F484373
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 483 | 1752 | 353 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2808606360|2808849987 |
| Length | 395 |
| Sequence | PGVLVSYIGTWCRLTGSGRIQERNTRTMVHKVQAVVVKEKNAPVSLETILVPDPGPGEALVDILTCGVCHTDLHYKQGGIGDDFPYLLGHEATGVVSAVGPDVTSVAPGDRVILNWRAVCGECRACAKGQPQYCFNTHNATQKMTLEDGTELSPALGIGAFAEKTLVAAGQCTKVDADVDAAAVGLLGCGIMAGIGAAINTGEVKRGESVAVIGCGGVGIAAIAGARLAGATTIIAVDIDDNKIEMAKSLGATHGVNSRQEDAVETIRALTGGHGADVVIDAVGRPETYKQAFYARDLAGRVVLVGVPTPEMSLELPLLDVFGRGGSLKSSWYGDCLPSRDFPMLVSHYKQGNLDLDAFVSERISINQVEEAFGKMHEGKVLRSVVEIQAAGASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 131 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 132 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 153 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 154 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 155 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 174 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 175 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 177 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 178 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 179 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 180 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 181 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 182 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 183 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 184 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 185 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 316 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 317 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 329 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 330 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 331 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 332 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 333 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 334 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 335 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 336 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 337 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 338 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 339 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 340 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 341 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 342 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 343 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 344 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 345 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 346 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 347 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 348 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 349 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 350 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 351 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 352 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 353 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 354 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 355 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 356 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 357 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 358 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 359 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 360 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 361 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 362 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 363 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 364 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 365 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 366 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 367 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 368 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 369 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 370 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 371 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 372 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 373 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 374 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 375 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 376 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 377 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 378 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 379 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 380 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 381 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 382 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 383 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 384 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 385 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 386 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 387 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 388 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 389 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 390 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 391 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 392 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 393 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 394 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 395 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 396 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 397 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 398 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 399 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 400 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 401 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 402 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 403 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 404 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 405 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 406 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 407 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 408 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 409 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 410 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 411 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 412 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 413 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 414 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 415 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 416 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 417 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 418 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 419 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 420 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 421 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 422 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 423 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 424 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 425 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 426 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 427 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 428 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 429 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 430 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 431 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 432 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 433 