F484373

General Info

Members Datasets Scaffolds Average Seq Length
876 483 1752 353

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606360|2808849987
Length 395
Sequence PGVLVSYIGTWCRLTGSGRIQERNTRTMVHKVQAVVVKEKNAPVSLETILVPDPGPGEALVDILTCGVCHTDLHYKQGGIGDDFPYLLGHEATGVVSAVGPDVTSVAPGDRVILNWRAVCGECRACAKGQPQYCFNTHNATQKMTLEDGTELSPALGIGAFAEKTLVAAGQCTKVDADVDAAAVGLLGCGIMAGIGAAINTGEVKRGESVAVIGCGGVGIAAIAGARLAGATTIIAVDIDDNKIEMAKSLGATHGVNSRQEDAVETIRALTGGHGADVVIDAVGRPETYKQAFYARDLAGRVVLVGVPTPEMSLELPLLDVFGRGGSLKSSWYGDCLPSRDFPMLVSHYKQGNLDLDAFVSERISINQVEEAFGKMHEGKVLRSVVEIQAAGASA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
185 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
316 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
317 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
329 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
330 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
331 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
332 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
333 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
334 2643221576 Nocardioides sp. Root614 Isolate Unclassified
335 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
336 2643221590 Nocardioides sp. Root682 Isolate Unclassified
337 2643221604 Nocardioides sp. Root190 Isolate Unclassified
338 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
339 2643221647 Streptomyces sp. Root369 Isolate Unclassified
340 2643221670 Streptomyces sp. Root431 Isolate Unclassified
341 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
342 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
343 2643221679 Angustibacter sp. Root456 Isolate Unclassified
344 2643221714 Streptomyces sp. Root264 Isolate Unclassified
345 2671180195 Frankia sp. CcI49 Isolate Nodule
346 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
347 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
348 2738541305 Nocardioides sp. CF167 Isolate Unclassified
349 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
350 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
351 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
352 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
353 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
354 2773857922 Frankia sp. CcI49 Isolate Nodule
355 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
356 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
357 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
358 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
359 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
360 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
361 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
362 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
363 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
364 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
365 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
366 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
367 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
368 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
369 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
370 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
371 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
372 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
373 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
374 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
375 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
376 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
377 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
378 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
379 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
380 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
381 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
382 2858882152 Micromonospora noduli MED15 Isolate Nodule
383 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
384 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
385 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
386 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
387 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
388 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
389 2862574272 Streptomyces sp. AcE210 Isolate Nodule
390 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
391 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
392 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
393 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
394 2867428634 Streptomyces sp. RP5T Isolate Unclassified
395 2867475112 Streptomyces sp. TM32 Isolate Unclassified
396 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
397 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
398 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
399 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
400 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
401 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
402 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
403 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
404 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
405 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
406 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
407 2891562705 Microbispora tritici MT50 Isolate Unclassified
408 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
409 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
410 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
411 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
412 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
413 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
414 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
415 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
416 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
417 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
418 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
419 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
420 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
421 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
422 2920879853 Kocuria salina CV6 Isolate Unclassified
423 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
424 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
425 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
426 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
427 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
428 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
429 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
430 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
431 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
432 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
433 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
434 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
435 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
436 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
437 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
438 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
439 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
440 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
441 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
442 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
443 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
444 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
445 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
446 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
447 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
448 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
449 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
450 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
451 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
452 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
453 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
454 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
455 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
456 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
457 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
458 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
459 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
460 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
461 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
462 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
463 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
464 8002784119 Frankia sp. AgB1.9 Isolate Nodule
465 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
466 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
467 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
468 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
469 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
470 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
471 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
472 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
473 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
474 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
475 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
476 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
477 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
478 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
479 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
480 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
481 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
482 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
483 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.97
Metatranscriptomes 0.91
Isolates 21.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 4.57
Nodule 1.6
Rhizoplane 5.14
Rhizosphere 75.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006008 3300000549 Bacteria 1522
2 JGI24740J21852_10022565 3300001979 Bacteria 2164
3 JGI25152J39213_1000564 3300002773 Bacteria 20360
4 rootL2_10182415 3300003322 Bacteria 4912
5 JGI25160J50197_1014019 3300003354 Bacteria 2702
6 Ga0055542_1004126 3300003762 Bacteria 3653
7 Ga0055540_1002891 3300003792 Bacteria 8711
8 Ga0055540_1005551 3300003792 Bacteria 5268
9 Ga0055540_1007668 3300003792 Bacteria 4025
10 Ga0065714_10017933 3300005288 Bacteria 2961
11 Ga0065714_10019874 3300005288 Bacteria 2010
12 Ga0070676_10128473 3300005328 Bacteria 1600
13 Ga0070683_100047725 3300005329 Bacteria 3958
14 Ga0070670_100043661 3300005331 Bacteria 3853
15 Ga0070670_100063897 3300005331 Bacteria 3158
16 Ga0070666_10082066 3300005335 Bacteria 2205
17 Ga0070680_100029410 3300005336 Bacteria 4413
18 Ga0070682_100045910 3300005337 Bacteria 2710
19 Ga0070687_100018156 3300005343 Bacteria 3248
20 Ga0070692_10003998 3300005345 Bacteria 6090
21 Ga0070692_10057589 3300005345 Bacteria 2038
22 Ga0070668_100180512 3300005347 Bacteria 1724
23 Ga0070669_100039627 3300005353 Bacteria 3423
24 Ga0070669_100113981 3300005353 Bacteria 2055
25 Ga0070675_100126521 3300005354 Bacteria 2174
26 Ga0070671_100055122 3300005355 Bacteria 3307
27 Ga0070671_100104983 3300005355 Bacteria 2371
28 Ga0070673_100157025 3300005364 Bacteria 1931
29 Ga0070659_100075973 3300005366 Bacteria 2679
30 Ga0070714_100169521 3300005435 Bacteria 1980
31 Ga0070713_100102826 3300005436 Bacteria 2478
32 Ga0070710_10003528 3300005437 Bacteria 7412
33 Ga0070711_100110460 3300005439 Bacteria 2017
34 Ga0070705_100209077 3300005440 Bacteria 1344
35 Ga0070700_100002168 3300005441 Bacteria 9962
36 Ga0070678_100012916 3300005456 Bacteria 5214
37 Ga0070681_10090418 3300005458 Bacteria 3012
38 Ga0068867_100095786 3300005459 Bacteria 2258
39 Ga0070707_100010754 3300005468 Bacteria 8524
40 Ga0070707_100057882 3300005468 Bacteria 3718
41 Ga0070698_100000415 3300005471 Bacteria 45479
42 Ga0070698_100035998 3300005471 Bacteria 5117
43 Ga0070679_100006189 3300005530 Bacteria 11142
44 Ga0070679_100062892 3300005530 Bacteria 3700
45 Ga0070679_100184078 3300005530 Bacteria 2060
46 Ga0070684_100043610 3300005535 Bacteria 3874
47 Ga0070684_100077247 3300005535 Bacteria 2940
48 Ga0070684_100134260 3300005535 Bacteria 2234
49 Ga0070697_100029208 3300005536 Bacteria 4419
50 Ga0070672_100001302 3300005543 Bacteria 15381
51 Ga0070672_100139221 3300005543 Bacteria 2000
52 Ga0070665_100001255 3300005548 Bacteria 30600
53 Ga0068857_100011946 3300005577 Bacteria 7550
54 Ga0070702_100082705 3300005615 Bacteria 1927
55 Ga0068852_100010223 3300005616 Bacteria 6996
56 Ga0068852_100078292 3300005616 Bacteria 2924
57 Ga0068864_100056722 3300005618 Bacteria 3384
58 Ga0068866_10016695 3300005718 Bacteria 3288
59 Ga0068861_100095487 3300005719 Bacteria 2354
60 Ga0081455_10014512 3300005937 Bacteria 7715
61 Ga0081540_1012199 3300005983 Bacteria 5682
62 Ga0075365_10030556 3300006038 Bacteria 3451
63 Ga0075365_10180105 3300006038 Bacteria 1477
64 Ga0075365_10242208 3300006038 Bacteria 1267
65 Ga0075432_10000424 3300006058 Bacteria 12331
66 Ga0070715_10081209 3300006163 Bacteria 1472
67 Ga0070716_100012164 3300006173 Bacteria 4355
68 Ga0075367_10001514 3300006178 Bacteria 10047
69 Ga0068865_100048815 3300006881 Bacteria 2914
70 Ga0099826_10084204 3300006948 Bacteria 1968
71 Ga0105251_10021678 3300009011 Bacteria 3350
72 Ga0105251_10024199 3300009011 Bacteria 3120
73 Ga0105244_10003027 3300009036 Bacteria 12338
74 Ga0105244_10098294 3300009036 Bacteria 1434
75 Ga0111539_10255520 3300009094 Bacteria 2040
76 Ga0105245_10085548 3300009098 Bacteria 2890
77 Ga0105245_10235075 3300009098 Bacteria 1774
78 Ga0105243_10010279 3300009148 Bacteria 7112
79 Ga0105243_10015649 3300009148 Bacteria 5734
80 Ga0105243_10034709 3300009148 Bacteria 3908
81 Ga0105243_10078234 3300009148 Bacteria 2692
82 Ga0105243_10113935 3300009148 Bacteria 2268
83 Ga0105248_10053041 3300009177 Bacteria 4550
84 Ga0105248_10061347 3300009177 Bacteria 4222
85 Ga0105238_10207521 3300009551 Bacteria 1935
86 Ga0105238_10288892 3300009551 Bacteria 1622
87 Ga0105249_10010275 3300009553 Bacteria 8222
88 Ga0105249_10159649 3300009553 Bacteria 2177
89 Ga0105239_10011607 3300010375 Bacteria 9828
90 Ga0105239_10279011 3300010375 Bacteria 1881
91 Ga0105246_10001152 3300011119 Bacteria 15338
92 Ga0105246_10002505 3300011119 Bacteria 11109
93 Ga0105246_10027246 3300011119 Bacteria 3742
94 Ga0105246_10112250 3300011119 Bacteria 2004
95 Ga0105246_10276060 3300011119 Bacteria 1346
96 Ga0157371_10085290 3300013102 Bacteria 2237
97 Ga0157369_10342459 3300013105 Bacteria 1553
98 Ga0163162_10020143 3300013306 Bacteria 6550
99 Ga0163162_10196031 3300013306 Bacteria 2148
100 Ga0157380_10170889 3300014326 Bacteria 1899
101 Ga0157377_10003750 3300014745 Bacteria 6894
102 Ga0157379_10019033 3300014968 Bacteria 6062
103 Ga0183367_1003 3300015688 Bacteria 814276
104 Ga0183367_1004 3300015688 Bacteria 716880
105 Ga0163161_10020014 3300017792 Bacteria 4694
106 Ga0206356_10752756 3300020070 Bacteria 1534
107 Ga0206350_10749295 3300020080 Bacteria 1429
108 Ga0206353_10539143 3300020082 Bacteria 2724
109 Ga0213875_10001608 3300021388 Bacteria 14280
110 Ga0213875_10001884 3300021388 Bacteria 12993
111 Ga0213875_10002648 3300021388 Bacteria 10589
112 Ga0213875_10003198 3300021388 Bacteria 9415
113 Ga0224712_10008931 3300022467 Bacteria 2995
114 Ga0209148_1004095 3300025254 Bacteria 3693
115 Ga0209129_1000448 3300025258 Bacteria 30833
116 Ga0209025_1001977 3300025294 Bacteria 23536
117 Ga0207426_1000996 3300025302 Bacteria 27634
118 Ga0207426_1001844 3300025302 Bacteria 15586
119 Ga0207426_1008971 3300025302 Bacteria 3987
120 Ga0207426_1015577 3300025302 Bacteria 2754
121 Ga0209051_1000569 3300025303 Bacteria 44797
122 Ga0209051_1005041 3300025303 Bacteria 7863
123 Ga0209051_1008251 3300025303 Bacteria 5543
124 Ga0209051_1010666 3300025303 Bacteria 4609
125 Ga0209051_1022562 3300025303 Bacteria 2646
126 Ga0207697_10002395 3300025315 Bacteria 9768
127 Ga0207697_10011335 3300025315 Bacteria 3773
128 Ga0207655_1034402 3300025728 Bacteria 2279
129 Ga0207688_10031078 3300025901 Bacteria 2947
130 Ga0207647_10006174 3300025904 Bacteria 8730
131 Ga0207699_10104347 3300025906 Bacteria 1805
132 Ga0207645_10076255 3300025907 Bacteria 2147
133 Ga0207705_10067528 3300025909 Bacteria 2588
134 Ga0207684_10031140 3300025910 Bacteria 4540
135 Ga0207707_10068043 3300025912 Bacteria 3103
136 Ga0207657_10009534 3300025919 Bacteria 9746
137 Ga0207657_10168981 3300025919 Bacteria 1773
138 Ga0207652_10059261 3300025921 Bacteria 3300
139 Ga0207646_10061476 3300025922 Bacteria 3353
140 Ga0207681_10105877 3300025923 Bacteria 2037
141 Ga0207650_10258405 3300025925 Bacteria 1412
142 Ga0207650_10309582 3300025925 Bacteria 1292
143 Ga0207659_10332160 3300025926 Bacteria 1257
144 Ga0207659_10339784 3300025926 Bacteria 1243
145 Ga0207700_10119803 3300025928 Bacteria 2132
146 Ga0207664_10014646 3300025929 Bacteria 5671
147 Ga0207690_10114019 3300025932 Bacteria 1951
148 Ga0207706_10330019 3300025933 Bacteria 1327
149 Ga0207709_10064881 3300025935 Bacteria 2294
150 Ga0207709_10077337 3300025935 Bacteria 2133
151 Ga0207709_10104325 3300025935 Bacteria 1881
152 Ga0207709_10226924 3300025935 Bacteria 1351
153 Ga0207669_10060376 3300025937 Bacteria 2324
154 Ga0207669_10203960 3300025937 Bacteria 1438
155 Ga0207704_10085325 3300025938 Bacteria 2055
156 Ga0207665_10006521 3300025939 Bacteria 7739
157 Ga0207691_10004085 3300025940 Bacteria 14164
158 Ga0207691_10005260 3300025940 Bacteria 12492
159 Ga0207691_10016690 3300025940 Bacteria 6973
160 Ga0207679_10149555 3300025945 Bacteria 1898
161 Ga0207667_10241581 3300025949 Bacteria 1848
162 Ga0207712_10342985 3300025961 Bacteria 1239
163 Ga0207668_10164577 3300025972 Bacteria 1732
164 Ga0207639_10108233 3300026041 Bacteria 2259
165 Ga0207678_10075994 3300026067 Bacteria 2877
166 Ga0207708_10000344 3300026075 Bacteria 36621
167 Ga0207702_10047904 3300026078 Bacteria 3603
168 Ga0207648_10006022 3300026089 Bacteria 12098
169 Ga0207674_10010339 3300026116 Bacteria 10580
170 Ga0207674_10041217 3300026116 Bacteria 4777
171 Ga0207675_100026825 3300026118 Bacteria 5361
172 Ga0207683_10009698 3300026121 Bacteria 8209
173 Ga0207698_10040586 3300026142 Bacteria 3460
174 Ga0207698_10152692 3300026142 Bacteria 2007
175 Ga0209813_10008271 3300027866 Bacteria 2622
176 Ga0207428_10070863 3300027907 Bacteria 2739
177 Ga0207428_10096726 3300027907 Bacteria 2286
178 Ga0268266_10003222 3300028379 Bacteria 16486
179 Ga0268266_10168223 3300028379 Bacteria 1988
180 Ga0265337_1000828 3300028556 Bacteria 16243
181 Ga0265319_1014199 3300028563 Bacteria 3132
182 Ga0265334_10001841 3300028573 Bacteria 10093
183 Ga0265318_10028543 3300028577 Bacteria 2181
184 Ga0307517_10005154 3300028786 Bacteria 19834
185 Ga0307517_10052524 3300028786 Bacteria 4082
186 Ga0307515_10000287 3300028794 Bacteria 123976
187 Ga0265338_10001152 3300028800 Bacteria 43720
188 Ga0265338_10001947 3300028800 Bacteria 32225
189 Ga0265324_10009980 3300029957 Bacteria 3686
190 Ga0307511_10054014 3300030521 Bacteria 3175
191 Ga0307511_10107460 3300030521 Bacteria 1796
192 Ga0316177_1202800 3300030731 Bacteria 2017
193 Ga0265332_10002553 3300031238 Bacteria 9246
194 Ga0265325_10016263 3300031241 Bacteria 4161
195 Ga0265327_10001401 3300031251 Bacteria 30722
196 Ga0265316_10036129 3300031344 Bacteria 3996
197 Ga0307509_10018420 3300031507 Bacteria 8007
198 Ga0307509_10181895 3300031507 Bacteria 1965
199 Ga0307408_100047312 3300031548 Bacteria 3080
200 Ga0307408_100052488 3300031548 Bacteria 2940
201 Ga0307408_100087671 3300031548 Bacteria 2342
202 Ga0307408_100159007 3300031548 Bacteria 1792
203 Ga0307508_10003098 3300031616 Bacteria 17069
204 Ga0307508_10005246 3300031616 Bacteria 12371
205 Ga0307508_10030795 3300031616 Bacteria 4848
206 Ga0307508_10104562 3300031616 Bacteria 2428
207 Ga0265314_10042418 3300031711 Bacteria 3246
208 Ga0307405_10043756 3300031731 Bacteria 2734
209 Ga0307405_10200291 3300031731 Bacteria 1449
210 Ga0307413_10031521 3300031824 Bacteria 2993
211 Ga0307413_10078550 3300031824 Bacteria 2106
212 Ga0307518_10073508 3300031838 Bacteria 2474
213 Ga0307518_10086335 3300031838 Bacteria 2262
214 Ga0307410_10015810 3300031852 Bacteria 4484
215 Ga0307410_10137137 3300031852 Bacteria 1805
216 Ga0307410_10161998 3300031852 Bacteria 1677
217 Ga0307410_10242880 3300031852 Bacteria 1396
218 Ga0307406_10057533 3300031901 Bacteria 2494
219 Ga0307406_10255168 3300031901 Bacteria 1323
220 Ga0307407_10009496 3300031903 Bacteria 4535
221 Ga0307407_10028919 3300031903 Bacteria 2970
222 Ga0307412_10023417 3300031911 Bacteria 3799
223 Ga0307412_10066466 3300031911 Bacteria 2444
224 Ga0307412_10089926 3300031911 Bacteria 2145
225 Ga0307412_10116847 3300031911 Bacteria 1914
226 Ga0307412_10172767 3300031911 Bacteria 1617
227 Ga0307409_100011989 3300031995 Bacteria 5499
228 Ga0307409_100072398 3300031995 Bacteria 2744
229 Ga0307409_100077431 3300031995 Bacteria 2671
230 Ga0307409_100154785 3300031995 Bacteria 1996
231 Ga0307409_100186119 3300031995 Bacteria 1843
232 Ga0307416_100051250 3300032002 Bacteria 3295
233 Ga0307416_100110817 3300032002 Bacteria 2418
234 Ga0307416_100156030 3300032002 Bacteria 2101
235 Ga0307416_100173584 3300032002 Bacteria 2010
236 Ga0307416_100269090 3300032002 Bacteria 1671
237 Ga0307416_100433997 3300032002 Bacteria 1361
238 Ga0307414_10085084 3300032004 Bacteria 2328
239 Ga0307414_10129394 3300032004 Bacteria 1957
240 Ga0307411_10064073 3300032005 Bacteria 2459
241 Ga0307415_100065053 3300032126 Bacteria 2539
242 Ga0307415_100156528 3300032126 Bacteria 1760
243 Ga0316585_10047709 3300032137 Bacteria 1372
244 Ga0307507_10011053 3300033179 Bacteria 11484
245 Ga0307507_10012829 3300033179 Bacteria 10281
246 Ga0307510_10033207 3300033180 Bacteria 5799
247 Ga0373941_0018446 3300035115 Bacteria 1928
248 Ga0373954_0004908 3300035118 Bacteria 5774
249 Ga0373956_0003350 3300035119 Bacteria 6446
250 Ga0373956_0008865 3300035119 Bacteria 4076
251 Ga0373957_0020668 3300035120 Bacteria 2328
252 Ga0373942_0000108 3300035207 Bacteria 18755
253 Ga0373962_0001387 3300035242 Bacteria 5715
254 Ga0316574_0086429 3300035398 Bacteria 1996
255 Ga0316574_0152459 3300035398 Bacteria 1489
256 Ga0373935_0146785 3300035692 Bacteria 1597
257 Ga0373933_0044544 3300035724 Bacteria 2628
258 Ga0373937_0069210 3300036401 Bacteria 3253
259 Ga0316584_0113785 3300036712 Bacteria 2024
260 Ga0373925_0000004 3300037068 Bacteria 361597
261 Ga0395899_0000668 3300037312 Bacteria 34727
262 Ga0395899_0189292 3300037312 Bacteria 1440
263 Ga0395900_0028800 3300037418 Bacteria 5693
264 Ga0395900_0031034 3300037418 Bacteria 5489
265 Ga0395900_0031468 3300037418 Bacteria 5452
266 Ga0395900_0056944 3300037418 Bacteria 4024
267 Ga0395900_0204452 3300037418 Bacteria 1996
268 Ga0395900_0301187 3300037418 Bacteria 1589
269 Ga0395898_0002672 3300037466 Bacteria 20661
270 Ga0395898_0002992 3300037466 Bacteria 19185
271 Ga0395898_0008045 3300037466 Bacteria 11176
272 Ga0395898_0008680 3300037466 Bacteria 10720
273 Ga0395898_0009913 3300037466 Bacteria 9980
274 Ga0395898_0012707 3300037466 Bacteria 8696
275 Ga0395898_0019330 3300037466 Bacteria 6935
276 Ga0395898_0037428 3300037466 Bacteria 4813
277 Ga0395898_0092713 3300037466 Bacteria 2904
278 Ga0395898_0240409 3300037466 Bacteria 1727
279 Ga0395905_0051920 3300037471 Bacteria 3840
280 Ga0395905_0072948 3300037471 Bacteria 3218
281 Ga0395905_0085470 3300037471 Bacteria 2956
282 Ga0395905_0354423 3300037471 Bacteria 1360
283 Ga0436364_0002840 3300037853 Bacteria 1961
284 Ga0436364_0183141 3300037853 Bacteria 23094
285 Ga0436364_0222259 3300037853 Bacteria 1407
286 Ga0436364_0464776 3300037853 Bacteria 2419
287 Ga0436364_0585101 3300037853 Bacteria 50100
288 Ga0436364_1115616 3300037853 Bacteria 49992
289 Ga0395901_0011064 3300038443 Bacteria 9144
290 Ga0395901_0030134 3300038443 Bacteria 5589
291 Ga0395901_0059991 3300038443 Bacteria 3958
292 Ga0395901_0285123 3300038443 Bacteria 1715
293 Ga0439436_0032068 3300041404 Bacteria 1524
294 Ga0439436_0045343 3300041404 Bacteria 1251
295 Ga0439466_0013413 3300041411 Bacteria 3000
296 Ga0451793_0113644 3300041452 Bacteria 3354
297 Ga0451793_1224384 3300041452 Bacteria 1621
298 Ga0451843_0286974 3300041509 Bacteria 2929
299 Ga0439433_0020558 3300041999 Bacteria 1474
300 Ga0439442_000330 3300042002 Bacteria 11263
301 Ga0439442_010928 3300042002 Bacteria 1844
302 Ga0439432_015564 3300042006 Bacteria 2566
303 Ga0439432_040014 3300042006 Bacteria 1488
304 Ga0439449_0003551 3300042007 Bacteria 6057
305 Ga0439449_0042080 3300042007 Bacteria 1698
306 Ga0439449_0080337 3300042007 Bacteria 1202
307 Ga0439455_0002123 3300042012 Bacteria 3540
308 Ga0450920_000102 3300042122 Bacteria 11247
309 Ga0450898_004930 3300042134 Bacteria 1995
310 Ga0450903_000028 3300042138 Bacteria 29850
311 Ga0450903_000647 3300042138 Bacteria 7029
312 Ga0450907_000576 3300042146 Bacteria 9870
313 Ga0439458_0000979 3300042157 Bacteria 7303
314 Ga0439458_0002962 3300042157 Bacteria 4074
315 Ga0439434_0000402 3300042435 Bacteria 12307
316 Ga0466969_0011224 3300044656 Bacteria 4742
317 Ga0466969_0017415 3300044656 Bacteria 3750
318 Ga0466969_0123707 3300044656 Bacteria 1203
319 Ga0466972_0003089 3300044658 Bacteria 8255
320 Ga0466972_0007226 3300044658 Bacteria 5577
321 Ga0466972_0008405 3300044658 Bacteria 5176
322 Ga0466972_0012491 3300044658 Bacteria 4269
323 Ga0466972_0049530 3300044658 Bacteria 2029
324 Ga0466972_0055310 3300044658 Bacteria 1909
325 Ga0466972_0064368 3300044658 Bacteria 1755
326 Ga0466965_0003208 3300044683 Bacteria 7146
327 Ga0466965_0006896 3300044683 Bacteria 5196
328 Ga0466965_0010505 3300044683 Bacteria 4323
329 Ga0466965_0042391 3300044683 Bacteria 2245
330 Ga0466965_0077332 3300044683 Bacteria 1680
331 Ga0466965_0112031 3300044683 Bacteria 1403
332 Ga0466966_0003577 3300044684 Bacteria 10254
333 Ga0466966_0007841 3300044684 Bacteria 7066
334 Ga0466966_0079869 3300044684 Bacteria 2038
335 Ga0466961_0010767 3300044693 Bacteria 5842
336 Ga0466961_0028768 3300044693 Bacteria 3574
337 Ga0466961_0097790 3300044693 Bacteria 1850
338 Ga0466963_0000184 3300044694 Bacteria 26087
339 Ga0466963_0003961 3300044694 Bacteria 8566
340 Ga0466963_0010203 3300044694 Bacteria 5681
341 Ga0466963_0031675 3300044694 Bacteria 3420
342 Ga0466963_0076410 3300044694 Bacteria 2261
343 Ga0466963_0110757 3300044694 Bacteria 1885
344 Ga0466963_0128402 3300044694 Bacteria 1749
345 Ga0466964_0018115 3300044706 Bacteria 2700
346 Ga0466964_0030623 3300044706 Bacteria 2130
347 Ga0466964_0049739 3300044706 Bacteria 1717
348 Ga0466971_0001168 3300044719 Bacteria 10914
349 Ga0466971_0069692 3300044719 Bacteria 1596
350 Ga0466970_0000851 3300044765 Bacteria 14710
351 Ga0466970_0002860 3300044765 Bacteria 8346
352 Ga0466970_0004846 3300044765 Bacteria 6641
353 Ga0466970_0005429 3300044765 Bacteria 6324
354 Ga0466970_0014964 3300044765 Bacteria 3989
355 Ga0466957_0000319 3300044842 Bacteria 23345
356 Ga0466957_0000619 3300044842 Bacteria 17948
357 Ga0466957_0075853 3300044842 Bacteria 2087
358 Ga0466957_0083109 3300044842 Bacteria 1997
359 Ga0466957_0122446 3300044842 Bacteria 1659
360 Ga0466957_0141812 3300044842 Bacteria 1548
361 Ga0466957_0260027 3300044842 Bacteria 1156
362 Ga0466960_0001604 3300044901 Bacteria 8276
363 Ga0466960_0032721 3300044901 Bacteria 2410
364 Ga0466960_0134883 3300044901 Bacteria 1306
365 Ga0466959_0001973 3300045049 Bacteria 12922
366 Ga0466959_0009364 3300045049 Bacteria 6961
367 Ga0451576_0353671 3300045051 Bacteria 1538
368 Ga0466958_0003638 3300045836 Bacteria 8039
369 Ga0466958_0008106 3300045836 Bacteria 5812
370 Ga0466967_0007656 3300045976 Bacteria 7819
371 Ga0466967_0019492 3300045976 Bacteria 5455
372 Ga0466967_0028997 3300045976 Bacteria 4627
373 Ga0466967_0029602 3300045976 Bacteria 4585
374 Ga0466967_0046771 3300045976 Bacteria 3769
375 Ga0466967_0107658 3300045976 Bacteria 2557
376 Ga0466967_0118121 3300045976 Bacteria 2446
377 Ga0466967_0121371 3300045976 Bacteria 2415
378 Ga0466967_0260110 3300045976 Bacteria 1660
379 Ga0466967_0500965 3300045976 Bacteria 1192
380 Ga0495592_0046729 3300046454 Bacteria 3226
381 Ga0495592_0064333 3300046454 Bacteria 2688
382 Ga0495603_0001380 3300046455 Bacteria 14114
383 Ga0495603_0006721 3300046455 Bacteria 6903
384 Ga0495603_0058514 3300046455 Bacteria 2278
385 Ga0495629_0034568 3300046459 Bacteria 3573
386 Ga0495629_0038087 3300046459 Bacteria 3388
387 Ga0495629_0075487 3300046459 Bacteria 2354
388 Ga0495629_0112167 3300046459 Bacteria 1900
389 Ga0495638_0011228 3300046460 Bacteria 6181
390 Ga0495641_0016892 3300046461 Bacteria 3825
391 Ga0495651_0007765 3300046462 Bacteria 8210
392 Ga0495651_0029494 3300046462 Bacteria 4278
393 Ga0495651_0040506 3300046462 Bacteria 3622
394 Ga0495653_0016899 3300046463 Bacteria 5936
395 Ga0495653_0104355 3300046463 Bacteria 2048
396 Ga0495580_0021310 3300046472 Bacteria 4782
397 Ga0495580_0078546 3300046472 Bacteria 2302
398 Ga0495580_0082867 3300046472 Bacteria 2235
399 Ga0495582_0080992 3300046473 Bacteria 1803
400 Ga0495582_0161229 3300046473 Bacteria 1275
401 Ga0495582_0170100 3300046473 Bacteria 1240
402 Ga0495639_0003396 3300046475 Bacteria 6900
403 Ga0495639_0011717 3300046475 Bacteria 3782
404 Ga0495662_0004479 3300046476 Bacteria 7011
405 Ga0495662_0031498 3300046476 Bacteria 2561
406 Ga0495664_0003161 3300046477 Bacteria 8940
407 Ga0495664_0065570 3300046477 Bacteria 2165
408 Ga0495594_0007265 3300046499 Bacteria 5696
409 Ga0495594_0008965 3300046499 Bacteria 5160
410 Ga0495608_0076166 3300046511 Bacteria 2186
411 Ga0495618_0015750 3300046514 Bacteria 4616
412 Ga0495618_0016080 3300046514 Bacteria 4571
413 Ga0495618_0038398 3300046514 Bacteria 3009
414 Ga0495618_0080568 3300046514 Bacteria 2077
415 Ga0495618_0084929 3300046514 Bacteria 2023
416 Ga0495628_0005874 3300046516 Bacteria 10748
417 Ga0495628_0193677 3300046516 Bacteria 1534
418 Ga0495630_0317016 3300046517 Bacteria 1192
419 Ga0495632_0025972 3300046519 Bacteria 3090
420 Ga0495643_0001312 3300046522 Bacteria 23618
421 Ga0495643_0089955 3300046522 Bacteria 1585
422 Ga0495666_0067295 3300046526 Bacteria 1707
423 Ga0495652_0001220 3300046529 Bacteria 28817
424 Ga0495652_0038810 3300046529 Bacteria 4122
425 Ga0495652_0063915 3300046529 Bacteria 3098
426 Ga0495652_0092796 3300046529 Bacteria 2466
427 Ga0495652_0110001 3300046529 Bacteria 2217
428 Ga0495665_0005843 3300046531 Bacteria 6637
429 Ga0495640_0022618 3300046533 Bacteria 4591
430 Ga0495640_0187365 3300046533 Bacteria 1316
431 Ga0495640_0211027 3300046533 Bacteria 1227
432 Ga0495586_0005357 3300046535 Bacteria 6861
433 Ga0495586_0039720 3300046535 Bacteria 2530
434 Ga0495586_0044726 3300046535 Bacteria 2385
435 Ga0495587_0000780 3300046536 Bacteria 21272
436 Ga0495587_0005283 3300046536 Bacteria 8443
437 Ga0495645_0000625 3300046543 Bacteria 24383
438 Ga0495645_0007448 3300046543 Bacteria 7619
439 Ga0495645_0019749 3300046543 Bacteria 4854
440 Ga0495645_0131956 3300046543 Bacteria 1750
441 Ga0495622_0028337 3300046557 Bacteria 2615
442 Ga0495633_0047948 3300046558 Bacteria 2018
443 Ga0495667_0000589 3300046559 Bacteria 23117
444 Ga0495667_0142705 3300046559 Bacteria 1543
445 Ga0495668_0001241 3300046616 Bacteria 25583
446 Ga0495634_0001298 3300046642 Bacteria 22835
447 Ga0495634_0088696 3300046642 Bacteria 2011
448 Ga0495634_0089815 3300046642 Bacteria 1996
449 Ga0495625_0000674 3300046660 Bacteria 48712
450 Ga0495625_0085072 3300046660 Bacteria 2196
451 Ga0495588_0010943 3300046674 Bacteria 4243
452 Ga0495588_0013960 3300046674 Bacteria 3837
453 Ga0495588_0014212 3300046674 Bacteria 3807
454 Ga0495588_0017061 3300046674 Bacteria 3519
455 Ga0495588_0018780 3300046674 Bacteria 3376
456 Ga0495588_0049457 3300046674 Bacteria 2162
457 Ga0495588_0071085 3300046674 Bacteria 1809
458 Ga0495588_0122359 3300046674 Bacteria 1371
459 Ga0495657_0001313 3300046675 Bacteria 21641
460 Ga0495657_0004127 3300046675 Bacteria 11635
461 Ga0495657_0005398 3300046675 Bacteria 10116
462 Ga0495657_0068617 3300046675 Bacteria 2322
463 Ga0495657_0098509 3300046675 Bacteria 1865
464 Ga0495599_0011242 3300046678 Bacteria 5497
465 Ga0495623_0053416 3300046679 Bacteria 2551
466 Ga0495623_0153427 3300046679 Bacteria 1359
467 Ga0495646_0030674 3300046680 Bacteria 3356
468 Ga0495646_0039162 3300046680 Bacteria 2923
469 Ga0495646_0052294 3300046680 Bacteria 2468
470 Ga0495646_0135158 3300046680 Bacteria 1384
471 Ga0495613_0008680 3300046689 Bacteria 7535
472 Ga0495613_0023725 3300046689 Bacteria 4571
473 Ga0495613_0031068 3300046689 Bacteria 3967
474 Ga0495613_0035144 3300046689 Bacteria 3720
475 Ga0495613_0035325 3300046689 Bacteria 3710
476 Ga0495613_0077140 3300046689 Bacteria 2424
477 Ga0495613_0095102 3300046689 Bacteria 2155
478 Ga0495624_0043285 3300046690 Bacteria 2873
479 Ga0495624_0089901 3300046690 Bacteria 1894
480 Ga0495624_0118044 3300046690 Bacteria 1630
481 Ga0495670_0036016 3300046691 Bacteria 2465
482 Ga0495671_0009657 3300046692 Bacteria 5381
483 Ga0495589_0026136 3300046794 Bacteria 2960
484 Ga0495589_0043533 3300046794 Bacteria 2234
485 Ga0495589_0059684 3300046794 Bacteria 1874
486 Ga0495589_0072677 3300046794 Bacteria 1679
487 Ga0495600_0015055 3300046809 Bacteria 4884
488 Ga0495600_0030554 3300046809 Bacteria 3489
489 Ga0495600_0088524 3300046809 Bacteria 2020
490 Ga0495581_0000180 3300047315 Bacteria 29020
491 Ga0495581_0013508 3300047315 Bacteria 4736
492 Ga0495581_0023426 3300047315 Bacteria 3578
493 Ga0495581_0033623 3300047315 Bacteria 2967
494 Ga0495581_0054559 3300047315 Bacteria 2307
495 Ga0495581_0060634 3300047315 Bacteria 2186
496 Ga0495581_0100037 3300047315 Bacteria 1684
497 Ga0495581_0118027 3300047315 Bacteria 1543
498 Ga0495581_0191761 3300047315 Bacteria 1195
499 Ga0495604_0003847 3300047317 Bacteria 11959
500 Ga0495604_0010094 3300047317 Bacteria 7478
501 Ga0495604_0093799 3300047317 Bacteria 2220
502 Ga0495636_0001028 3300047318 Bacteria 10459
503 Ga0495636_0003017 3300047318 Bacteria 6524
504 Ga0495636_0003187 3300047318 Bacteria 6359
505 Ga0495636_0004267 3300047318 Bacteria 5610
506 Ga0495636_0026343 3300047318 Bacteria 2365
507 Ga0495674_0097949 3300047319 Bacteria 2498
508 Ga0495676_0009557 3300047321 Bacteria 8825
509 Ga0495676_0017172 3300047321 Bacteria 6404
510 Ga0495676_0109818 3300047321 Bacteria 2026
511 Ga0495676_0167406 3300047321 Bacteria 1549
512 Ga0495680_0004071 3300047322 Bacteria 14077
513 Ga0495680_0030897 3300047322 Bacteria 4365
514 Ga0495687_003646 3300047443 Bacteria 10977
515 Ga0495687_009699 3300047443 Bacteria 5354
516 Ga0495687_013800 3300047443 Bacteria 4193
517 Ga0495675_0017025 3300047444 Bacteria 4601
518 Ga0495675_0089173 3300047444 Bacteria 1936
519 Ga0495675_0100744 3300047444 Bacteria 1808
520 Ga0495675_0137607 3300047444 Bacteria 1515
521 Ga0495685_000217 3300047447 Bacteria 19537
522 Ga0495685_000379 3300047447 Bacteria 14136
523 Ga0495685_004594 3300047447 Bacteria 4474
524 Ga0495685_008255 3300047447 Bacteria 3452
525 Ga0495685_021565 3300047447 Bacteria 2216
526 Ga0495681_0000539 3300047470 Bacteria 29033
527 Ga0495684_0061052 3300047471 Bacteria 2868
528 Ga0495593_0006519 3300047673 Bacteria 6839
529 Ga0495593_0007619 3300047673 Bacteria 6322
530 Ga0495593_0025856 3300047673 Bacteria 3248
531 Ga0495593_0038476 3300047673 Bacteria 2583
532 Ga0495602_0077445 3300048088 Bacteria 2813
533 Ga0495614_0005289 3300048089 Bacteria 5821
534 Ga0495614_0005327 3300048089 Bacteria 5801
535 Ga0495614_0022556 3300048089 Bacteria 2716
536 Ga0495614_0081593 3300048089 Bacteria 1401
537 Ga0495626_0000930 3300048091 Bacteria 25621
538 Ga0496100_0168919 3300048903 Bacteria 1573
539 Ga0496101_0021141 3300048904 Bacteria 4468
540 Ga0496101_0097312 3300048904 Bacteria 2197
541 Ga0496101_0312280 3300048904 Bacteria 1232
542 Ga0496102_0003332 3300048905 Bacteria 13622
543 Ga0496102_0031780 3300048905 Bacteria 4738
544 Ga0496102_0040238 3300048905 Bacteria 4228
545 Ga0496102_0173650 3300048905 Bacteria 2029
546 Ga0496102_0333936 3300048905 Bacteria 1427
547 Ga0496103_0039094 3300048906 Bacteria 2914
548 Ga0496104_0038820 3300048907 Bacteria 4457
549 Ga0496104_0257633 3300048907 Bacteria 1657
550 Ga0496106_0071584 3300048909 Bacteria 2650
551 Ga0496106_0073226 3300048909 Bacteria 2620
552 Ga0496106_0109089 3300048909 Bacteria 2153
553 Ga0496107_0111213 3300048910 Bacteria 2013
554 Ga0496108_0059332 3300048911 Bacteria 3217
555 Ga0496108_0118726 3300048911 Bacteria 2267
556 Ga0496108_0138358 3300048911 Bacteria 2097
557 Ga0496108_0150889 3300048911 Bacteria 2005
558 Ga0496108_0250406 3300048911 Bacteria 1541
559 Ga0496109_0010492 3300048912 Bacteria 7915
560 Ga0496109_0012909 3300048912 Bacteria 7223
561 Ga0496109_0063641 3300048912 Bacteria 3374
562 Ga0496109_0091864 3300048912 Bacteria 2807
563 Ga0496110_0015615 3300048913 Bacteria 6324
564 Ga0496110_0350854 3300048913 Bacteria 1344
565 Ga0496111_0109993 3300048914 Bacteria 2029
566 Ga0496111_0189592 3300048914 Bacteria 1528
567 Ga0496111_0370464 3300048914 Bacteria 1060
568 Ga0496112_0010348 3300048915 Bacteria 8458
569 Ga0496112_0023592 3300048915 Bacteria 5880
570 Ga0496112_0150097 3300048915 Bacteria 2298
571 Ga0496112_0321906 3300048915 Bacteria 1491
572 Ga0496113_0042260 3300048916 Bacteria 3367
573 Ga0496113_0118312 3300048916 Bacteria 2069
574 Ga0496114_0000523 3300048917 Bacteria 28236
575 Ga0496114_0016774 3300048917 Bacteria 5905
576 Ga0496114_0149008 3300048917 Bacteria 2029
577 Ga0496114_0172838 3300048917 Bacteria 1884
578 Ga0496114_0272719 3300048917 Bacteria 1491
579 Ga0496115_0009426 3300048918 Bacteria 7254
580 Ga0496124_0081618 3300048927 Bacteria 2657
581 Ga0496124_0163388 3300048927 Bacteria 1733
582 Ga0496126_0014945 3300048929 Bacteria 7828
583 Ga0496126_0347198 3300048929 Bacteria 1214
584 Ga0501317_008913 3300049533 Bacteria 1167
585 Ga0501318_001910 3300049534 Bacteria 1729
586 Ga0501318_002651 3300049534 Bacteria 1574
587 Ga0501032_0009671 3300049569 Bacteria 6983
588 Ga0501032_0045906 3300049569 Bacteria 2953
589 Ga0501032_0050144 3300049569 Bacteria 2815
590 Ga0501032_0090277 3300049569 Bacteria 2033
591 Ga0501032_0127279 3300049569 Bacteria 1682
592 Ga0501033_0002155 3300049570 Bacteria 17027
593 Ga0501033_0016026 3300049570 Bacteria 5676
594 Ga0501034_0006642 3300049571 Bacteria 12413
595 Ga0501034_0017406 3300049571 Bacteria 7372
596 Ga0501034_0042464 3300049571 Bacteria 4603
597 Ga0501034_0051344 3300049571 Bacteria 4158
598 Ga0501034_0221030 3300049571 Bacteria 1847
599 Ga0501036_0000774 3300049572 Bacteria 23713
600 Ga0501036_0003007 3300049572 Bacteria 13416
601 Ga0501036_0005567 3300049572 Bacteria 10218
602 Ga0501036_0008555 3300049572 Bacteria 8392
603 Ga0501036_0069750 3300049572 Bacteria 2973
604 Ga0501036_0087052 3300049572 Bacteria 2640
605 Ga0501036_0287098 3300049572 Bacteria 1377
606 Ga0501037_0007927 3300049573 Bacteria 7781
607 Ga0501037_0011721 3300049573 Bacteria 6454
608 Ga0501037_0178807 3300049573 Bacteria 1506
609 Ga0501037_0231453 3300049573 Bacteria 1297
610 Ga0501038_0001037 3300049574 Bacteria 25085
611 Ga0501038_0002536 3300049574 Bacteria 17027
612 Ga0501038_0018586 3300049574 Bacteria 6277
613 Ga0501038_0089268 3300049574 Bacteria 2585
614 Ga0501038_0166775 3300049574 Bacteria 1786
615 Ga0501038_0206621 3300049574 Bacteria 1573
616 Ga0501038_0409832 3300049574 Bacteria 1047
617 Ga0501039_0061924 3300049575 Bacteria 2898
618 Ga0501042_0003369 3300049578 Bacteria 10023
619 Ga0501042_0074685 3300049578 Bacteria 2426
620 Ga0501043_0002134 3300049579 Bacteria 16883
621 Ga0501043_0002303 3300049579 Bacteria 16184
622 Ga0501043_0022882 3300049579 Bacteria 4900
623 Ga0501043_0053435 3300049579 Bacteria 3172
624 Ga0501046_0064418 3300049580 Bacteria 2861
625 Ga0501047_0030168 3300049581 Bacteria 5228
626 Ga0501047_0054229 3300049581 Bacteria 3877
627 Ga0501067_0012919 3300049583 Bacteria 4621
628 Ga0501068_0021266 3300049584 Bacteria 3787
629 Ga0501070_0000581 3300049586 Bacteria 33287
630 Ga0501070_0001853 3300049586 Bacteria 18668
631 Ga0501070_0002822 3300049586 Bacteria 15159
632 Ga0501070_0010509 3300049586 Bacteria 7825
633 Ga0501070_0025748 3300049586 Bacteria 4935
634 Ga0501070_0114748 3300049586 Bacteria 2225
635 Ga0501070_0134279 3300049586 Bacteria 2043
636 Ga0501070_0328109 3300049586 Bacteria 1244
637 Ga0501071_0253090 3300049587 Bacteria 1330
638 Ga0501073_0143765 3300049589 Bacteria 1653
639 Ga0501074_0000701 3300049590 Bacteria 20963
640 Ga0501074_0006411 3300049590 Bacteria 8500
641 Ga0501074_0008606 3300049590 Bacteria 7391
642 Ga0501074_0064424 3300049590 Bacteria 2638
643 Ga0501074_0133091 3300049590 Bacteria 1778
644 Ga0501076_0168883 3300049592 Bacteria 1783
645 Ga0501077_0116703 3300049593 Bacteria 1691
646 Ga0501079_0000273 3300049741 Bacteria 31797
647 Ga0501080_0001250 3300049742 Bacteria 21163
648 Ga0501080_0040138 3300049742 Bacteria 4366
649 Ga0501080_0069805 3300049742 Bacteria 3268
650 Ga0501080_0120778 3300049742 Bacteria 2428
651 Ga0501080_0387650 3300049742 Bacteria 1258
652 Ga0501035_0001796 3300049822 Bacteria 21670
653 Ga0501035_0189363 3300049822 Bacteria 1769
654 Ga0501035_0202195 3300049822 Bacteria 1703
655 Ga0501044_0005003 3300049823 Bacteria 14795
656 Ga0501044_0065849 3300049823 Bacteria 3695
657 Ga0501044_0122235 3300049823 Bacteria 2603
658 Ga0501044_0147342 3300049823 Bacteria 2338
659 Ga0501044_0160030 3300049823 Bacteria 2229
660 Ga0501045_0042782 3300049824 Bacteria 3298
661 Ga0501045_0055560 3300049824 Bacteria 2895
662 nmdc:mga03n38_96907_c1 3300050490 Bacteria 1415
663 nmdc:mga00v17_125686_c1 3300050491 Bacteria 1636
664 nmdc:mga0yw44_114454_c1 3300050492 Bacteria 1731
665 nmdc:mga0yw44_185289_c1 3300050492 Bacteria 1371
666 nmdc:mga0yw44_276917_c1 3300050492 Bacteria 1121
667 nmdc:mga04h51_1007_c1 3300050495 Bacteria 6501
668 nmdc:mga05p37_384066_c1 3300050507 Bacteria 1644
669 nmdc:mga0qj67_38538_c1 3300050509 Bacteria 3750
670 Ga0495601_0001056 3300053077 Bacteria 15081
671 Ga0495612_0064966 3300053078 Bacteria 1515
672 Ga0495612_0070362 3300053078 Bacteria 1458
673 Ga0495655_0004320 3300053083 Bacteria 2420
674 Ga0495619_0045273 3300053085 Bacteria 2891
675 Ga0500578_0119065 3300053086 Bacteria 1660
676 Ga0500553_096763 3300053101 Bacteria 1282
677 Ga0500652_035224 3300053131 Bacteria 1987
678 Ga0500561_0010182 3300053137 Bacteria 1934
679 Ga0500568_0000053 3300053139 Bacteria 111636
680 Ga0500573_0077316 3300053140 Bacteria 1894
681 Ga0500600_0062325 3300053149 Bacteria 2074
682 Ga0500616_0003791 3300053153 Bacteria 11224
683 Ga0500616_0024724 3300053153 Bacteria 3334
684 Ga0500633_0034499 3300053160 Bacteria 1659
685 Ga0500634_0021094 3300053161 Bacteria 3526
686 Ga0501084_0000052 3300054114 Bacteria 92225
687 Ga0501084_0049504 3300054114 Bacteria 3518
688 Ga0587067_019276 3300059640 Bacteria 1154
689 Ga0501082_0153936 3300060353 Bacteria 1997
690 Ga0466962_0000181 3300061719 Bacteria 26153
691 Ga0466962_0000902 3300061719 Bacteria 13479
692 2808849987 2808606360 Bacteria 4404006
693 2554260255 2554235005 Bacteria 6457341
694 2585297731 2582581312 Bacteria 7308206
695 2585303219 2582581313 Bacteria 10042643
696 2585309639 2582581313 Bacteria 10042643
697 2616693827 2616644814 Bacteria 11555299
698 2623497907 2622736605 Bacteria 4992138
699 2643890166 2643221576 Bacteria 5214352
700 2643890794 2643221576 Bacteria 5214352
701 2643946368 2643221587 Bacteria 7586415
702 2643959222 2643221590 Bacteria 5214697
703 2643959850 2643221590 Bacteria 5214697
704 2644033513 2643221604 Bacteria 5014917
705 2644178381 2643221631 Bacteria 8168043
706 2644262131 2643221647 Bacteria 10741251
707 2644264335 2643221647 Bacteria 10741251
708 2644389285 2643221670 Bacteria 6497041
709 2644434172 2643221677 Bacteria 7584031
710 2644440570 2643221678 Bacteria 9540101
711 2644446894 2643221679 Bacteria 3839507
712 2644627719 2643221714 Bacteria 9015452
713 2644627741 2643221714 Bacteria 9015452
714 2671835278 2671180195 Bacteria 9757215
715 2676484594 2675903059 Bacteria 8644972
716 2691512194 2690315906 Bacteria 4517044
717 2738870082 2738541305 Bacteria 4910150
718 2744954341 2744054611 Bacteria 5611514
719 2753072146 2751185734 Bacteria 8863695
720 2768645204 2767802112 Bacteria 6465194
721 2772647346 2772190715 Bacteria 6959372
722 2774395389 2773857762 Bacteria 5971770
723 2774853434 2773857922 Bacteria 9757215
724 2775655777 2775506735 Bacteria 4556596
725 2775657517 2775506735 Bacteria 4556596
726 2776374812 2775506925 Bacteria 7237746
727 2785346535 2784746763 Bacteria 9783172
728 2785366824 2784746768 Bacteria 10036182
729 2785374045 2784746768 Bacteria 10036182
730 2786667870 2786546132 Bacteria 10419719
731 2786674284 2786546132 Bacteria 10419719
732 2791909865 2791354901 Bacteria 8322202
733 2793977590 2791355406 Bacteria 11364898
734 2795781678 2795385470 Bacteria 8317180
735 2808828722 2808606357 Bacteria 4466944
736 2808845761 2808606359 Bacteria 9866990
737 2808877451 2808606366 Bacteria 4415912
738 2808893716 2808606370 Bacteria 4942454
739 2808898930 2808606371 Bacteria 4251511
740 2808915609 2808606375 Bacteria 9466072
741 2808917880 2808606375 Bacteria 9466072
742 2810363884 2808606700 Bacteria 3482157
743 2811842709 2808606982 Bacteria 7791042
744 2812319551 2811994871 Bacteria 4497550
745 2812321407 2811994871 Bacteria 4497550
746 2812330079 2811994874 Bacteria 5367947
747 2812348510 2811994878 Bacteria 5992952
748 2819743467 2818991472 Bacteria 10089953
749 2844851774 2844849076 Bacteria 4091819
750 2855673297 2855670206 Bacteria 7120389
751 2855681094 2855676851 Bacteria 7063653
752 2856745207 2856741275 Bacteria 8096094
753 2857293511 2857288857 Bacteria 7189066
754 2857743392 2857740372 Bacteria 4782044
755 2858851318 2858848962 Bacteria 6963058
756 2858887572 2858882152 Bacteria 7230291
757 2858892690 2858888857 Bacteria 7060307
758 2861528235 2861520306 Bacteria 8348283
759 2862180493 2862178590 Bacteria 8583590
760 2862282602 2862281513 Bacteria 9621493
761 2862283804 2862281513 Bacteria 9621493
762 2862292886 2862290372 Bacteria 7471434
763 2862390607 2862382967 Bacteria 10317375
764 2862574974 2862574272 Bacteria 10567477
765 2863071955 2863067949 Bacteria 8541735
766 2863410843 2863404153 Bacteria 9672205
767 2866554457 2866552031 Bacteria 5824618
768 2867347660 2867346516 Bacteria 7608576
769 2867432053 2867428634 Bacteria 9590268
770 2867438000 2867428634 Bacteria 9590268
771 2867479539 2867475112 Bacteria 6909112
772 2867507198 2867507094 Bacteria 6506033
773 2869049405 2869048445 Bacteria 6875584
774 2869066982 2869061728 Bacteria 7112407
775 2869070139 2869068681 Bacteria 7205615
776 2873152277 2873151551 Bacteria 8625867
777 2873157777 2873151551 Bacteria 8625867
778 2873321940 2873314349 Bacteria 8512634
779 2877677224 2877676314 Bacteria 9512378
780 2877683722 2877676314 Bacteria 9512378
781 2880500726 2880495981 Bacteria 7340502
782 2884695133 2884693830 Bacteria 11273186
783 2891328823 2891326441 Bacteria 6439512
784 2891404343 2891395885 Bacteria 9251614
785 2891567117 2891562705 Bacteria 8039471
786 2893686684 2893684298 Bacteria 2897960
787 2895446185 2895442618 Bacteria 11027144
788 2904498038 2904497146 Bacteria 4731781
789 2904777396 2904776348 Bacteria 4658726
790 2905926853 2905926851 Bacteria 4423176
791 2905930110 2905926851 Bacteria 4423176
792 2910813425 2910809715 Bacteria 4982797
793 2912723859 2912715099 Bacteria 9460473
794 2912759071 2912757875 Bacteria 7940295
795 2919034768 2919034639 Bacteria 4763403
796 2919054090 2919051321 Bacteria 4210889
797 2919054380 2919051321 Bacteria 4210889
798 2919062086 2919059106 Bacteria 4991624
799 2919448236 2919446982 Bacteria 3994487
800 2919470640 2919468124 Bacteria 9133025
801 2919540233 2919538618 Bacteria 4677069
802 2920880117 2920879853 Bacteria 4216831
803 2920882157 2920879853 Bacteria 4216831
804 2929229238 2929226422 Bacteria 7248583
805 2932428063 2932426870 Bacteria 4547726
806 2933421420 2933418574 Bacteria 4476724
807 2939598227 2939598168 Bacteria 4687164
808 2939601131 2939598168 Bacteria 4687164
809 2939647544 2939647034 Bacteria 4681660
810 2939675472 2939674588 Bacteria 4844420
811 2945917297 2945916053 Bacteria 4555517
812 2945923257 2945920336 Bacteria 4501603
813 2945941349 2945941187 Bacteria 4682474
814 2945960860 2945956166 Bacteria 5110334
815 2945960892 2945956166 Bacteria 5110334
816 2946004296 2946003308 Bacteria 3857229
817 2946024612 2946024296 Bacteria 3508095
818 2946041028 2946037020 Bacteria 4900426
819 2946045892 2946045630 Bacteria 8527308
820 2946061137 2946059875 Bacteria 4386623
821 2946079601 2946072368 Bacteria 8999607
822 2947224854 2947224130 Bacteria 9938529
823 2954002260 2953998280 Bacteria 4812144
824 2954003464 2954002825 Bacteria 9173742
825 2954381950 2954380949 Bacteria 10050426
826 2954389016 2954380949 Bacteria 10050426
827 2954674010 2954673503 Bacteria 9685905
828 2954681127 2954673503 Bacteria 9685905
829 2954683030 2954682443 Bacteria 9862841
830 2954689978 2954682443 Bacteria 9862841
831 2954699755 2954691527 Bacteria 10720516
832 2954712408 2954711539 Bacteria 10867210
833 2954718695 2954711539 Bacteria 10867210
834 2954722356 2954721474 Bacteria 10456478
835 2954728666 2954721474 Bacteria 10456478
836 2954733146 2954731030 Bacteria 10243860
837 2954739495 2954731030 Bacteria 10243860
838 2954741242 2954740390 Bacteria 10229294
839 2954747562 2954740390 Bacteria 10229294
840 2954752026 2954749733 Bacteria 10366972
841 2954758322 2954749733 Bacteria 10366972
842 2954760253 2954759201 Bacteria 9358192
843 2954766679 2954759201 Bacteria 9358192
844 2964328358 2964326757 Bacteria 3290868
845 2974305284 2974302888 Bacteria 4369871
846 2984577372 2984576629 Bacteria 4248407
847 2990064633 2990059506 Bacteria 9321252
848 2990259533 2990256926 Bacteria 4252839
849 2995727388 2995726249 Bacteria 3470435
850 2997456493 2997451912 Bacteria 8492419
851 2997600332 2997600082 Bacteria 9896405
852 3006328171 3006321560 Bacteria 8247479
853 3006428785 3006425503 Bacteria 6491253
854 3006491147 3006486233 Bacteria 8157040
855 3006494953 3006493962 Bacteria 8825450
856 8002788839 8002784119 Bacteria 9788632
857 8004029050 8004025490 Bacteria 4327753
858 8008564971 8008558824 Bacteria 10610750
859 8047716635 8047710418 Bacteria 11023148
860 8047898023 8047893842 Bacteria 11723082
861 8048360870 8048356638 Bacteria 11044339
862 8048374986 8048369669 Bacteria 11666822
863 8048383220 8048379754 Bacteria 11877923
864 8054109925 8054107350 Bacteria 5022511
865 8054162770 8054160619 Bacteria 7783213
866 8054706131 8054704163 Bacteria 7247792
867 8054730363 8054727385 Bacteria 7558670
868 8054738167 8054734606 Bacteria 6947278
869 8055071441 8055066027 Bacteria 9479577
870 8055159771 8055157932 Bacteria 6429399
871 8055174947 8055172936 Bacteria 9305943
872 8055417823 8055412473 Bacteria 6257500
873 8056211410 8056207758 Bacteria 8639239
874 8056673323 8056667051 Bacteria 6953971
875 8056830730 8056829672 Bacteria 9045328
876 8056834826 8056829672 Bacteria 9045328
877 LJQas_1006008
878 JGI24740J21852_10022565
879 JGI25152J39213_1000564
880 rootL2_10182415
881 JGI25160J50197_1014019
882 Ga0055542_1004126
883 Ga0055540_1002891
884 Ga0055540_1005551
885 Ga0055540_1007668
886 Ga0065714_10017933
887 Ga0065714_10019874
888 Ga0070676_10128473
889 Ga0070683_100047725
890 Ga0070670_100043661
891 Ga0070670_100063897
892 Ga0070666_10082066
893 Ga0070680_100029410
894 Ga0070682_100045910
895 Ga0070687_100018156
896 Ga0070692_10003998
897 Ga0070692_10057589
898 Ga0070668_100180512
899 Ga0070669_100039627
900 Ga0070669_100113981
901 Ga0070675_100126521
902 Ga0070671_100055122
903 Ga0070671_100104983
904 Ga0070673_100157025
905 Ga0070659_100075973
906 Ga0070714_100169521
907 Ga0070713_100102826
908 Ga0070710_10003528
909 Ga0070711_100110460
910 Ga0070705_100209077
911 Ga0070700_100002168
912 Ga0070678_100012916
913 Ga0070681_10090418
914 Ga0068867_100095786
915 Ga0070707_100010754
916 Ga0070707_100057882
917 Ga0070698_100000415
918 Ga0070698_100035998
919 Ga0070679_100006189
920 Ga0070679_100062892
921 Ga0070679_100184078
922 Ga0070684_100043610
923 Ga0070684_100077247
924 Ga0070684_100134260
925 Ga0070697_100029208
926 Ga0070672_100001302
927 Ga0070672_100139221
928 Ga0070665_100001255
929 Ga0068857_100011946
930 Ga0070702_100082705
931 Ga0068852_100010223
932 Ga0068852_100078292
933 Ga0068864_100056722
934 Ga0068866_10016695
935 Ga0068861_100095487
936 Ga0081455_10014512
937 Ga0081540_1012199
938 Ga0075365_10030556
939 Ga0075365_10180105
940 Ga0075365_10242208
941 Ga0075432_10000424
942 Ga0070715_10081209
943 Ga0070716_100012164
944 Ga0075367_10001514
945 Ga0068865_100048815
946 Ga0099826_10084204
947 Ga0105251_10021678
948 Ga0105251_10024199
949 Ga0105244_10003027
950 Ga0105244_10098294
951 Ga0111539_10255520
952 Ga0105245_10085548
953 Ga0105245_10235075
954 Ga0105243_10010279
955 Ga0105243_10015649
956 Ga0105243_10034709
957 Ga0105243_10078234
958 Ga0105243_10113935
959 Ga0105248_10053041
960 Ga0105248_10061347
961 Ga0105238_10207521
962 Ga0105238_10288892
963 Ga0105249_10010275
964 Ga0105249_10159649
965 Ga0105239_10011607
966 Ga0105239_10279011
967 Ga0105246_10001152
968 Ga0105246_10002505
969 Ga0105246_10027246
970 Ga0105246_10112250
971 Ga0105246_10276060
972 Ga0157371_10085290
973 Ga0157369_10342459
974 Ga0163162_10020143
975 Ga0163162_10196031
976 Ga0157380_10170889
977 Ga0157377_10003750
978 Ga0157379_10019033
979 Ga0183367_1003
980 Ga0183367_1004
981 Ga0163161_10020014
982 Ga0206356_10752756
983 Ga0206350_10749295
984 Ga0206353_10539143
985 Ga0213875_10001608
986 Ga0213875_10001884
987 Ga0213875_10002648
988 Ga0213875_10003198
989 Ga0224712_10008931
990 Ga0209148_1004095
991 Ga0209129_1000448
992 Ga0209025_1001977
993 Ga0207426_1000996
994 Ga0207426_1001844
995 Ga0207426_1008971
996 Ga0207426_1015577
997 Ga0209051_1000569
998 Ga0209051_1005041
999 Ga0209051_1008251
1000 Ga0209051_1010666
1001 Ga0209051_1022562
1002 Ga0207697_10002395
1003 Ga0207697_10011335
1004 Ga0207655_1034402
1005 Ga0207688_10031078
1006 Ga0207647_10006174
1007 Ga0207699_10104347
1008 Ga0207645_10076255
1009 Ga0207705_10067528
1010 Ga0207684_10031140
1011 Ga0207707_10068043
1012 Ga0207657_10009534
1013 Ga0207657_10168981
1014 Ga0207652_10059261
1015 Ga0207646_10061476
1016 Ga0207681_10105877
1017 Ga0207650_10258405
1018 Ga0207650_10309582
1019 Ga0207659_10332160
1020 Ga0207659_10339784
1021 Ga0207700_10119803
1022 Ga0207664_10014646
1023 Ga0207690_10114019
1024 Ga0207706_10330019
1025 Ga0207709_10064881
1026 Ga0207709_10077337
1027 Ga0207709_10104325
1028 Ga0207709_10226924
1029 Ga0207669_10060376
1030 Ga0207669_10203960
1031 Ga0207704_10085325
1032 Ga0207665_10006521
1033 Ga0207691_10004085
1034 Ga0207691_10005260
1035 Ga0207691_10016690
1036 Ga0207679_10149555
1037 Ga0207667_10241581
1038 Ga0207712_10342985
1039 Ga0207668_10164577
1040 Ga0207639_10108233
1041 Ga0207678_10075994
1042 Ga0207708_10000344
1043 Ga0207702_10047904
1044 Ga0207648_10006022
1045 Ga0207674_10010339
1046 Ga0207674_10041217
1047 Ga0207675_100026825
1048 Ga0207683_10009698
1049 Ga0207698_10040586
1050 Ga0207698_10152692
1051 Ga0209813_10008271
1052 Ga0207428_10070863
1053 Ga0207428_10096726
1054 Ga0268266_10003222
1055 Ga0268266_10168223
1056 Ga0265337_1000828
1057 Ga0265319_1014199
1058 Ga0265334_10001841
1059 Ga0265318_10028543
1060 Ga0307517_10005154
1061 Ga0307517_10052524
1062 Ga0307515_10000287
1063 Ga0265338_10001152
1064 Ga0265338_10001947
1065 Ga0265324_10009980
1066 Ga0307511_10054014
1067 Ga0307511_10107460
1068 Ga0316177_1202800
1069 Ga0265332_10002553
1070 Ga0265325_10016263
1071 Ga0265327_10001401
1072 Ga0265316_10036129
1073 Ga0307509_10018420
1074 Ga0307509_10181895
1075 Ga0307408_100047312
1076 Ga0307408_100052488
1077 Ga0307408_100087671
1078 Ga0307408_100159007
1079 Ga0307508_10003098
1080 Ga0307508_10005246
1081 Ga0307508_10030795
1082 Ga0307508_10104562
1083 Ga0265314_10042418
1084 Ga0307405_10043756
1085 Ga0307405_10200291
1086 Ga0307413_10031521
1087 Ga0307413_10078550
1088 Ga0307518_10073508
1089 Ga0307518_10086335
1090 Ga0307410_10015810
1091 Ga0307410_10137137
1092 Ga0307410_10161998
1093 Ga0307410_10242880
1094 Ga0307406_10057533
1095 Ga0307406_10255168
1096 Ga0307407_10009496
1097 Ga0307407_10028919
1098 Ga0307412_10023417
1099 Ga0307412_10066466
1100 Ga0307412_10089926
1101 Ga0307412_10116847
1102 Ga0307412_10172767
1103 Ga0307409_100011989
1104 Ga0307409_100072398
1105 Ga0307409_100077431
1106 Ga0307409_100154785
1107 Ga0307409_100186119
1108 Ga0307416_100051250
1109 Ga0307416_100110817
1110 Ga0307416_100156030
1111 Ga0307416_100173584
1112 Ga0307416_100269090
1113 Ga0307416_100433997
1114 Ga0307414_10085084
1115 Ga0307414_10129394
1116 Ga0307411_10064073
1117 Ga0307415_100065053
1118 Ga0307415_100156528
1119 Ga0316585_10047709
1120 Ga0307507_10011053
1121 Ga0307507_10012829
1122 Ga0307510_10033207
1123 Ga0373941_0018446
1124 Ga0373954_0004908
1125 Ga0373956_0003350
1126 Ga0373956_0008865
1127 Ga0373957_0020668
1128 Ga0373942_0000108
1129 Ga0373962_0001387
1130 Ga0316574_0086429
1131 Ga0316574_0152459
1132 Ga0373935_0146785
1133 Ga0373933_0044544
1134 Ga0373937_0069210
1135 Ga0316584_0113785
1136 Ga0373925_0000004
1137 Ga0395899_0000668
1138 Ga0395899_0189292
1139 Ga0395900_0028800
1140 Ga0395900_0031034
1141 Ga0395900_0031468
1142 Ga0395900_0056944
1143 Ga0395900_0204452
1144 Ga0395900_0301187
1145 Ga0395898_0002672
1146 Ga0395898_0002992
1147 Ga0395898_0008045
1148 Ga0395898_0008680
1149 Ga0395898_0009913
1150 Ga0395898_0012707
1151 Ga0395898_0019330
1152 Ga0395898_0037428
1153 Ga0395898_0092713
1154 Ga0395898_0240409
1155 Ga0395905_0051920
1156 Ga0395905_0072948
1157 Ga0395905_0085470
1158 Ga0395905_0354423
1159 Ga0436364_0002840
1160 Ga0436364_0183141
1161 Ga0436364_0222259
1162 Ga0436364_0464776
1163 Ga0436364_0585101
1164 Ga0436364_1115616
1165 Ga0395901_0011064
1166 Ga0395901_0030134
1167 Ga0395901_0059991
1168 Ga0395901_0285123
1169 Ga0439436_0032068
1170 Ga0439436_0045343
1171 Ga0439466_0013413
1172 Ga0451793_0113644
1173 Ga0451793_1224384
1174 Ga0451843_0286974
1175 Ga0439433_0020558
1176 Ga0439442_000330
1177 Ga0439442_010928
1178 Ga0439432_015564
1179 Ga0439432_040014
1180 Ga0439449_0003551
1181 Ga0439449_0042080
1182 Ga0439449_0080337
1183 Ga0439455_0002123
1184 Ga0450920_000102
1185 Ga0450898_004930
1186 Ga0450903_000028
1187 Ga0450903_000647
1188 Ga0450907_000576
1189 Ga0439458_0000979
1190 Ga0439458_0002962
1191 Ga0439434_0000402
1192 Ga0466969_0011224
1193 Ga0466969_0017415
1194 Ga0466969_0123707
1195 Ga0466972_0003089
1196 Ga0466972_0007226
1197 Ga0466972_0008405
1198 Ga0466972_0012491
1199 Ga0466972_0049530
1200 Ga0466972_0055310
1201 Ga0466972_0064368
1202 Ga0466965_0003208
1203 Ga0466965_0006896
1204 Ga0466965_0010505
1205 Ga0466965_0042391
1206 Ga0466965_0077332
1207 Ga0466965_0112031
1208 Ga0466966_0003577
1209 Ga0466966_0007841
1210 Ga0466966_0079869
1211 Ga0466961_0010767
1212 Ga0466961_0028768
1213 Ga0466961_0097790
1214 Ga0466963_0000184
1215 Ga0466963_0003961
1216 Ga0466963_0010203
1217 Ga0466963_0031675
1218 Ga0466963_0076410
1219 Ga0466963_0110757
1220 Ga0466963_0128402
1221 Ga0466964_0018115
1222 Ga0466964_0030623
1223 Ga0466964_0049739
1224 Ga0466971_0001168
1225 Ga0466971_0069692
1226 Ga0466970_0000851
1227 Ga0466970_0002860
1228 Ga0466970_0004846
1229 Ga0466970_0005429
1230 Ga0466970_0014964
1231 Ga0466957_0000319
1232 Ga0466957_0000619
1233 Ga0466957_0075853
1234 Ga0466957_0083109
1235 Ga0466957_0122446
1236 Ga0466957_0141812
1237 Ga0466957_0260027
1238 Ga0466960_0001604
1239 Ga0466960_0032721
1240 Ga0466960_0134883
1241 Ga0466959_0001973
1242 Ga0466959_0009364
1243 Ga0451576_0353671
1244 Ga0466958_0003638
1245 Ga0466958_0008106
1246 Ga0466967_0007656
1247 Ga0466967_0019492
1248 Ga0466967_0028997
1249 Ga0466967_0029602
1250 Ga0466967_0046771
1251 Ga0466967_0107658
1252 Ga0466967_0118121
1253 Ga0466967_0121371
1254 Ga0466967_0260110
1255 Ga0466967_0500965
1256 Ga0495592_0046729
1257 Ga0495592_0064333
1258 Ga0495603_0001380
1259 Ga0495603_0006721
1260 Ga0495603_0058514
1261 Ga0495629_0034568
1262 Ga0495629_0038087
1263 Ga0495629_0075487
1264 Ga0495629_0112167
1265 Ga0495638_0011228
1266 Ga0495641_0016892
1267 Ga0495651_0007765
1268 Ga0495651_0029494
1269 Ga0495651_0040506
1270 Ga0495653_0016899
1271 Ga0495653_0104355
1272 Ga0495580_0021310
1273 Ga0495580_0078546
1274 Ga0495580_0082867
1275 Ga0495582_0080992
1276 Ga0495582_0161229
1277 Ga0495582_0170100
1278 Ga0495639_0003396
1279 Ga0495639_0011717
1280 Ga0495662_0004479
1281 Ga0495662_0031498
1282 Ga0495664_0003161
1283 Ga0495664_0065570
1284 Ga0495594_0007265
1285 Ga0495594_0008965
1286 Ga0495608_0076166
1287 Ga0495618_0015750
1288 Ga0495618_0016080
1289 Ga0495618_0038398
1290 Ga0495618_0080568
1291 Ga0495618_0084929
1292 Ga0495628_0005874
1293 Ga0495628_0193677
1294 Ga0495630_0317016
1295 Ga0495632_0025972
1296 Ga0495643_0001312
1297 Ga0495643_0089955
1298 Ga0495666_0067295
1299 Ga0495652_0001220
1300 Ga0495652_0038810
1301 Ga0495652_0063915
1302 Ga0495652_0092796
1303 Ga0495652_0110001
1304 Ga0495665_0005843
1305 Ga0495640_0022618
1306 Ga0495640_0187365
1307 Ga0495640_0211027
1308 Ga0495586_0005357
1309 Ga0495586_0039720
1310 Ga0495586_0044726
1311 Ga0495587_0000780
1312 Ga0495587_0005283
1313 Ga0495645_0000625
1314 Ga0495645_0007448
1315 Ga0495645_0019749
1316 Ga0495645_0131956
1317 Ga0495622_0028337
1318 Ga0495633_0047948
1319 Ga0495667_0000589
1320 Ga0495667_0142705
1321 Ga0495668_0001241
1322 Ga0495634_0001298
1323 Ga0495634_0088696
1324 Ga0495634_0089815
1325 Ga0495625_0000674
1326 Ga0495625_0085072
1327 Ga0495588_0010943
1328 Ga0495588_0013960
1329 Ga0495588_0014212
1330 Ga0495588_0017061
1331 Ga0495588_0018780
1332 Ga0495588_0049457
1333 Ga0495588_0071085
1334 Ga0495588_0122359
1335 Ga0495657_0001313
1336 Ga0495657_0004127
1337 Ga0495657_0005398
1338 Ga0495657_0068617
1339 Ga0495657_0098509
1340 Ga0495599_0011242
1341 Ga0495623_0053416
1342 Ga0495623_0153427
1343 Ga0495646_0030674
1344 Ga0495646_0039162
1345 Ga0495646_0052294
1346 Ga0495646_0135158
1347 Ga0495613_0008680
1348 Ga0495613_0023725
1349 Ga0495613_0031068
1350 Ga0495613_0035144
1351 Ga0495613_0035325
1352 Ga0495613_0077140
1353 Ga0495613_0095102
1354 Ga0495624_0043285
1355 Ga0495624_0089901
1356 Ga0495624_0118044
1357 Ga0495670_0036016
1358 Ga0495671_0009657
1359 Ga0495589_0026136
1360 Ga0495589_0043533
1361 Ga0495589_0059684
1362 Ga0495589_0072677
1363 Ga0495600_0015055
1364 Ga0495600_0030554
1365 Ga0495600_0088524
1366 Ga0495581_0000180
1367 Ga0495581_0013508
1368 Ga0495581_0023426
1369 Ga0495581_0033623
1370 Ga0495581_0054559
1371 Ga0495581_0060634
1372 Ga0495581_0100037
1373 Ga0495581_0118027
1374 Ga0495581_0191761
1375 Ga0495604_0003847
1376 Ga0495604_0010094
1377 Ga0495604_0093799
1378 Ga0495636_0001028
1379 Ga0495636_0003017
1380 Ga0495636_0003187
1381 Ga0495636_0004267
1382 Ga0495636_0026343
1383 Ga0495674_0097949
1384 Ga0495676_0009557
1385 Ga0495676_0017172
1386 Ga0495676_0109818
1387 Ga0495676_0167406
1388 Ga0495680_0004071
1389 Ga0495680_0030897
1390 Ga0495687_003646
1391 Ga0495687_009699
1392 Ga0495687_013800
1393 Ga0495675_0017025
1394 Ga0495675_0089173
1395 Ga0495675_0100744
1396 Ga0495675_0137607
1397 Ga0495685_000217
1398 Ga0495685_000379
1399 Ga0495685_004594
1400 Ga0495685_008255
1401 Ga0495685_021565
1402 Ga0495681_0000539
1403 Ga0495684_0061052
1404 Ga0495593_0006519
1405 Ga0495593_0007619
1406 Ga0495593_0025856
1407 Ga0495593_0038476
1408 Ga0495602_0077445
1409 Ga0495614_0005289
1410 Ga0495614_0005327
1411 Ga0495614_0022556
1412 Ga0495614_0081593
1413 Ga0495626_0000930
1414 Ga0496100_0168919
1415 Ga0496101_0021141
1416 Ga0496101_0097312
1417 Ga0496101_0312280
1418 Ga0496102_0003332
1419 Ga0496102_0031780
1420 Ga0496102_0040238
1421 Ga0496102_0173650
1422 Ga0496102_0333936
1423 Ga0496103_0039094
1424 Ga0496104_0038820
1425 Ga0496104_0257633
1426 Ga0496106_0071584
1427 Ga0496106_0073226
1428 Ga0496106_0109089
1429 Ga0496107_0111213
1430 Ga0496108_0059332
1431 Ga0496108_0118726
1432 Ga0496108_0138358
1433 Ga0496108_0150889
1434 Ga0496108_0250406
1435 Ga0496109_0010492
1436 Ga0496109_0012909
1437 Ga0496109_0063641
1438 Ga0496109_0091864
1439 Ga0496110_0015615
1440 Ga0496110_0350854
1441 Ga0496111_0109993
1442 Ga0496111_0189592
1443 Ga0496111_0370464
1444 Ga0496112_0010348
1445 Ga0496112_0023592
1446 Ga0496112_0150097
1447 Ga0496112_0321906
1448 Ga0496113_0042260
1449 Ga0496113_0118312
1450 Ga0496114_0000523
1451 Ga0496114_0016774
1452 Ga0496114_0149008
1453 Ga0496114_0172838
1454 Ga0496114_0272719
1455 Ga0496115_0009426
1456 Ga0496124_0081618
1457 Ga0496124_0163388
1458 Ga0496126_0014945
1459 Ga0496126_0347198
1460 Ga0501317_008913
1461 Ga0501318_001910
1462 Ga0501318_002651
1463 Ga0501032_0009671
1464 Ga0501032_0045906
1465 Ga0501032_0050144
1466 Ga0501032_0090277
1467 Ga0501032_0127279
1468 Ga0501033_0002155
1469 Ga0501033_0016026
1470 Ga0501034_0006642
1471 Ga0501034_0017406
1472 Ga0501034_0042464
1473 Ga0501034_0051344
1474 Ga0501034_0221030
1475 Ga0501036_0000774
1476 Ga0501036_0003007
1477 Ga0501036_0005567
1478 Ga0501036_0008555
1479 Ga0501036_0069750
1480 Ga0501036_0087052
1481 Ga0501036_0287098
1482 Ga0501037_0007927
1483 Ga0501037_0011721
1484 Ga0501037_0178807
1485 Ga0501037_0231453
1486 Ga0501038_0001037
1487 Ga0501038_0002536
1488 Ga0501038_0018586
1489 Ga0501038_0089268
1490 Ga0501038_0166775
1491 Ga0501038_0206621
1492 Ga0501038_0409832
1493 Ga0501039_0061924
1494 Ga0501042_0003369
1495 Ga0501042_0074685
1496 Ga0501043_0002134
1497 Ga0501043_0002303
1498 Ga0501043_0022882
1499 Ga0501043_0053435
1500 Ga0501046_0064418
1501 Ga0501047_0030168
1502 Ga0501047_0054229
1503 Ga0501067_0012919
1504 Ga0501068_0021266
1505 Ga0501070_0000581
1506 Ga0501070_0001853
1507 Ga0501070_0002822
1508 Ga0501070_0010509
1509 Ga0501070_0025748
1510 Ga0501070_0114748
1511 Ga0501070_0134279
1512 Ga0501070_0328109
1513 Ga0501071_0253090
1514 Ga0501073_0143765
1515 Ga0501074_0000701
1516 Ga0501074_0006411
1517 Ga0501074_0008606
1518 Ga0501074_0064424
1519 Ga0501074_0133091
1520 Ga0501076_0168883
1521 Ga0501077_0116703
1522 Ga0501079_0000273
1523 Ga0501080_0001250
1524 Ga0501080_0040138
1525 Ga0501080_0069805
1526 Ga0501080_0120778
1527 Ga0501080_0387650
1528 Ga0501035_0001796
1529 Ga0501035_0189363
1530 Ga0501035_0202195
1531 Ga0501044_0005003
1532 Ga0501044_0065849
1533 Ga0501044_0122235
1534 Ga0501044_0147342
1535 Ga0501044_0160030
1536 Ga0501045_0042782
1537 Ga0501045_0055560
1538 nmdc:mga03n38_96907_c1
1539 nmdc:mga00v17_125686_c1
1540 nmdc:mga0yw44_114454_c1
1541 nmdc:mga0yw44_185289_c1
1542 nmdc:mga0yw44_276917_c1
1543 nmdc:mga04h51_1007_c1
1544 nmdc:mga05p37_384066_c1
1545 nmdc:mga0qj67_38538_c1
1546 Ga0495601_0001056
1547 Ga0495612_0064966
1548 Ga0495612_0070362
1549 Ga0495655_0004320
1550 Ga0495619_0045273
1551 Ga0500578_0119065
1552 Ga0500553_096763
1553 Ga0500652_035224
1554 Ga0500561_0010182
1555 Ga0500568_0000053
1556 Ga0500573_0077316
1557 Ga0500600_0062325
1558 Ga0500616_0003791
1559 Ga0500616_0024724
1560 Ga0500633_0034499
1561 Ga0500634_0021094
1562 Ga0501084_0000052
1563 Ga0501084_0049504
1564 Ga0587067_019276
1565 Ga0501082_0153936
1566 Ga0466962_0000181
1567 Ga0466962_0000902
1568 2808849987
1569 2554260255
1570 2585297731
1571 2585303219
1572 2585309639
1573 2616693827
1574 2623497907
1575 2643890166
1576 2643890794
1577 2643946368
1578 2643959222
1579 2643959850
1580 2644033513
1581 2644178381
1582 2644262131
1583 2644264335
1584 2644389285
1585 2644434172
1586 2644440570
1587 2644446894
1588 2644627719
1589 2644627741
1590 2671835278
1591 2676484594
1592 2691512194
1593 2738870082
1594 2744954341
1595 2753072146
1596 2768645204
1597 2772647346
1598 2774395389
1599 2774853434
1600 2775655777
1601 2775657517
1602 2776374812
1603 2785346535
1604 2785366824
1605 2785374045
1606 2786667870
1607 2786674284
1608 2791909865
1609 2793977590
1610 2795781678
1611 2808828722
1612 2808845761
1613 2808877451
1614 2808893716
1615 2808898930
1616 2808915609
1617 2808917880
1618 2810363884
1619 2811842709
1620 2812319551
1621 2812321407
1622 2812330079
1623 2812348510
1624 2819743467
1625 2844851774
1626 2855673297
1627 2855681094
1628 2856745207
1629 2857293511
1630 2857743392
1631 2858851318
1632 2858887572
1633 2858892690
1634 2861528235
1635 2862180493
1636 2862282602
1637 2862283804
1638 2862292886
1639 2862390607
1640 2862574974
1641 2863071955
1642 2863410843
1643 2866554457
1644 2867347660
1645 2867432053
1646 2867438000
1647 2867479539
1648 2867507198
1649 2869049405
1650 2869066982
1651 2869070139
1652 2873152277
1653 2873157777
1654 2873321940
1655 2877677224
1656 2877683722
1657 2880500726
1658 2884695133
1659 2891328823
1660 2891404343
1661 2891567117
1662 2893686684
1663 2895446185
1664 2904498038
1665 2904777396
1666 2905926853
1667 2905930110
1668 2910813425
1669 2912723859
1670 2912759071
1671 2919034768
1672 2919054090
1673 2919054380
1674 2919062086
1675 2919448236
1676 2919470640
1677 2919540233
1678 2920880117
1679 2920882157
1680 2929229238
1681 2932428063
1682 2933421420
1683 2939598227
1684 2939601131
1685 2939647544
1686 2939675472
1687 2945917297
1688 2945923257
1689 2945941349
1690 2945960860
1691 2945960892
1692 2946004296
1693 2946024612
1694 2946041028
1695 2946045892
1696 2946061137
1697 2946079601
1698 2947224854
1699 2954002260
1700 2954003464
1701 2954381950
1702 2954389016
1703 2954674010
1704 2954681127
1705 2954683030
1706 2954689978
1707 2954699755
1708 2954712408
1709 2954718695
1710 2954722356
1711 2954728666
1712 2954733146
1713 2954739495
1714 2954741242
1715 2954747562
1716 2954752026
1717 2954758322
1718 2954760253
1719 2954766679
1720 2964328358
1721 2974305284
1722 2984577372
1723 2990064633
1724 2990259533
1725 2995727388
1726 2997456493
1727 2997600332
1728 3006328171
1729 3006428785
1730 3006491147
1731 3006494953
1732 8002788839
1733 8004029050
1734 8008564971
1735 8047716635
1736 8047898023
1737 8048360870
1738 8048374986
1739 8048383220
1740 8054109925
1741 8054162770
1742 8054706131
1743 8054730363
1744 8054738167
1745 8055071441
1746 8055159771
1747 8055174947
1748 8055417823
1749 8056211410
1750 8056673323
1751 8056830730
1752 8056834826

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

217

351

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

55

177

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

250

383

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1axg-assembly2.cif.gz_D crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution 0.9403 2 331
1htb-assembly1.cif.gz_B crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c 0.94 2 331
1p0f-assembly1.cif.gz_B crystal structure of the binary complex: nadp(h)-dependent vertebrate alcohol dehydrogenase (adh8) with the cofactor nadp 0.9379 2 331
1hdy-assembly1.cif.gz_B three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences 0.9376 2 331
1qv7-assembly1.cif.gz_B horse liver alcohol dehydrogenase his51gln/lys228arg mutant complexed with nad+ and 2,3-difluorobenzyl alcohol 0.9372 2 331
ID Description Score Start End Superfamily
af_O53533_167_304_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9836 165 274 3.90.180.10
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 173 267 3.40.50.720
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9299 165 273 3.40.50.720
af_A1L4Y2_14_383_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9115 9 325 3.90.180.10
4ejmA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 170 274 3.40.50.720
ID Description Score Start End GO Terms
AF-L7FHX7-F1-model_v4 Mycothiol-dependent formaldehyde dehydrogenase (EC 1.1.1.306) 0.9891 1 331 GO:0008270
GO:0050607
AF-A0A250V640-F1-model_v4 Oxidoreductase 0.9874 1 331 GO:0008270
GO:0016491
AF-A0A6B3HDC4-F1-model_v4 Zinc-binding dehydrogenase 0.9864 178 304
AF-L7FHX7-F1-model_v4 Mycothiol-dependent formaldehyde dehydrogenase (EC 1.1.1.306) 0.9861 1 331 GO:0008270
GO:0050607
AF-A0A250V640-F1-model_v4 Oxidoreductase 0.9845 1 331 GO:0008270
GO:0016491

Map