F484382

General Info

Members Datasets Scaffolds Average Seq Length
877 393 864 125

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100161826|Ga0070713_1001618262
Length 141
Sequence VHIRAEDLINLRPRISNLSKMPVIAIVDDDESFRRATTSFVRSLGYGTAAFDSAEAFLKSERINDADCLITDVQMPGMTGIELQGRLIAQGHSLPVIFITAFPEMKARAQALADGAIGFLAKPFDDKGLIQCLDEALARAA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
4 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
5 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
6 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
7 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
8 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
9 2849560528 Caulobacter zeae 410 Isolate Unclassified
10 2851153111 Caulobacter radicis 736 Isolate Unclassified
11 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
12 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
13 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
247 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
248 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
249 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
250 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
251 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
252 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
370 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
371 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
387 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.46
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.34
Rhizoplane 5.82
Rhizosphere 89.28
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214850756 2209111006 Bacteria 1649
2 Ga0055530_10001135 3300003791 Bacteria 20743
3 Ga0055540_1000008 3300003792 Bacteria 309635
4 Ga0055531_10000242 3300003794 Bacteria 59638
5 Ga0065714_10014890 3300005288 Bacteria 2397
6 Ga0065714_10065188 3300005288 Bacteria 12118
7 Ga0065704_10583659 3300005289 Bacteria 616
8 Ga0070676_10162671 3300005328 Bacteria 1438
9 Ga0070676_10401704 3300005328 Bacteria 953
10 Ga0070683_100363425 3300005329 Bacteria 1378
11 Ga0070690_100393593 3300005330 Bacteria 1016
12 Ga0070670_100003347 3300005331 Bacteria 13269
13 Ga0070670_100421784 3300005331 Bacteria 1179
14 Ga0068869_101051392 3300005334 Bacteria 711
15 Ga0068869_101751541 3300005334 Bacteria 555
16 Ga0070666_10005529 3300005335 Bacteria 7752
17 Ga0070666_10208862 3300005335 Bacteria 1375
18 Ga0070680_100057430 3300005336 Bacteria 3182
19 Ga0070680_101915847 3300005336 Unclassified 514
20 Ga0070682_100020338 3300005337 Bacteria 3905
21 Ga0070682_101473187 3300005337 Bacteria 584
22 Ga0068868_100038627 3300005338 Bacteria 3706
23 Ga0068868_100424460 3300005338 Bacteria 1152
24 Ga0068868_100582735 3300005338 Bacteria 989
25 Ga0070689_100023332 3300005340 Bacteria 4630
26 Ga0070689_100255578 3300005340 Bacteria 1447
27 Ga0070691_10636117 3300005341 Bacteria 634
28 Ga0070661_100090445 3300005344 Bacteria 2267
29 Ga0070661_100283490 3300005344 Unclassified 1286
30 Ga0070661_100440372 3300005344 Bacteria 1035
31 Ga0070692_10595238 3300005345 Bacteria 731
32 Ga0070668_100166802 3300005347 Bacteria 1790
33 Ga0070668_100177451 3300005347 Bacteria 1738
34 Ga0070675_100028633 3300005354 Bacteria 4484
35 Ga0070675_100040864 3300005354 Bacteria 3788
36 Ga0070671_100006876 3300005355 Bacteria 9110
37 Ga0070674_100242059 3300005356 Bacteria 1413
38 Ga0070674_100500579 3300005356 Bacteria 1012
39 Ga0070674_100508834 3300005356 Bacteria 1004
40 Ga0070674_100680090 3300005356 Unclassified 878
41 Ga0070673_100018919 3300005364 Bacteria 4936
42 Ga0070673_100045737 3300005364 Bacteria 3396
43 Ga0070673_100387190 3300005364 Bacteria 1248
44 Ga0070673_100429997 3300005364 Bacteria 1185
45 Ga0070673_101348922 3300005364 Bacteria 670
46 Ga0070688_100011841 3300005365 Bacteria 4865
47 Ga0070659_100077706 3300005366 Bacteria 2648
48 Ga0070659_100225409 3300005366 Bacteria 1548
49 Ga0070659_100468208 3300005366 Bacteria 1071
50 Ga0070667_100109225 3300005367 Bacteria 2397
51 Ga0070667_100331251 3300005367 Unclassified 1375
52 Ga0070709_10001257 3300005434 Bacteria 13866
53 Ga0070709_10138798 3300005434 Bacteria 1668
54 Ga0070709_11118234 3300005434 Bacteria 631
55 Ga0070714_100264708 3300005435 Bacteria 1593
56 Ga0070714_100940867 3300005435 Unclassified 840
57 Ga0070713_100000374 3300005436 Bacteria 28680
58 Ga0070713_100161826 3300005436 Unclassified 1998
59 Ga0070713_100193160 3300005436 Bacteria 1835
60 Ga0070710_10022882 3300005437 Bacteria 3276
61 Ga0070710_10089362 3300005437 Bacteria 1814
62 Ga0070710_10271507 3300005437 Bacteria 1097
63 Ga0070711_100025801 3300005439 Bacteria 3847
64 Ga0070711_100117107 3300005439 Bacteria 1964
65 Ga0070711_100164344 3300005439 Bacteria 1686
66 Ga0070705_100025237 3300005440 Bacteria 3220
67 Ga0070705_100198912 3300005440 Unclassified 1372
68 Ga0070705_100375552 3300005440 Bacteria 1045
69 Ga0070700_100520759 3300005441 Unclassified 918
70 Ga0070694_100017044 3300005444 Bacteria 4585
71 Ga0070694_100480475 3300005444 Bacteria 986
72 Ga0070663_100004752 3300005455 Bacteria 8018
73 Ga0070663_100006279 3300005455 Bacteria 7130
74 Ga0070663_100120852 3300005455 Bacteria 1978
75 Ga0070663_100497881 3300005455 Bacteria 1011
76 Ga0070663_100771108 3300005455 Bacteria 823
77 Ga0070678_100001680 3300005456 Bacteria 11863
78 Ga0070678_100092383 3300005456 Bacteria 2325
79 Ga0070678_100191340 3300005456 Bacteria 1682
80 Ga0070678_100866919 3300005456 Bacteria 824
81 Ga0070678_101667579 3300005456 Unclassified 599
82 Ga0070662_100168705 3300005457 Unclassified 1717
83 Ga0070662_100813318 3300005457 Unclassified 795
84 Ga0070662_101342486 3300005457 Bacteria 616
85 Ga0070662_101697874 3300005457 Bacteria 545
86 Ga0070681_10087903 3300005458 Bacteria 3060
87 Ga0070681_10211862 3300005458 Bacteria 1853
88 Ga0068867_100286247 3300005459 Bacteria 1353
89 Ga0070685_10045113 3300005466 Bacteria 2526
90 Ga0070685_10923808 3300005466 Unclassified 651
91 Ga0070707_100545061 3300005468 Bacteria 1122
92 Ga0070679_100014128 3300005530 Bacteria 7658
93 Ga0070679_100096085 3300005530 Bacteria 2951
94 Ga0070684_100028831 3300005535 Bacteria 4698
95 Ga0068853_100015623 3300005539 Bacteria 6236
96 Ga0068853_101720981 3300005539 Unclassified 608
97 Ga0070672_100469277 3300005543 Bacteria 1086
98 Ga0070686_100008801 3300005544 Bacteria 5657
99 Ga0070686_100884531 3300005544 Unclassified 726
100 Ga0070686_101132796 3300005544 Unclassified 647
101 Ga0070695_100386328 3300005545 Bacteria 1058
102 Ga0070695_100735282 3300005545 Unclassified 786
103 Ga0070696_100096185 3300005546 Bacteria 2116
104 Ga0070693_100003700 3300005547 Bacteria 7150
105 Ga0070693_100045294 3300005547 Bacteria 2493
106 Ga0070665_100009597 3300005548 Bacteria 9789
107 Ga0070665_100934358 3300005548 Bacteria 880
108 Ga0070665_102066152 3300005548 Unclassified 574
109 Ga0070704_100362004 3300005549 Bacteria 1227
110 Ga0068855_100095497 3300005563 Bacteria 3426
111 Ga0070664_100259116 3300005564 Bacteria 1565
112 Ga0070664_100639438 3300005564 Bacteria 988
113 Ga0070664_101553732 3300005564 Bacteria 626
114 Ga0068854_100479261 3300005578 Unclassified 1044
115 Ga0068856_100293887 3300005614 Unclassified 1642
116 Ga0068856_100399720 3300005614 Unclassified 1394
117 Ga0068856_100745133 3300005614 Unclassified 1000
118 Ga0068856_101070301 3300005614 Bacteria 824
119 Ga0070702_100015364 3300005615 Bacteria 3908
120 Ga0068859_100156223 3300005617 Bacteria 2358
121 Ga0068864_100059734 3300005618 Bacteria 3299
122 Ga0068866_10053271 3300005718 Bacteria 2068
123 Ga0068866_10407214 3300005718 Bacteria 879
124 Ga0068866_11010074 3300005718 Unclassified 591
125 Ga0068861_101251162 3300005719 Bacteria 720
126 Ga0068870_10195448 3300005840 Bacteria 1223
127 Ga0068858_100045177 3300005842 Bacteria 4082
128 Ga0068858_100157469 3300005842 Bacteria 2137
129 Ga0068858_100292027 3300005842 Unclassified 1554
130 Ga0068858_100382227 3300005842 Bacteria 1351
131 Ga0068860_100056891 3300005843 Bacteria 3717
132 Ga0068862_102131832 3300005844 Bacteria 572
133 Ga0081540_1076267 3300005983 Bacteria 1528
134 Ga0070717_10007141 3300006028 Bacteria 8277
135 Ga0070717_10273133 3300006028 Bacteria 1497
136 Ga0070715_10517003 3300006163 Unclassified 686
137 Ga0070716_100281784 3300006173 Bacteria 1147
138 Ga0070716_100293371 3300006173 Bacteria 1128
139 Ga0070712_100059255 3300006175 Bacteria 2696
140 Ga0070712_100106363 3300006175 Bacteria 2085
141 Ga0070712_100586280 3300006175 Bacteria 942
142 Ga0097621_100015177 3300006237 Bacteria 5787
143 Ga0097621_100071730 3300006237 Bacteria 2863
144 Ga0097621_100410007 3300006237 Bacteria 1214
145 Ga0068871_100005428 3300006358 Bacteria 8937
146 Ga0068871_100095207 3300006358 Bacteria 2486
147 Ga0068871_100216396 3300006358 Bacteria 1658
148 Ga0075430_100000026 3300006846 Bacteria 78833
149 Ga0075431_100000451 3300006847 Bacteria 33773
150 Ga0075433_10007117 3300006852 Bacteria 8857
151 Ga0075434_100000110 3300006871 Bacteria 46873
152 Ga0075434_100208594 3300006871 Bacteria 1974
153 Ga0075429_100000247 3300006880 Bacteria 37266
154 Ga0068865_100067848 3300006881 Bacteria 2520
155 Ga0068865_100427472 3300006881 Bacteria 1090
156 Ga0068865_100780565 3300006881 Bacteria 823
157 Ga0068865_100794996 3300006881 Bacteria 816
158 Ga0068865_101062156 3300006881 Unclassified 712
159 Ga0075436_100102335 3300006914 Bacteria 1995
160 Ga0075436_100488962 3300006914 Bacteria 899
161 Ga0075436_100939538 3300006914 Bacteria 648
162 Ga0097620_100156229 3300006931 Bacteria 2358
163 Ga0079104_1051120 3300006946 Bacteria 920
164 Ga0075435_100039007 3300007076 Bacteria 3790
165 Ga0075435_100105078 3300007076 Bacteria 2344
166 Ga0105251_10003490 3300009011 Bacteria 11387
167 Ga0105251_10076536 3300009011 Bacteria 1553
168 Ga0105244_10111259 3300009036 Bacteria 1332
169 Ga0105250_10001249 3300009092 Bacteria 14082
170 Ga0105240_10256119 3300009093 Bacteria 2021
171 Ga0105240_10278491 3300009093 Bacteria 1922
172 Ga0105240_10820836 3300009093 Bacteria 1006
173 Ga0111539_10000337 3300009094 Bacteria 57733
174 Ga0105245_10046365 3300009098 Bacteria 3884
175 Ga0105245_10595789 3300009098 Bacteria 1131
176 Ga0105245_10768731 3300009098 Bacteria 1000
177 Ga0105245_10909330 3300009098 Bacteria 922
178 Ga0105247_10219702 3300009101 Bacteria 1286
179 Ga0105247_10431733 3300009101 Bacteria 946
180 Ga0105247_10512269 3300009101 Bacteria 876
181 Ga0105247_10595158 3300009101 Bacteria 819
182 Ga0114129_10028763 3300009147 Bacteria 7874
183 Ga0105243_10084054 3300009148 Bacteria 2606
184 Ga0105243_10377470 3300009148 Bacteria 1310
185 Ga0105243_11495491 3300009148 Bacteria 699
186 Ga0105241_10051739 3300009174 Bacteria 3133
187 Ga0105241_10216234 3300009174 Bacteria 1608
188 Ga0105241_10327163 3300009174 Bacteria 1323
189 Ga0105242_10052542 3300009176 Bacteria 3325
190 Ga0105242_10060494 3300009176 Bacteria 3112
191 Ga0105242_10071848 3300009176 Bacteria 2873
192 Ga0105242_10269012 3300009176 Bacteria 1543
193 Ga0105242_10956899 3300009176 Bacteria 861
194 Ga0105248_10198325 3300009177 Unclassified 2261
195 Ga0105248_10458518 3300009177 Bacteria 1437
196 Ga0105248_11752089 3300009177 Bacteria 704
197 Ga0105237_10008020 3300009545 Bacteria 11493
198 Ga0105237_10125972 3300009545 Bacteria 2556
199 Ga0105237_10384688 3300009545 Bacteria 1408
200 Ga0105238_10069394 3300009551 Bacteria 3525
201 Ga0105238_10073909 3300009551 Bacteria 3402
202 Ga0105238_10368596 3300009551 Bacteria 1426
203 Ga0105238_10852742 3300009551 Bacteria 928
204 Ga0105249_10077845 3300009553 Unclassified 3076
205 Ga0105249_10187907 3300009553 Bacteria 2014
206 Ga0105249_13491419 3300009553 Bacteria 506
207 Ga0105239_10110277 3300010375 Bacteria 3050
208 Ga0105239_10191679 3300010375 Bacteria 2288
209 Ga0105239_10308607 3300010375 Bacteria 1783
210 Ga0105239_10546437 3300010375 Bacteria 1319
211 Ga0105239_12890599 3300010375 Unclassified 560
212 Ga0105246_10032880 3300011119 Bacteria 3443
213 Ga0105246_10205263 3300011119 Unclassified 1535
214 Ga0105246_10732624 3300011119 Bacteria 870
215 Ga0105246_10794292 3300011119 Bacteria 839
216 Ga0157314_1005454 3300012500 Bacteria 965
217 Ga0157373_10883073 3300013100 Bacteria 663
218 Ga0157371_10226064 3300013102 Bacteria 1344
219 Ga0157371_11368106 3300013102 Bacteria 549
220 Ga0157370_10171945 3300013104 Bacteria 2014
221 Ga0157370_10271641 3300013104 Bacteria 1566
222 Ga0157369_10227818 3300013105 Unclassified 1949
223 Ga0157374_10346892 3300013296 Bacteria 1475
224 Ga0157374_10729637 3300013296 Bacteria 1005
225 Ga0157378_10024975 3300013297 Bacteria 5263
226 Ga0157378_10028933 3300013297 Bacteria 4891
227 Ga0157378_10145600 3300013297 Bacteria 2203
228 Ga0157378_10564098 3300013297 Bacteria 1146
229 Ga0157378_11451341 3300013297 Bacteria 730
230 Ga0163162_10214069 3300013306 Bacteria 2057
231 Ga0163162_10476432 3300013306 Bacteria 1379
232 Ga0163162_11752619 3300013306 Unclassified 710
233 Ga0157372_10177133 3300013307 Bacteria 2468
234 Ga0157375_10096569 3300013308 Bacteria 3028
235 Ga0157375_10428019 3300013308 Bacteria 1489
236 Ga0163163_10041194 3300014325 Bacteria 4515
237 Ga0163163_10304120 3300014325 Bacteria 1647
238 Ga0157380_10108544 3300014326 Bacteria 2327
239 Ga0157380_10200476 3300014326 Bacteria 1770
240 Ga0157380_10225731 3300014326 Bacteria 1679
241 Ga0182008_10032593 3300014497 Bacteria 2617
242 Ga0182008_10859436 3300014497 Unclassified 531
243 Ga0157379_10069742 3300014968 Bacteria 3144
244 Ga0157379_10158612 3300014968 Bacteria 2042
245 Ga0157376_10014087 3300014969 Bacteria 5989
246 Ga0157376_10109346 3300014969 Bacteria 2430
247 Ga0157376_10288237 3300014969 Bacteria 1549
248 Ga0157376_10410243 3300014969 Unclassified 1312
249 Ga0157376_12588404 3300014969 Bacteria 547
250 Ga0182005_1002145 3300015265 Bacteria 7297
251 Ga0182005_1012712 3300015265 Bacteria 2374
252 Ga0163161_10155334 3300017792 Bacteria 1741
253 Ga0163161_10228167 3300017792 Bacteria 1444
254 Ga0163161_10308462 3300017792 Bacteria 1248
255 Ga0163161_10846124 3300017792 Bacteria 772
256 Ga0206356_10275917 3300020070 Unclassified 537
257 Ga0213872_10000200 3300021361 Bacteria 53095
258 Ga0213872_10047353 3300021361 Bacteria 1955
259 Ga0247553_112590 3300023672 Unclassified 501
260 Ga0228598_1001577 3300024227 Bacteria 4988
261 Ga0209675_1009397 3300025291 Bacteria 3460
262 Ga0209676_1000002 3300025292 Bacteria 1732948
263 Ga0209050_1000006 3300025298 Bacteria 1359702
264 Ga0209256_1004316 3300025299 Bacteria 9043
265 Ga0209051_1000001 3300025303 Bacteria 1732974
266 Ga0209257_1000029 3300025304 Bacteria 695617
267 Ga0207696_1000830 3300025711 Bacteria 19705
268 Ga0207696_1018347 3300025711 Bacteria 2299
269 Ga0207655_1005592 3300025728 Bacteria 8508
270 Ga0207713_1000243 3300025735 Bacteria 70146
271 Ga0207713_1006378 3300025735 Bacteria 7195
272 Ga0207713_1023423 3300025735 Bacteria 2905
273 Ga0207713_1042265 3300025735 Bacteria 1894
274 Ga0207713_1042280 3300025735 Bacteria 1894
275 Ga0207692_10018584 3300025898 Bacteria 3123
276 Ga0207692_10130373 3300025898 Bacteria 1419
277 Ga0207642_10046105 3300025899 Bacteria 1940
278 Ga0207710_10049105 3300025900 Bacteria 1890
279 Ga0207710_10141056 3300025900 Bacteria 1163
280 Ga0207688_10009920 3300025901 Bacteria 5183
281 Ga0207680_10068729 3300025903 Bacteria 2186
282 Ga0207680_10228328 3300025903 Bacteria 1278
283 Ga0207647_10007334 3300025904 Bacteria 7974
284 Ga0207685_10101510 3300025905 Bacteria 1231
285 Ga0207699_10032006 3300025906 Bacteria 2959
286 Ga0207699_10050300 3300025906 Bacteria 2457
287 Ga0207699_10196074 3300025906 Bacteria 1365
288 Ga0207645_10065079 3300025907 Bacteria 2329
289 Ga0207645_10630041 3300025907 Unclassified 728
290 Ga0207654_10131415 3300025911 Bacteria 1585
291 Ga0207654_10204484 3300025911 Bacteria 1302
292 Ga0207654_11229144 3300025911 Unclassified 546
293 Ga0207707_10022287 3300025912 Bacteria 5538
294 Ga0207707_10166213 3300025912 Bacteria 1928
295 Ga0207695_10328974 3300025913 Bacteria 1417
296 Ga0207695_10941615 3300025913 Bacteria 743
297 Ga0207695_11094316 3300025913 Bacteria 677
298 Ga0207671_10094841 3300025914 Bacteria 2252
299 Ga0207671_10254540 3300025914 Bacteria 1381
300 Ga0207671_10344692 3300025914 Bacteria 1181
301 Ga0207693_10019086 3300025915 Bacteria 5457
302 Ga0207693_10078213 3300025915 Bacteria 2589
303 Ga0207693_10864050 3300025915 Unclassified 695
304 Ga0207693_10922971 3300025915 Bacteria 669
305 Ga0207663_10059650 3300025916 Bacteria 2415
306 Ga0207663_10128641 3300025916 Bacteria 1746
307 Ga0207663_10586118 3300025916 Bacteria 875
308 Ga0207660_10113593 3300025917 Bacteria 2042
309 Ga0207660_10190011 3300025917 Bacteria 1599
310 Ga0207660_11322970 3300025917 Unclassified 585
311 Ga0207657_10013452 3300025919 Bacteria 8027
312 Ga0207649_10214582 3300025920 Bacteria 1367
313 Ga0207649_10352910 3300025920 Unclassified 1089
314 Ga0207652_10062545 3300025921 Bacteria 3216
315 Ga0207646_10613360 3300025922 Bacteria 976
316 Ga0207681_10907596 3300025923 Bacteria 738
317 Ga0207694_10137815 3300025924 Bacteria 1961
318 Ga0207694_10671011 3300025924 Unclassified 874
319 Ga0207650_10003393 3300025925 Bacteria 10955
320 Ga0207687_10015342 3300025927 Bacteria 5021
321 Ga0207687_10062423 3300025927 Bacteria 2635
322 Ga0207687_10485772 3300025927 Unclassified 1029
323 Ga0207700_10004890 3300025928 Bacteria 7962
324 Ga0207700_10219630 3300025928 Unclassified 1610
325 Ga0207700_10587976 3300025928 Unclassified 990
326 Ga0207664_10017822 3300025929 Bacteria 5217
327 Ga0207644_10006011 3300025931 Bacteria 7913
328 Ga0207644_10056236 3300025931 Bacteria 2838
329 Ga0207690_10159609 3300025932 Unclassified 1680
330 Ga0207706_10075392 3300025933 Unclassified 2966
331 Ga0207706_10514818 3300025933 Bacteria 1032
332 Ga0207706_10533288 3300025933 Bacteria 1012
333 Ga0207686_10197940 3300025934 Bacteria 1437
334 Ga0207686_10365618 3300025934 Bacteria 1090
335 Ga0207686_11409547 3300025934 Bacteria 574
336 Ga0207670_10050284 3300025936 Bacteria 2793
337 Ga0207669_10129493 3300025937 Bacteria 1731
338 Ga0207704_10339513 3300025938 Bacteria 1165
339 Ga0207704_10629900 3300025938 Bacteria 881
340 Ga0207704_11404798 3300025938 Unclassified 598
341 Ga0207665_10009568 3300025939 Bacteria 6365
342 Ga0207665_10047429 3300025939 Bacteria 2881
343 Ga0207691_11719012 3300025940 Bacteria 507
344 Ga0207711_10149269 3300025941 Bacteria 2108
345 Ga0207711_10265132 3300025941 Bacteria 1580
346 Ga0207711_10397571 3300025941 Bacteria 1280
347 Ga0207711_11319315 3300025941 Bacteria 664
348 Ga0207689_10063790 3300025942 Bacteria 3031
349 Ga0207689_11097309 3300025942 Bacteria 671
350 Ga0207661_10758085 3300025944 Bacteria 893
351 Ga0207679_10037485 3300025945 Bacteria 3447
352 Ga0207679_10123058 3300025945 Bacteria 2068
353 Ga0207667_11460497 3300025949 Bacteria 656
354 Ga0207651_10512526 3300025960 Bacteria 1038
355 Ga0207712_10232519 3300025961 Bacteria 1481
356 Ga0207712_11506306 3300025961 Bacteria 603
357 Ga0207668_10126264 3300025972 Bacteria 1946
358 Ga0207668_10314182 3300025972 Bacteria 1298
359 Ga0207668_11098180 3300025972 Bacteria 713
360 Ga0207640_10602058 3300025981 Bacteria 930
361 Ga0207658_10049195 3300025986 Bacteria 3096
362 Ga0207658_10312853 3300025986 Bacteria 1357
363 Ga0207677_10032034 3300026023 Bacteria 3375
364 Ga0207703_10045571 3300026035 Bacteria 3528
365 Ga0207703_10356628 3300026035 Unclassified 1348
366 Ga0207703_10567789 3300026035 Unclassified 1071
367 Ga0207703_10651041 3300026035 Unclassified 999
368 Ga0207639_10036106 3300026041 Bacteria 3660
369 Ga0207639_11599415 3300026041 Unclassified 611
370 Ga0207678_10000262 3300026067 Bacteria 47571
371 Ga0207678_10003507 3300026067 Bacteria 14107
372 Ga0207678_10028571 3300026067 Bacteria 4867
373 Ga0207678_10230494 3300026067 Bacteria 1586
374 Ga0207678_10683779 3300026067 Bacteria 902
375 Ga0207708_10184872 3300026075 Bacteria 1656
376 Ga0207702_10821172 3300026078 Bacteria 919
377 Ga0207702_11118528 3300026078 Bacteria 782
378 Ga0207641_10062948 3300026088 Bacteria 3167
379 Ga0207641_10648662 3300026088 Bacteria 1037
380 Ga0207648_10818418 3300026089 Unclassified 868
381 Ga0207648_10906607 3300026089 Unclassified 824
382 Ga0207676_11464389 3300026095 Unclassified 679
383 Ga0207674_11044445 3300026116 Bacteria 786
384 Ga0207683_10007540 3300026121 Bacteria 9324
385 Ga0207683_10191881 3300026121 Bacteria 1855
386 Ga0207683_10221434 3300026121 Bacteria 1724
387 Ga0207683_10490671 3300026121 Bacteria 1134
388 Ga0207683_10692815 3300026121 Bacteria 944
389 Ga0209281_1032564 3300027111 Bacteria 921
390 Ga0207428_10000140 3300027907 Bacteria 97818
391 Ga0268266_10000419 3300028379 Bacteria 64526
392 Ga0268266_10007719 3300028379 Bacteria 9656
393 Ga0268266_10032170 3300028379 Bacteria 4457
394 Ga0268266_10259075 3300028379 Bacteria 1611
395 Ga0268264_10039627 3300028381 Bacteria 3892
396 Ga0268264_10062262 3300028381 Bacteria 3132
397 Ga0265337_1008064 3300028556 Bacteria 3871
398 Ga0265338_10006825 3300028800 Bacteria 14384
399 Ga0265769_122209 3300030888 Unclassified 510
400 Ga0265760_10106519 3300031090 Bacteria 890
401 Ga0265316_10728227 3300031344 Unclassified 698
402 Ga0307508_10088081 3300031616 Bacteria 2688
403 Ga0307507_10213162 3300033179 Bacteria 1313
404 Ga0373930_0048085 3300034816 Unclassified 925
405 Ga0373958_0023273 3300034819 Bacteria 1164
406 Ga0373926_0054469 3300035083 Bacteria 1449
407 Ga0373926_0143526 3300035083 Unclassified 907
408 Ga0373928_0008886 3300035084 Bacteria 1959
409 Ga0373928_0050631 3300035084 Bacteria 980
410 Ga0373928_0228974 3300035084 Bacteria 546
411 Ga0373934_0060202 3300035086 Unclassified 1512
412 Ga0373940_0135916 3300035088 Unclassified 773
413 Ga0373944_0002962 3300035089 Bacteria 4367
414 Ga0373944_0003642 3300035089 Bacteria 3981
415 Ga0373949_0007653 3300035090 Bacteria 2368
416 Ga0373951_0026913 3300035091 Bacteria 1342
417 Ga0373952_0073413 3300035092 Unclassified 860
418 Ga0373923_0005750 3300035111 Bacteria 4230
419 Ga0373923_0010927 3300035111 Bacteria 3318
420 Ga0373932_0058629 3300035112 Bacteria 1164
421 Ga0373936_0092759 3300035113 Bacteria 1267
422 Ga0373936_0130984 3300035113 Bacteria 1078
423 Ga0373939_0041966 3300035114 Unclassified 1381
424 Ga0373941_0012175 3300035115 Bacteria 2243
425 Ga0373945_0012871 3300035116 Bacteria 2785
426 Ga0373945_0309630 3300035116 Unclassified 678
427 Ga0373954_0007152 3300035118 Bacteria 4874
428 Ga0373956_0088696 3300035119 Bacteria 1425
429 Ga0373957_0005746 3300035120 Bacteria 3866
430 Ga0373960_0242430 3300035121 Bacteria 652
431 Ga0373943_0001305 3300035170 Bacteria 11190
432 Ga0373943_0010781 3300035170 Bacteria 4102
433 Ga0373946_0017815 3300035171 Bacteria 2721
434 Ga0373946_0245829 3300035171 Bacteria 871
435 Ga0373955_0062239 3300035172 Unclassified 2063
436 Ga0373955_0077459 3300035172 Bacteria 1872
437 Ga0373955_0077543 3300035172 Bacteria 1871
438 Ga0373961_0025714 3300035241 Bacteria 1603
439 Ga0373924_0171588 3300035410 Bacteria 953
440 Ga0373931_0018223 3300035691 Bacteria 3489
441 Ga0373931_0064180 3300035691 Bacteria 1987
442 Ga0373935_0003279 3300035692 Bacteria 9359
443 Ga0373935_0162398 3300035692 Bacteria 1523
444 Ga0373935_0316219 3300035692 Bacteria 1107
445 Ga0373935_0420121 3300035692 Unclassified 962
446 Ga0373927_0037544 3300035695 Bacteria 3148
447 Ga0373927_0501566 3300035695 Bacteria 802
448 Ga0373933_0011439 3300035724 Bacteria 4891
449 Ga0373933_0085990 3300035724 Unclassified 1934
450 Ga0373947_0000340 3300035725 Bacteria 26369
451 Ga0373947_0092135 3300035725 Bacteria 1892
452 Ga0373947_0118844 3300035725 Bacteria 1677
453 Ga0373947_0438011 3300035725 Unclassified 884
454 Ga0373937_0001302 3300036401 Bacteria 20904
455 Ga0373937_0044446 3300036401 Unclassified 4057
456 Ga0373937_0044652 3300036401 Bacteria 4048
457 Ga0373925_0100828 3300037068 Bacteria 2219
458 Ga0373925_1119472 3300037068 Bacteria 648
459 Ga0436361_0136543 3300039447 Bacteria 15949
460 Ga0436361_0446726 3300039447 Bacteria 4024
461 Ga0436361_1020246 3300039447 Bacteria 8764
462 Ga0436362_0236268 3300039453 Bacteria 1122
463 Ga0439438_024115 3300041405 Bacteria 1669
464 Ga0439447_009420 3300041407 Bacteria 2963
465 Ga0439466_0020787 3300041411 Bacteria 2336
466 Ga0439466_0070446 3300041411 Bacteria 1114
467 Ga0439452_000239 3300042010 Bacteria 38013
468 Ga0439456_006060 3300042013 Bacteria 2462
469 Ga0439456_031600 3300042013 Bacteria 1135
470 Ga0450911_001328 3300042115 Bacteria 5825
471 Ga0450911_001897 3300042115 Bacteria 4399
472 Ga0450902_007716 3300042137 Bacteria 1670
473 Ga0450904_000079 3300042139 Bacteria 22089
474 Ga0450905_015150 3300042142 Bacteria 1104
475 Ga0495617_001653 3300046452 Bacteria 9584
476 Ga0495617_011581 3300046452 Bacteria 3007
477 Ga0495617_089138 3300046452 Bacteria 1008
478 Ga0495627_009751 3300046453 Bacteria 3521
479 Ga0495627_021912 3300046453 Bacteria 2110
480 Ga0495592_0016424 3300046454 Bacteria 5615
481 Ga0495592_0027610 3300046454 Bacteria 4301
482 Ga0495592_0118353 3300046454 Bacteria 1866
483 Ga0495603_0014210 3300046455 Bacteria 4816
484 Ga0495603_0026165 3300046455 Bacteria 3526
485 Ga0495603_0185935 3300046455 Bacteria 1202
486 Ga0495603_0803066 3300046455 Bacteria 536
487 Ga0495590_0003032 3300046457 Bacteria 6884
488 Ga0495590_0005330 3300046457 Bacteria 5107
489 Ga0495591_000049 3300046458 Bacteria 138951
490 Ga0495591_005658 3300046458 Bacteria 5723
491 Ga0495591_031438 3300046458 Bacteria 1592
492 Ga0495629_0000253 3300046459 Bacteria 46595
493 Ga0495629_0031625 3300046459 Bacteria 3746
494 Ga0495629_0037747 3300046459 Bacteria 3404
495 Ga0495629_0038826 3300046459 Bacteria 3353
496 Ga0495638_0000842 3300046460 Bacteria 32131
497 Ga0495638_0001095 3300046460 Bacteria 26399
498 Ga0495638_0003569 3300046460 Bacteria 12184
499 Ga0495638_0004165 3300046460 Bacteria 11029
500 Ga0495638_0009019 3300046460 Bacteria 7033
501 Ga0495638_0021382 3300046460 Bacteria 4265
502 Ga0495638_0026703 3300046460 Bacteria 3741
503 Ga0495641_0011612 3300046461 Bacteria 5000
504 Ga0495651_0007189 3300046462 Bacteria 8514
505 Ga0495651_0022459 3300046462 Bacteria 4903
506 Ga0495653_0090847 3300046463 Bacteria 2233
507 Ga0495653_0117173 3300046463 Bacteria 1903
508 Ga0495650_0001581 3300046471 Bacteria 21346
509 Ga0495650_0002179 3300046471 Bacteria 16563
510 Ga0495650_0012440 3300046471 Bacteria 4579
511 Ga0495650_0025453 3300046471 Bacteria 2773
512 Ga0495580_0027657 3300046472 Bacteria 4125
513 Ga0495580_0136359 3300046472 Bacteria 1701
514 Ga0495580_0523913 3300046472 Bacteria 789
515 Ga0495582_0010154 3300046473 Bacteria 5186
516 Ga0495582_0489602 3300046473 Bacteria 711
517 Ga0495605_0000047 3300046474 Bacteria 171270
518 Ga0495605_0000054 3300046474 Bacteria 157560
519 Ga0495605_0000447 3300046474 Bacteria 37007
520 Ga0495605_0013312 3300046474 Bacteria 4540
521 Ga0495605_0179597 3300046474 Unclassified 931
522 Ga0495639_0109856 3300046475 Bacteria 1308
523 Ga0495662_0003409 3300046476 Bacteria 8058
524 Ga0495664_0006671 3300046477 Bacteria 6382
525 Ga0495664_0060681 3300046477 Bacteria 2251
526 Ga0495584_0000438 3300046491 Bacteria 28666
527 Ga0495584_0006144 3300046491 Bacteria 6317
528 Ga0495584_0013360 3300046491 Bacteria 4192
529 Ga0495584_0015763 3300046491 Bacteria 3853
530 Ga0495584_0025712 3300046491 Bacteria 2984
531 Ga0495584_0144796 3300046491 Bacteria 1207
532 Ga0495584_0183243 3300046491 Bacteria 1064
533 Ga0495585_0000253 3300046492 Bacteria 55394
534 Ga0495585_0000498 3300046492 Bacteria 37103
535 Ga0495585_0073623 3300046492 Bacteria 1859
536 Ga0495585_0080529 3300046492 Bacteria 1765
537 Ga0495594_0007741 3300046499 Bacteria 5524
538 Ga0495594_0049144 3300046499 Bacteria 2318
539 Ga0495594_0364149 3300046499 Bacteria 823
540 Ga0495596_0000087 3300046500 Bacteria 64252
541 Ga0495607_0000036 3300046501 Bacteria 140259
542 Ga0495607_0001995 3300046501 Bacteria 17168
543 Ga0495607_0007777 3300046501 Bacteria 7379
544 Ga0495607_0009931 3300046501 Bacteria 6410
545 Ga0495607_0018731 3300046501 Bacteria 4404
546 Ga0495607_0025255 3300046501 Bacteria 3697
547 Ga0495607_0061864 3300046501 Bacteria 2125
548 Ga0495583_0004007 3300046506 Bacteria 10854
549 Ga0495606_0000199 3300046507 Bacteria 104847
550 Ga0495606_0001473 3300046507 Bacteria 31418
551 Ga0495606_0002612 3300046507 Bacteria 20576
552 Ga0495606_0015401 3300046507 Bacteria 5893
553 Ga0495606_0057983 3300046507 Bacteria 2491
554 Ga0495608_0001048 3300046511 Bacteria 19467
555 Ga0495608_0029862 3300046511 Bacteria 3695
556 Ga0495608_0038316 3300046511 Bacteria 3220
557 Ga0495608_0807682 3300046511 Bacteria 553
558 Ga0495610_0003227 3300046512 Bacteria 12896
559 Ga0495610_0006343 3300046512 Bacteria 8173
560 Ga0495610_0011507 3300046512 Bacteria 5406
561 Ga0495610_0078147 3300046512 Bacteria 1526
562 Ga0495616_0009808 3300046513 Bacteria 5578
563 Ga0495616_0024444 3300046513 Bacteria 3241
564 Ga0495616_0024711 3300046513 Bacteria 3219
565 Ga0495618_0008923 3300046514 Bacteria 6050
566 Ga0495618_0242767 3300046514 Bacteria 1132
567 Ga0495618_0489679 3300046514 Bacteria 742
568 Ga0495620_0000095 3300046515 Bacteria 70152
569 Ga0495620_0000136 3300046515 Bacteria 60464
570 Ga0495620_0007747 3300046515 Bacteria 5801
571 Ga0495628_0162504 3300046516 Unclassified 1696
572 Ga0495630_0017170 3300046517 Bacteria 5299
573 Ga0495630_0651559 3300046517 Bacteria 806
574 Ga0495631_0001725 3300046518 Bacteria 12981
575 Ga0495631_0001808 3300046518 Bacteria 12647
576 Ga0495631_0027169 3300046518 Bacteria 2622
577 Ga0495631_0151049 3300046518 Bacteria 997
578 Ga0495632_0001145 3300046519 Bacteria 22647
579 Ga0495632_0001397 3300046519 Bacteria 20236
580 Ga0495632_0003535 3300046519 Bacteria 11051
581 Ga0495632_0011016 3300046519 Bacteria 5301
582 Ga0495632_0019238 3300046519 Bacteria 3725
583 Ga0495637_0000200 3300046520 Bacteria 46589
584 Ga0495637_0000363 3300046520 Bacteria 34565
585 Ga0495637_0000401 3300046520 Bacteria 32143
586 Ga0495637_0007836 3300046520 Bacteria 5270
587 Ga0495637_0052548 3300046520 Bacteria 1700
588 Ga0495643_0006541 3300046522 Bacteria 7667
589 Ga0495643_0020020 3300046522 Bacteria 3865
590 Ga0495643_0022355 3300046522 Bacteria 3609
591 Ga0495643_0047189 3300046522 Bacteria 2333
592 Ga0495643_0076959 3300046522 Bacteria 1744
593 Ga0495643_0253479 3300046522 Bacteria 820
594 Ga0495644_0000221 3300046523 Bacteria 26846
595 Ga0495644_0001523 3300046523 Bacteria 9447
596 Ga0495644_0002206 3300046523 Bacteria 7797
597 Ga0495644_0093846 3300046523 Bacteria 1133
598 Ga0495648_0009478 3300046524 Bacteria 7538
599 Ga0495666_0004756 3300046526 Bacteria 6866
600 Ga0495666_0295640 3300046526 Bacteria 733
601 Ga0495652_0021402 3300046529 Bacteria 5749
602 Ga0495652_0059356 3300046529 Bacteria 3236
603 Ga0495652_0069898 3300046529 Bacteria 2937
604 Ga0495652_0237092 3300046529 Unclassified 1360
605 Ga0495654_0001853 3300046530 Bacteria 14074
606 Ga0495654_0008687 3300046530 Bacteria 5600
607 Ga0495654_0056029 3300046530 Bacteria 1906
608 Ga0495654_0223394 3300046530 Bacteria 795
609 Ga0495665_0008307 3300046531 Bacteria 5627
610 Ga0495665_0067027 3300046531 Bacteria 1894
611 Ga0495665_0215511 3300046531 Bacteria 993
612 Ga0495640_0016874 3300046533 Bacteria 5456
613 Ga0495640_0019059 3300046533 Bacteria 5072
614 Ga0495640_0034262 3300046533 Bacteria 3602
615 Ga0495640_0808386 3300046533 Unclassified 558
616 Ga0495586_0031716 3300046535 Bacteria 2832
617 Ga0495586_0324291 3300046535 Unclassified 883
618 Ga0495587_0009102 3300046536 Bacteria 6371
619 Ga0495587_0021008 3300046536 Bacteria 4027
620 Ga0495587_0144041 3300046536 Bacteria 1359
621 Ga0495609_0000149 3300046538 Bacteria 72309
622 Ga0495609_0000160 3300046538 Bacteria 69846
623 Ga0495609_0457562 3300046538 Unclassified 507
624 Ga0495621_0039434 3300046539 Bacteria 1652
625 Ga0495597_0000205 3300046542 Bacteria 54352
626 Ga0495597_0002975 3300046542 Bacteria 10264
627 Ga0495597_0005321 3300046542 Bacteria 6825
628 Ga0495597_0015654 3300046542 Bacteria 3588
629 Ga0495597_0030706 3300046542 Bacteria 2447
630 Ga0495597_0030859 3300046542 Bacteria 2440
631 Ga0495597_0147296 3300046542 Bacteria 967
632 Ga0495645_0075417 3300046543 Bacteria 2427
633 Ga0495645_0169284 3300046543 Unclassified 1504
634 Ga0495622_0027785 3300046557 Bacteria 2640
635 Ga0495622_0041666 3300046557 Bacteria 2135
636 Ga0495622_0114093 3300046557 Bacteria 1236
637 Ga0495633_0013957 3300046558 Bacteria 4213
638 Ga0495667_0005768 3300046559 Bacteria 8384
639 Ga0495667_0040977 3300046559 Bacteria 3073
640 Ga0495667_0641098 3300046559 Bacteria 660
641 Ga0495656_0001748 3300046615 Bacteria 7119
642 Ga0495656_0026011 3300046615 Bacteria 2326
643 Ga0495668_0001686 3300046616 Bacteria 20450
644 Ga0495668_0006773 3300046616 Bacteria 7448
645 Ga0495668_0352547 3300046616 Bacteria 807
646 Ga0495634_0058021 3300046642 Bacteria 2581
647 Ga0495634_0314599 3300046642 Bacteria 944
648 Ga0495634_0594727 3300046642 Bacteria 642
649 Ga0495611_0005933 3300046648 Bacteria 5211
650 Ga0495611_0007091 3300046648 Bacteria 4760
651 Ga0495625_0002208 3300046660 Bacteria 21531
652 Ga0495625_0005523 3300046660 Bacteria 11493
653 Ga0495625_0020820 3300046660 Bacteria 5056
654 Ga0495625_0289544 3300046660 Bacteria 1051
655 Ga0495635_0025275 3300046663 Bacteria 4136
656 Ga0495635_0196896 3300046663 Bacteria 1367
657 Ga0495635_0347652 3300046663 Bacteria 989
658 Ga0495659_0013022 3300046664 Unclassified 2704
659 Ga0495661_0003804 3300046665 Bacteria 11047
660 Ga0495661_0004291 3300046665 Bacteria 10347
661 Ga0495661_0007546 3300046665 Bacteria 7578
662 Ga0495661_0008355 3300046665 Bacteria 7164
663 Ga0495661_0013543 3300046665 Bacteria 5474
664 Ga0495661_0101133 3300046665 Bacteria 1622
665 Ga0495661_0150919 3300046665 Bacteria 1255
666 Ga0495588_0002028 3300046674 Bacteria 8666
667 Ga0495588_0103635 3300046674 Unclassified 1496
668 Ga0495657_0040981 3300046675 Bacteria 3172
669 Ga0495599_0020425 3300046678 Unclassified 4124
670 Ga0495599_0050524 3300046678 Unclassified 2605
671 Ga0495623_0027977 3300046679 Bacteria 3629
672 Ga0495623_0086318 3300046679 Unclassified 1934
673 Ga0495646_0010572 3300046680 Bacteria 5863
674 Ga0495646_0017992 3300046680 Unclassified 4477
675 Ga0495646_0350640 3300046680 Bacteria 773
676 Ga0495647_0029072 3300046681 Bacteria 2041
677 Ga0495658_0000473 3300046683 Bacteria 22266
678 Ga0495658_0075779 3300046683 Bacteria 1964
679 Ga0495658_0100072 3300046683 Bacteria 1729
680 Ga0495613_0268002 3300046689 Bacteria 1188
681 Ga0495613_0372036 3300046689 Unclassified 978
682 Ga0495624_0005790 3300046690 Bacteria 8852
683 Ga0495624_0059190 3300046690 Bacteria 2404
684 Ga0495670_0005085 3300046691 Bacteria 6469
685 Ga0495670_0113876 3300046691 Bacteria 1401
686 Ga0495670_0214606 3300046691 Bacteria 1021
687 Ga0495671_0016853 3300046692 Bacteria 3894
688 Ga0495671_0063070 3300046692 Bacteria 1825
689 Ga0495671_0165026 3300046692 Bacteria 1077
690 Ga0495671_0196879 3300046692 Bacteria 978
691 Ga0495649_0000495 3300046694 Bacteria 33735
692 Ga0495649_0000752 3300046694 Bacteria 26113
693 Ga0495649_0024812 3300046694 Bacteria 3343
694 Ga0495649_0025265 3300046694 Bacteria 3309
695 Ga0495589_0000239 3300046794 Bacteria 45943
696 Ga0495589_0001694 3300046794 Bacteria 12587
697 Ga0495589_0321341 3300046794 Bacteria 715
698 Ga0495589_0520976 3300046794 Bacteria 542
699 Ga0495600_0015219 3300046809 Bacteria 4860
700 Ga0495600_0356527 3300046809 Unclassified 915
701 Ga0495660_0004785 3300046810 Bacteria 8172
702 Ga0495660_0005136 3300046810 Bacteria 7868
703 Ga0495660_0006108 3300046810 Bacteria 7148
704 Ga0495660_0009910 3300046810 Bacteria 5544
705 Ga0495660_0022323 3300046810 Bacteria 3613
706 Ga0495660_0036915 3300046810 Bacteria 2724
707 Ga0495660_0040542 3300046810 Bacteria 2580
708 Ga0495581_0376258 3300047315 Bacteria 829
709 Ga0495604_0002235 3300047317 Bacteria 15508
710 Ga0495604_0090150 3300047317 Bacteria 2278
711 Ga0495674_0006763 3300047319 Bacteria 10975
712 Ga0495674_0043756 3300047319 Bacteria 3983
713 Ga0495674_0903933 3300047319 Bacteria 681
714 Ga0495672_0005068 3300047320 Bacteria 10528
715 Ga0495672_0007498 3300047320 Bacteria 8199
716 Ga0495672_0079502 3300047320 Bacteria 1831
717 Ga0495676_0656338 3300047321 Bacteria 680
718 Ga0495680_0012645 3300047322 Bacteria 7415
719 Ga0495680_0039115 3300047322 Bacteria 3785
720 Ga0495680_0230314 3300047322 Bacteria 1319
721 Ga0495680_0458416 3300047322 Bacteria 871
722 Ga0495683_0013942 3300047323 Bacteria 4191
723 Ga0495683_0019232 3300047323 Bacteria 3525
724 Ga0495683_0295338 3300047323 Bacteria 697
725 Ga0495675_0002904 3300047444 Bacteria 10293
726 Ga0495677_0040783 3300047445 Bacteria 1698
727 Ga0495679_000894 3300047446 Bacteria 18697
728 Ga0495679_004604 3300047446 Bacteria 6293
729 Ga0495679_028588 3300047446 Bacteria 1828
730 Ga0495673_0001220 3300047469 Bacteria 21349
731 Ga0495673_0002461 3300047469 Bacteria 13012
732 Ga0495673_0006969 3300047469 Bacteria 6576
733 Ga0495673_0009237 3300047469 Bacteria 5470
734 Ga0495673_0009612 3300047469 Bacteria 5335
735 Ga0495673_0016407 3300047469 Bacteria 3787
736 Ga0495673_0022084 3300047469 Bacteria 3125
737 Ga0495673_0033328 3300047469 Bacteria 2391
738 Ga0495681_0000234 3300047470 Bacteria 45933
739 Ga0495681_0000460 3300047470 Bacteria 31243
740 Ga0495681_0003684 3300047470 Bacteria 10641
741 Ga0495681_0012817 3300047470 Bacteria 4902
742 Ga0495681_0022099 3300047470 Bacteria 3412
743 Ga0495681_0120520 3300047470 Unclassified 1126
744 Ga0495684_0146629 3300047471 Unclassified 1767
745 Ga0495684_0152628 3300047471 Bacteria 1726
746 Ga0495684_0643206 3300047471 Unclassified 710
747 Ga0495686_0000636 3300047472 Bacteria 48321
748 Ga0495686_0026767 3300047472 Bacteria 3772
749 Ga0495686_0033044 3300047472 Bacteria 3342
750 Ga0495686_0043400 3300047472 Bacteria 2851
751 Ga0495593_0004020 3300047673 Bacteria 8768
752 Ga0495593_0038512 3300047673 Bacteria 2582
753 Ga0495593_0099094 3300047673 Unclassified 1496
754 Ga0495602_0001451 3300048088 Bacteria 23534
755 Ga0495602_0059231 3300048088 Bacteria 3344
756 Ga0495614_0139729 3300048089 Bacteria 1076
757 Ga0495626_0000057 3300048091 Bacteria 148288
758 Ga0495626_0000065 3300048091 Bacteria 141689
759 Ga0496100_0013607 3300048903 Bacteria 4699
760 Ga0496100_0055226 3300048903 Bacteria 2594
761 Ga0496100_0107976 3300048903 Bacteria 1929
762 Ga0496100_0390232 3300048903 Bacteria 1058
763 Ga0496101_0001165 3300048904 Bacteria 15728
764 Ga0496101_0043061 3300048904 Bacteria 3225
765 Ga0496101_0947373 3300048904 Bacteria 677
766 Ga0496102_0005341 3300048905 Bacteria 10905
767 Ga0496102_0061563 3300048905 Bacteria 3435
768 Ga0496102_0115503 3300048905 Bacteria 2504
769 Ga0496102_0475672 3300048905 Bacteria 1170
770 Ga0496103_0157425 3300048906 Bacteria 1456
771 Ga0496103_0259328 3300048906 Bacteria 1118
772 Ga0496103_0262405 3300048906 Bacteria 1111
773 Ga0496104_0015669 3300048907 Bacteria 6875
774 Ga0496104_0688144 3300048907 Bacteria 930
775 Ga0496105_0121713 3300048908 Bacteria 2151
776 Ga0496105_0674625 3300048908 Unclassified 795
777 Ga0496106_0015809 3300048909 Bacteria 5581
778 Ga0496106_0032287 3300048909 Bacteria 3903
779 Ga0496106_0184893 3300048909 Bacteria 1655
780 Ga0496107_0023030 3300048910 Bacteria 4403
781 Ga0496107_0035626 3300048910 Bacteria 3567
782 Ga0496107_0049494 3300048910 Bacteria 3028
783 Ga0496108_0229662 3300048911 Bacteria 1613
784 Ga0496108_0567087 3300048911 Bacteria 990
785 Ga0496109_0071006 3300048912 Bacteria 3196
786 Ga0496109_0078310 3300048912 Bacteria 3043
787 Ga0496109_0136382 3300048912 Bacteria 2293
788 Ga0496109_0911732 3300048912 Bacteria 817
789 Ga0496110_0019494 3300048913 Bacteria 5710
790 Ga0496110_0096810 3300048913 Bacteria 2644
791 Ga0496110_0215110 3300048913 Bacteria 1748
792 Ga0496110_0247205 3300048913 Bacteria 1623
793 Ga0496110_0578168 3300048913 Bacteria 1020
794 Ga0496111_0020228 3300048914 Bacteria 4630
795 Ga0496111_0637666 3300048914 Bacteria 778
796 Ga0496111_0761448 3300048914 Bacteria 702
797 Ga0496112_0011859 3300048915 Bacteria 7982
798 Ga0496112_0087029 3300048915 Bacteria 3091
799 Ga0496112_0802620 3300048915 Bacteria 866
800 Ga0496112_1844484 3300048915 Unclassified 516
801 Ga0496113_0163836 3300048916 Bacteria 1758
802 Ga0496114_0200540 3300048917 Bacteria 1747
803 Ga0496114_0374920 3300048917 Bacteria 1259
804 Ga0496114_0693320 3300048917 Bacteria 893
805 Ga0496115_0032424 3300048918 Bacteria 4121
806 Ga0496115_0113999 3300048918 Bacteria 2221
807 Ga0496117_0071323 3300048920 Bacteria 2328
808 Ga0496117_0151355 3300048920 Bacteria 1373
809 Ga0496118_0102888 3300048921 Bacteria 1923
810 Ga0496121_0001087 3300048924 Bacteria 48027
811 Ga0496121_0058560 3300048924 Bacteria 3183
812 Ga0496121_0150175 3300048924 Bacteria 1715
813 Ga0496121_0259666 3300048924 Bacteria 1200
814 Ga0496122_0000043 3300048925 Bacteria 280333
815 Ga0496122_0518336 3300048925 Unclassified 575
816 Ga0496123_0000090 3300048926 Bacteria 179735
817 Ga0496123_0063037 3300048926 Bacteria 2371
818 Ga0496124_0000423 3300048927 Bacteria 75679
819 Ga0496124_0005631 3300048927 Bacteria 14007
820 Ga0496124_0015758 3300048927 Bacteria 7225
821 Ga0496125_0203815 3300048928 Bacteria 1292
822 Ga0496126_0607656 3300048929 Bacteria 861
823 Ga0495678_000592 3300049459 Bacteria 34104
824 Ga0495678_001121 3300049459 Bacteria 22234
825 Ga0495678_001152 3300049459 Bacteria 21898
826 Ga0495678_007757 3300049459 Bacteria 5528
827 Ga0495678_029261 3300049459 Bacteria 2315
828 Ga0495682_0000025 3300049460 Bacteria 147931
829 Ga0495682_0101678 3300049460 Bacteria 1031
830 Ga0501077_0472141 3300049593 Bacteria 804
831 nmdc:mga07m45_449116_c1 3300050496 Bacteria 747
832 nmdc:mga05p37_225_c1 3300050507 Bacteria 57238
833 nmdc:mga09592_244_c1 3300050508 Bacteria 39424
834 nmdc:mga0qj67_697_c1 3300050509 Bacteria 22881
835 nmdc:mga06r32_731_c1 3300050510 Bacteria 28813
836 nmdc:mga08y16_296601_c1 3300050511 Bacteria 1666
837 nmdc:mga08y16_617_c1 3300050511 Bacteria 33261
838 nmdc:mga0n895_329652_c1 3300050512 Bacteria 1547
839 nmdc:mga0n895_48088_c1 3300050512 Bacteria 4174
840 nmdc:mga0n895_877514_c1 3300050512 Bacteria 883
841 nmdc:mga0rr50_61528_c1 3300050513 Bacteria 2829
842 nmdc:mga0rr50_790_c1 3300050513 Bacteria 17055
843 nmdc:mga08x19_1171203_c1 3300050514 Bacteria 545
844 nmdc:mga08x19_58563_c1 3300050514 Bacteria 2492
845 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
846 Ga0495601_0000413 3300053077 Bacteria 22423
847 Ga0495601_0019631 3300053077 Unclassified 4124
848 Ga0495601_0079895 3300053077 Bacteria 2097
849 Ga0495612_0035714 3300053078 Bacteria 2014
850 Ga0495612_0042296 3300053078 Unclassified 1859
851 Ga0495595_0006073 3300053084 Bacteria 4907
852 Ga0495595_0090096 3300053084 Unclassified 1470
853 Ga0495595_0098869 3300053084 Bacteria 1406
854 Ga0495619_0001679 3300053085 Bacteria 14639
855 Ga0495619_0002856 3300053085 Bacteria 11246
856 Ga0495619_0013291 3300053085 Bacteria 5186
857 Ga0495619_0079002 3300053085 Bacteria 2212
858 Ga0500646_0068953 3300053090 Unclassified 1057
859 Ga0500594_0160864 3300053118 Bacteria 726
860 Ga0500595_010770 3300053119 Bacteria 3615
861 Ga0500658_0073758 3300053134 Bacteria 1446
862 Ga0500568_0078911 3300053139 Bacteria 1252
863 Ga0500577_0114797 3300053142 Bacteria 1115
864 Ga0500616_0000964 3300053153 Bacteria 31200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1008064 Ga0265337_10080643 104
2 3300028800 Ga0265338_10006825 Ga0265338_100068255 104
3 iso_pu_bacteria 2919385768 2919391063 114
4 3300025923 Ga0207681_10907596 Ga0207681_109075961 115
5 3300006914 Ga0075436_100939538 Ga0075436_1009395381 116
6 3300007076 Ga0075435_100105078 Ga0075435_1001050783 116
7 3300046507 Ga0495606_0015401 Ga0495606_0015401_5233_5583 116
8 3300046520 Ga0495637_0000200 Ga0495637_0000200_5618_5968 116
9 3300046616 Ga0495668_0006773 Ga0495668_0006773_1737_2087 116
10 3300046665 Ga0495661_0007546 Ga0495661_0007546_4267_4617 116
11 3300046810 Ga0495660_0006108 Ga0495660_0006108_2019_2369 116
12 3300047469 Ga0495673_0009237 Ga0495673_0009237_1239_1589 116
13 3300047469 Ga0495673_0033328 Ga0495673_0033328_1268_1618 116
14 3300048914 Ga0496111_0761448 Ga0496111_0761448_118_468 116
15 3300048927 Ga0496124_0015758 Ga0496124_0015758_217_567 116
16 3300049459 Ga0495678_000592 Ga0495678_000592_28000_28350 116
17 3300050512 nmdc:mga0n895_877514_c1 nmdc:mga0n895_877514_c1_40_393 116
18 3300050514 nmdc:mga08x19_1171203_c1 nmdc:mga08x19_1171203_c1_48_401 116
19 3300006846 Ga0075430_100000026 Ga0075430_10000002632 117
20 3300006847 Ga0075431_100000451 Ga0075431_10000045113 117
21 3300006852 Ga0075433_10007117 Ga0075433_100071177 117
22 3300006871 Ga0075434_100000110 Ga0075434_1000001103 117
23 3300006880 Ga0075429_100000247 Ga0075429_10000024717 117
24 3300007076 Ga0075435_100039007 Ga0075435_1000390072 117
25 3300009094 Ga0111539_10000337 Ga0111539_1000033735 117
26 3300027907 Ga0207428_10000140 Ga0207428_1000014072 117
27 3300047320 Ga0495672_0079502 Ga0495672_0079502_1450_1806 117
28 3300050507 nmdc:mga05p37_225_c1 nmdc:mga05p37_225_c1_33995_34348 117
29 3300050508 nmdc:mga09592_244_c1 nmdc:mga09592_244_c1_4762_5115 117
30 3300050509 nmdc:mga0qj67_697_c1 nmdc:mga0qj67_697_c1_21186_21539 117
31 3300050510 nmdc:mga06r32_731_c1 nmdc:mga06r32_731_c1_16548_16901 117
32 3300050511 nmdc:mga08y16_617_c1 nmdc:mga08y16_617_c1_27997_28350 117
33 3300050512 nmdc:mga0n895_48088_c1 nmdc:mga0n895_48088_c1_1062_1415 117
34 3300050513 nmdc:mga0rr50_790_c1 nmdc:mga0rr50_790_c1_16224_16577 117
35 3300050515 nmdc:mga0a205_1019_c1 nmdc:mga0a205_1019_c1_13124_13477 117
36 3300005548 Ga0070665_100009597 Ga0070665_1000095979 118
37 3300009093 Ga0105240_10256119 Ga0105240_102561193 118
38 3300013306 Ga0163162_11752619 Ga0163162_117526192 118
39 3300014325 Ga0163163_10304120 Ga0163163_103041202 118
40 3300025913 Ga0207695_10941615 Ga0207695_109416152 118
41 3300025927 Ga0207687_10485772 Ga0207687_104857722 118
42 3300030888 Ga0265769_122209 Ga0265769_1222091 118
43 3300039447 Ga0436361_0136543 Ga0436361_0136543_6858_7226 118
44 3300039453 Ga0436362_0236268 Ga0436362_0236268_374_742 118
45 3300046474 Ga0495605_0000047 Ga0495605_0000047_16610_16987 118
46 3300046474 Ga0495605_0000447 Ga0495605_0000447_23845_24246 118
47 3300046501 Ga0495607_0007777 Ga0495607_0007777_2058_2459 118
48 3300046506 Ga0495583_0004007 Ga0495583_0004007_7691_8092 118
49 3300046522 Ga0495643_0020020 Ga0495643_0020020_337_705 118
50 3300046538 Ga0495609_0000149 Ga0495609_0000149_58201_58602 118
51 3300046810 Ga0495660_0040542 Ga0495660_0040542_2181_2549 118
52 3300047469 Ga0495673_0016407 Ga0495673_0016407_2293_2670 118
53 3300047469 Ga0495673_0022084 Ga0495673_0022084_1836_2237 118
54 3300048929 Ga0496126_0607656 Ga0496126_0607656_331_699 118
55 3300053119 Ga0500595_010770 Ga0500595_010770_2918_3286 118
56 3300005434 Ga0070709_10138798 Ga0070709_101387982 119
57 3300005983 Ga0081540_1076267 Ga0081540_10762671 119
58 3300009098 Ga0105245_10595789 Ga0105245_105957892 119
59 3300009101 Ga0105247_10431733 Ga0105247_104317332 119
60 3300009147 Ga0114129_10028763 Ga0114129_100287637 119
61 3300009176 Ga0105242_10269012 Ga0105242_102690122 119
62 3300009545 Ga0105237_10008020 Ga0105237_100080205 119
63 3300009551 Ga0105238_10069394 Ga0105238_100693942 119
64 3300011119 Ga0105246_10794292 Ga0105246_107942922 119
65 3300013297 Ga0157378_10145600 Ga0157378_101456002 119
66 3300013297 Ga0157378_11451341 Ga0157378_114513411 119
67 3300014326 Ga0157380_10108544 Ga0157380_101085443 119
68 3300014326 Ga0157380_10200476 Ga0157380_102004761 119
69 3300014968 Ga0157379_10069742 Ga0157379_100697422 119
70 3300014969 Ga0157376_10014087 Ga0157376_100140875 119
71 3300023672 Ga0247553_112590 Ga0247553_1125901 119
72 3300024227 Ga0228598_1001577 Ga0228598_10015775 119
73 3300025299 Ga0209256_1004316 Ga0209256_10043164 119
74 3300031090 Ga0265760_10106519 Ga0265760_101065192 119
75 3300035111 Ga0373923_0010927 Ga0373923_0010927_894_1256 119
76 3300035113 Ga0373936_0130984 Ga0373936_0130984_130_492 119
77 3300035172 Ga0373955_0077459 Ga0373955_0077459_872_1234 119
78 3300035692 Ga0373935_0316219 Ga0373935_0316219_720_1082 119
79 3300035695 Ga0373927_0501566 Ga0373927_0501566_28_390 119
80 3300035725 Ga0373947_0092135 Ga0373947_0092135_208_570 119
81 3300036401 Ga0373937_0044652 Ga0373937_0044652_2088_2450 119
82 3300037068 Ga0373925_1119472 Ga0373925_1119472_220_582 119
83 3300046454 Ga0495592_0118353 Ga0495592_0118353_301_663 119
84 3300046455 Ga0495603_0185935 Ga0495603_0185935_264_626 119
85 3300046459 Ga0495629_0038826 Ga0495629_0038826_392_754 119
86 3300046462 Ga0495651_0022459 Ga0495651_0022459_1329_1691 119
87 3300046474 Ga0495605_0000054 Ga0495605_0000054_44405_44776 119
88 3300046491 Ga0495584_0183243 Ga0495584_0183243_520_891 119
89 3300046501 Ga0495607_0000036 Ga0495607_0000036_14831_15202 119
90 3300046507 Ga0495606_0000199 Ga0495606_0000199_74055_74435 119
91 3300046511 Ga0495608_0038316 Ga0495608_0038316_752_1114 119
92 3300046514 Ga0495618_0242767 Ga0495618_0242767_638_1000 119
93 3300046515 Ga0495620_0000136 Ga0495620_0000136_25353_25724 119
94 3300046529 Ga0495652_0069898 Ga0495652_0069898_1476_1838 119
95 3300046531 Ga0495665_0067027 Ga0495665_0067027_194_556 119
96 3300046533 Ga0495640_0034262 Ga0495640_0034262_2655_3017 119
97 3300046536 Ga0495587_0144041 Ga0495587_0144041_610_972 119
98 3300046543 Ga0495645_0075417 Ga0495645_0075417_1877_2239 119
99 3300046559 Ga0495667_0040977 Ga0495667_0040977_1400_1762 119
100 3300046642 Ga0495634_0314599 Ga0495634_0314599_409_771 119
101 3300046663 Ga0495635_0196896 Ga0495635_0196896_803_1165 119
102 3300046665 Ga0495661_0004291 Ga0495661_0004291_2546_2917 119
103 3300046679 Ga0495623_0027977 Ga0495623_0027977_195_557 119
104 3300046680 Ga0495646_0350640 Ga0495646_0350640_288_650 119
105 3300046683 Ga0495658_0100072 Ga0495658_0100072_64_426 119
106 3300046689 Ga0495613_0268002 Ga0495613_0268002_158_520 119
107 3300046809 Ga0495600_0015219 Ga0495600_0015219_2977_3339 119
108 3300047315 Ga0495581_0376258 Ga0495581_0376258_215_577 119
109 3300047317 Ga0495604_0090150 Ga0495604_0090150_1362_1724 119
110 3300047319 Ga0495674_0903933 Ga0495674_0903933_25_387 119
111 3300047322 Ga0495680_0230314 Ga0495680_0230314_86_448 119
112 3300047469 Ga0495673_0009612 Ga0495673_0009612_2371_2742 119
113 3300048088 Ga0495602_0059231 Ga0495602_0059231_2384_2746 119
114 3300048903 Ga0496100_0055226 Ga0496100_0055226_1690_2067 119
115 3300048904 Ga0496101_0043061 Ga0496101_0043061_299_676 119
116 3300048905 Ga0496102_0061563 Ga0496102_0061563_266_646 119
117 3300048905 Ga0496102_0115503 Ga0496102_0115503_496_873 119
118 3300048906 Ga0496103_0259328 Ga0496103_0259328_494_871 119
119 3300048909 Ga0496106_0032287 Ga0496106_0032287_2726_3103 119
120 3300048910 Ga0496107_0023030 Ga0496107_0023030_3394_3771 119
121 3300048912 Ga0496109_0911732 Ga0496109_0911732_81_458 119
122 3300048913 Ga0496110_0247205 Ga0496110_0247205_1248_1613 119
123 3300048917 Ga0496114_0693320 Ga0496114_0693320_82_459 119
124 3300048918 Ga0496115_0032424 Ga0496115_0032424_978_1355 119
125 3300048920 Ga0496117_0151355 Ga0496117_0151355_722_1102 119
126 3300048924 Ga0496121_0001087 Ga0496121_0001087_40202_40582 119
127 3300048925 Ga0496122_0518336 Ga0496122_0518336_94_474 119
128 3300048926 Ga0496123_0063037 Ga0496123_0063037_1629_2009 119
129 3300048927 Ga0496124_0000423 Ga0496124_0000423_31438_31818 119
130 3300049460 Ga0495682_0000025 Ga0495682_0000025_112895_113266 119
131 3300053077 Ga0495601_0079895 Ga0495601_0079895_920_1282 119
132 3300053084 Ga0495595_0098869 Ga0495595_0098869_902_1264 119
133 3300053085 Ga0495619_0079002 Ga0495619_0079002_1571_1933 119
134 3300053153 Ga0500616_0000964 Ga0500616_0000964_6204_6581 119
135 iso_pu_bacteria 2511231010 2511290283 119
136 iso_pu_bacteria 2600255318 2601799477 119
137 iso_pu_bacteria 2603880185 2606078289 119
138 iso_pu_bacteria 2603880199 2606130397 119
139 iso_pu_bacteria 2623620443 2624480448 119
140 iso_pu_bacteria 2713897149 2715759357 119
141 iso_pu_bacteria 2919063839 2919065260 119
142 iso_pu_bacteria 3007861166 3007861707 119
143 iso_pu_bacteria 8056177738 8056183938 119
144 3300003791 Ga0055530_10001135 Ga0055530_1000113512 120
145 3300003792 Ga0055540_1000008 Ga0055540_1000008228 120
146 3300003794 Ga0055531_10000242 Ga0055531_1000024210 120
147 3300005288 Ga0065714_10065188 Ga0065714_100651888 120
148 3300005441 Ga0070700_100520759 Ga0070700_1005207592 120
149 3300006946 Ga0079104_1051120 Ga0079104_10511202 120
150 3300009092 Ga0105250_10001249 Ga0105250_100012494 120
151 3300013104 Ga0157370_10171945 Ga0157370_101719451 120
152 3300013104 Ga0157370_10271641 Ga0157370_102716412 120
153 3300015265 Ga0182005_1002145 Ga0182005_10021453 120
154 3300017792 Ga0163161_10228167 Ga0163161_102281672 120
155 3300025291 Ga0209675_1009397 Ga0209675_10093972 120
156 3300025292 Ga0209676_1000002 Ga0209676_10000021344 120
157 3300025298 Ga0209050_1000006 Ga0209050_1000006226 120
158 3300025303 Ga0209051_1000001 Ga0209051_10000011344 120
159 3300025304 Ga0209257_1000029 Ga0209257_1000029226 120
160 3300025711 Ga0207696_1000830 Ga0207696_10008308 120
161 3300025711 Ga0207696_1018347 Ga0207696_10183474 120
162 3300025735 Ga0207713_1023423 Ga0207713_10234234 120
163 3300025735 Ga0207713_1042265 Ga0207713_10422652 120
164 3300025735 Ga0207713_1042280 Ga0207713_10422802 120
165 3300027111 Ga0209281_1032564 Ga0209281_10325641 120
166 3300031344 Ga0265316_10728227 Ga0265316_107282272 120
167 3300041407 Ga0439447_009420 Ga0439447_009420_2503_2895 120
168 3300041411 Ga0439466_0070446 Ga0439466_0070446_508_900 120
169 3300042013 Ga0439456_006060 Ga0439456_006060_1174_1566 120
170 3300042115 Ga0450911_001328 Ga0450911_001328_3303_3695 120
171 3300042139 Ga0450904_000079 Ga0450904_000079_9507_9899 120
172 3300046453 Ga0495627_009751 Ga0495627_009751_1620_2027 120
173 3300046460 Ga0495638_0000842 Ga0495638_0000842_4959_5351 120
174 3300046460 Ga0495638_0001095 Ga0495638_0001095_19029_19421 120
175 3300046471 Ga0495650_0012440 Ga0495650_0012440_3580_3987 120
176 3300046491 Ga0495584_0000438 Ga0495584_0000438_11402_11809 120
177 3300046491 Ga0495584_0025712 Ga0495584_0025712_2273_2665 120
178 3300046492 Ga0495585_0000498 Ga0495585_0000498_30677_31069 120
179 3300046507 Ga0495606_0001473 Ga0495606_0001473_12486_12893 120
180 3300046512 Ga0495610_0078147 Ga0495610_0078147_276_668 120
181 3300046513 Ga0495616_0024711 Ga0495616_0024711_333_725 120
182 3300046515 Ga0495620_0000095 Ga0495620_0000095_23305_23712 120
183 3300046518 Ga0495631_0001725 Ga0495631_0001725_12052_12459 120
184 3300046519 Ga0495632_0001145 Ga0495632_0001145_9774_10181 120
185 3300046519 Ga0495632_0011016 Ga0495632_0011016_4198_4590 120
186 3300046520 Ga0495637_0000363 Ga0495637_0000363_12222_12629 120
187 3300046520 Ga0495637_0007836 Ga0495637_0007836_1064_1456 120
188 3300046522 Ga0495643_0076959 Ga0495643_0076959_1268_1660 120
189 3300046530 Ga0495654_0008687 Ga0495654_0008687_904_1296 120
190 3300046530 Ga0495654_0223394 Ga0495654_0223394_336_728 120
191 3300046538 Ga0495609_0000160 Ga0495609_0000160_23010_23417 120
192 3300046542 Ga0495597_0002975 Ga0495597_0002975_5255_5647 120
193 3300046542 Ga0495597_0015654 Ga0495597_0015654_2629_3003 120
194 3300046557 Ga0495622_0114093 Ga0495622_0114093_718_1092 120
195 3300046616 Ga0495668_0352547 Ga0495668_0352547_316_723 120
196 3300046660 Ga0495625_0002208 Ga0495625_0002208_12273_12680 120
197 3300046660 Ga0495625_0289544 Ga0495625_0289544_75_467 120
198 3300046665 Ga0495661_0013543 Ga0495661_0013543_2319_2711 120
199 3300046694 Ga0495649_0000495 Ga0495649_0000495_21081_21488 120
200 3300046694 Ga0495649_0024812 Ga0495649_0024812_14_388 120
201 3300046794 Ga0495589_0000239 Ga0495589_0000239_23561_23968 120
202 3300046810 Ga0495660_0004785 Ga0495660_0004785_6398_6805 120
203 3300047470 Ga0495681_0000234 Ga0495681_0000234_23557_23964 120
204 3300047470 Ga0495681_0022099 Ga0495681_0022099_2570_2962 120
205 3300047472 Ga0495686_0000636 Ga0495686_0000636_29257_29649 120
206 3300048920 Ga0496117_0071323 Ga0496117_0071323_447_866 120
207 3300048921 Ga0496118_0102888 Ga0496118_0102888_128_547 120
208 3300048924 Ga0496121_0150175 Ga0496121_0150175_951_1325 120
209 3300049459 Ga0495678_001152 Ga0495678_001152_12177_12584 120
210 3300053139 Ga0500568_0078911 Ga0500568_0078911_510_902 120
211 iso_pu_bacteria 2643221565 2643846128 120
212 iso_pu_bacteria 2849560528 2849563506 120
213 iso_pu_bacteria 2851153111 2851157886 120
214 2209111006 2214850756 2213895385 121
215 3300005288 Ga0065714_10014890 Ga0065714_100148902 121
216 3300005289 Ga0065704_10583659 Ga0065704_105836591 121
217 3300005328 Ga0070676_10162671 Ga0070676_101626713 121
218 3300005328 Ga0070676_10401704 Ga0070676_104017041 121
219 3300005329 Ga0070683_100363425 Ga0070683_1003634252 121
220 3300005330 Ga0070690_100393593 Ga0070690_1003935931 121
221 3300005331 Ga0070670_100003347 Ga0070670_1000033476 121
222 3300005331 Ga0070670_100421784 Ga0070670_1004217841 121
223 3300005334 Ga0068869_101051392 Ga0068869_1010513921 121
224 3300005334 Ga0068869_101751541 Ga0068869_1017515411 121
225 3300005335 Ga0070666_10005529 Ga0070666_100055298 121
226 3300005335 Ga0070666_10208862 Ga0070666_102088621 121
227 3300005336 Ga0070680_100057430 Ga0070680_1000574304 121
228 3300005336 Ga0070680_101915847 Ga0070680_1019158471 121
229 3300005337 Ga0070682_100020338 Ga0070682_1000203382 121
230 3300005337 Ga0070682_101473187 Ga0070682_1014731871 121
231 3300005338 Ga0068868_100038627 Ga0068868_1000386273 121
232 3300005338 Ga0068868_100424460 Ga0068868_1004244601 121
233 3300005338 Ga0068868_100582735 Ga0068868_1005827352 121
234 3300005340 Ga0070689_100023332 Ga0070689_1000233322 121
235 3300005340 Ga0070689_100255578 Ga0070689_1002555782 121
236 3300005341 Ga0070691_10636117 Ga0070691_106361172 121
237 3300005344 Ga0070661_100090445 Ga0070661_1000904452 121
238 3300005344 Ga0070661_100283490 Ga0070661_1002834902 121
239 3300005344 Ga0070661_100440372 Ga0070661_1004403721 121
240 3300005345 Ga0070692_10595238 Ga0070692_105952382 121
241 3300005347 Ga0070668_100166802 Ga0070668_1001668023 121
242 3300005347 Ga0070668_100177451 Ga0070668_1001774512 121
243 3300005354 Ga0070675_100028633 Ga0070675_1000286333 121
244 3300005354 Ga0070675_100040864 Ga0070675_1000408643 121
245 3300005355 Ga0070671_100006876 Ga0070671_1000068763 121
246 3300005356 Ga0070674_100242059 Ga0070674_1002420592 121
247 3300005356 Ga0070674_100500579 Ga0070674_1005005791 121
248 3300005356 Ga0070674_100508834 Ga0070674_1005088342 121
249 3300005356 Ga0070674_100680090 Ga0070674_1006800902 121
250 3300005364 Ga0070673_100018919 Ga0070673_1000189191 121
251 3300005364 Ga0070673_100045737 Ga0070673_1000457373 121
252 3300005364 Ga0070673_100387190 Ga0070673_1003871902 121
253 3300005364 Ga0070673_100429997 Ga0070673_1004299972 121
254 3300005364 Ga0070673_101348922 Ga0070673_1013489222 121
255 3300005365 Ga0070688_100011841 Ga0070688_1000118411 121
256 3300005366 Ga0070659_100077706 Ga0070659_1000777063 121
257 3300005366 Ga0070659_100225409 Ga0070659_1002254092 121
258 3300005366 Ga0070659_100468208 Ga0070659_1004682082 121
259 3300005367 Ga0070667_100109225 Ga0070667_1001092252 121
260 3300005367 Ga0070667_100331251 Ga0070667_1003312512 121
261 3300005434 Ga0070709_10001257 Ga0070709_1000125711 121
262 3300005434 Ga0070709_11118234 Ga0070709_111182342 121
263 3300005435 Ga0070714_100264708 Ga0070714_1002647082 121
264 3300005435 Ga0070714_100940867 Ga0070714_1009408672 121
265 3300005436 Ga0070713_100000374 Ga0070713_10000037416 121
266 3300005436 Ga0070713_100161826 Ga0070713_1001618262 121
267 3300005436 Ga0070713_100193160 Ga0070713_1001931601 121
268 3300005437 Ga0070710_10022882 Ga0070710_100228822 121
269 3300005437 Ga0070710_10089362 Ga0070710_100893622 121
270 3300005437 Ga0070710_10271507 Ga0070710_102715071 121
271 3300005439 Ga0070711_100025801 Ga0070711_1000258011 121
272 3300005439 Ga0070711_100117107 Ga0070711_1001171072 121
273 3300005439 Ga0070711_100164344 Ga0070711_1001643442 121
274 3300005440 Ga0070705_100025237 Ga0070705_1000252373 121
275 3300005440 Ga0070705_100198912 Ga0070705_1001989122 121
276 3300005440 Ga0070705_100375552 Ga0070705_1003755522 121
277 3300005444 Ga0070694_100017044 Ga0070694_1000170445 121
278 3300005444 Ga0070694_100480475 Ga0070694_1004804751 121
279 3300005455 Ga0070663_100004752 Ga0070663_1000047524 121
280 3300005455 Ga0070663_100006279 Ga0070663_1000062795 121
281 3300005455 Ga0070663_100120852 Ga0070663_1001208522 121
282 3300005455 Ga0070663_100497881 Ga0070663_1004978812 121
283 3300005455 Ga0070663_100771108 Ga0070663_1007711081 121
284 3300005456 Ga0070678_100001680 Ga0070678_1000016808 121
285 3300005456 Ga0070678_100092383 Ga0070678_1000923832 121
286 3300005456 Ga0070678_100191340 Ga0070678_1001913402 121
287 3300005456 Ga0070678_100866919 Ga0070678_1008669192 121
288 3300005456 Ga0070678_101667579 Ga0070678_1016675791 121
289 3300005457 Ga0070662_100168705 Ga0070662_1001687051 121
290 3300005457 Ga0070662_100813318 Ga0070662_1008133181 121
291 3300005457 Ga0070662_101342486 Ga0070662_1013424861 121
292 3300005457 Ga0070662_101697874 Ga0070662_1016978741 121
293 3300005458 Ga0070681_10087903 Ga0070681_100879031 121
294 3300005458 Ga0070681_10211862 Ga0070681_102118622 121
295 3300005459 Ga0068867_100286247 Ga0068867_1002862472 121
296 3300005466 Ga0070685_10045113 Ga0070685_100451132 121
297 3300005466 Ga0070685_10923808 Ga0070685_109238081 121
298 3300005468 Ga0070707_100545061 Ga0070707_1005450611 121
299 3300005530 Ga0070679_100014128 Ga0070679_1000141287 121
300 3300005530 Ga0070679_100096085 Ga0070679_1000960852 121
301 3300005535 Ga0070684_100028831 Ga0070684_1000288315 121
302 3300005539 Ga0068853_100015623 Ga0068853_1000156234 121
303 3300005539 Ga0068853_101720981 Ga0068853_1017209811 121
304 3300005543 Ga0070672_100469277 Ga0070672_1004692771 121
305 3300005544 Ga0070686_100008801 Ga0070686_1000088017 121
306 3300005544 Ga0070686_100884531 Ga0070686_1008845311 121
307 3300005544 Ga0070686_101132796 Ga0070686_1011327962 121
308 3300005545 Ga0070695_100386328 Ga0070695_1003863281 121
309 3300005545 Ga0070695_100735282 Ga0070695_1007352822 121
310 3300005546 Ga0070696_100096185 Ga0070696_1000961853 121
311 3300005547 Ga0070693_100003700 Ga0070693_1000037003 121
312 3300005547 Ga0070693_100045294 Ga0070693_1000452942 121
313 3300005548 Ga0070665_100934358 Ga0070665_1009343582 121
314 3300005548 Ga0070665_102066152 Ga0070665_1020661521 121
315 3300005549 Ga0070704_100362004 Ga0070704_1003620042 121
316 3300005563 Ga0068855_100095497 Ga0068855_1000954974 121
317 3300005564 Ga0070664_100259116 Ga0070664_1002591162 121
318 3300005564 Ga0070664_100639438 Ga0070664_1006394382 121
319 3300005564 Ga0070664_101553732 Ga0070664_1015537321 121
320 3300005578 Ga0068854_100479261 Ga0068854_1004792612 121
321 3300005614 Ga0068856_100293887 Ga0068856_1002938872 121
322 3300005614 Ga0068856_100399720 Ga0068856_1003997202 121
323 3300005614 Ga0068856_100745133 Ga0068856_1007451332 121
324 3300005614 Ga0068856_101070301 Ga0068856_1010703012 121
325 3300005615 Ga0070702_100015364 Ga0070702_1000153643 121
326 3300005617 Ga0068859_100156223 Ga0068859_1001562232 121
327 3300005618 Ga0068864_100059734 Ga0068864_1000597342 121
328 3300005718 Ga0068866_10053271 Ga0068866_100532712 121
329 3300005718 Ga0068866_10407214 Ga0068866_104072142 121
330 3300005718 Ga0068866_11010074 Ga0068866_110100741 121
331 3300005719 Ga0068861_101251162 Ga0068861_1012511622 121
332 3300005840 Ga0068870_10195448 Ga0068870_101954482 121
333 3300005842 Ga0068858_100045177 Ga0068858_1000451771 121
334 3300005842 Ga0068858_100157469 Ga0068858_1001574692 121
335 3300005842 Ga0068858_100292027 Ga0068858_1002920272 121
336 3300005842 Ga0068858_100382227 Ga0068858_1003822272 121
337 3300005843 Ga0068860_100056891 Ga0068860_1000568913 121
338 3300005844 Ga0068862_102131832 Ga0068862_1021318321 121
339 3300006028 Ga0070717_10007141 Ga0070717_100071412 121
340 3300006028 Ga0070717_10273133 Ga0070717_102731333 121
341 3300006163 Ga0070715_10517003 Ga0070715_105170031 121
342 3300006173 Ga0070716_100281784 Ga0070716_1002817842 121
343 3300006173 Ga0070716_100293371 Ga0070716_1002933712 121
344 3300006175 Ga0070712_100059255 Ga0070712_1000592553 121
345 3300006175 Ga0070712_100106363 Ga0070712_1001063632 121
346 3300006175 Ga0070712_100586280 Ga0070712_1005862802 121
347 3300006237 Ga0097621_100015177 Ga0097621_1000151775 121
348 3300006237 Ga0097621_100071730 Ga0097621_1000717301 121
349 3300006237 Ga0097621_100410007 Ga0097621_1004100072 121
350 3300006358 Ga0068871_100005428 Ga0068871_1000054287 121
351 3300006358 Ga0068871_100095207 Ga0068871_1000952072 121
352 3300006358 Ga0068871_100216396 Ga0068871_1002163962 121
353 3300006871 Ga0075434_100208594 Ga0075434_1002085942 121
354 3300006881 Ga0068865_100067848 Ga0068865_1000678483 121
355 3300006881 Ga0068865_100427472 Ga0068865_1004274722 121
356 3300006881 Ga0068865_100780565 Ga0068865_1007805652 121
357 3300006881 Ga0068865_100794996 Ga0068865_1007949962 121
358 3300006881 Ga0068865_101062156 Ga0068865_1010621561 121
359 3300006914 Ga0075436_100102335 Ga0075436_1001023352 121
360 3300006914 Ga0075436_100488962 Ga0075436_1004889622 121
361 3300006931 Ga0097620_100156229 Ga0097620_1001562293 121
362 3300009011 Ga0105251_10003490 Ga0105251_100034908 121
363 3300009011 Ga0105251_10076536 Ga0105251_100765362 121
364 3300009036 Ga0105244_10111259 Ga0105244_101112592 121
365 3300009093 Ga0105240_10278491 Ga0105240_102784913 121
366 3300009093 Ga0105240_10820836 Ga0105240_108208362 121
367 3300009098 Ga0105245_10046365 Ga0105245_100463651 121
368 3300009098 Ga0105245_10768731 Ga0105245_107687311 121
369 3300009098 Ga0105245_10909330 Ga0105245_109093301 121
370 3300009101 Ga0105247_10219702 Ga0105247_102197022 121
371 3300009101 Ga0105247_10512269 Ga0105247_105122692 121
372 3300009101 Ga0105247_10595158 Ga0105247_105951581 121
373 3300009148 Ga0105243_10084054 Ga0105243_100840543 121
374 3300009148 Ga0105243_10377470 Ga0105243_103774703 121
375 3300009148 Ga0105243_11495491 Ga0105243_114954911 121
376 3300009174 Ga0105241_10051739 Ga0105241_100517393 121
377 3300009174 Ga0105241_10216234 Ga0105241_102162342 121
378 3300009174 Ga0105241_10327163 Ga0105241_103271631 121
379 3300009176 Ga0105242_10052542 Ga0105242_100525425 121
380 3300009176 Ga0105242_10060494 Ga0105242_100604942 121
381 3300009176 Ga0105242_10071848 Ga0105242_100718483 121
382 3300009176 Ga0105242_10956899 Ga0105242_109568992 121
383 3300009177 Ga0105248_10198325 Ga0105248_101983252 121
384 3300009177 Ga0105248_10458518 Ga0105248_104585182 121
385 3300009177 Ga0105248_11752089 Ga0105248_117520891 121
386 3300009545 Ga0105237_10125972 Ga0105237_101259723 121
387 3300009545 Ga0105237_10384688 Ga0105237_103846882 121
388 3300009551 Ga0105238_10073909 Ga0105238_100739093 121
389 3300009551 Ga0105238_10368596 Ga0105238_103685961 121
390 3300009551 Ga0105238_10852742 Ga0105238_108527422 121
391 3300009553 Ga0105249_10077845 Ga0105249_100778453 121
392 3300009553 Ga0105249_10187907 Ga0105249_101879073 121
393 3300009553 Ga0105249_13491419 Ga0105249_134914191 121
394 3300010375 Ga0105239_10110277 Ga0105239_101102772 121
395 3300010375 Ga0105239_10191679 Ga0105239_101916792 121
396 3300010375 Ga0105239_10308607 Ga0105239_103086072 121
397 3300010375 Ga0105239_10546437 Ga0105239_105464372 121
398 3300010375 Ga0105239_12890599 Ga0105239_128905991 121
399 3300011119 Ga0105246_10032880 Ga0105246_100328803 121
400 3300011119 Ga0105246_10205263 Ga0105246_102052632 121
401 3300011119 Ga0105246_10732624 Ga0105246_107326242 121
402 3300012500 Ga0157314_1005454 Ga0157314_10054542 121
403 3300013100 Ga0157373_10883073 Ga0157373_108830731 121
404 3300013102 Ga0157371_10226064 Ga0157371_102260642 121
405 3300013102 Ga0157371_11368106 Ga0157371_113681061 121
406 3300013105 Ga0157369_10227818 Ga0157369_102278183 121
407 3300013296 Ga0157374_10346892 Ga0157374_103468921 121
408 3300013296 Ga0157374_10729637 Ga0157374_107296372 121
409 3300013297 Ga0157378_10024975 Ga0157378_100249752 121
410 3300013297 Ga0157378_10028933 Ga0157378_100289334 121
411 3300013297 Ga0157378_10564098 Ga0157378_105640982 121
412 3300013306 Ga0163162_10214069 Ga0163162_102140693 121
413 3300013306 Ga0163162_10476432 Ga0163162_104764322 121
414 3300013307 Ga0157372_10177133 Ga0157372_101771332 121
415 3300013308 Ga0157375_10096569 Ga0157375_100965693 121
416 3300013308 Ga0157375_10428019 Ga0157375_104280192 121
417 3300014325 Ga0163163_10041194 Ga0163163_100411944 121
418 3300014326 Ga0157380_10225731 Ga0157380_102257312 121
419 3300014497 Ga0182008_10032593 Ga0182008_100325933 121
420 3300014497 Ga0182008_10859436 Ga0182008_108594362 121
421 3300014968 Ga0157379_10158612 Ga0157379_101586123 121
422 3300014969 Ga0157376_10109346 Ga0157376_101093463 121
423 3300014969 Ga0157376_10288237 Ga0157376_102882371 121
424 3300014969 Ga0157376_10410243 Ga0157376_104102432 121
425 3300014969 Ga0157376_12588404 Ga0157376_125884041 121
426 3300015265 Ga0182005_1012712 Ga0182005_10127123 121
427 3300017792 Ga0163161_10155334 Ga0163161_101553342 121
428 3300017792 Ga0163161_10308462 Ga0163161_103084621 121
429 3300017792 Ga0163161_10846124 Ga0163161_108461241 121
430 3300020070 Ga0206356_10275917 Ga0206356_102759171 121
431 3300021361 Ga0213872_10000200 Ga0213872_1000020022 121
432 3300021361 Ga0213872_10047353 Ga0213872_100473532 121
433 3300025728 Ga0207655_1005592 Ga0207655_10055922 121
434 3300025735 Ga0207713_1000243 Ga0207713_100024364 121
435 3300025735 Ga0207713_1006378 Ga0207713_10063788 121
436 3300025898 Ga0207692_10018584 Ga0207692_100185843 121
437 3300025898 Ga0207692_10130373 Ga0207692_101303732 121
438 3300025899 Ga0207642_10046105 Ga0207642_100461051 121
439 3300025900 Ga0207710_10049105 Ga0207710_100491053 121
440 3300025900 Ga0207710_10141056 Ga0207710_101410562 121
441 3300025901 Ga0207688_10009920 Ga0207688_100099204 121
442 3300025903 Ga0207680_10068729 Ga0207680_100687293 121
443 3300025903 Ga0207680_10228328 Ga0207680_102283283 121
444 3300025904 Ga0207647_10007334 Ga0207647_100073344 121
445 3300025905 Ga0207685_10101510 Ga0207685_101015102 121
446 3300025906 Ga0207699_10032006 Ga0207699_100320063 121
447 3300025906 Ga0207699_10050300 Ga0207699_100503003 121
448 3300025906 Ga0207699_10196074 Ga0207699_101960741 121
449 3300025907 Ga0207645_10065079 Ga0207645_100650793 121
450 3300025907 Ga0207645_10630041 Ga0207645_106300411 121
451 3300025911 Ga0207654_10131415 Ga0207654_101314152 121
452 3300025911 Ga0207654_10204484 Ga0207654_102044842 121
453 3300025911 Ga0207654_11229144 Ga0207654_112291441 121
454 3300025912 Ga0207707_10022287 Ga0207707_100222877 121
455 3300025912 Ga0207707_10166213 Ga0207707_101662132 121
456 3300025913 Ga0207695_10328974 Ga0207695_103289742 121
457 3300025913 Ga0207695_11094316 Ga0207695_110943162 121
458 3300025914 Ga0207671_10094841 Ga0207671_100948414 121
459 3300025914 Ga0207671_10254540 Ga0207671_102545402 121
460 3300025914 Ga0207671_10344692 Ga0207671_103446921 121
461 3300025915 Ga0207693_10019086 Ga0207693_100190862 121
462 3300025915 Ga0207693_10078213 Ga0207693_100782132 121
463 3300025915 Ga0207693_10864050 Ga0207693_108640501 121
464 3300025915 Ga0207693_10922971 Ga0207693_109229711 121
465 3300025916 Ga0207663_10059650 Ga0207663_100596503 121
466 3300025916 Ga0207663_10128641 Ga0207663_101286412 121
467 3300025916 Ga0207663_10586118 Ga0207663_105861182 121
468 3300025917 Ga0207660_10113593 Ga0207660_101135932 121
469 3300025917 Ga0207660_10190011 Ga0207660_101900111 121
470 3300025917 Ga0207660_11322970 Ga0207660_113229701 121
471 3300025919 Ga0207657_10013452 Ga0207657_100134524 121
472 3300025920 Ga0207649_10214582 Ga0207649_102145822 121
473 3300025920 Ga0207649_10352910 Ga0207649_103529101 121
474 3300025921 Ga0207652_10062545 Ga0207652_100625453 121
475 3300025922 Ga0207646_10613360 Ga0207646_106133601 121
476 3300025924 Ga0207694_10137815 Ga0207694_101378151 121
477 3300025924 Ga0207694_10671011 Ga0207694_106710112 121
478 3300025925 Ga0207650_10003393 Ga0207650_100033939 121
479 3300025927 Ga0207687_10015342 Ga0207687_100153421 121
480 3300025927 Ga0207687_10062423 Ga0207687_100624232 121
481 3300025928 Ga0207700_10004890 Ga0207700_100048902 121
482 3300025928 Ga0207700_10219630 Ga0207700_102196303 121
483 3300025928 Ga0207700_10587976 Ga0207700_105879762 121
484 3300025929 Ga0207664_10017822 Ga0207664_100178228 121
485 3300025931 Ga0207644_10006011 Ga0207644_100060112 121
486 3300025931 Ga0207644_10056236 Ga0207644_100562363 121
487 3300025932 Ga0207690_10159609 Ga0207690_101596092 121
488 3300025933 Ga0207706_10075392 Ga0207706_100753923 121
489 3300025933 Ga0207706_10514818 Ga0207706_105148182 121
490 3300025933 Ga0207706_10533288 Ga0207706_105332882 121
491 3300025934 Ga0207686_10197940 Ga0207686_101979402 121
492 3300025934 Ga0207686_10365618 Ga0207686_103656182 121
493 3300025934 Ga0207686_11409547 Ga0207686_114095471 121
494 3300025936 Ga0207670_10050284 Ga0207670_100502844 121
495 3300025937 Ga0207669_10129493 Ga0207669_101294931 121
496 3300025938 Ga0207704_10339513 Ga0207704_103395132 121
497 3300025938 Ga0207704_10629900 Ga0207704_106299002 121
498 3300025938 Ga0207704_11404798 Ga0207704_114047981 121
499 3300025939 Ga0207665_10009568 Ga0207665_100095682 121
500 3300025939 Ga0207665_10047429 Ga0207665_100474293 121
501 3300025940 Ga0207691_11719012 Ga0207691_117190121 121
502 3300025941 Ga0207711_10149269 Ga0207711_101492692 121
503 3300025941 Ga0207711_10265132 Ga0207711_102651323 121
504 3300025941 Ga0207711_10397571 Ga0207711_103975712 121
505 3300025941 Ga0207711_11319315 Ga0207711_113193151 121
506 3300025942 Ga0207689_10063790 Ga0207689_100637904 121
507 3300025942 Ga0207689_11097309 Ga0207689_110973091 121
508 3300025944 Ga0207661_10758085 Ga0207661_107580851 121
509 3300025945 Ga0207679_10037485 Ga0207679_100374852 121
510 3300025945 Ga0207679_10123058 Ga0207679_101230582 121
511 3300025949 Ga0207667_11460497 Ga0207667_114604971 121
512 3300025960 Ga0207651_10512526 Ga0207651_105125262 121
513 3300025961 Ga0207712_10232519 Ga0207712_102325192 121
514 3300025961 Ga0207712_11506306 Ga0207712_115063061 121
515 3300025972 Ga0207668_10126264 Ga0207668_101262642 121
516 3300025972 Ga0207668_10314182 Ga0207668_103141821 121
517 3300025972 Ga0207668_11098180 Ga0207668_110981801 121
518 3300025981 Ga0207640_10602058 Ga0207640_106020582 121
519 3300025986 Ga0207658_10049195 Ga0207658_100491953 121
520 3300025986 Ga0207658_10312853 Ga0207658_103128532 121
521 3300026023 Ga0207677_10032034 Ga0207677_100320343 121
522 3300026035 Ga0207703_10045571 Ga0207703_100455712 121
523 3300026035 Ga0207703_10356628 Ga0207703_103566282 121
524 3300026035 Ga0207703_10567789 Ga0207703_105677892 121
525 3300026035 Ga0207703_10651041 Ga0207703_106510411 121
526 3300026041 Ga0207639_10036106 Ga0207639_100361064 121
527 3300026041 Ga0207639_11599415 Ga0207639_115994151 121
528 3300026067 Ga0207678_10000262 Ga0207678_1000026220 121
529 3300026067 Ga0207678_10003507 Ga0207678_100035078 121
530 3300026067 Ga0207678_10028571 Ga0207678_100285712 121
531 3300026067 Ga0207678_10230494 Ga0207678_102304942 121
532 3300026067 Ga0207678_10683779 Ga0207678_106837791 121
533 3300026075 Ga0207708_10184872 Ga0207708_101848721 121
534 3300026078 Ga0207702_10821172 Ga0207702_108211722 121
535 3300026078 Ga0207702_11118528 Ga0207702_111185282 121
536 3300026088 Ga0207641_10062948 Ga0207641_100629484 121
537 3300026088 Ga0207641_10648662 Ga0207641_106486622 121
538 3300026089 Ga0207648_10818418 Ga0207648_108184182 121
539 3300026089 Ga0207648_10906607 Ga0207648_109066072 121
540 3300026095 Ga0207676_11464389 Ga0207676_114643891 121
541 3300026116 Ga0207674_11044445 Ga0207674_110444452 121
542 3300026121 Ga0207683_10007540 Ga0207683_100075404 121
543 3300026121 Ga0207683_10191881 Ga0207683_101918812 121
544 3300026121 Ga0207683_10221434 Ga0207683_102214342 121
545 3300026121 Ga0207683_10490671 Ga0207683_104906712 121
546 3300026121 Ga0207683_10692815 Ga0207683_106928151 121
547 3300028379 Ga0268266_10000419 Ga0268266_100004193 121
548 3300028379 Ga0268266_10007719 Ga0268266_100077192 121
549 3300028379 Ga0268266_10032170 Ga0268266_100321701 121
550 3300028379 Ga0268266_10259075 Ga0268266_102590752 121
551 3300028381 Ga0268264_10039627 Ga0268264_100396273 121
552 3300028381 Ga0268264_10062262 Ga0268264_100622621 121
553 3300031616 Ga0307508_10088081 Ga0307508_100880812 121
554 3300033179 Ga0307507_10213162 Ga0307507_102131622 121
555 3300034816 Ga0373930_0048085 Ga0373930_0048085_279_644 121
556 3300034819 Ga0373958_0023273 Ga0373958_0023273_703_1068 121
557 3300035083 Ga0373926_0054469 Ga0373926_0054469_840_1205 121
558 3300035083 Ga0373926_0143526 Ga0373926_0143526_264_629 121
559 3300035084 Ga0373928_0008886 Ga0373928_0008886_626_991 121
560 3300035084 Ga0373928_0050631 Ga0373928_0050631_209_574 121
561 3300035084 Ga0373928_0228974 Ga0373928_0228974_162_527 121
562 3300035086 Ga0373934_0060202 Ga0373934_0060202_633_998 121
563 3300035088 Ga0373940_0135916 Ga0373940_0135916_36_401 121
564 3300035089 Ga0373944_0002962 Ga0373944_0002962_3266_3631 121
565 3300035089 Ga0373944_0003642 Ga0373944_0003642_3438_3863 121
566 3300035090 Ga0373949_0007653 Ga0373949_0007653_1928_2293 121
567 3300035091 Ga0373951_0026913 Ga0373951_0026913_178_543 121
568 3300035092 Ga0373952_0073413 Ga0373952_0073413_171_536 121
569 3300035111 Ga0373923_0005750 Ga0373923_0005750_2415_2780 121
570 3300035112 Ga0373932_0058629 Ga0373932_0058629_527_892 121
571 3300035113 Ga0373936_0092759 Ga0373936_0092759_472_897 121
572 3300035114 Ga0373939_0041966 Ga0373939_0041966_805_1170 121
573 3300035115 Ga0373941_0012175 Ga0373941_0012175_900_1265 121
574 3300035116 Ga0373945_0012871 Ga0373945_0012871_2267_2632 121
575 3300035116 Ga0373945_0309630 Ga0373945_0309630_48_413 121
576 3300035118 Ga0373954_0007152 Ga0373954_0007152_294_659 121
577 3300035119 Ga0373956_0088696 Ga0373956_0088696_761_1126 121
578 3300035120 Ga0373957_0005746 Ga0373957_0005746_2306_2671 121
579 3300035121 Ga0373960_0242430 Ga0373960_0242430_18_383 121
580 3300035170 Ga0373943_0001305 Ga0373943_0001305_7673_8038 121
581 3300035170 Ga0373943_0010781 Ga0373943_0010781_2531_2896 121
582 3300035171 Ga0373946_0017815 Ga0373946_0017815_644_1009 121
583 3300035171 Ga0373946_0245829 Ga0373946_0245829_331_696 121
584 3300035172 Ga0373955_0062239 Ga0373955_0062239_1481_1846 121
585 3300035172 Ga0373955_0077543 Ga0373955_0077543_912_1277 121
586 3300035241 Ga0373961_0025714 Ga0373961_0025714_29_394 121
587 3300035410 Ga0373924_0171588 Ga0373924_0171588_448_813 121
588 3300035691 Ga0373931_0018223 Ga0373931_0018223_312_677 121
589 3300035691 Ga0373931_0064180 Ga0373931_0064180_1272_1637 121
590 3300035692 Ga0373935_0003279 Ga0373935_0003279_7984_8349 121
591 3300035692 Ga0373935_0162398 Ga0373935_0162398_461_826 121
592 3300035692 Ga0373935_0420121 Ga0373935_0420121_19_384 121
593 3300035695 Ga0373927_0037544 Ga0373927_0037544_703_1068 121
594 3300035724 Ga0373933_0011439 Ga0373933_0011439_497_862 121
595 3300035724 Ga0373933_0085990 Ga0373933_0085990_1322_1687 121
596 3300035725 Ga0373947_0000340 Ga0373947_0000340_81_446 121
597 3300035725 Ga0373947_0118844 Ga0373947_0118844_268_633 121
598 3300035725 Ga0373947_0438011 Ga0373947_0438011_32_397 121
599 3300036401 Ga0373937_0001302 Ga0373937_0001302_6426_6791 121
600 3300036401 Ga0373937_0044446 Ga0373937_0044446_405_770 121
601 3300037068 Ga0373925_0100828 Ga0373925_0100828_1111_1476 121
602 3300039447 Ga0436361_0446726 Ga0436361_0446726_1250_1672 121
603 3300039447 Ga0436361_1020246 Ga0436361_1020246_1762_2148 121
604 3300041405 Ga0439438_024115 Ga0439438_024115_83_481 121
605 3300041411 Ga0439466_0020787 Ga0439466_0020787_1251_1631 121
606 3300042010 Ga0439452_000239 Ga0439452_000239_21683_22081 121
607 3300042013 Ga0439456_031600 Ga0439456_031600_107_505 121
608 3300042115 Ga0450911_001897 Ga0450911_001897_1061_1456 121
609 3300042137 Ga0450902_007716 Ga0450902_007716_1179_1559 121
610 3300042142 Ga0450905_015150 Ga0450905_015150_374_772 121
611 3300046452 Ga0495617_001653 Ga0495617_001653_757_1155 121
612 3300046452 Ga0495617_011581 Ga0495617_011581_1411_1836 121
613 3300046452 Ga0495617_089138 Ga0495617_089138_160_525 121
614 3300046453 Ga0495627_021912 Ga0495627_021912_851_1234 121
615 3300046454 Ga0495592_0016424 Ga0495592_0016424_400_765 121
616 3300046454 Ga0495592_0027610 Ga0495592_0027610_3811_4176 121
617 3300046455 Ga0495603_0014210 Ga0495603_0014210_1710_2075 121
618 3300046455 Ga0495603_0026165 Ga0495603_0026165_1898_2263 121
619 3300046455 Ga0495603_0803066 Ga0495603_0803066_50_415 121
620 3300046457 Ga0495590_0003032 Ga0495590_0003032_3378_3758 121
621 3300046457 Ga0495590_0005330 Ga0495590_0005330_4096_4494 121
622 3300046458 Ga0495591_000049 Ga0495591_000049_13107_13505 121
623 3300046458 Ga0495591_005658 Ga0495591_005658_2824_3249 121
624 3300046458 Ga0495591_031438 Ga0495591_031438_1163_1543 121
625 3300046459 Ga0495629_0000253 Ga0495629_0000253_42131_42496 121
626 3300046459 Ga0495629_0031625 Ga0495629_0031625_176_541 121
627 3300046459 Ga0495629_0037747 Ga0495629_0037747_2806_3171 121
628 3300046460 Ga0495638_0003569 Ga0495638_0003569_1928_2308 121
629 3300046460 Ga0495638_0004165 Ga0495638_0004165_4927_5319 121
630 3300046460 Ga0495638_0009019 Ga0495638_0009019_3544_3969 121
631 3300046460 Ga0495638_0021382 Ga0495638_0021382_3810_4190 121
632 3300046460 Ga0495638_0026703 Ga0495638_0026703_1254_1652 121
633 3300046461 Ga0495641_0011612 Ga0495641_0011612_2792_3157 121
634 3300046462 Ga0495651_0007189 Ga0495651_0007189_4850_5215 121
635 3300046463 Ga0495653_0090847 Ga0495653_0090847_467_832 121
636 3300046463 Ga0495653_0117173 Ga0495653_0117173_1394_1759 121
637 3300046471 Ga0495650_0001581 Ga0495650_0001581_11907_12287 121
638 3300046471 Ga0495650_0002179 Ga0495650_0002179_13382_13780 121
639 3300046471 Ga0495650_0025453 Ga0495650_0025453_1382_1807 121
640 3300046472 Ga0495580_0027657 Ga0495580_0027657_1000_1365 121
641 3300046472 Ga0495580_0136359 Ga0495580_0136359_1207_1572 121
642 3300046472 Ga0495580_0523913 Ga0495580_0523913_388_753 121
643 3300046473 Ga0495582_0010154 Ga0495582_0010154_3235_3600 121
644 3300046473 Ga0495582_0489602 Ga0495582_0489602_178_543 121
645 3300046474 Ga0495605_0013312 Ga0495605_0013312_2423_2848 121
646 3300046474 Ga0495605_0179597 Ga0495605_0179597_398_778 121
647 3300046475 Ga0495639_0109856 Ga0495639_0109856_327_692 121
648 3300046476 Ga0495662_0003409 Ga0495662_0003409_3267_3632 121
649 3300046477 Ga0495664_0006671 Ga0495664_0006671_2888_3253 121
650 3300046477 Ga0495664_0060681 Ga0495664_0060681_171_536 121
651 3300046491 Ga0495584_0006144 Ga0495584_0006144_5151_5531 121
652 3300046491 Ga0495584_0013360 Ga0495584_0013360_1190_1615 121
653 3300046491 Ga0495584_0015763 Ga0495584_0015763_881_1279 121
654 3300046491 Ga0495584_0144796 Ga0495584_0144796_49_414 121
655 3300046492 Ga0495585_0000253 Ga0495585_0000253_5344_5742 121
656 3300046492 Ga0495585_0073623 Ga0495585_0073623_1018_1398 121
657 3300046492 Ga0495585_0080529 Ga0495585_0080529_94_519 121
658 3300046499 Ga0495594_0007741 Ga0495594_0007741_1926_2291 121
659 3300046499 Ga0495594_0049144 Ga0495594_0049144_1497_1862 121
660 3300046499 Ga0495594_0364149 Ga0495594_0364149_420_785 121
661 3300046500 Ga0495596_0000087 Ga0495596_0000087_54515_54913 121
662 3300046501 Ga0495607_0001995 Ga0495607_0001995_3656_4036 121
663 3300046501 Ga0495607_0009931 Ga0495607_0009931_3068_3433 121
664 3300046501 Ga0495607_0018731 Ga0495607_0018731_2559_2984 121
665 3300046501 Ga0495607_0025255 Ga0495607_0025255_2632_3030 121
666 3300046501 Ga0495607_0061864 Ga0495607_0061864_658_1038 121
667 3300046507 Ga0495606_0002612 Ga0495606_0002612_17569_17994 121
668 3300046507 Ga0495606_0057983 Ga0495606_0057983_1494_1892 121
669 3300046511 Ga0495608_0001048 Ga0495608_0001048_18671_19036 121
670 3300046511 Ga0495608_0029862 Ga0495608_0029862_2713_3078 121
671 3300046511 Ga0495608_0807682 Ga0495608_0807682_82_447 121
672 3300046512 Ga0495610_0003227 Ga0495610_0003227_4076_4474 121
673 3300046512 Ga0495610_0006343 Ga0495610_0006343_6293_6673 121
674 3300046512 Ga0495610_0011507 Ga0495610_0011507_1413_1838 121
675 3300046513 Ga0495616_0009808 Ga0495616_0009808_546_926 121
676 3300046513 Ga0495616_0024444 Ga0495616_0024444_36_461 121
677 3300046514 Ga0495618_0008923 Ga0495618_0008923_1127_1492 121
678 3300046514 Ga0495618_0489679 Ga0495618_0489679_151_516 121
679 3300046515 Ga0495620_0007747 Ga0495620_0007747_2906_3331 121
680 3300046516 Ga0495628_0162504 Ga0495628_0162504_491_856 121
681 3300046517 Ga0495630_0017170 Ga0495630_0017170_4069_4434 121
682 3300046517 Ga0495630_0651559 Ga0495630_0651559_291_656 121
683 3300046518 Ga0495631_0001808 Ga0495631_0001808_1854_2252 121
684 3300046518 Ga0495631_0027169 Ga0495631_0027169_538_963 121
685 3300046518 Ga0495631_0151049 Ga0495631_0151049_36_422 121
686 3300046519 Ga0495632_0001397 Ga0495632_0001397_16495_16875 121
687 3300046519 Ga0495632_0003535 Ga0495632_0003535_1116_1496 121
688 3300046519 Ga0495632_0019238 Ga0495632_0019238_538_963 121
689 3300046520 Ga0495637_0000401 Ga0495637_0000401_21099_21497 121
690 3300046520 Ga0495637_0052548 Ga0495637_0052548_316_741 121
691 3300046522 Ga0495643_0006541 Ga0495643_0006541_1865_2287 121
692 3300046522 Ga0495643_0022355 Ga0495643_0022355_859_1239 121
693 3300046522 Ga0495643_0047189 Ga0495643_0047189_1361_1741 121
694 3300046522 Ga0495643_0253479 Ga0495643_0253479_324_749 121
695 3300046523 Ga0495644_0000221 Ga0495644_0000221_23090_23470 121
696 3300046523 Ga0495644_0001523 Ga0495644_0001523_7709_8107 121
697 3300046523 Ga0495644_0002206 Ga0495644_0002206_614_979 121
698 3300046523 Ga0495644_0093846 Ga0495644_0093846_17_442 121
699 3300046524 Ga0495648_0009478 Ga0495648_0009478_2633_3031 121
700 3300046526 Ga0495666_0004756 Ga0495666_0004756_3771_4136 121
701 3300046526 Ga0495666_0295640 Ga0495666_0295640_280_645 121
702 3300046529 Ga0495652_0021402 Ga0495652_0021402_5166_5531 121
703 3300046529 Ga0495652_0059356 Ga0495652_0059356_2058_2423 121
704 3300046529 Ga0495652_0237092 Ga0495652_0237092_147_512 121
705 3300046530 Ga0495654_0001853 Ga0495654_0001853_10319_10717 121
706 3300046530 Ga0495654_0056029 Ga0495654_0056029_980_1360 121
707 3300046531 Ga0495665_0008307 Ga0495665_0008307_5220_5585 121
708 3300046531 Ga0495665_0215511 Ga0495665_0215511_466_831 121
709 3300046533 Ga0495640_0016874 Ga0495640_0016874_2098_2463 121
710 3300046533 Ga0495640_0019059 Ga0495640_0019059_4551_4916 121
711 3300046533 Ga0495640_0808386 Ga0495640_0808386_98_463 121
712 3300046535 Ga0495586_0031716 Ga0495586_0031716_2370_2735 121
713 3300046535 Ga0495586_0324291 Ga0495586_0324291_103_468 121
714 3300046536 Ga0495587_0009102 Ga0495587_0009102_758_1123 121
715 3300046536 Ga0495587_0021008 Ga0495587_0021008_2479_2844 121
716 3300046538 Ga0495609_0457562 Ga0495609_0457562_113_478 121
717 3300046539 Ga0495621_0039434 Ga0495621_0039434_219_584 121
718 3300046542 Ga0495597_0000205 Ga0495597_0000205_41701_42081 121
719 3300046542 Ga0495597_0005321 Ga0495597_0005321_5227_5649 121
720 3300046542 Ga0495597_0030706 Ga0495597_0030706_1187_1585 121
721 3300046542 Ga0495597_0030859 Ga0495597_0030859_1233_1658 121
722 3300046542 Ga0495597_0147296 Ga0495597_0147296_262_642 121
723 3300046543 Ga0495645_0169284 Ga0495645_0169284_841_1206 121
724 3300046557 Ga0495622_0027785 Ga0495622_0027785_745_1110 121
725 3300046557 Ga0495622_0041666 Ga0495622_0041666_200_565 121
726 3300046558 Ga0495633_0013957 Ga0495633_0013957_457_822 121
727 3300046559 Ga0495667_0005768 Ga0495667_0005768_7103_7468 121
728 3300046559 Ga0495667_0641098 Ga0495667_0641098_110_475 121
729 3300046615 Ga0495656_0001748 Ga0495656_0001748_6308_6673 121
730 3300046615 Ga0495656_0026011 Ga0495656_0026011_727_1107 121
731 3300046616 Ga0495668_0001686 Ga0495668_0001686_9340_9738 121
732 3300046642 Ga0495634_0058021 Ga0495634_0058021_2041_2406 121
733 3300046642 Ga0495634_0594727 Ga0495634_0594727_103_468 121
734 3300046648 Ga0495611_0005933 Ga0495611_0005933_1882_2247 121
735 3300046648 Ga0495611_0007091 Ga0495611_0007091_4240_4620 121
736 3300046660 Ga0495625_0005523 Ga0495625_0005523_143_541 121
737 3300046660 Ga0495625_0020820 Ga0495625_0020820_2772_3197 121
738 3300046663 Ga0495635_0025275 Ga0495635_0025275_1858_2223 121
739 3300046663 Ga0495635_0347652 Ga0495635_0347652_103_468 121
740 3300046664 Ga0495659_0013022 Ga0495659_0013022_160_525 121
741 3300046665 Ga0495661_0003804 Ga0495661_0003804_4084_4482 121
742 3300046665 Ga0495661_0008355 Ga0495661_0008355_2785_3210 121
743 3300046665 Ga0495661_0101133 Ga0495661_0101133_120_500 121
744 3300046665 Ga0495661_0150919 Ga0495661_0150919_765_1145 121
745 3300046674 Ga0495588_0002028 Ga0495588_0002028_5719_6084 121
746 3300046674 Ga0495588_0103635 Ga0495588_0103635_1064_1429 121
747 3300046675 Ga0495657_0040981 Ga0495657_0040981_2701_3066 121
748 3300046678 Ga0495599_0020425 Ga0495599_0020425_841_1206 121
749 3300046678 Ga0495599_0050524 Ga0495599_0050524_335_700 121
750 3300046679 Ga0495623_0086318 Ga0495623_0086318_627_992 121
751 3300046680 Ga0495646_0010572 Ga0495646_0010572_2170_2535 121
752 3300046680 Ga0495646_0017992 Ga0495646_0017992_947_1312 121
753 3300046681 Ga0495647_0029072 Ga0495647_0029072_43_408 121
754 3300046683 Ga0495658_0000473 Ga0495658_0000473_304_669 121
755 3300046683 Ga0495658_0075779 Ga0495658_0075779_1240_1665 121
756 3300046689 Ga0495613_0372036 Ga0495613_0372036_154_519 121
757 3300046690 Ga0495624_0005790 Ga0495624_0005790_5061_5426 121
758 3300046690 Ga0495624_0059190 Ga0495624_0059190_1557_1922 121
759 3300046691 Ga0495670_0005085 Ga0495670_0005085_42_407 121
760 3300046691 Ga0495670_0113876 Ga0495670_0113876_635_1015 121
761 3300046691 Ga0495670_0214606 Ga0495670_0214606_92_490 121
762 3300046692 Ga0495671_0016853 Ga0495671_0016853_2766_3146 121
763 3300046692 Ga0495671_0063070 Ga0495671_0063070_1172_1597 121
764 3300046692 Ga0495671_0165026 Ga0495671_0165026_120_500 121
765 3300046692 Ga0495671_0196879 Ga0495671_0196879_398_763 121
766 3300046694 Ga0495649_0000752 Ga0495649_0000752_3366_3746 121
767 3300046694 Ga0495649_0025265 Ga0495649_0025265_2661_3086 121
768 3300046794 Ga0495589_0001694 Ga0495589_0001694_2195_2593 121
769 3300046794 Ga0495589_0321341 Ga0495589_0321341_120_485 121
770 3300046794 Ga0495589_0520976 Ga0495589_0520976_29_454 121
771 3300046809 Ga0495600_0356527 Ga0495600_0356527_48_413 121
772 3300046810 Ga0495660_0005136 Ga0495660_0005136_4124_4504 121
773 3300046810 Ga0495660_0009910 Ga0495660_0009910_1509_1889 121
774 3300046810 Ga0495660_0022323 Ga0495660_0022323_2090_2488 121
775 3300046810 Ga0495660_0036915 Ga0495660_0036915_1253_1675 121
776 3300047317 Ga0495604_0002235 Ga0495604_0002235_5941_6306 121
777 3300047319 Ga0495674_0006763 Ga0495674_0006763_3179_3544 121
778 3300047319 Ga0495674_0043756 Ga0495674_0043756_322_687 121
779 3300047320 Ga0495672_0005068 Ga0495672_0005068_9887_10267 121
780 3300047320 Ga0495672_0007498 Ga0495672_0007498_5834_6214 121
781 3300047321 Ga0495676_0656338 Ga0495676_0656338_175_540 121
782 3300047322 Ga0495680_0012645 Ga0495680_0012645_6544_6909 121
783 3300047322 Ga0495680_0039115 Ga0495680_0039115_980_1345 121
784 3300047322 Ga0495680_0458416 Ga0495680_0458416_137_502 121
785 3300047323 Ga0495683_0013942 Ga0495683_0013942_451_831 121
786 3300047323 Ga0495683_0019232 Ga0495683_0019232_112_510 121
787 3300047323 Ga0495683_0295338 Ga0495683_0295338_137_562 121
788 3300047444 Ga0495675_0002904 Ga0495675_0002904_6675_7040 121
789 3300047445 Ga0495677_0040783 Ga0495677_0040783_319_699 121
790 3300047446 Ga0495679_000894 Ga0495679_000894_7082_7480 121
791 3300047446 Ga0495679_004604 Ga0495679_004604_5270_5695 121
792 3300047446 Ga0495679_028588 Ga0495679_028588_1075_1440 121
793 3300047469 Ga0495673_0001220 Ga0495673_0001220_18340_18765 121
794 3300047469 Ga0495673_0002461 Ga0495673_0002461_2879_3304 121
795 3300047469 Ga0495673_0006969 Ga0495673_0006969_454_834 121
796 3300047470 Ga0495681_0000460 Ga0495681_0000460_7878_8276 121
797 3300047470 Ga0495681_0003684 Ga0495681_0003684_3121_3501 121
798 3300047470 Ga0495681_0012817 Ga0495681_0012817_1246_1671 121
799 3300047470 Ga0495681_0120520 Ga0495681_0120520_705_1103 121
800 3300047471 Ga0495684_0146629 Ga0495684_0146629_104_469 121
801 3300047471 Ga0495684_0152628 Ga0495684_0152628_283_648 121
802 3300047471 Ga0495684_0643206 Ga0495684_0643206_38_403 121
803 3300047472 Ga0495686_0026767 Ga0495686_0026767_261_641 121
804 3300047472 Ga0495686_0033044 Ga0495686_0033044_600_998 121
805 3300047472 Ga0495686_0043400 Ga0495686_0043400_774_1199 121
806 3300047673 Ga0495593_0004020 Ga0495593_0004020_5043_5408 121
807 3300047673 Ga0495593_0038512 Ga0495593_0038512_1186_1551 121
808 3300047673 Ga0495593_0099094 Ga0495593_0099094_370_735 121
809 3300048088 Ga0495602_0001451 Ga0495602_0001451_17759_18124 121
810 3300048089 Ga0495614_0139729 Ga0495614_0139729_431_796 121
811 3300048091 Ga0495626_0000057 Ga0495626_0000057_8989_9387 121
812 3300048091 Ga0495626_0000065 Ga0495626_0000065_101889_102314 121
813 3300048903 Ga0496100_0013607 Ga0496100_0013607_3915_4280 121
814 3300048903 Ga0496100_0107976 Ga0496100_0107976_1527_1904 121
815 3300048903 Ga0496100_0390232 Ga0496100_0390232_382_747 121
816 3300048904 Ga0496101_0001165 Ga0496101_0001165_5758_6123 121
817 3300048904 Ga0496101_0947373 Ga0496101_0947373_174_539 121
818 3300048905 Ga0496102_0005341 Ga0496102_0005341_4177_4542 121
819 3300048905 Ga0496102_0475672 Ga0496102_0475672_584_949 121
820 3300048906 Ga0496103_0157425 Ga0496103_0157425_424_789 121
821 3300048906 Ga0496103_0262405 Ga0496103_0262405_325_690 121
822 3300048907 Ga0496104_0015669 Ga0496104_0015669_2686_3051 121
823 3300048907 Ga0496104_0688144 Ga0496104_0688144_312_677 121
824 3300048908 Ga0496105_0121713 Ga0496105_0121713_540_905 121
825 3300048908 Ga0496105_0674625 Ga0496105_0674625_300_665 121
826 3300048909 Ga0496106_0015809 Ga0496106_0015809_2644_3009 121
827 3300048909 Ga0496106_0184893 Ga0496106_0184893_1154_1519 121
828 3300048910 Ga0496107_0035626 Ga0496107_0035626_1682_2047 121
829 3300048910 Ga0496107_0049494 Ga0496107_0049494_1888_2253 121
830 3300048911 Ga0496108_0229662 Ga0496108_0229662_312_677 121
831 3300048911 Ga0496108_0567087 Ga0496108_0567087_444_809 121
832 3300048912 Ga0496109_0071006 Ga0496109_0071006_2674_3039 121
833 3300048912 Ga0496109_0078310 Ga0496109_0078310_312_677 121
834 3300048912 Ga0496109_0136382 Ga0496109_0136382_699_1106 121
835 3300048913 Ga0496110_0019494 Ga0496110_0019494_2367_2732 121
836 3300048913 Ga0496110_0096810 Ga0496110_0096810_2237_2617 121
837 3300048913 Ga0496110_0215110 Ga0496110_0215110_872_1237 121
838 3300048913 Ga0496110_0578168 Ga0496110_0578168_326_703 121
839 3300048914 Ga0496111_0020228 Ga0496111_0020228_3194_3559 121
840 3300048914 Ga0496111_0637666 Ga0496111_0637666_95_472 121
841 3300048915 Ga0496112_0011859 Ga0496112_0011859_7306_7671 121
842 3300048915 Ga0496112_0087029 Ga0496112_0087029_904_1311 121
843 3300048915 Ga0496112_0802620 Ga0496112_0802620_459_824 121
844 3300048915 Ga0496112_1844484 Ga0496112_1844484_132_497 121
845 3300048916 Ga0496113_0163836 Ga0496113_0163836_505_870 121
846 3300048917 Ga0496114_0200540 Ga0496114_0200540_505_870 121
847 3300048917 Ga0496114_0374920 Ga0496114_0374920_720_1085 121
848 3300048918 Ga0496115_0113999 Ga0496115_0113999_1007_1372 121
849 3300048924 Ga0496121_0058560 Ga0496121_0058560_2541_2924 121
850 3300048924 Ga0496121_0259666 Ga0496121_0259666_435_800 121
851 3300048925 Ga0496122_0000043 Ga0496122_0000043_245395_245778 121
852 3300048926 Ga0496123_0000090 Ga0496123_0000090_34549_34932 121
853 3300048927 Ga0496124_0005631 Ga0496124_0005631_10265_10645 121
854 3300048928 Ga0496125_0203815 Ga0496125_0203815_299_664 121
855 3300049459 Ga0495678_001121 Ga0495678_001121_12012_12392 121
856 3300049459 Ga0495678_007757 Ga0495678_007757_3337_3717 121
857 3300049459 Ga0495678_029261 Ga0495678_029261_1400_1825 121
858 3300049460 Ga0495682_0101678 Ga0495682_0101678_361_759 121
859 3300049593 Ga0501077_0472141 Ga0501077_0472141_26_403 121
860 3300050496 nmdc:mga07m45_449116_c1 nmdc:mga07m45_449116_c1_15_401 121
861 3300050511 nmdc:mga08y16_296601_c1 nmdc:mga08y16_296601_c1_688_1053 121
862 3300050512 nmdc:mga0n895_329652_c1 nmdc:mga0n895_329652_c1_259_624 121
863 3300050513 nmdc:mga0rr50_61528_c1 nmdc:mga0rr50_61528_c1_2414_2779 121
864 3300050514 nmdc:mga08x19_58563_c1 nmdc:mga08x19_58563_c1_67_432 121
865 3300053077 Ga0495601_0000413 Ga0495601_0000413_6420_6785 121
866 3300053077 Ga0495601_0019631 Ga0495601_0019631_841_1206 121
867 3300053078 Ga0495612_0035714 Ga0495612_0035714_1531_1896 121
868 3300053078 Ga0495612_0042296 Ga0495612_0042296_433_798 121
869 3300053084 Ga0495595_0006073 Ga0495595_0006073_1189_1554 121
870 3300053084 Ga0495595_0090096 Ga0495595_0090096_384_749 121
871 3300053085 Ga0495619_0001679 Ga0495619_0001679_7915_8280 121
872 3300053085 Ga0495619_0002856 Ga0495619_0002856_780_1145 121
873 3300053085 Ga0495619_0013291 Ga0495619_0013291_1615_1980 121
874 3300053090 Ga0500646_0068953 Ga0500646_0068953_107_499 121
875 3300053118 Ga0500594_0160864 Ga0500594_0160864_181_567 121
876 3300053134 Ga0500658_0073758 Ga0500658_0073758_986_1372 121
877 3300053142 Ga0500577_0114797 Ga0500577_0114797_703_1095 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zn2-assembly1.cif.gz_A low resolution structure of response regulator styr 0.93 2 120
7w9h-assembly1.cif.gz_A crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa 0.9241 2 115
3f7a-assembly1.cif.gz_B structure of orthorhombic crystal form of pseudomonas aeruginosa rssb 0.9236 1 119
2b1j-assembly1.cif.gz_A crystal structure of unphosphorylated chey bound to the n-terminus of flim 0.9224 2 119
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.9222 1 121
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9501 2 78 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9403 1 81 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9336 3 81 3.40.50.2300
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9335 1 121 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9314 3 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6G6X5H5-F1-model_v4 Response regulator 0.9999 2 118 GO:0000160
AF-A0A127EUS4-F1-model_v4 Two-component response regulator 0.9998 2 119 GO:0000160
AF-A0A560M0H5-F1-model_v4 Response regulator receiver domain-containing protein 0.9977 2 118 GO:0000160
AF-A0A2A2V2Z7-F1-model_v4 Two-component system response regulator 0.9971 2 120 GO:0000160
AF-A0A1H5LBM1-F1-model_v4 Response regulator receiver domain-containing protein 0.9971 1 117 GO:0000160

Feature Viewer

pLDDT pTM Quality
93.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map