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 434 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 435 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 436 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 437 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 438 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 439 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 440 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 441 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 442 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 443 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 444 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 445 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 446 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 447 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 448 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 449 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 450 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 451 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 452 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 453 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 454 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 455 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 456 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 457 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 458 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 459 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 460 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 461 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 462 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 463 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 464 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 465 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 466 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 467 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 468 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 469 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 470 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 471 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 472 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 473 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 474 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 475 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 476 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 477 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 478 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 479 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 480 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 481 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 482 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 483 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.97 |
| Metatranscriptomes | 0.91 |
| Isolates | 21.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 1.6 |
| Rhizoplane | 5.14 |
| Rhizosphere | 75.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006008 | 3300000549 | Bacteria | 1522 |
| 2 | JGI24740J21852_10022565 | 3300001979 | Bacteria | 2164 |
| 3 | JGI25152J39213_1000564 | 3300002773 | Bacteria | 20360 |
| 4 | rootL2_10182415 | 3300003322 | Bacteria | 4912 |
| 5 | JGI25160J50197_1014019 | 3300003354 | Bacteria | 2702 |
| 6 | Ga0055542_1004126 | 3300003762 | Bacteria | 3653 |
| 7 | Ga0055540_1002891 | 3300003792 | Bacteria | 8711 |
| 8 | Ga0055540_1005551 | 3300003792 | Bacteria | 5268 |
| 9 | Ga0055540_1007668 | 3300003792 | Bacteria | 4025 |
| 10 | Ga0065714_10017933 | 3300005288 | Bacteria | 2961 |
| 11 | Ga0065714_10019874 | 3300005288 | Bacteria | 2010 |
| 12 | Ga0070676_10128473 | 3300005328 | Bacteria | 1600 |
| 13 | Ga0070683_100047725 | 3300005329 | Bacteria | 3958 |
| 14 | Ga0070670_100043661 | 3300005331 | Bacteria | 3853 |
| 15 | Ga0070670_100063897 | 3300005331 | Bacteria | 3158 |
| 16 | Ga0070666_10082066 | 3300005335 | Bacteria | 2205 |
| 17 | Ga0070680_100029410 | 3300005336 | Bacteria | 4413 |
| 18 | Ga0070682_100045910 | 3300005337 | Bacteria | 2710 |
| 19 | Ga0070687_100018156 | 3300005343 | Bacteria | 3248 |
| 20 | Ga0070692_10003998 | 3300005345 | Bacteria | 6090 |
| 21 | Ga0070692_10057589 | 3300005345 | Bacteria | 2038 |
| 22 | Ga0070668_100180512 | 3300005347 | Bacteria | 1724 |
| 23 | Ga0070669_100039627 | 3300005353 | Bacteria | 3423 |
| 24 | Ga0070669_100113981 | 3300005353 | Bacteria | 2055 |
| 25 | Ga0070675_100126521 | 3300005354 | Bacteria | 2174 |
| 26 | Ga0070671_100055122 | 3300005355 | Bacteria | 3307 |
| 27 | Ga0070671_100104983 | 3300005355 | Bacteria | 2371 |
| 28 | Ga0070673_100157025 | 3300005364 | Bacteria | 1931 |
| 29 | Ga0070659_100075973 | 3300005366 | Bacteria | 2679 |
| 30 | Ga0070714_100169521 | 3300005435 | Bacteria | 1980 |
| 31 | Ga0070713_100102826 | 3300005436 | Bacteria | 2478 |
| 32 | Ga0070710_10003528 | 3300005437 | Bacteria | 7412 |
| 33 | Ga0070711_100110460 | 3300005439 | Bacteria | 2017 |
| 34 | Ga0070705_100209077 | 3300005440 | Bacteria | 1344 |
| 35 | Ga0070700_100002168 | 3300005441 | Bacteria | 9962 |
| 36 | Ga0070678_100012916 | 3300005456 | Bacteria | 5214 |
| 37 | Ga0070681_10090418 | 3300005458 | Bacteria | 3012 |
| 38 | Ga0068867_100095786 | 3300005459 | Bacteria | 2258 |
| 39 | Ga0070707_100010754 | 3300005468 | Bacteria | 8524 |
| 40 | Ga0070707_100057882 | 3300005468 | Bacteria | 3718 |
| 41 | Ga0070698_100000415 | 3300005471 | Bacteria | 45479 |
| 42 | Ga0070698_100035998 | 3300005471 | Bacteria | 5117 |
| 43 | Ga0070679_100006189 | 3300005530 | Bacteria | 11142 |
| 44 | Ga0070679_100062892 | 3300005530 | Bacteria | 3700 |
| 45 | Ga0070679_100184078 | 3300005530 | Bacteria | 2060 |
| 46 | Ga0070684_100043610 | 3300005535 | Bacteria | 3874 |
| 47 | Ga0070684_100077247 | 3300005535 | Bacteria | 2940 |
| 48 | Ga0070684_100134260 | 3300005535 | Bacteria | 2234 |
| 49 | Ga0070697_100029208 | 3300005536 | Bacteria | 4419 |
| 50 | Ga0070672_100001302 | 3300005543 | Bacteria | 15381 |
| 51 | Ga0070672_100139221 | 3300005543 | Bacteria | 2000 |
| 52 | Ga0070665_100001255 | 3300005548 | Bacteria | 30600 |
| 53 | Ga0068857_100011946 | 3300005577 | Bacteria | 7550 |
| 54 | Ga0070702_100082705 | 3300005615 | Bacteria | 1927 |
| 55 | Ga0068852_100010223 | 3300005616 | Bacteria | 6996 |
| 56 | Ga0068852_100078292 | 3300005616 | Bacteria | 2924 |
| 57 | Ga0068864_100056722 | 3300005618 | Bacteria | 3384 |
| 58 | Ga0068866_10016695 | 3300005718 | Bacteria | 3288 |
| 59 | Ga0068861_100095487 | 3300005719 | Bacteria | 2354 |
| 60 | Ga0081455_10014512 | 3300005937 | Bacteria | 7715 |
| 61 | Ga0081540_1012199 | 3300005983 | Bacteria | 5682 |
| 62 | Ga0075365_10030556 | 3300006038 | Bacteria | 3451 |
| 63 | Ga0075365_10180105 | 3300006038 | Bacteria | 1477 |
| 64 | Ga0075365_10242208 | 3300006038 | Bacteria | 1267 |
| 65 | Ga0075432_10000424 | 3300006058 | Bacteria | 12331 |
| 66 | Ga0070715_10081209 | 3300006163 | Bacteria | 1472 |
| 67 | Ga0070716_100012164 | 3300006173 | Bacteria | 4355 |
| 68 | Ga0075367_10001514 | 3300006178 | Bacteria | 10047 |
| 69 | Ga0068865_100048815 | 3300006881 | Bacteria | 2914 |
| 70 | Ga0099826_10084204 | 3300006948 | Bacteria | 1968 |
| 71 | Ga0105251_10021678 | 3300009011 | Bacteria | 3350 |
| 72 | Ga0105251_10024199 | 3300009011 | Bacteria | 3120 |
| 73 | Ga0105244_10003027 | 3300009036 | Bacteria | 12338 |
| 74 | Ga0105244_10098294 | 3300009036 | Bacteria | 1434 |
| 75 | Ga0111539_10255520 | 3300009094 | Bacteria | 2040 |
| 76 | Ga0105245_10085548 | 3300009098 | Bacteria | 2890 |
| 77 | Ga0105245_10235075 | 3300009098 | Bacteria | 1774 |
| 78 | Ga0105243_10010279 | 3300009148 | Bacteria | 7112 |
| 79 | Ga0105243_10015649 | 3300009148 | Bacteria | 5734 |
| 80 | Ga0105243_10034709 | 3300009148 | Bacteria | 3908 |
| 81 | Ga0105243_10078234 | 3300009148 | Bacteria | 2692 |
| 82 | Ga0105243_10113935 | 3300009148 | Bacteria | 2268 |
| 83 | Ga0105248_10053041 | 3300009177 | Bacteria | 4550 |
| 84 | Ga0105248_10061347 | 3300009177 | Bacteria | 4222 |
| 85 | Ga0105238_10207521 | 3300009551 | Bacteria | 1935 |
| 86 | Ga0105238_10288892 | 3300009551 | Bacteria | 1622 |
| 87 | Ga0105249_10010275 | 3300009553 | Bacteria | 8222 |
| 88 | Ga0105249_10159649 | 3300009553 | Bacteria | 2177 |
| 89 | Ga0105239_10011607 | 3300010375 | Bacteria | 9828 |
| 90 | Ga0105239_10279011 | 3300010375 | Bacteria | 1881 |
| 91 | Ga0105246_10001152 | 3300011119 | Bacteria | 15338 |
| 92 | Ga0105246_10002505 | 3300011119 | Bacteria | 11109 |
| 93 | Ga0105246_10027246 | 3300011119 | Bacteria | 3742 |
| 94 | Ga0105246_10112250 | 3300011119 | Bacteria | 2004 |
| 95 | Ga0105246_10276060 | 3300011119 | Bacteria | 1346 |
| 96 | Ga0157371_10085290 | 3300013102 | Bacteria | 2237 |
| 97 | Ga0157369_10342459 | 3300013105 | Bacteria | 1553 |
| 98 | Ga0163162_10020143 | 3300013306 | Bacteria | 6550 |
| 99 | Ga0163162_10196031 | 3300013306 | Bacteria | 2148 |
| 100 | Ga0157380_10170889 | 3300014326 | Bacteria | 1899 |
| 101 | Ga0157377_10003750 | 3300014745 | Bacteria | 6894 |
| 102 | Ga0157379_10019033 | 3300014968 | Bacteria | 6062 |
| 103 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 104 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 105 | Ga0163161_10020014 | 3300017792 | Bacteria | 4694 |
| 106 | Ga0206356_10752756 | 3300020070 | Bacteria | 1534 |
| 107 | Ga0206350_10749295 | 3300020080 | Bacteria | 1429 |
| 108 | Ga0206353_10539143 | 3300020082 | Bacteria | 2724 |
| 109 | Ga0213875_10001608 | 3300021388 | Bacteria | 14280 |
| 110 | Ga0213875_10001884 | 3300021388 | Bacteria | 12993 |
| 111 | Ga0213875_10002648 | 3300021388 | Bacteria | 10589 |
| 112 | Ga0213875_10003198 | 3300021388 | Bacteria | 9415 |
| 113 | Ga0224712_10008931 | 3300022467 | Bacteria | 2995 |
| 114 | Ga0209148_1004095 | 3300025254 | Bacteria | 3693 |
| 115 | Ga0209129_1000448 | 3300025258 | Bacteria | 30833 |
| 116 | Ga0209025_1001977 | 3300025294 | Bacteria | 23536 |
| 117 | Ga0207426_1000996 | 3300025302 | Bacteria | 27634 |
| 118 | Ga0207426_1001844 | 3300025302 | Bacteria | 15586 |
| 119 | Ga0207426_1008971 | 3300025302 | Bacteria | 3987 |
| 120 | Ga0207426_1015577 | 3300025302 | Bacteria | 2754 |
| 121 | Ga0209051_1000569 | 3300025303 | Bacteria | 44797 |
| 122 | Ga0209051_1005041 | 3300025303 | Bacteria | 7863 |
| 123 | Ga0209051_1008251 | 3300025303 | Bacteria | 5543 |
| 124 | Ga0209051_1010666 | 3300025303 | Bacteria | 4609 |
| 125 | Ga0209051_1022562 | 3300025303 | Bacteria | 2646 |
| 126 | Ga0207697_10002395 | 3300025315 | Bacteria | 9768 |
| 127 | Ga0207697_10011335 | 3300025315 | Bacteria | 3773 |
| 128 | Ga0207655_1034402 | 3300025728 | Bacteria | 2279 |
| 129 | Ga0207688_10031078 | 3300025901 | Bacteria | 2947 |
| 130 | Ga0207647_10006174 | 3300025904 | Bacteria | 8730 |
| 131 | Ga0207699_10104347 | 3300025906 | Bacteria | 1805 |
| 132 | Ga0207645_10076255 | 3300025907 | Bacteria | 2147 |
| 133 | Ga0207705_10067528 | 3300025909 | Bacteria | 2588 |
| 134 | Ga0207684_10031140 | 3300025910 | Bacteria | 4540 |
| 135 | Ga0207707_10068043 | 3300025912 | Bacteria | 3103 |
| 136 | Ga0207657_10009534 | 3300025919 | Bacteria | 9746 |
| 137 | Ga0207657_10168981 | 3300025919 | Bacteria | 1773 |
| 138 | Ga0207652_10059261 | 3300025921 | Bacteria | 3300 |
| 139 | Ga0207646_10061476 | 3300025922 | Bacteria | 3353 |
| 140 | Ga0207681_10105877 | 3300025923 | Bacteria | 2037 |
| 141 | Ga0207650_10258405 | 3300025925 | Bacteria | 1412 |
| 142 | Ga0207650_10309582 | 3300025925 | Bacteria | 1292 |
| 143 | Ga0207659_10332160 | 3300025926 | Bacteria | 1257 |
| 144 | Ga0207659_10339784 | 3300025926 | Bacteria | 1243 |
| 145 | Ga0207700_10119803 | 3300025928 | Bacteria | 2132 |
| 146 | Ga0207664_10014646 | 3300025929 | Bacteria | 5671 |
| 147 | Ga0207690_10114019 | 3300025932 | Bacteria | 1951 |
| 148 | Ga0207706_10330019 | 3300025933 | Bacteria | 1327 |
| 149 | Ga0207709_10064881 | 3300025935 | Bacteria | 2294 |
| 150 | Ga0207709_10077337 | 3300025935 | Bacteria | 2133 |
| 151 | Ga0207709_10104325 | 3300025935 | Bacteria | 1881 |
| 152 | Ga0207709_10226924 | 3300025935 | Bacteria | 1351 |
| 153 | Ga0207669_10060376 | 3300025937 | Bacteria | 2324 |
| 154 | Ga0207669_10203960 | 3300025937 | Bacteria | 1438 |
| 155 | Ga0207704_10085325 | 3300025938 | Bacteria | 2055 |
| 156 | Ga0207665_10006521 | 3300025939 | Bacteria | 7739 |
| 157 | Ga0207691_10004085 | 3300025940 | Bacteria | 14164 |
| 158 | Ga0207691_10005260 | 3300025940 | Bacteria | 12492 |
| 159 | Ga0207691_10016690 | 3300025940 | Bacteria | 6973 |
| 160 | Ga0207679_10149555 | 3300025945 | Bacteria | 1898 |
| 161 | Ga0207667_10241581 | 3300025949 | Bacteria | 1848 |
| 162 | Ga0207712_10342985 | 3300025961 | Bacteria | 1239 |
| 163 | Ga0207668_10164577 | 3300025972 | Bacteria | 1732 |
| 164 | Ga0207639_10108233 | 3300026041 | Bacteria | 2259 |
| 165 | Ga0207678_10075994 | 3300026067 | Bacteria | 2877 |
| 166 | Ga0207708_10000344 | 3300026075 | Bacteria | 36621 |
| 167 | Ga0207702_10047904 | 3300026078 | Bacteria | 3603 |
| 168 | Ga0207648_10006022 | 3300026089 | Bacteria | 12098 |
| 169 | Ga0207674_10010339 | 3300026116 | Bacteria | 10580 |
| 170 | Ga0207674_10041217 | 3300026116 | Bacteria | 4777 |
| 171 | Ga0207675_100026825 | 3300026118 | Bacteria | 5361 |
| 172 | Ga0207683_10009698 | 3300026121 | Bacteria | 8209 |
| 173 | Ga0207698_10040586 | 3300026142 | Bacteria | 3460 |
| 174 | Ga0207698_10152692 | 3300026142 | Bacteria | 2007 |
| 175 | Ga0209813_10008271 | 3300027866 | Bacteria | 2622 |
| 176 | Ga0207428_10070863 | 3300027907 | Bacteria | 2739 |
| 177 | Ga0207428_10096726 | 3300027907 | Bacteria | 2286 |
| 178 | Ga0268266_10003222 | 3300028379 | Bacteria | 16486 |
| 179 | Ga0268266_10168223 | 3300028379 | Bacteria | 1988 |
| 180 | Ga0265337_1000828 | 3300028556 | Bacteria | 16243 |
| 181 | Ga0265319_1014199 | 3300028563 | Bacteria | 3132 |
| 182 | Ga0265334_10001841 | 3300028573 | Bacteria | 10093 |
| 183 | Ga0265318_10028543 | 3300028577 | Bacteria | 2181 |
| 184 | Ga0307517_10005154 | 3300028786 | Bacteria | 19834 |
| 185 | Ga0307517_10052524 | 3300028786 | Bacteria | 4082 |
| 186 | Ga0307515_10000287 | 3300028794 | Bacteria | 123976 |
| 187 | Ga0265338_10001152 | 3300028800 | Bacteria | 43720 |
| 188 | Ga0265338_10001947 | 3300028800 | Bacteria | 32225 |
| 189 | Ga0265324_10009980 | 3300029957 | Bacteria | 3686 |
| 190 | Ga0307511_10054014 | 3300030521 | Bacteria | 3175 |
| 191 | Ga0307511_10107460 | 3300030521 | Bacteria | 1796 |
| 192 | Ga0316177_1202800 | 3300030731 | Bacteria | 2017 |
| 193 | Ga0265332_10002553 | 3300031238 | Bacteria | 9246 |
| 194 | Ga0265325_10016263 | 3300031241 | Bacteria | 4161 |
| 195 | Ga0265327_10001401 | 3300031251 | Bacteria | 30722 |
| 196 | Ga0265316_10036129 | 3300031344 | Bacteria | 3996 |
| 197 | Ga0307509_10018420 | 3300031507 | Bacteria | 8007 |
| 198 | Ga0307509_10181895 | 3300031507 | Bacteria | 1965 |
| 199 | Ga0307408_100047312 | 3300031548 | Bacteria | 3080 |
| 200 | Ga0307408_100052488 | 3300031548 | Bacteria | 2940 |
| 201 | Ga0307408_100087671 | 3300031548 | Bacteria | 2342 |
| 202 | Ga0307408_100159007 | 3300031548 | Bacteria | 1792 |
| 203 | Ga0307508_10003098 | 3300031616 | Bacteria | 17069 |
| 204 | Ga0307508_10005246 | 3300031616 | Bacteria | 12371 |
| 205 | Ga0307508_10030795 | 3300031616 | Bacteria | 4848 |
| 206 | Ga0307508_10104562 | 3300031616 | Bacteria | 2428 |
| 207 | Ga0265314_10042418 | 3300031711 | Bacteria | 3246 |
| 208 | Ga0307405_10043756 | 3300031731 | Bacteria | 2734 |
| 209 | Ga0307405_10200291 | 3300031731 | Bacteria | 1449 |
| 210 | Ga0307413_10031521 | 3300031824 | Bacteria | 2993 |
| 211 | Ga0307413_10078550 | 3300031824 | Bacteria | 2106 |
| 212 | Ga0307518_10073508 | 3300031838 | Bacteria | 2474 |
| 213 | Ga0307518_10086335 | 3300031838 | Bacteria | 2262 |
| 214 | Ga0307410_10015810 | 3300031852 | Bacteria | 4484 |
| 215 | Ga0307410_10137137 | 3300031852 | Bacteria | 1805 |
| 216 | Ga0307410_10161998 | 3300031852 | Bacteria | 1677 |
| 217 | Ga0307410_10242880 | 3300031852 | Bacteria | 1396 |
| 218 | Ga0307406_10057533 | 3300031901 | Bacteria | 2494 |
| 219 | Ga0307406_10255168 | 3300031901 | Bacteria | 1323 |
| 220 | Ga0307407_10009496 | 3300031903 | Bacteria | 4535 |
| 221 | Ga0307407_10028919 | 3300031903 | Bacteria | 2970 |
| 222 | Ga0307412_10023417 | 3300031911 | Bacteria | 3799 |
| 223 | Ga0307412_10066466 | 3300031911 | Bacteria | 2444 |
| 224 | Ga0307412_10089926 | 3300031911 | Bacteria | 2145 |
| 225 | Ga0307412_10116847 | 3300031911 | Bacteria | 1914 |
| 226 | Ga0307412_10172767 | 3300031911 | Bacteria | 1617 |
| 227 | Ga0307409_100011989 | 3300031995 | Bacteria | 5499 |
| 228 | Ga0307409_100072398 | 3300031995 | Bacteria | 2744 |
| 229 | Ga0307409_100077431 | 3300031995 | Bacteria | 2671 |
| 230 | Ga0307409_100154785 | 3300031995 | Bacteria | 1996 |
| 231 | Ga0307409_100186119 | 3300031995 | Bacteria | 1843 |
| 232 | Ga0307416_100051250 | 3300032002 | Bacteria | 3295 |
| 233 | Ga0307416_100110817 | 3300032002 | Bacteria | 2418 |
| 234 | Ga0307416_100156030 | 3300032002 | Bacteria | 2101 |
| 235 | Ga0307416_100173584 | 3300032002 | Bacteria | 2010 |
| 236 | Ga0307416_100269090 | 3300032002 | Bacteria | 1671 |
| 237 | Ga0307416_100433997 | 3300032002 | Bacteria | 1361 |
| 238 | Ga0307414_10085084 | 3300032004 | Bacteria | 2328 |
| 239 | Ga0307414_10129394 | 3300032004 | Bacteria | 1957 |
| 240 | Ga0307411_10064073 | 3300032005 | Bacteria | 2459 |
| 241 | Ga0307415_100065053 | 3300032126 | Bacteria | 2539 |
| 242 | Ga0307415_100156528 | 3300032126 | Bacteria | 1760 |
| 243 | Ga0316585_10047709 | 3300032137 | Bacteria | 1372 |
| 244 | Ga0307507_10011053 | 3300033179 | Bacteria | 11484 |
| 245 | Ga0307507_10012829 | 3300033179 | Bacteria | 10281 |
| 246 | Ga0307510_10033207 | 3300033180 | Bacteria | 5799 |
| 247 | Ga0373941_0018446 | 3300035115 | Bacteria | 1928 |
| 248 | Ga0373954_0004908 | 3300035118 | Bacteria | 5774 |
| 249 | Ga0373956_0003350 | 3300035119 | Bacteria | 6446 |
| 250 | Ga0373956_0008865 | 3300035119 | Bacteria | 4076 |
| 251 | Ga0373957_0020668 | 3300035120 | Bacteria | 2328 |
| 252 | Ga0373942_0000108 | 3300035207 | Bacteria | 18755 |
| 253 | Ga0373962_0001387 | 3300035242 | Bacteria | 5715 |
| 254 | Ga0316574_0086429 | 3300035398 | Bacteria | 1996 |
| 255 | Ga0316574_0152459 | 3300035398 | Bacteria | 1489 |
| 256 | Ga0373935_0146785 | 3300035692 | Bacteria | 1597 |
| 257 | Ga0373933_0044544 | 3300035724 | Bacteria | 2628 |
| 258 | Ga0373937_0069210 | 3300036401 | Bacteria | 3253 |
| 259 | Ga0316584_0113785 | 3300036712 | Bacteria | 2024 |
| 260 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 261 | Ga0395899_0000668 | 3300037312 | Bacteria | 34727 |
| 262 | Ga0395899_0189292 | 3300037312 | Bacteria | 1440 |
| 263 | Ga0395900_0028800 | 3300037418 | Bacteria | 5693 |
| 264 | Ga0395900_0031034 | 3300037418 | Bacteria | 5489 |
| 265 | Ga0395900_0031468 | 3300037418 | Bacteria | 5452 |
| 266 | Ga0395900_0056944 | 3300037418 | Bacteria | 4024 |
| 267 | Ga0395900_0204452 | 3300037418 | Bacteria | 1996 |
| 268 | Ga0395900_0301187 | 3300037418 | Bacteria | 1589 |
| 269 | Ga0395898_0002672 | 3300037466 | Bacteria | 20661 |
| 270 | Ga0395898_0002992 | 3300037466 | Bacteria | 19185 |
| 271 | Ga0395898_0008045 | 3300037466 | Bacteria | 11176 |
| 272 | Ga0395898_0008680 | 3300037466 | Bacteria | 10720 |
| 273 | Ga0395898_0009913 | 3300037466 | Bacteria | 9980 |
| 274 | Ga0395898_0012707 | 3300037466 | Bacteria | 8696 |
| 275 | Ga0395898_0019330 | 3300037466 | Bacteria | 6935 |
| 276 | Ga0395898_0037428 | 3300037466 | Bacteria | 4813 |
| 277 | Ga0395898_0092713 | 3300037466 | Bacteria | 2904 |
| 278 | Ga0395898_0240409 | 3300037466 | Bacteria | 1727 |
| 279 | Ga0395905_0051920 | 3300037471 | Bacteria | 3840 |
| 280 | Ga0395905_0072948 | 3300037471 | Bacteria | 3218 |
| 281 | Ga0395905_0085470 | 3300037471 | Bacteria | 2956 |
| 282 | Ga0395905_0354423 | 3300037471 | Bacteria | 1360 |
| 283 | Ga0436364_0002840 | 3300037853 | Bacteria | 1961 |
| 284 | Ga0436364_0183141 | 3300037853 | Bacteria | 23094 |
| 285 | Ga0436364_0222259 | 3300037853 | Bacteria | 1407 |
| 286 | Ga0436364_0464776 | 3300037853 | Bacteria | 2419 |
| 287 | Ga0436364_0585101 | 3300037853 | Bacteria | 50100 |
| 288 | Ga0436364_1115616 | 3300037853 | Bacteria | 49992 |
| 289 | Ga0395901_0011064 | 3300038443 | Bacteria | 9144 |
| 290 | Ga0395901_0030134 | 3300038443 | Bacteria | 5589 |
| 291 | Ga0395901_0059991 | 3300038443 | Bacteria | 3958 |
| 292 | Ga0395901_0285123 | 3300038443 | Bacteria | 1715 |
| 293 | Ga0439436_0032068 | 3300041404 | Bacteria | 1524 |
| 294 | Ga0439436_0045343 | 3300041404 | Bacteria | 1251 |
| 295 | Ga0439466_0013413 | 3300041411 | Bacteria | 3000 |
| 296 | Ga0451793_0113644 | 3300041452 | Bacteria | 3354 |
| 297 | Ga0451793_1224384 | 3300041452 | Bacteria | 1621 |
| 298 | Ga0451843_0286974 | 3300041509 | Bacteria | 2929 |
| 299 | Ga0439433_0020558 | 3300041999 | Bacteria | 1474 |
| 300 | Ga0439442_000330 | 3300042002 | Bacteria | 11263 |
| 301 | Ga0439442_010928 | 3300042002 | Bacteria | 1844 |
| 302 | Ga0439432_015564 | 3300042006 | Bacteria | 2566 |
| 303 | Ga0439432_040014 | 3300042006 | Bacteria | 1488 |
| 304 | Ga0439449_0003551 | 3300042007 | Bacteria | 6057 |
| 305 | Ga0439449_0042080 | 3300042007 | Bacteria | 1698 |
| 306 | Ga0439449_0080337 | 3300042007 | Bacteria | 1202 |
| 307 | Ga0439455_0002123 | 3300042012 | Bacteria | 3540 |
| 308 | Ga0450920_000102 | 3300042122 | Bacteria | 11247 |
| 309 | Ga0450898_004930 | 3300042134 | Bacteria | 1995 |
| 310 | Ga0450903_000028 | 3300042138 | Bacteria | 29850 |
| 311 | Ga0450903_000647 | 3300042138 | Bacteria | 7029 |
| 312 | Ga0450907_000576 | 3300042146 | Bacteria | 9870 |
| 313 | Ga0439458_0000979 | 3300042157 | Bacteria | 7303 |
| 314 | Ga0439458_0002962 | 3300042157 | Bacteria | 4074 |
| 315 | Ga0439434_0000402 | 3300042435 | Bacteria | 12307 |
| 316 | Ga0466969_0011224 | 3300044656 | Bacteria | 4742 |
| 317 | Ga0466969_0017415 | 3300044656 | Bacteria | 3750 |
| 318 | Ga0466969_0123707 | 3300044656 | Bacteria | 1203 |
| 319 | Ga0466972_0003089 | 3300044658 | Bacteria | 8255 |
| 320 | Ga0466972_0007226 | 3300044658 | Bacteria | 5577 |
| 321 | Ga0466972_0008405 | 3300044658 | Bacteria | 5176 |
| 322 | Ga0466972_0012491 | 3300044658 | Bacteria | 4269 |
| 323 | Ga0466972_0049530 | 3300044658 | Bacteria | 2029 |
| 324 | Ga0466972_0055310 | 3300044658 | Bacteria | 1909 |
| 325 | Ga0466972_0064368 | 3300044658 | Bacteria | 1755 |
| 326 | Ga0466965_0003208 | 3300044683 | Bacteria | 7146 |
| 327 | Ga0466965_0006896 | 3300044683 | Bacteria | 5196 |
| 328 | Ga0466965_0010505 | 3300044683 | Bacteria | 4323 |
| 329 | Ga0466965_0042391 | 3300044683 | Bacteria | 2245 |
| 330 | Ga0466965_0077332 | 3300044683 | Bacteria | 1680 |
| 331 | Ga0466965_0112031 | 3300044683 | Bacteria | 1403 |
| 332 | Ga0466966_0003577 | 3300044684 | Bacteria | 10254 |
| 333 | Ga0466966_0007841 | 3300044684 | Bacteria | 7066 |
| 334 | Ga0466966_0079869 | 3300044684 | Bacteria | 2038 |
| 335 | Ga0466961_0010767 | 3300044693 | Bacteria | 5842 |
| 336 | Ga0466961_0028768 | 3300044693 | Bacteria | 3574 |
| 337 | Ga0466961_0097790 | 3300044693 | Bacteria | 1850 |
| 338 | Ga0466963_0000184 | 3300044694 | Bacteria | 26087 |
| 339 | Ga0466963_0003961 | 3300044694 | Bacteria | 8566 |
| 340 | Ga0466963_0010203 | 3300044694 | Bacteria | 5681 |
| 341 | Ga0466963_0031675 | 3300044694 | Bacteria | 3420 |
| 342 | Ga0466963_0076410 | 3300044694 | Bacteria | 2261 |
| 343 | Ga0466963_0110757 | 3300044694 | Bacteria | 1885 |
| 344 | Ga0466963_0128402 | 3300044694 | Bacteria | 1749 |
| 345 | Ga0466964_0018115 | 3300044706 | Bacteria | 2700 |
| 346 | Ga0466964_0030623 | 3300044706 | Bacteria | 2130 |
| 347 | Ga0466964_0049739 | 3300044706 | Bacteria | 1717 |
| 348 | Ga0466971_0001168 | 3300044719 | Bacteria | 10914 |
| 349 | Ga0466971_0069692 | 3300044719 | Bacteria | 1596 |
| 350 | Ga0466970_0000851 | 3300044765 | Bacteria | 14710 |
| 351 | Ga0466970_0002860 | 3300044765 | Bacteria | 8346 |
| 352 | Ga0466970_0004846 | 3300044765 | Bacteria | 6641 |
| 353 | Ga0466970_0005429 | 3300044765 | Bacteria | 6324 |
| 354 | Ga0466970_0014964 | 3300044765 | Bacteria | 3989 |
| 355 | Ga0466957_0000319 | 3300044842 | Bacteria | 23345 |
| 356 | Ga0466957_0000619 | 3300044842 | Bacteria | 17948 |
| 357 | Ga0466957_0075853 | 3300044842 | Bacteria | 2087 |
| 358 | Ga0466957_0083109 | 3300044842 | Bacteria | 1997 |
| 359 | Ga0466957_0122446 | 3300044842 | Bacteria | 1659 |
| 360 | Ga0466957_0141812 | 3300044842 | Bacteria | 1548 |
| 361 | Ga0466957_0260027 | 3300044842 | Bacteria | 1156 |
| 362 | Ga0466960_0001604 | 3300044901 | Bacteria | 8276 |
| 363 | Ga0466960_0032721 | 3300044901 | Bacteria | 2410 |
| 364 | Ga0466960_0134883 | 3300044901 | Bacteria | 1306 |
| 365 | Ga0466959_0001973 | 3300045049 | Bacteria | 12922 |
| 366 | Ga0466959_0009364 | 3300045049 | Bacteria | 6961 |
| 367 | Ga0451576_0353671 | 3300045051 | Bacteria | 1538 |
| 368 | Ga0466958_0003638 | 3300045836 | Bacteria | 8039 |
| 369 | Ga0466958_0008106 | 3300045836 | Bacteria | 5812 |
| 370 | Ga0466967_0007656 | 3300045976 | Bacteria | 7819 |
| 371 | Ga0466967_0019492 | 3300045976 | Bacteria | 5455 |
| 372 | Ga0466967_0028997 | 3300045976 | Bacteria | 4627 |
| 373 | Ga0466967_0029602 | 3300045976 | Bacteria | 4585 |
| 374 | Ga0466967_0046771 | 3300045976 | Bacteria | 3769 |
| 375 | Ga0466967_0107658 | 3300045976 | Bacteria | 2557 |
| 376 | Ga0466967_0118121 | 3300045976 | Bacteria | 2446 |
| 377 | Ga0466967_0121371 | 3300045976 | Bacteria | 2415 |
| 378 | Ga0466967_0260110 | 3300045976 | Bacteria | 1660 |
| 379 | Ga0466967_0500965 | 3300045976 | Bacteria | 1192 |
| 380 | Ga0495592_0046729 | 3300046454 | Bacteria | 3226 |
| 381 | Ga0495592_0064333 | 3300046454 | Bacteria | 2688 |
| 382 | Ga0495603_0001380 | 3300046455 | Bacteria | 14114 |
| 383 | Ga0495603_0006721 | 3300046455 | Bacteria | 6903 |
| 384 | Ga0495603_0058514 | 3300046455 | Bacteria | 2278 |
| 385 | Ga0495629_0034568 | 3300046459 | Bacteria | 3573 |
| 386 | Ga0495629_0038087 | 3300046459 | Bacteria | 3388 |
| 387 | Ga0495629_0075487 | 3300046459 | Bacteria | 2354 |
| 388 | Ga0495629_0112167 | 3300046459 | Bacteria | 1900 |
| 389 | Ga0495638_0011228 | 3300046460 | Bacteria | 6181 |
| 390 | Ga0495641_0016892 | 3300046461 | Bacteria | 3825 |
| 391 | Ga0495651_0007765 | 3300046462 | Bacteria | 8210 |
| 392 | Ga0495651_0029494 | 3300046462 | Bacteria | 4278 |
| 393 | Ga0495651_0040506 | 3300046462 | Bacteria | 3622 |
| 394 | Ga0495653_0016899 | 3300046463 | Bacteria | 5936 |
| 395 | Ga0495653_0104355 | 3300046463 | Bacteria | 2048 |
| 396 | Ga0495580_0021310 | 3300046472 | Bacteria | 4782 |
| 397 | Ga0495580_0078546 | 3300046472 | Bacteria | 2302 |
| 398 | Ga0495580_0082867 | 3300046472 | Bacteria | 2235 |
| 399 | Ga0495582_0080992 | 3300046473 | Bacteria | 1803 |
| 400 | Ga0495582_0161229 | 3300046473 | Bacteria | 1275 |
| 401 | Ga0495582_0170100 | 3300046473 | Bacteria | 1240 |
| 402 | Ga0495639_0003396 | 3300046475 | Bacteria | 6900 |
| 403 | Ga0495639_0011717 | 3300046475 | Bacteria | 3782 |
| 404 | Ga0495662_0004479 | 3300046476 | Bacteria | 7011 |
| 405 | Ga0495662_0031498 | 3300046476 | Bacteria | 2561 |
| 406 | Ga0495664_0003161 | 3300046477 | Bacteria | 8940 |
| 407 | Ga0495664_0065570 | 3300046477 | Bacteria | 2165 |
| 408 | Ga0495594_0007265 | 3300046499 | Bacteria | 5696 |
| 409 | Ga0495594_0008965 | 3300046499 | Bacteria | 5160 |
| 410 | Ga0495608_0076166 | 3300046511 | Bacteria | 2186 |
| 411 | Ga0495618_0015750 | 3300046514 | Bacteria | 4616 |
| 412 | Ga0495618_0016080 | 3300046514 | Bacteria | 4571 |
| 413 | Ga0495618_0038398 | 3300046514 | Bacteria | 3009 |
| 414 | Ga0495618_0080568 | 3300046514 | Bacteria | 2077 |
| 415 | Ga0495618_0084929 | 3300046514 | Bacteria | 2023 |
| 416 | Ga0495628_0005874 | 3300046516 | Bacteria | 10748 |
| 417 | Ga0495628_0193677 | 3300046516 | Bacteria | 1534 |
| 418 | Ga0495630_0317016 | 3300046517 | Bacteria | 1192 |
| 419 | Ga0495632_0025972 | 3300046519 | Bacteria | 3090 |
| 420 | Ga0495643_0001312 | 3300046522 | Bacteria | 23618 |
| 421 | Ga0495643_0089955 | 3300046522 | Bacteria | 1585 |
| 422 | Ga0495666_0067295 | 3300046526 | Bacteria | 1707 |
| 423 | Ga0495652_0001220 | 3300046529 | Bacteria | 28817 |
| 424 | Ga0495652_0038810 | 3300046529 | Bacteria | 4122 |
| 425 | Ga0495652_0063915 | 3300046529 | Bacteria | 3098 |
| 426 | Ga0495652_0092796 | 3300046529 | Bacteria | 2466 |
| 427 | Ga0495652_0110001 | 3300046529 | Bacteria | 2217 |
| 428 | Ga0495665_0005843 | 3300046531 | Bacteria | 6637 |
| 429 | Ga0495640_0022618 | 3300046533 | Bacteria | 4591 |
| 430 | Ga0495640_0187365 | 3300046533 | Bacteria | 1316 |
| 431 | Ga0495640_0211027 | 3300046533 | Bacteria | 1227 |
| 432 | Ga0495586_0005357 | 3300046535 | Bacteria | 6861 |
| 433 | Ga0495586_0039720 | 3300046535 | Bacteria | 2530 |
| 434 | Ga0495586_0044726 | 3300046535 | Bacteria | 2385 |
| 435 | Ga0495587_0000780 | 3300046536 | Bacteria | 21272 |
| 436 | Ga0495587_0005283 | 3300046536 | Bacteria | 8443 |
| 437 | Ga0495645_0000625 | 3300046543 | Bacteria | 24383 |
| 438 | Ga0495645_0007448 | 3300046543 | Bacteria | 7619 |
| 439 | Ga0495645_0019749 | 3300046543 | Bacteria | 4854 |
| 440 | Ga0495645_0131956 | 3300046543 | Bacteria | 1750 |
| 441 | Ga0495622_0028337 | 3300046557 | Bacteria | 2615 |
| 442 | Ga0495633_0047948 | 3300046558 | Bacteria | 2018 |
| 443 | Ga0495667_0000589 | 3300046559 | Bacteria | 23117 |
| 444 | Ga0495667_0142705 | 3300046559 | Bacteria | 1543 |
| 445 | Ga0495668_0001241 | 3300046616 | Bacteria | 25583 |
| 446 | Ga0495634_0001298 | 3300046642 | Bacteria | 22835 |
| 447 | Ga0495634_0088696 | 3300046642 | Bacteria | 2011 |
| 448 | Ga0495634_0089815 | 3300046642 | Bacteria | 1996 |
| 449 | Ga0495625_0000674 | 3300046660 | Bacteria | 48712 |
| 450 | Ga0495625_0085072 | 3300046660 | Bacteria | 2196 |
| 451 | Ga0495588_0010943 | 3300046674 | Bacteria | 4243 |
| 452 | Ga0495588_0013960 | 3300046674 | Bacteria | 3837 |
| 453 | Ga0495588_0014212 | 3300046674 | Bacteria | 3807 |
| 454 | Ga0495588_0017061 | 3300046674 | Bacteria | 3519 |
| 455 | Ga0495588_0018780 | 3300046674 | Bacteria | 3376 |
| 456 | Ga0495588_0049457 | 3300046674 | Bacteria | 2162 |
| 457 | Ga0495588_0071085 | 3300046674 | Bacteria | 1809 |
| 458 | Ga0495588_0122359 | 3300046674 | Bacteria | 1371 |
| 459 | Ga0495657_0001313 | 3300046675 | Bacteria | 21641 |
| 460 | Ga0495657_0004127 | 3300046675 | Bacteria | 11635 |
| 461 | Ga0495657_0005398 | 3300046675 | Bacteria | 10116 |
| 462 | Ga0495657_0068617 | 3300046675 | Bacteria | 2322 |
| 463 | Ga0495657_0098509 | 3300046675 | Bacteria | 1865 |
| 464 | Ga0495599_0011242 | 3300046678 | Bacteria | 5497 |
| 465 | Ga0495623_0053416 | 3300046679 | Bacteria | 2551 |
| 466 | Ga0495623_0153427 | 3300046679 | Bacteria | 1359 |
| 467 | Ga0495646_0030674 | 3300046680 | Bacteria | 3356 |
| 468 | Ga0495646_0039162 | 3300046680 | Bacteria | 2923 |
| 469 | Ga0495646_0052294 | 3300046680 | Bacteria | 2468 |
| 470 | Ga0495646_0135158 | 3300046680 | Bacteria | 1384 |
| 471 | Ga0495613_0008680 | 3300046689 | Bacteria | 7535 |
| 472 | Ga0495613_0023725 | 3300046689 | Bacteria | 4571 |
| 473 | Ga0495613_0031068 | 3300046689 | Bacteria | 3967 |
| 474 | Ga0495613_0035144 | 3300046689 | Bacteria | 3720 |
| 475 | Ga0495613_0035325 | 3300046689 | Bacteria | 3710 |
| 476 | Ga0495613_0077140 | 3300046689 | Bacteria | 2424 |
| 477 | Ga0495613_0095102 | 3300046689 | Bacteria | 2155 |
| 478 | Ga0495624_0043285 | 3300046690 | Bacteria | 2873 |
| 479 | Ga0495624_0089901 | 3300046690 | Bacteria | 1894 |
| 480 | Ga0495624_0118044 | 3300046690 | Bacteria | 1630 |
| 481 | Ga0495670_0036016 | 3300046691 | Bacteria | 2465 |
| 482 | Ga0495671_0009657 | 3300046692 | Bacteria | 5381 |
| 483 | Ga0495589_0026136 | 3300046794 | Bacteria | 2960 |
| 484 | Ga0495589_0043533 | 3300046794 | Bacteria | 2234 |
| 485 | Ga0495589_0059684 | 3300046794 | Bacteria | 1874 |
| 486 | Ga0495589_0072677 | 3300046794 | Bacteria | 1679 |
| 487 | Ga0495600_0015055 | 3300046809 | Bacteria | 4884 |
| 488 | Ga0495600_0030554 | 3300046809 | Bacteria | 3489 |
| 489 | Ga0495600_0088524 | 3300046809 | Bacteria | 2020 |
| 490 | Ga0495581_0000180 | 3300047315 | Bacteria | 29020 |
| 491 | Ga0495581_0013508 | 3300047315 | Bacteria | 4736 |
| 492 | Ga0495581_0023426 | 3300047315 | Bacteria | 3578 |
| 493 | Ga0495581_0033623 | 3300047315 | Bacteria | 2967 |
| 494 | Ga0495581_0054559 | 3300047315 | Bacteria | 2307 |
| 495 | Ga0495581_0060634 | 3300047315 | Bacteria | 2186 |
| 496 | Ga0495581_0100037 | 3300047315 | Bacteria | 1684 |
| 497 | Ga0495581_0118027 | 3300047315 | Bacteria | 1543 |
| 498 | Ga0495581_0191761 | 3300047315 | Bacteria | 1195 |
| 499 | Ga0495604_0003847 | 3300047317 | Bacteria | 11959 |
| 500 | Ga0495604_0010094 | 3300047317 | Bacteria | 7478 |
| 501 | Ga0495604_0093799 | 3300047317 | Bacteria | 2220 |
| 502 | Ga0495636_0001028 | 3300047318 | Bacteria | 10459 |
| 503 | Ga0495636_0003017 | 3300047318 | Bacteria | 6524 |
| 504 | Ga0495636_0003187 | 3300047318 | Bacteria | 6359 |
| 505 | Ga0495636_0004267 | 3300047318 | Bacteria | 5610 |
| 506 | Ga0495636_0026343 | 3300047318 | Bacteria | 2365 |
| 507 | Ga0495674_0097949 | 3300047319 | Bacteria | 2498 |
| 508 | Ga0495676_0009557 | 3300047321 | Bacteria | 8825 |
| 509 | Ga0495676_0017172 | 3300047321 | Bacteria | 6404 |
| 510 | Ga0495676_0109818 | 3300047321 | Bacteria | 2026 |
| 511 | Ga0495676_0167406 | 3300047321 | Bacteria | 1549 |
| 512 | Ga0495680_0004071 | 3300047322 | Bacteria | 14077 |
| 513 | Ga0495680_0030897 | 3300047322 | Bacteria | 4365 |
| 514 | Ga0495687_003646 | 3300047443 | Bacteria | 10977 |
| 515 | Ga0495687_009699 | 3300047443 | Bacteria | 5354 |
| 516 | Ga0495687_013800 | 3300047443 | Bacteria | 4193 |
| 517 | Ga0495675_0017025 | 3300047444 | Bacteria | 4601 |
| 518 | Ga0495675_0089173 | 3300047444 | Bacteria | 1936 |
| 519 | Ga0495675_0100744 | 3300047444 | Bacteria | 1808 |
| 520 | Ga0495675_0137607 | 3300047444 | Bacteria | 1515 |
| 521 | Ga0495685_000217 | 3300047447 | Bacteria | 19537 |
| 522 | Ga0495685_000379 | 3300047447 | Bacteria | 14136 |
| 523 | Ga0495685_004594 | 3300047447 | Bacteria | 4474 |
| 524 | Ga0495685_008255 | 3300047447 | Bacteria | 3452 |
| 525 | Ga0495685_021565 | 3300047447 | Bacteria | 2216 |
| 526 | Ga0495681_0000539 | 3300047470 | Bacteria | 29033 |
| 527 | Ga0495684_0061052 | 3300047471 | Bacteria | 2868 |
| 528 | Ga0495593_0006519 | 3300047673 | Bacteria | 6839 |
| 529 | Ga0495593_0007619 | 3300047673 | Bacteria | 6322 |
| 530 | Ga0495593_0025856 | 3300047673 | Bacteria | 3248 |
| 531 | Ga0495593_0038476 | 3300047673 | Bacteria | 2583 |
| 532 | Ga0495602_0077445 | 3300048088 | Bacteria | 2813 |
| 533 | Ga0495614_0005289 | 3300048089 | Bacteria | 5821 |
| 534 | Ga0495614_0005327 | 3300048089 | Bacteria | 5801 |
| 535 | Ga0495614_0022556 | 3300048089 | Bacteria | 2716 |
| 536 | Ga0495614_0081593 | 3300048089 | Bacteria | 1401 |
| 537 | Ga0495626_0000930 | 3300048091 | Bacteria | 25621 |
| 538 | Ga0496100_0168919 | 3300048903 | Bacteria | 1573 |
| 539 | Ga0496101_0021141 | 3300048904 | Bacteria | 4468 |
| 540 | Ga0496101_0097312 | 3300048904 | Bacteria | 2197 |
| 541 | Ga0496101_0312280 | 3300048904 | Bacteria | 1232 |
| 542 | Ga0496102_0003332 | 3300048905 | Bacteria | 13622 |
| 543 | Ga0496102_0031780 | 3300048905 | Bacteria | 4738 |
| 544 | Ga0496102_0040238 | 3300048905 | Bacteria | 4228 |
| 545 | Ga0496102_0173650 | 3300048905 | Bacteria | 2029 |
| 546 | Ga0496102_0333936 | 3300048905 | Bacteria | 1427 |
| 547 | Ga0496103_0039094 | 3300048906 | Bacteria | 2914 |
| 548 | Ga0496104_0038820 | 3300048907 | Bacteria | 4457 |
| 549 | Ga0496104_0257633 | 3300048907 | Bacteria | 1657 |
| 550 | Ga0496106_0071584 | 3300048909 | Bacteria | 2650 |
| 551 | Ga0496106_0073226 | 3300048909 | Bacteria | 2620 |
| 552 | Ga0496106_0109089 | 3300048909 | Bacteria | 2153 |
| 553 | Ga0496107_0111213 | 3300048910 | Bacteria | 2013 |
| 554 | Ga0496108_0059332 | 3300048911 | Bacteria | 3217 |
| 555 | Ga0496108_0118726 | 3300048911 | Bacteria | 2267 |
| 556 | Ga0496108_0138358 | 3300048911 | Bacteria | 2097 |
| 557 | Ga0496108_0150889 | 3300048911 | Bacteria | 2005 |
| 558 | Ga0496108_0250406 | 3300048911 | Bacteria | 1541 |
| 559 | Ga0496109_0010492 | 3300048912 | Bacteria | 7915 |
| 560 | Ga0496109_0012909 | 3300048912 | Bacteria | 7223 |
| 561 | Ga0496109_0063641 | 3300048912 | Bacteria | 3374 |
| 562 | Ga0496109_0091864 | 3300048912 | Bacteria | 2807 |
| 563 | Ga0496110_0015615 | 3300048913 | Bacteria | 6324 |
| 564 | Ga0496110_0350854 | 3300048913 | Bacteria | 1344 |
| 565 | Ga0496111_0109993 | 3300048914 | Bacteria | 2029 |
| 566 | Ga0496111_0189592 | 3300048914 | Bacteria | 1528 |
| 567 | Ga0496111_0370464 | 3300048914 | Bacteria | 1060 |
| 568 | Ga0496112_0010348 | 3300048915 | Bacteria | 8458 |
| 569 | Ga0496112_0023592 | 3300048915 | Bacteria | 5880 |
| 570 | Ga0496112_0150097 | 3300048915 | Bacteria | 2298 |
| 571 | Ga0496112_0321906 | 3300048915 | Bacteria | 1491 |
| 572 | Ga0496113_0042260 | 3300048916 | Bacteria | 3367 |
| 573 | Ga0496113_0118312 | 3300048916 | Bacteria | 2069 |
| 574 | Ga0496114_0000523 | 3300048917 | Bacteria | 28236 |
| 575 | Ga0496114_0016774 | 3300048917 | Bacteria | 5905 |
| 576 | Ga0496114_0149008 | 3300048917 | Bacteria | 2029 |
| 577 | Ga0496114_0172838 | 3300048917 | Bacteria | 1884 |
| 578 | Ga0496114_0272719 | 3300048917 | Bacteria | 1491 |
| 579 | Ga0496115_0009426 | 3300048918 | Bacteria | 7254 |
| 580 | Ga0496124_0081618 | 3300048927 | Bacteria | 2657 |
| 581 | Ga0496124_0163388 | 3300048927 | Bacteria | 1733 |
| 582 | Ga0496126_0014945 | 3300048929 | Bacteria | 7828 |
| 583 | Ga0496126_0347198 | 3300048929 | Bacteria | 1214 |
| 584 | Ga0501317_008913 | 3300049533 | Bacteria | 1167 |
| 585 | Ga0501318_001910 | 3300049534 | Bacteria | 1729 |
| 586 | Ga0501318_002651 | 3300049534 | Bacteria | 1574 |
| 587 | Ga0501032_0009671 | 3300049569 | Bacteria | 6983 |
| 588 | Ga0501032_0045906 | 3300049569 | Bacteria | 2953 |
| 589 | Ga0501032_0050144 | 3300049569 | Bacteria | 2815 |
| 590 | Ga0501032_0090277 | 3300049569 | Bacteria | 2033 |
| 591 | Ga0501032_0127279 | 3300049569 | Bacteria | 1682 |
| 592 | Ga0501033_0002155 | 3300049570 | Bacteria | 17027 |
| 593 | Ga0501033_0016026 | 3300049570 | Bacteria | 5676 |
| 594 | Ga0501034_0006642 | 3300049571 | Bacteria | 12413 |
| 595 | Ga0501034_0017406 | 3300049571 | Bacteria | 7372 |
| 596 | Ga0501034_0042464 | 3300049571 | Bacteria | 4603 |
| 597 | Ga0501034_0051344 | 3300049571 | Bacteria | 4158 |
| 598 | Ga0501034_0221030 | 3300049571 | Bacteria | 1847 |
| 599 | Ga0501036_0000774 | 3300049572 | Bacteria | 23713 |
| 600 | Ga0501036_0003007 | 3300049572 | Bacteria | 13416 |
| 601 | Ga0501036_0005567 | 3300049572 | Bacteria | 10218 |
| 602 | Ga0501036_0008555 | 3300049572 | Bacteria | 8392 |
| 603 | Ga0501036_0069750 | 3300049572 | Bacteria | 2973 |
| 604 | Ga0501036_0087052 | 3300049572 | Bacteria | 2640 |
| 605 | Ga0501036_0287098 | 3300049572 | Bacteria | 1377 |
| 606 | Ga0501037_0007927 | 3300049573 | Bacteria | 7781 |
| 607 | Ga0501037_0011721 | 3300049573 | Bacteria | 6454 |
| 608 | Ga0501037_0178807 | 3300049573 | Bacteria | 1506 |
| 609 | Ga0501037_0231453 | 3300049573 | Bacteria | 1297 |
| 610 | Ga0501038_0001037 | 3300049574 | Bacteria | 25085 |
| 611 | Ga0501038_0002536 | 3300049574 | Bacteria | 17027 |
| 612 | Ga0501038_0018586 | 3300049574 | Bacteria | 6277 |
| 613 | Ga0501038_0089268 | 3300049574 | Bacteria | 2585 |
| 614 | Ga0501038_0166775 | 3300049574 | Bacteria | 1786 |
| 615 | Ga0501038_0206621 | 3300049574 | Bacteria | 1573 |
| 616 | Ga0501038_0409832 | 3300049574 | Bacteria | 1047 |
| 617 | Ga0501039_0061924 | 3300049575 | Bacteria | 2898 |
| 618 | Ga0501042_0003369 | 3300049578 | Bacteria | 10023 |
| 619 | Ga0501042_0074685 | 3300049578 | Bacteria | 2426 |
| 620 | Ga0501043_0002134 | 3300049579 | Bacteria | 16883 |
| 621 | Ga0501043_0002303 | 3300049579 | Bacteria | 16184 |
| 622 | Ga0501043_0022882 | 3300049579 | Bacteria | 4900 |
| 623 | Ga0501043_0053435 | 3300049579 | Bacteria | 3172 |
| 624 | Ga0501046_0064418 | 3300049580 | Bacteria | 2861 |
| 625 | Ga0501047_0030168 | 3300049581 | Bacteria | 5228 |
| 626 | Ga0501047_0054229 | 3300049581 | Bacteria | 3877 |
| 627 | Ga0501067_0012919 | 3300049583 | Bacteria | 4621 |
| 628 | Ga0501068_0021266 | 3300049584 | Bacteria | 3787 |
| 629 | Ga0501070_0000581 | 3300049586 | Bacteria | 33287 |
| 630 | Ga0501070_0001853 | 3300049586 | Bacteria | 18668 |
| 631 | Ga0501070_0002822 | 3300049586 | Bacteria | 15159 |
| 632 | Ga0501070_0010509 | 3300049586 | Bacteria | 7825 |
| 633 | Ga0501070_0025748 | 3300049586 | Bacteria | 4935 |
| 634 | Ga0501070_0114748 | 3300049586 | Bacteria | 2225 |
| 635 | Ga0501070_0134279 | 3300049586 | Bacteria | 2043 |
| 636 | Ga0501070_0328109 | 3300049586 | Bacteria | 1244 |
| 637 | Ga0501071_0253090 | 3300049587 | Bacteria | 1330 |
| 638 | Ga0501073_0143765 | 3300049589 | Bacteria | 1653 |
| 639 | Ga0501074_0000701 | 3300049590 | Bacteria | 20963 |
| 640 | Ga0501074_0006411 | 3300049590 | Bacteria | 8500 |
| 641 | Ga0501074_0008606 | 3300049590 | Bacteria | 7391 |
| 642 | Ga0501074_0064424 | 3300049590 | Bacteria | 2638 |
| 643 | Ga0501074_0133091 | 3300049590 | Bacteria | 1778 |
| 644 | Ga0501076_0168883 | 3300049592 | Bacteria | 1783 |
| 645 | Ga0501077_0116703 | 3300049593 | Bacteria | 1691 |
| 646 | Ga0501079_0000273 | 3300049741 | Bacteria | 31797 |
| 647 | Ga0501080_0001250 | 3300049742 | Bacteria | 21163 |
| 648 | Ga0501080_0040138 | 3300049742 | Bacteria | 4366 |
| 649 | Ga0501080_0069805 | 3300049742 | Bacteria | 3268 |
| 650 | Ga0501080_0120778 | 3300049742 | Bacteria | 2428 |
| 651 | Ga0501080_0387650 | 3300049742 | Bacteria | 1258 |
| 652 | Ga0501035_0001796 | 3300049822 | Bacteria | 21670 |
| 653 | Ga0501035_0189363 | 3300049822 | Bacteria | 1769 |
| 654 | Ga0501035_0202195 | 3300049822 | Bacteria | 1703 |
| 655 | Ga0501044_0005003 | 3300049823 | Bacteria | 14795 |
| 656 | Ga0501044_0065849 | 3300049823 | Bacteria | 3695 |
| 657 | Ga0501044_0122235 | 3300049823 | Bacteria | 2603 |
| 658 | Ga0501044_0147342 | 3300049823 | Bacteria | 2338 |
| 659 | Ga0501044_0160030 | 3300049823 | Bacteria | 2229 |
| 660 | Ga0501045_0042782 | 3300049824 | Bacteria | 3298 |
| 661 | Ga0501045_0055560 | 3300049824 | Bacteria | 2895 |
| 662 | nmdc:mga03n38_96907_c1 | 3300050490 | Bacteria | 1415 |
| 663 | nmdc:mga00v17_125686_c1 | 3300050491 | Bacteria | 1636 |
| 664 | nmdc:mga0yw44_114454_c1 | 3300050492 | Bacteria | 1731 |
| 665 | nmdc:mga0yw44_185289_c1 | 3300050492 | Bacteria | 1371 |
| 666 | nmdc:mga0yw44_276917_c1 | 3300050492 | Bacteria | 1121 |
| 667 | nmdc:mga04h51_1007_c1 | 3300050495 | Bacteria | 6501 |
| 668 | nmdc:mga05p37_384066_c1 | 3300050507 | Bacteria | 1644 |
| 669 | nmdc:mga0qj67_38538_c1 | 3300050509 | Bacteria | 3750 |
| 670 | Ga0495601_0001056 | 3300053077 | Bacteria | 15081 |
| 671 | Ga0495612_0064966 | 3300053078 | Bacteria | 1515 |
| 672 | Ga0495612_0070362 | 3300053078 | Bacteria | 1458 |
| 673 | Ga0495655_0004320 | 3300053083 | Bacteria | 2420 |
| 674 | Ga0495619_0045273 | 3300053085 | Bacteria | 2891 |
| 675 | Ga0500578_0119065 | 3300053086 | Bacteria | 1660 |
| 676 | Ga0500553_096763 | 3300053101 | Bacteria | 1282 |
| 677 | Ga0500652_035224 | 3300053131 | Bacteria | 1987 |
| 678 | Ga0500561_0010182 | 3300053137 | Bacteria | 1934 |
| 679 | Ga0500568_0000053 | 3300053139 | Bacteria | 111636 |
| 680 | Ga0500573_0077316 | 3300053140 | Bacteria | 1894 |
| 681 | Ga0500600_0062325 | 3300053149 | Bacteria | 2074 |
| 682 | Ga0500616_0003791 | 3300053153 | Bacteria | 11224 |
| 683 | Ga0500616_0024724 | 3300053153 | Bacteria | 3334 |
| 684 | Ga0500633_0034499 | 3300053160 | Bacteria | 1659 |
| 685 | Ga0500634_0021094 | 3300053161 | Bacteria | 3526 |
| 686 | Ga0501084_0000052 | 3300054114 | Bacteria | 92225 |
| 687 | Ga0501084_0049504 | 3300054114 | Bacteria | 3518 |
| 688 | Ga0587067_019276 | 3300059640 | Bacteria | 1154 |
| 689 | Ga0501082_0153936 | 3300060353 | Bacteria | 1997 |
| 690 | Ga0466962_0000181 | 3300061719 | Bacteria | 26153 |
| 691 | Ga0466962_0000902 | 3300061719 | Bacteria | 13479 |
| 692 | 2808849987 | 2808606360 | Bacteria | 4404006 |
| 693 | 2554260255 | 2554235005 | Bacteria | 6457341 |
| 694 | 2585297731 | 2582581312 | Bacteria | 7308206 |
| 695 | 2585303219 | 2582581313 | Bacteria | 10042643 |
| 696 | 2585309639 | 2582581313 | Bacteria | 10042643 |
| 697 | 2616693827 | 2616644814 | Bacteria | 11555299 |
| 698 | 2623497907 | 2622736605 | Bacteria | 4992138 |
| 699 | 2643890166 | 2643221576 | Bacteria | 5214352 |
| 700 | 2643890794 | 2643221576 | Bacteria | 5214352 |
| 701 | 2643946368 | 2643221587 | Bacteria | 7586415 |
| 702 | 2643959222 | 2643221590 | Bacteria | 5214697 |
| 703 | 2643959850 | 2643221590 | Bacteria | 5214697 |
| 704 | 2644033513 | 2643221604 | Bacteria | 5014917 |
| 705 | 2644178381 | 2643221631 | Bacteria | 8168043 |
| 706 | 2644262131 | 2643221647 | Bacteria | 10741251 |
| 707 | 2644264335 | 2643221647 | Bacteria | 10741251 |
| 708 | 2644389285 | 2643221670 | Bacteria | 6497041 |
| 709 | 2644434172 | 2643221677 | Bacteria | 7584031 |
| 710 | 2644440570 | 2643221678 | Bacteria | 9540101 |
| 711 | 2644446894 | 2643221679 | Bacteria | 3839507 |
| 712 | 2644627719 | 2643221714 | Bacteria | 9015452 |
| 713 | 2644627741 | 2643221714 | Bacteria | 9015452 |
| 714 | 2671835278 | 2671180195 | Bacteria | 9757215 |
| 715 | 2676484594 | 2675903059 | Bacteria | 8644972 |
| 716 | 2691512194 | 2690315906 | Bacteria | 4517044 |
| 717 | 2738870082 | 2738541305 | Bacteria | 4910150 |
| 718 | 2744954341 | 2744054611 | Bacteria | 5611514 |
| 719 | 2753072146 | 2751185734 | Bacteria | 8863695 |
| 720 | 2768645204 | 2767802112 | Bacteria | 6465194 |
| 721 | 2772647346 | 2772190715 | Bacteria | 6959372 |
| 722 | 2774395389 | 2773857762 | Bacteria | 5971770 |
| 723 | 2774853434 | 2773857922 | Bacteria | 9757215 |
| 724 | 2775655777 | 2775506735 | Bacteria | 4556596 |
| 725 | 2775657517 | 2775506735 | Bacteria | 4556596 |
| 726 | 2776374812 | 2775506925 | Bacteria | 7237746 |
| 727 | 2785346535 | 2784746763 | Bacteria | 9783172 |
| 728 | 2785366824 | 2784746768 | Bacteria | 10036182 |
| 729 | 2785374045 | 2784746768 | Bacteria | 10036182 |
| 730 | 2786667870 | 2786546132 | Bacteria | 10419719 |
| 731 | 2786674284 | 2786546132 | Bacteria | 10419719 |
| 732 | 2791909865 | 2791354901 | Bacteria | 8322202 |
| 733 | 2793977590 | 2791355406 | Bacteria | 11364898 |
| 734 | 2795781678 | 2795385470 | Bacteria | 8317180 |
| 735 | 2808828722 | 2808606357 | Bacteria | 4466944 |
| 736 | 2808845761 | 2808606359 | Bacteria | 9866990 |
| 737 | 2808877451 | 2808606366 | Bacteria | 4415912 |
| 738 | 2808893716 | 2808606370 | Bacteria | 4942454 |
| 739 | 2808898930 | 2808606371 | Bacteria | 4251511 |
| 740 | 2808915609 | 2808606375 | Bacteria | 9466072 |
| 741 | 2808917880 | 2808606375 | Bacteria | 9466072 |
| 742 | 2810363884 | 2808606700 | Bacteria | 3482157 |
| 743 | 2811842709 | 2808606982 | Bacteria | 7791042 |
| 744 | 2812319551 | 2811994871 | Bacteria | 4497550 |
| 745 | 2812321407 | 2811994871 | Bacteria | 4497550 |
| 746 | 2812330079 | 2811994874 | Bacteria | 5367947 |
| 747 | 2812348510 | 2811994878 | Bacteria | 5992952 |
| 748 | 2819743467 | 2818991472 | Bacteria | 10089953 |
| 749 | 2844851774 | 2844849076 | Bacteria | 4091819 |
| 750 | 2855673297 | 2855670206 | Bacteria | 7120389 |
| 751 | 2855681094 | 2855676851 | Bacteria | 7063653 |
| 752 | 2856745207 | 2856741275 | Bacteria | 8096094 |
| 753 | 2857293511 | 2857288857 | Bacteria | 7189066 |
| 754 | 2857743392 | 2857740372 | Bacteria | 4782044 |
| 755 | 2858851318 | 2858848962 | Bacteria | 6963058 |
| 756 | 2858887572 | 2858882152 | Bacteria | 7230291 |
| 757 | 2858892690 | 2858888857 | Bacteria | 7060307 |
| 758 | 2861528235 | 2861520306 | Bacteria | 8348283 |
| 759 | 2862180493 | 2862178590 | Bacteria | 8583590 |
| 760 | 2862282602 | 2862281513 | Bacteria | 9621493 |
| 761 | 2862283804 | 2862281513 | Bacteria | 9621493 |
| 762 | 2862292886 | 2862290372 | Bacteria | 7471434 |
| 763 | 2862390607 | 2862382967 | Bacteria | 10317375 |
| 764 | 2862574974 | 2862574272 | Bacteria | 10567477 |
| 765 | 2863071955 | 2863067949 | Bacteria | 8541735 |
| 766 | 2863410843 | 2863404153 | Bacteria | 9672205 |
| 767 | 2866554457 | 2866552031 | Bacteria | 5824618 |
| 768 | 2867347660 | 2867346516 | Bacteria | 7608576 |
| 769 | 2867432053 | 2867428634 | Bacteria | 9590268 |
| 770 | 2867438000 | 2867428634 | Bacteria | 9590268 |
| 771 | 2867479539 | 2867475112 | Bacteria | 6909112 |
| 772 | 2867507198 | 2867507094 | Bacteria | 6506033 |
| 773 | 2869049405 | 2869048445 | Bacteria | 6875584 |
| 774 | 2869066982 | 2869061728 | Bacteria | 7112407 |
| 775 | 2869070139 | 2869068681 | Bacteria | 7205615 |
| 776 | 2873152277 | 2873151551 | Bacteria | 8625867 |
| 777 | 2873157777 | 2873151551 | Bacteria | 8625867 |
| 778 | 2873321940 | 2873314349 | Bacteria | 8512634 |
| 779 | 2877677224 | 2877676314 | Bacteria | 9512378 |
| 780 | 2877683722 | 2877676314 | Bacteria | 9512378 |
| 781 | 2880500726 | 2880495981 | Bacteria | 7340502 |
| 782 | 2884695133 | 2884693830 | Bacteria | 11273186 |
| 783 | 2891328823 | 2891326441 | Bacteria | 6439512 |
| 784 | 2891404343 | 2891395885 | Bacteria | 9251614 |
| 785 | 2891567117 | 2891562705 | Bacteria | 8039471 |
| 786 | 2893686684 | 2893684298 | Bacteria | 2897960 |
| 787 | 2895446185 | 2895442618 | Bacteria | 11027144 |
| 788 | 2904498038 | 2904497146 | Bacteria | 4731781 |
| 789 | 2904777396 | 2904776348 | Bacteria | 4658726 |
| 790 | 2905926853 | 2905926851 | Bacteria | 4423176 |
| 791 | 2905930110 | 2905926851 | Bacteria | 4423176 |
| 792 | 2910813425 | 2910809715 | Bacteria | 4982797 |
| 793 | 2912723859 | 2912715099 | Bacteria | 9460473 |
| 794 | 2912759071 | 2912757875 | Bacteria | 7940295 |
| 795 | 2919034768 | 2919034639 | Bacteria | 4763403 |
| 796 | 2919054090 | 2919051321 | Bacteria | 4210889 |
| 797 | 2919054380 | 2919051321 | Bacteria | 4210889 |
| 798 | 2919062086 | 2919059106 | Bacteria | 4991624 |
| 799 | 2919448236 | 2919446982 | Bacteria | 3994487 |
| 800 | 2919470640 | 2919468124 | Bacteria | 9133025 |
| 801 | 2919540233 | 2919538618 | Bacteria | 4677069 |
| 802 | 2920880117 | 2920879853 | Bacteria | 4216831 |
| 803 | 2920882157 | 2920879853 | Bacteria | 4216831 |
| 804 | 2929229238 | 2929226422 | Bacteria | 7248583 |
| 805 | 2932428063 | 2932426870 | Bacteria | 4547726 |
| 806 | 2933421420 | 2933418574 | Bacteria | 4476724 |
| 807 | 2939598227 | 2939598168 | Bacteria | 4687164 |
| 808 | 2939601131 | 2939598168 | Bacteria | 4687164 |
| 809 | 2939647544 | 2939647034 | Bacteria | 4681660 |
| 810 | 2939675472 | 2939674588 | Bacteria | 4844420 |
| 811 | 2945917297 | 2945916053 | Bacteria | 4555517 |
| 812 | 2945923257 | 2945920336 | Bacteria | 4501603 |
| 813 | 2945941349 | 2945941187 | Bacteria | 4682474 |
| 814 | 2945960860 | 2945956166 | Bacteria | 5110334 |
| 815 | 2945960892 | 2945956166 | Bacteria | 5110334 |
| 816 | 2946004296 | 2946003308 | Bacteria | 3857229 |
| 817 | 2946024612 | 2946024296 | Bacteria | 3508095 |
| 818 | 2946041028 | 2946037020 | Bacteria | 4900426 |
| 819 | 2946045892 | 2946045630 | Bacteria | 8527308 |
| 820 | 2946061137 | 2946059875 | Bacteria | 4386623 |
| 821 | 2946079601 | 2946072368 | Bacteria | 8999607 |
| 822 | 2947224854 | 2947224130 | Bacteria | 9938529 |
| 823 | 2954002260 | 2953998280 | Bacteria | 4812144 |
| 824 | 2954003464 | 2954002825 | Bacteria | 9173742 |
| 825 | 2954381950 | 2954380949 | Bacteria | 10050426 |
| 826 | 2954389016 | 2954380949 | Bacteria | 10050426 |
| 827 | 2954674010 | 2954673503 | Bacteria | 9685905 |
| 828 | 2954681127 | 2954673503 | Bacteria | 9685905 |
| 829 | 2954683030 | 2954682443 | Bacteria | 9862841 |
| 830 | 2954689978 | 2954682443 | Bacteria | 9862841 |
| 831 | 2954699755 | 2954691527 | Bacteria | 10720516 |
| 832 | 2954712408 | 2954711539 | Bacteria | 10867210 |
| 833 | 2954718695 | 2954711539 | Bacteria | 10867210 |
| 834 | 2954722356 | 2954721474 | Bacteria | 10456478 |
| 835 | 2954728666 | 2954721474 | Bacteria | 10456478 |
| 836 | 2954733146 | 2954731030 | Bacteria | 10243860 |
| 837 | 2954739495 | 2954731030 | Bacteria | 10243860 |
| 838 | 2954741242 | 2954740390 | Bacteria | 10229294 |
| 839 | 2954747562 | 2954740390 | Bacteria | 10229294 |
| 840 | 2954752026 | 2954749733 | Bacteria | 10366972 |
| 841 | 2954758322 | 2954749733 | Bacteria | 10366972 |
| 842 | 2954760253 | 2954759201 | Bacteria | 9358192 |
| 843 | 2954766679 | 2954759201 | Bacteria | 9358192 |
| 844 | 2964328358 | 2964326757 | Bacteria | 3290868 |
| 845 | 2974305284 | 2974302888 | Bacteria | 4369871 |
| 846 | 2984577372 | 2984576629 | Bacteria | 4248407 |
| 847 | 2990064633 | 2990059506 | Bacteria | 9321252 |
| 848 | 2990259533 | 2990256926 | Bacteria | 4252839 |
| 849 | 2995727388 | 2995726249 | Bacteria | 3470435 |
| 850 | 2997456493 | 2997451912 | Bacteria | 8492419 |
| 851 | 2997600332 | 2997600082 | Bacteria | 9896405 |
| 852 | 3006328171 | 3006321560 | Bacteria | 8247479 |
| 853 | 3006428785 | 3006425503 | Bacteria | 6491253 |
| 854 | 3006491147 | 3006486233 | Bacteria | 8157040 |
| 855 | 3006494953 | 3006493962 | Bacteria | 8825450 |
| 856 | 8002788839 | 8002784119 | Bacteria | 9788632 |
| 857 | 8004029050 | 8004025490 | Bacteria | 4327753 |
| 858 | 8008564971 | 8008558824 | Bacteria | 10610750 |
| 859 | 8047716635 | 8047710418 | Bacteria | 11023148 |
| 860 | 8047898023 | 8047893842 | Bacteria | 11723082 |
| 861 | 8048360870 | 8048356638 | Bacteria | 11044339 |
| 862 | 8048374986 | 8048369669 | Bacteria | 11666822 |
| 863 | 8048383220 | 8048379754 | Bacteria | 11877923 |
| 864 | 8054109925 | 8054107350 | Bacteria | 5022511 |
| 865 | 8054162770 | 8054160619 | Bacteria | 7783213 |
| 866 | 8054706131 | 8054704163 | Bacteria | 7247792 |
| 867 | 8054730363 | 8054727385 | Bacteria | 7558670 |
| 868 | 8054738167 | 8054734606 | Bacteria | 6947278 |
| 869 | 8055071441 | 8055066027 | