
| 505 | 3300025941 | Ga0207711_11319315 | Ga0207711_113193151 | 121 |
| 506 | 3300025942 | Ga0207689_10063790 | Ga0207689_100637904 | 121 |
| 507 | 3300025942 | Ga0207689_11097309 | Ga0207689_110973091 | 121 |
| 508 | 3300025944 | Ga0207661_10758085 | Ga0207661_107580851 | 121 |
| 509 | 3300025945 | Ga0207679_10037485 | Ga0207679_100374852 | 121 |
| 510 | 3300025945 | Ga0207679_10123058 | Ga0207679_101230582 | 121 |
| 511 | 3300025949 | Ga0207667_11460497 | Ga0207667_114604971 | 121 |
| 512 | 3300025960 | Ga0207651_10512526 | Ga0207651_105125262 | 121 |
| 513 | 3300025961 | Ga0207712_10232519 | Ga0207712_102325192 | 121 |
| 514 | 3300025961 | Ga0207712_11506306 | Ga0207712_115063061 | 121 |
| 515 | 3300025972 | Ga0207668_10126264 | Ga0207668_101262642 | 121 |
| 516 | 3300025972 | Ga0207668_10314182 | Ga0207668_103141821 | 121 |
| 517 | 3300025972 | Ga0207668_11098180 | Ga0207668_110981801 | 121 |
| 518 | 3300025981 | Ga0207640_10602058 | Ga0207640_106020582 | 121 |
| 519 | 3300025986 | Ga0207658_10049195 | Ga0207658_100491953 | 121 |
| 520 | 3300025986 | Ga0207658_10312853 | Ga0207658_103128532 | 121 |
| 521 | 3300026023 | Ga0207677_10032034 | Ga0207677_100320343 | 121 |
| 522 | 3300026035 | Ga0207703_10045571 | Ga0207703_100455712 | 121 |
| 523 | 3300026035 | Ga0207703_10356628 | Ga0207703_103566282 | 121 |
| 524 | 3300026035 | Ga0207703_10567789 | Ga0207703_105677892 | 121 |
| 525 | 3300026035 | Ga0207703_10651041 | Ga0207703_106510411 | 121 |
| 526 | 3300026041 | Ga0207639_10036106 | Ga0207639_100361064 | 121 |
| 527 | 3300026041 | Ga0207639_11599415 | Ga0207639_115994151 | 121 |
| 528 | 3300026067 | Ga0207678_10000262 | Ga0207678_1000026220 | 121 |
| 529 | 3300026067 | Ga0207678_10003507 | Ga0207678_100035078 | 121 |
| 530 | 3300026067 | Ga0207678_10028571 | Ga0207678_100285712 | 121 |
| 531 | 3300026067 | Ga0207678_10230494 | Ga0207678_102304942 | 121 |
| 532 | 3300026067 | Ga0207678_10683779 | Ga0207678_106837791 | 121 |
| 533 | 3300026075 | Ga0207708_10184872 | Ga0207708_101848721 | 121 |
| 534 | 3300026078 | Ga0207702_10821172 | Ga0207702_108211722 | 121 |
| 535 | 3300026078 | Ga0207702_11118528 | Ga0207702_111185282 | 121 |
| 536 | 3300026088 | Ga0207641_10062948 | Ga0207641_100629484 | 121 |
| 537 | 3300026088 | Ga0207641_10648662 | Ga0207641_106486622 | 121 |
| 538 | 3300026089 | Ga0207648_10818418 | Ga0207648_108184182 | 121 |
| 539 | 3300026089 | Ga0207648_10906607 | Ga0207648_109066072 | 121 |
| 540 | 3300026095 | Ga0207676_11464389 | Ga0207676_114643891 | 121 |
| 541 | 3300026116 | Ga0207674_11044445 | Ga0207674_110444452 | 121 |
| 542 | 3300026121 | Ga0207683_10007540 | Ga0207683_100075404 | 121 |
| 543 | 3300026121 | Ga0207683_10191881 | Ga0207683_101918812 | 121 |
| 544 | 3300026121 | Ga0207683_10221434 | Ga0207683_102214342 | 121 |
| 545 | 3300026121 | Ga0207683_10490671 | Ga0207683_104906712 | 121 |
| 546 | 3300026121 | Ga0207683_10692815 | Ga0207683_106928151 | 121 |
| 547 | 3300028379 | Ga0268266_10000419 | Ga0268266_100004193 | 121 |
| 548 | 3300028379 | Ga0268266_10007719 | Ga0268266_100077192 | 121 |
| 549 | 3300028379 | Ga0268266_10032170 | Ga0268266_100321701 | 121 |
| 550 | 3300028379 | Ga0268266_10259075 | Ga0268266_102590752 | 121 |
| 551 | 3300028381 | Ga0268264_10039627 | Ga0268264_100396273 | 121 |
| 552 | 3300028381 | Ga0268264_10062262 | Ga0268264_100622621 | 121 |
| 553 | 3300031616 | Ga0307508_10088081 | Ga0307508_100880812 | 121 |
| 554 | 3300033179 | Ga0307507_10213162 | Ga0307507_102131622 | 121 |
| 555 | 3300034816 | Ga0373930_0048085 | Ga0373930_0048085_279_644 | 121 |
| 556 | 3300034819 | Ga0373958_0023273 | Ga0373958_0023273_703_1068 | 121 |
| 557 | 3300035083 | Ga0373926_0054469 | Ga0373926_0054469_840_1205 | 121 |
| 558 | 3300035083 | Ga0373926_0143526 | Ga0373926_0143526_264_629 | 121 |
| 559 | 3300035084 | Ga0373928_0008886 | Ga0373928_0008886_626_991 | 121 |
| 560 | 3300035084 | Ga0373928_0050631 | Ga0373928_0050631_209_574 | 121 |
| 561 | 3300035084 | Ga0373928_0228974 | Ga0373928_0228974_162_527 | 121 |
| 562 | 3300035086 | Ga0373934_0060202 | Ga0373934_0060202_633_998 | 121 |
| 563 | 3300035088 | Ga0373940_0135916 | Ga0373940_0135916_36_401 | 121 |
| 564 | 3300035089 | Ga0373944_0002962 | Ga0373944_0002962_3266_3631 | 121 |
| 565 | 3300035089 | Ga0373944_0003642 | Ga0373944_0003642_3438_3863 | 121 |
| 566 | 3300035090 | Ga0373949_0007653 | Ga0373949_0007653_1928_2293 | 121 |
| 567 | 3300035091 | Ga0373951_0026913 | Ga0373951_0026913_178_543 | 121 |
| 568 | 3300035092 | Ga0373952_0073413 | Ga0373952_0073413_171_536 | 121 |
| 569 | 3300035111 | Ga0373923_0005750 | Ga0373923_0005750_2415_2780 | 121 |
| 570 | 3300035112 | Ga0373932_0058629 | Ga0373932_0058629_527_892 | 121 |
| 571 | 3300035113 | Ga0373936_0092759 | Ga0373936_0092759_472_897 | 121 |
| 572 | 3300035114 | Ga0373939_0041966 | Ga0373939_0041966_805_1170 | 121 |
| 573 | 3300035115 | Ga0373941_0012175 | Ga0373941_0012175_900_1265 | 121 |
| 574 | 3300035116 | Ga0373945_0012871 | Ga0373945_0012871_2267_2632 | 121 |
| 575 | 3300035116 | Ga0373945_0309630 | Ga0373945_0309630_48_413 | 121 |
| 576 | 3300035118 | Ga0373954_0007152 | Ga0373954_0007152_294_659 | 121 |
| 577 | 3300035119 | Ga0373956_0088696 | Ga0373956_0088696_761_1126 | 121 |
| 578 | 3300035120 | Ga0373957_0005746 | Ga0373957_0005746_2306_2671 | 121 |
| 579 | 3300035121 | Ga0373960_0242430 | Ga0373960_0242430_18_383 | 121 |
| 580 | 3300035170 | Ga0373943_0001305 | Ga0373943_0001305_7673_8038 | 121 |
| 581 | 3300035170 | Ga0373943_0010781 | Ga0373943_0010781_2531_2896 | 121 |
| 582 | 3300035171 | Ga0373946_0017815 | Ga0373946_0017815_644_1009 | 121 |
| 583 | 3300035171 | Ga0373946_0245829 | Ga0373946_0245829_331_696 | 121 |
| 584 | 3300035172 | Ga0373955_0062239 | Ga0373955_0062239_1481_1846 | 121 |
| 585 | 3300035172 | Ga0373955_0077543 | Ga0373955_0077543_912_1277 | 121 |
| 586 | 3300035241 | Ga0373961_0025714 | Ga0373961_0025714_29_394 | 121 |
| 587 | 3300035410 | Ga0373924_0171588 | Ga0373924_0171588_448_813 | 121 |
| 588 | 3300035691 | Ga0373931_0018223 | Ga0373931_0018223_312_677 | 121 |
| 589 | 3300035691 | Ga0373931_0064180 | Ga0373931_0064180_1272_1637 | 121 |
| 590 | 3300035692 | Ga0373935_0003279 | Ga0373935_0003279_7984_8349 | 121 |
| 591 | 3300035692 | Ga0373935_0162398 | Ga0373935_0162398_461_826 | 121 |
| 592 | 3300035692 | Ga0373935_0420121 | Ga0373935_0420121_19_384 | 121 |
| 593 | 3300035695 | Ga0373927_0037544 | Ga0373927_0037544_703_1068 | 121 |
| 594 | 3300035724 | Ga0373933_0011439 | Ga0373933_0011439_497_862 | 121 |
| 595 | 3300035724 | Ga0373933_0085990 | Ga0373933_0085990_1322_1687 | 121 |
| 596 | 3300035725 | Ga0373947_0000340 | Ga0373947_0000340_81_446 | 121 |
| 597 | 3300035725 | Ga0373947_0118844 | Ga0373947_0118844_268_633 | 121 |
| 598 | 3300035725 | Ga0373947_0438011 | Ga0373947_0438011_32_397 | 121 |
| 599 | 3300036401 | Ga0373937_0001302 | Ga0373937_0001302_6426_6791 | 121 |
| 600 | 3300036401 | Ga0373937_0044446 | Ga0373937_0044446_405_770 | 121 |
| 601 | 3300037068 | Ga0373925_0100828 | Ga0373925_0100828_1111_1476 | 121 |
| 602 | 3300039447 | Ga0436361_0446726 | Ga0436361_0446726_1250_1672 | 121 |
| 603 | 3300039447 | Ga0436361_1020246 | Ga0436361_1020246_1762_2148 | 121 |
| 604 | 3300041405 | Ga0439438_024115 | Ga0439438_024115_83_481 | 121 |
| 605 | 3300041411 | Ga0439466_0020787 | Ga0439466_0020787_1251_1631 | 121 |
| 606 | 3300042010 | Ga0439452_000239 | Ga0439452_000239_21683_22081 | 121 |
| 607 | 3300042013 | Ga0439456_031600 | Ga0439456_031600_107_505 | 121 |
| 608 | 3300042115 | Ga0450911_001897 | Ga0450911_001897_1061_1456 | 121 |
| 609 | 3300042137 | Ga0450902_007716 | Ga0450902_007716_1179_1559 | 121 |
| 610 | 3300042142 | Ga0450905_015150 | Ga0450905_015150_374_772 | 121 |
| 611 | 3300046452 | Ga0495617_001653 | Ga0495617_001653_757_1155 | 121 |
| 612 | 3300046452 | Ga0495617_011581 | Ga0495617_011581_1411_1836 | 121 |
| 613 | 3300046452 | Ga0495617_089138 | Ga0495617_089138_160_525 | 121 |
| 614 | 3300046453 | Ga0495627_021912 | Ga0495627_021912_851_1234 | 121 |
| 615 | 3300046454 | Ga0495592_0016424 | Ga0495592_0016424_400_765 | 121 |
| 616 | 3300046454 | Ga0495592_0027610 | Ga0495592_0027610_3811_4176 | 121 |
| 617 | 3300046455 | Ga0495603_0014210 | Ga0495603_0014210_1710_2075 | 121 |
| 618 | 3300046455 | Ga0495603_0026165 | Ga0495603_0026165_1898_2263 | 121 |
| 619 | 3300046455 | Ga0495603_0803066 | Ga0495603_0803066_50_415 | 121 |
| 620 | 3300046457 | Ga0495590_0003032 | Ga0495590_0003032_3378_3758 | 121 |
| 621 | 3300046457 | Ga0495590_0005330 | Ga0495590_0005330_4096_4494 | 121 |
| 622 | 3300046458 | Ga0495591_000049 | Ga0495591_000049_13107_13505 | 121 |
| 623 | 3300046458 | Ga0495591_005658 | Ga0495591_005658_2824_3249 | 121 |
| 624 | 3300046458 | Ga0495591_031438 | Ga0495591_031438_1163_1543 | 121 |
| 625 | 3300046459 | Ga0495629_0000253 | Ga0495629_0000253_42131_42496 | 121 |
| 626 | 3300046459 | Ga0495629_0031625 | Ga0495629_0031625_176_541 | 121 |
| 627 | 3300046459 | Ga0495629_0037747 | Ga0495629_0037747_2806_3171 | 121 |
| 628 | 3300046460 | Ga0495638_0003569 | Ga0495638_0003569_1928_2308 | 121 |
| 629 | 3300046460 | Ga0495638_0004165 | Ga0495638_0004165_4927_5319 | 121 |
| 630 | 3300046460 | Ga0495638_0009019 | Ga0495638_0009019_3544_3969 | 121 |
| 631 | 3300046460 | Ga0495638_0021382 | Ga0495638_0021382_3810_4190 | 121 |
| 632 | 3300046460 | Ga0495638_0026703 | Ga0495638_0026703_1254_1652 | 121 |
| 633 | 3300046461 | Ga0495641_0011612 | Ga0495641_0011612_2792_3157 | 121 |
| 634 | 3300046462 | Ga0495651_0007189 | Ga0495651_0007189_4850_5215 | 121 |
| 635 | 3300046463 | Ga0495653_0090847 | Ga0495653_0090847_467_832 | 121 |
| 636 | 3300046463 | Ga0495653_0117173 | Ga0495653_0117173_1394_1759 | 121 |
| 637 | 3300046471 | Ga0495650_0001581 | Ga0495650_0001581_11907_12287 | 121 |
| 638 | 3300046471 | Ga0495650_0002179 | Ga0495650_0002179_13382_13780 | 121 |
| 639 | 3300046471 | Ga0495650_0025453 | Ga0495650_0025453_1382_1807 | 121 |
| 640 | 3300046472 | Ga0495580_0027657 | Ga0495580_0027657_1000_1365 | 121 |
| 641 | 3300046472 | Ga0495580_0136359 | Ga0495580_0136359_1207_1572 | 121 |
| 642 | 3300046472 | Ga0495580_0523913 | Ga0495580_0523913_388_753 | 121 |
| 643 | 3300046473 | Ga0495582_0010154 | Ga0495582_0010154_3235_3600 | 121 |
| 644 | 3300046473 | Ga0495582_0489602 | Ga0495582_0489602_178_543 | 121 |
| 645 | 3300046474 | Ga0495605_0013312 | Ga0495605_0013312_2423_2848 | 121 |
| 646 | 3300046474 | Ga0495605_0179597 | Ga0495605_0179597_398_778 | 121 |
| 647 | 3300046475 | Ga0495639_0109856 | Ga0495639_0109856_327_692 | 121 |
| 648 | 3300046476 | Ga0495662_0003409 | Ga0495662_0003409_3267_3632 | 121 |
| 649 | 3300046477 | Ga0495664_0006671 | Ga0495664_0006671_2888_3253 | 121 |
| 650 | 3300046477 | Ga0495664_0060681 | Ga0495664_0060681_171_536 | 121 |
| 651 | 3300046491 | Ga0495584_0006144 | Ga0495584_0006144_5151_5531 | 121 |
| 652 | 3300046491 | Ga0495584_0013360 | Ga0495584_0013360_1190_1615 | 121 |
| 653 | 3300046491 | Ga0495584_0015763 | Ga0495584_0015763_881_1279 | 121 |
| 654 | 3300046491 | Ga0495584_0144796 | Ga0495584_0144796_49_414 | 121 |
| 655 | 3300046492 | Ga0495585_0000253 | Ga0495585_0000253_5344_5742 | 121 |
| 656 | 3300046492 | Ga0495585_0073623 | Ga0495585_0073623_1018_1398 | 121 |
| 657 | 3300046492 | Ga0495585_0080529 | Ga0495585_0080529_94_519 | 121 |
| 658 | 3300046499 | Ga0495594_0007741 | Ga0495594_0007741_1926_2291 | 121 |
| 659 | 3300046499 | Ga0495594_0049144 | Ga0495594_0049144_1497_1862 | 121 |
| 660 | 3300046499 | Ga0495594_0364149 | Ga0495594_0364149_420_785 | 121 |
| 661 | 3300046500 | Ga0495596_0000087 | Ga0495596_0000087_54515_54913 | 121 |
| 662 | 3300046501 | Ga0495607_0001995 | Ga0495607_0001995_3656_4036 | 121 |
| 663 | 3300046501 | Ga0495607_0009931 | Ga0495607_0009931_3068_3433 | 121 |
| 664 | 3300046501 | Ga0495607_0018731 | Ga0495607_0018731_2559_2984 | 121 |
| 665 | 3300046501 | Ga0495607_0025255 | Ga0495607_0025255_2632_3030 | 121 |
| 666 | 3300046501 | Ga0495607_0061864 | Ga0495607_0061864_658_1038 | 121 |
| 667 | 3300046507 | Ga0495606_0002612 | Ga0495606_0002612_17569_17994 | 121 |
| 668 | 3300046507 | Ga0495606_0057983 | Ga0495606_0057983_1494_1892 | 121 |
| 669 | 3300046511 | Ga0495608_0001048 | Ga0495608_0001048_18671_19036 | 121 |
| 670 | 3300046511 | Ga0495608_0029862 | Ga0495608_0029862_2713_3078 | 121 |
| 671 | 3300046511 | Ga0495608_0807682 | Ga0495608_0807682_82_447 | 121 |
| 672 | 3300046512 | Ga0495610_0003227 | Ga0495610_0003227_4076_4474 | 121 |
| 673 | 3300046512 | Ga0495610_0006343 | Ga0495610_0006343_6293_6673 | 121 |
| 674 | 3300046512 | Ga0495610_0011507 | Ga0495610_0011507_1413_1838 | 121 |
| 675 | 3300046513 | Ga0495616_0009808 | Ga0495616_0009808_546_926 | 121 |
| 676 | 3300046513 | Ga0495616_0024444 | Ga0495616_0024444_36_461 | 121 |
| 677 | 3300046514 | Ga0495618_0008923 | Ga0495618_0008923_1127_1492 | 121 |
| 678 | 3300046514 | Ga0495618_0489679 | Ga0495618_0489679_151_516 | 121 |
| 679 | 3300046515 | Ga0495620_0007747 | Ga0495620_0007747_2906_3331 | 121 |
| 680 | 3300046516 | Ga0495628_0162504 | Ga0495628_0162504_491_856 | 121 |
| 681 | 3300046517 | Ga0495630_0017170 | Ga0495630_0017170_4069_4434 | 121 |
| 682 | 3300046517 | Ga0495630_0651559 | Ga0495630_0651559_291_656 | 121 |
| 683 | 3300046518 | Ga0495631_0001808 | Ga0495631_0001808_1854_2252 | 121 |
| 684 | 3300046518 | Ga0495631_0027169 | Ga0495631_0027169_538_963 | 121 |
| 685 | 3300046518 | Ga0495631_0151049 | Ga0495631_0151049_36_422 | 121 |
| 686 | 3300046519 | Ga0495632_0001397 | Ga0495632_0001397_16495_16875 | 121 |
| 687 | 3300046519 | Ga0495632_0003535 | Ga0495632_0003535_1116_1496 | 121 |
| 688 | 3300046519 | Ga0495632_0019238 | Ga0495632_0019238_538_963 | 121 |
| 689 | 3300046520 | Ga0495637_0000401 | Ga0495637_0000401_21099_21497 | 121 |
| 690 | 3300046520 | Ga0495637_0052548 | Ga0495637_0052548_316_741 | 121 |
| 691 | 3300046522 | Ga0495643_0006541 | Ga0495643_0006541_1865_2287 | 121 |
| 692 | 3300046522 | Ga0495643_0022355 | Ga0495643_0022355_859_1239 | 121 |
| 693 | 3300046522 | Ga0495643_0047189 | Ga0495643_0047189_1361_1741 | 121 |
| 694 | 3300046522 | Ga0495643_0253479 | Ga0495643_0253479_324_749 | 121 |
| 695 | 3300046523 | Ga0495644_0000221 | Ga0495644_0000221_23090_23470 | 121 |
| 696 | 3300046523 | Ga0495644_0001523 | Ga0495644_0001523_7709_8107 | 121 |
| 697 | 3300046523 | Ga0495644_0002206 | Ga0495644_0002206_614_979 | 121 |
| 698 | 3300046523 | Ga0495644_0093846 | Ga0495644_0093846_17_442 | 121 |
| 699 | 3300046524 | Ga0495648_0009478 | Ga0495648_0009478_2633_3031 | 121 |
| 700 | 3300046526 | Ga0495666_0004756 | Ga0495666_0004756_3771_4136 | 121 |
| 701 | 3300046526 | Ga0495666_0295640 | Ga0495666_0295640_280_645 | 121 |
| 702 | 3300046529 | Ga0495652_0021402 | Ga0495652_0021402_5166_5531 | 121 |
| 703 | 3300046529 | Ga0495652_0059356 | Ga0495652_0059356_2058_2423 | 121 |
| 704 | 3300046529 | Ga0495652_0237092 | Ga0495652_0237092_147_512 | 121 |
| 705 | 3300046530 | Ga0495654_0001853 | Ga0495654_0001853_10319_10717 | 121 |
| 706 | 3300046530 | Ga0495654_0056029 | Ga0495654_0056029_980_1360 | 121 |
| 707 | 3300046531 | Ga0495665_0008307 | Ga0495665_0008307_5220_5585 | 121 |
| 708 | 3300046531 | Ga0495665_0215511 | Ga0495665_0215511_466_831 | 121 |
| 709 | 3300046533 | Ga0495640_0016874 | Ga0495640_0016874_2098_2463 | 121 |
| 710 | 3300046533 | Ga0495640_0019059 | Ga0495640_0019059_4551_4916 | 121 |
| 711 | 3300046533 | Ga0495640_0808386 | Ga0495640_0808386_98_463 | 121 |
| 712 | 3300046535 | Ga0495586_0031716 | Ga0495586_0031716_2370_2735 | 121 |
| 713 | 3300046535 | Ga0495586_0324291 | Ga0495586_0324291_103_468 | 121 |
| 714 | 3300046536 | Ga0495587_0009102 | Ga0495587_0009102_758_1123 | 121 |
| 715 | 3300046536 | Ga0495587_0021008 | Ga0495587_0021008_2479_2844 | 121 |
| 716 | 3300046538 | Ga0495609_0457562 | Ga0495609_0457562_113_478 | 121 |
| 717 | 3300046539 | Ga0495621_0039434 | Ga0495621_0039434_219_584 | 121 |
| 718 | 3300046542 | Ga0495597_0000205 | Ga0495597_0000205_41701_42081 | 121 |
| 719 | 3300046542 | Ga0495597_0005321 | Ga0495597_0005321_5227_5649 | 121 |
| 720 | 3300046542 | Ga0495597_0030706 | Ga0495597_0030706_1187_1585 | 121 |
| 721 | 3300046542 | Ga0495597_0030859 | Ga0495597_0030859_1233_1658 | 121 |
| 722 | 3300046542 | Ga0495597_0147296 | Ga0495597_0147296_262_642 | 121 |
| 723 | 3300046543 | Ga0495645_0169284 | Ga0495645_0169284_841_1206 | 121 |
| 724 | 3300046557 | Ga0495622_0027785 | Ga0495622_0027785_745_1110 | 121 |
| 725 | 3300046557 | Ga0495622_0041666 | Ga0495622_0041666_200_565 | 121 |
| 726 | 3300046558 | Ga0495633_0013957 | Ga0495633_0013957_457_822 | 121 |
| 727 | 3300046559 | Ga0495667_0005768 | Ga0495667_0005768_7103_7468 | 121 |
| 728 | 3300046559 | Ga0495667_0641098 | Ga0495667_0641098_110_475 | 121 |
| 729 | 3300046615 | Ga0495656_0001748 | Ga0495656_0001748_6308_6673 | 121 |
| 730 | 3300046615 | Ga0495656_0026011 | Ga0495656_0026011_727_1107 | 121 |
| 731 | 3300046616 | Ga0495668_0001686 | Ga0495668_0001686_9340_9738 | 121 |
| 732 | 3300046642 | Ga0495634_0058021 | Ga0495634_0058021_2041_2406 | 121 |
| 733 | 3300046642 | Ga0495634_0594727 | Ga0495634_0594727_103_468 | 121 |
| 734 | 3300046648 | Ga0495611_0005933 | Ga0495611_0005933_1882_2247 | 121 |
| 735 | 3300046648 | Ga0495611_0007091 | Ga0495611_0007091_4240_4620 | 121 |
| 736 | 3300046660 | Ga0495625_0005523 | Ga0495625_0005523_143_541 | 121 |
| 737 | 3300046660 | Ga0495625_0020820 | Ga0495625_0020820_2772_3197 | 121 |
| 738 | 3300046663 | Ga0495635_0025275 | Ga0495635_0025275_1858_2223 | 121 |
| 739 | 3300046663 | Ga0495635_0347652 | Ga0495635_0347652_103_468 | 121 |
| 740 | 3300046664 | Ga0495659_0013022 | Ga0495659_0013022_160_525 | 121 |
| 741 | 3300046665 | Ga0495661_0003804 | Ga0495661_0003804_4084_4482 | 121 |
| 742 | 3300046665 | Ga0495661_0008355 | Ga0495661_0008355_2785_3210 | 121 |
| 743 | 3300046665 | Ga0495661_0101133 | Ga0495661_0101133_120_500 | 121 |
| 744 | 3300046665 | Ga0495661_0150919 | Ga0495661_0150919_765_1145 | 121 |
| 745 | 3300046674 | Ga0495588_0002028 | Ga0495588_0002028_5719_6084 | 121 |
| 746 | 3300046674 | Ga0495588_0103635 | Ga0495588_0103635_1064_1429 | 121 |
| 747 | 3300046675 | Ga0495657_0040981 | Ga0495657_0040981_2701_3066 | 121 |
| 748 | 3300046678 | Ga0495599_0020425 | Ga0495599_0020425_841_1206 | 121 |
| 749 | 3300046678 | Ga0495599_0050524 | Ga0495599_0050524_335_700 | 121 |
| 750 | 3300046679 | Ga0495623_0086318 | Ga0495623_0086318_627_992 | 121 |
| 751 | 3300046680 | Ga0495646_0010572 | Ga0495646_0010572_2170_2535 | 121 |
| 752 | 3300046680 | Ga0495646_0017992 | Ga0495646_0017992_947_1312 | 121 |
| 753 | 3300046681 | Ga0495647_0029072 | Ga0495647_0029072_43_408 | 121 |
| 754 | 3300046683 | Ga0495658_0000473 | Ga0495658_0000473_304_669 | 121 |
| 755 | 3300046683 | Ga0495658_0075779 | Ga0495658_0075779_1240_1665 | 121 |
| 756 | 3300046689 | Ga0495613_0372036 | Ga0495613_0372036_154_519 | 121 |
| 757 | 3300046690 | Ga0495624_0005790 | Ga0495624_0005790_5061_5426 | 121 |
| 758 | 3300046690 | Ga0495624_0059190 | Ga0495624_0059190_1557_1922 | 121 |
| 759 | 3300046691 | Ga0495670_0005085 | Ga0495670_0005085_42_407 | 121 |
| 760 | 3300046691 | Ga0495670_0113876 | Ga0495670_0113876_635_1015 | 121 |
| 761 | 3300046691 | Ga0495670_0214606 | Ga0495670_0214606_92_490 | 121 |
| 762 | 3300046692 | Ga0495671_0016853 | Ga0495671_0016853_2766_3146 | 121 |
| 763 | 3300046692 | Ga0495671_0063070 | Ga0495671_0063070_1172_1597 | 121 |
| 764 | 3300046692 | Ga0495671_0165026 | Ga0495671_0165026_120_500 | 121 |
| 765 | 3300046692 | Ga0495671_0196879 | Ga0495671_0196879_398_763 | 121 |
| 766 | 3300046694 | Ga0495649_0000752 | Ga0495649_0000752_3366_3746 | 121 |
| 767 | 3300046694 | Ga0495649_0025265 | Ga0495649_0025265_2661_3086 | 121 |
| 768 | 3300046794 | Ga0495589_0001694 | Ga0495589_0001694_2195_2593 | 121 |
| 769 | 3300046794 | Ga0495589_0321341 | Ga0495589_0321341_120_485 | 121 |
| 770 | 3300046794 | Ga0495589_0520976 | Ga0495589_0520976_29_454 | 121 |
| 771 | 3300046809 | Ga0495600_0356527 | Ga0495600_0356527_48_413 | 121 |
| 772 | 3300046810 | Ga0495660_0005136 | Ga0495660_0005136_4124_4504 | 121 |
| 773 | 3300046810 | Ga0495660_0009910 | Ga0495660_0009910_1509_1889 | 121 |
| 774 | 3300046810 | Ga0495660_0022323 | Ga0495660_0022323_2090_2488 | 121 |
| 775 | 3300046810 | Ga0495660_0036915 | Ga0495660_0036915_1253_1675 | 121 |
| 776 | 3300047317 | Ga0495604_0002235 | Ga0495604_0002235_5941_6306 | 121 |
| 777 | 3300047319 | Ga0495674_0006763 | Ga0495674_0006763_3179_3544 | 121 |
| 778 | 3300047319 | Ga0495674_0043756 | Ga0495674_0043756_322_687 | 121 |
| 779 | 3300047320 | Ga0495672_0005068 | Ga0495672_0005068_9887_10267 | 121 |
| 780 | 3300047320 | Ga0495672_0007498 | Ga0495672_0007498_5834_6214 | 121 |
| 781 | 3300047321 | Ga0495676_0656338 | Ga0495676_0656338_175_540 | 121 |
| 782 | 3300047322 | Ga0495680_0012645 | Ga0495680_0012645_6544_6909 | 121 |
| 783 | 3300047322 | Ga0495680_0039115 | Ga0495680_0039115_980_1345 | 121 |
| 784 | 3300047322 | Ga0495680_0458416 | Ga0495680_0458416_137_502 | 121 |
| 785 | 3300047323 | Ga0495683_0013942 | Ga0495683_0013942_451_831 | 121 |
| 786 | 3300047323 | Ga0495683_0019232 | Ga0495683_0019232_112_510 | 121 |
| 787 | 3300047323 | Ga0495683_0295338 | Ga0495683_0295338_137_562 | 121 |
| 788 | 3300047444 | Ga0495675_0002904 | Ga0495675_0002904_6675_7040 | 121 |
| 789 | 3300047445 | Ga0495677_0040783 | Ga0495677_0040783_319_699 | 121 |
| 790 | 3300047446 | Ga0495679_000894 | Ga0495679_000894_7082_7480 | 121 |
| 791 | 3300047446 | Ga0495679_004604 | Ga0495679_004604_5270_5695 | 121 |
| 792 | 3300047446 | Ga0495679_028588 | Ga0495679_028588_1075_1440 | 121 |
| 793 | 3300047469 | Ga0495673_0001220 | Ga0495673_0001220_18340_18765 | 121 |
| 794 | 3300047469 | Ga0495673_0002461 | Ga0495673_0002461_2879_3304 | 121 |
| 795 | 3300047469 | Ga0495673_0006969 | Ga0495673_0006969_454_834 | 121 |
| 796 | 3300047470 | Ga0495681_0000460 | Ga0495681_0000460_7878_8276 | 121 |
| 797 | 3300047470 | Ga0495681_0003684 | Ga0495681_0003684_3121_3501 | 121 |
| 798 | 3300047470 | Ga0495681_0012817 | Ga0495681_0012817_1246_1671 | 121 |
| 799 | 3300047470 | Ga0495681_0120520 | Ga0495681_0120520_705_1103 | 121 |
| 800 | 3300047471 | Ga0495684_0146629 | Ga0495684_0146629_104_469 | 121 |
| 801 | 3300047471 | Ga0495684_0152628 | Ga0495684_0152628_283_648 | 121 |
| 802 | 3300047471 | Ga0495684_0643206 | Ga0495684_0643206_38_403 | 121 |
| 803 | 3300047472 | Ga0495686_0026767 | Ga0495686_0026767_261_641 | 121 |
| 804 | 3300047472 | Ga0495686_0033044 | Ga0495686_0033044_600_998 | 121 |
| 805 | 3300047472 | Ga0495686_0043400 | Ga0495686_0043400_774_1199 | 121 |
| 806 | 3300047673 | Ga0495593_0004020 | Ga0495593_0004020_5043_5408 | 121 |
| 807 | 3300047673 | Ga0495593_0038512 | Ga0495593_0038512_1186_1551 | 121 |
| 808 | 3300047673 | Ga0495593_0099094 | Ga0495593_0099094_370_735 | 121 |
| 809 | 3300048088 | Ga0495602_0001451 | Ga0495602_0001451_17759_18124 | 121 |
| 810 | 3300048089 | Ga0495614_0139729 | Ga0495614_0139729_431_796 | 121 |
| 811 | 3300048091 | Ga0495626_0000057 | Ga0495626_0000057_8989_9387 | 121 |
| 812 | 3300048091 | Ga0495626_0000065 | Ga0495626_0000065_101889_102314 | 121 |
| 813 | 3300048903 | Ga0496100_0013607 | Ga0496100_0013607_3915_4280 | 121 |
| 814 | 3300048903 | Ga0496100_0107976 | Ga0496100_0107976_1527_1904 | 121 |
| 815 | 3300048903 | Ga0496100_0390232 | Ga0496100_0390232_382_747 | 121 |
| 816 | 3300048904 | Ga0496101_0001165 | Ga0496101_0001165_5758_6123 | 121 |
| 817 | 3300048904 | Ga0496101_0947373 | Ga0496101_0947373_174_539 | 121 |
| 818 | 3300048905 | Ga0496102_0005341 | Ga0496102_0005341_4177_4542 | 121 |
| 819 | 3300048905 | Ga0496102_0475672 | Ga0496102_0475672_584_949 | 121 |
| 820 | 3300048906 | Ga0496103_0157425 | Ga0496103_0157425_424_789 | 121 |
| 821 | 3300048906 | Ga0496103_0262405 | Ga0496103_0262405_325_690 | 121 |
| 822 | 3300048907 | Ga0496104_0015669 | Ga0496104_0015669_2686_3051 | 121 |
| 823 | 3300048907 | Ga0496104_0688144 | Ga0496104_0688144_312_677 | 121 |
| 824 | 3300048908 | Ga0496105_0121713 | Ga0496105_0121713_540_905 | 121 |
| 825 | 3300048908 | Ga0496105_0674625 | Ga0496105_0674625_300_665 | 121 |
| 826 | 3300048909 | Ga0496106_0015809 | Ga0496106_0015809_2644_3009 | 121 |
| 827 | 3300048909 | Ga0496106_0184893 | Ga0496106_0184893_1154_1519 | 121 |
| 828 | 3300048910 | Ga0496107_0035626 | Ga0496107_0035626_1682_2047 | 121 |
| 829 | 3300048910 | Ga0496107_0049494 | Ga0496107_0049494_1888_2253 | 121 |
| 830 | 3300048911 | Ga0496108_0229662 | Ga0496108_0229662_312_677 | 121 |
| 831 | 3300048911 | Ga0496108_0567087 | Ga0496108_0567087_444_809 | 121 |
| 832 | 3300048912 | Ga0496109_0071006 | Ga0496109_0071006_2674_3039 | 121 |
| 833 | 3300048912 | Ga0496109_0078310 | Ga0496109_0078310_312_677 | 121 |
| 834 | 3300048912 | Ga0496109_0136382 | Ga0496109_0136382_699_1106 | 121 |
| 835 | 3300048913 | Ga0496110_0019494 | Ga0496110_0019494_2367_2732 | 121 |
| 836 | 3300048913 | Ga0496110_0096810 | Ga0496110_0096810_2237_2617 | 121 |
| 837 | 3300048913 | Ga0496110_0215110 | Ga0496110_0215110_872_1237 | 121 |
| 838 | 3300048913 | Ga0496110_0578168 | Ga0496110_0578168_326_703 | 121 |
| 839 | 3300048914 | Ga0496111_0020228 | Ga0496111_0020228_3194_3559 | 121 |
| 840 | 3300048914 | Ga0496111_0637666 | Ga0496111_0637666_95_472 | 121 |
| 841 | 3300048915 | Ga0496112_0011859 | Ga0496112_0011859_7306_7671 | 121 |
| 842 | 3300048915 | Ga0496112_0087029 | Ga0496112_0087029_904_1311 | 121 |
| 843 | 3300048915 | Ga0496112_0802620 | Ga0496112_0802620_459_824 | 121 |
| 844 | 3300048915 | Ga0496112_1844484 | Ga0496112_1844484_132_497 | 121 |
| 845 | 3300048916 | Ga0496113_0163836 | Ga0496113_0163836_505_870 | 121 |
| 846 | 3300048917 | Ga0496114_0200540 | Ga0496114_0200540_505_870 | 121 |
| 847 | 3300048917 | Ga0496114_0374920 | Ga0496114_0374920_720_1085 | 121 |
| 848 | 3300048918 | Ga0496115_0113999 | Ga0496115_0113999_1007_1372 | 121 |
| 849 | 3300048924 | Ga0496121_0058560 | Ga0496121_0058560_2541_2924 | 121 |
| 850 | 3300048924 | Ga0496121_0259666 | Ga0496121_0259666_435_800 | 121 |
| 851 | 3300048925 | Ga0496122_0000043 | Ga0496122_0000043_245395_245778 | 121 |
| 852 | 3300048926 | Ga0496123_0000090 | Ga0496123_0000090_34549_34932 | 121 |
| 853 | 3300048927 | Ga0496124_0005631 | Ga0496124_0005631_10265_10645 | 121 |
| 854 | 3300048928 | Ga0496125_0203815 | Ga0496125_0203815_299_664 | 121 |
| 855 | 3300049459 | Ga0495678_001121 | Ga0495678_001121_12012_12392 | 121 |
| 856 | 3300049459 | Ga0495678_007757 | Ga0495678_007757_3337_3717 | 121 |
| 857 | 3300049459 | Ga0495678_029261 | Ga0495678_029261_1400_1825 | 121 |
| 858 | 3300049460 | Ga0495682_0101678 | Ga0495682_0101678_361_759 | 121 |
| 859 | 3300049593 | Ga0501077_0472141 | Ga0501077_0472141_26_403 | 121 |
| 860 | 3300050496 | nmdc:mga07m45_449116_c1 | nmdc:mga07m45_449116_c1_15_401 | 121 |
| 861 | 3300050511 | nmdc:mga08y16_296601_c1 | nmdc:mga08y16_296601_c1_688_1053 | 121 |
| 862 | 3300050512 | nmdc:mga0n895_329652_c1 | nmdc:mga0n895_329652_c1_259_624 | 121 |
| 863 | 3300050513 | nmdc:mga0rr50_61528_c1 | nmdc:mga0rr50_61528_c1_2414_2779 | 121 |
| 864 | 3300050514 | nmdc:mga08x19_58563_c1 | nmdc:mga08x19_58563_c1_67_432 | 121 |
| 865 | 3300053077 | Ga0495601_0000413 | Ga0495601_0000413_6420_6785 | 121 |
| 866 | 3300053077 | Ga0495601_0019631 | Ga0495601_0019631_841_1206 | 121 |
| 867 | 3300053078 | Ga0495612_0035714 | Ga0495612_0035714_1531_1896 | 121 |
| 868 | 3300053078 | Ga0495612_0042296 | Ga0495612_0042296_433_798 | 121 |
| 869 | 3300053084 | Ga0495595_0006073 | Ga0495595_0006073_1189_1554 | 121 |
| 870 | 3300053084 | Ga0495595_0090096 | Ga0495595_0090096_384_749 | 121 |
| 871 | 3300053085 | Ga0495619_0001679 | Ga0495619_0001679_7915_8280 | 121 |
| 872 | 3300053085 | Ga0495619_0002856 | Ga0495619_0002856_780_1145 | 121 |
| 873 | 3300053085 | Ga0495619_0013291 | Ga0495619_0013291_1615_1980 | 121 |
| 874 | 3300053090 | Ga0500646_0068953 | Ga0500646_0068953_107_499 | 121 |
| 875 | 3300053118 | Ga0500594_0160864 | Ga0500594_0160864_181_567 | 121 |
| 876 | 3300053134 | Ga0500658_0073758 | Ga0500658_0073758_986_1372 | 121 |
| 877 | 3300053142 | Ga0500577_0114797 | Ga0500577_0114797_703_1095 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zn2-assembly1.cif.gz_A | low resolution structure of response regulator styr | 0.93 | 2 | 120 |
| 7w9h-assembly1.cif.gz_A | crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa | 0.9241 | 2 | 115 |
| 3f7a-assembly1.cif.gz_B | structure of orthorhombic crystal form of pseudomonas aeruginosa rssb | 0.9236 | 1 | 119 |
| 2b1j-assembly1.cif.gz_A | crystal structure of unphosphorylated chey bound to the n-terminus of flim | 0.9224 | 2 | 119 |
| 1xhf-assembly1.cif.gz_A | crystal structure of the bef3-activated receiver domain of redox response regulator arca | 0.9222 | 1 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9501 | 2 | 78 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9403 | 1 | 81 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9336 | 3 | 81 | 3.40.50.2300 |
| af_P0AFU4_2_125_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9335 | 1 | 121 | 3.40.50.2300 |
| af_P71814_19_100_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9314 | 3 | 81 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G6X5H5-F1-model_v4 | Response regulator | 0.9999 | 2 | 118 |
GO:0000160
|
| AF-A0A127EUS4-F1-model_v4 | Two-component response regulator | 0.9998 | 2 | 119 |
GO:0000160
|
| AF-A0A560M0H5-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9977 | 2 | 118 |
GO:0000160
|
| AF-A0A2A2V2Z7-F1-model_v4 | Two-component system response regulator | 0.9971 | 2 | 120 |
GO:0000160
|
| AF-A0A1H5LBM1-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9971 | 1 | 117 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar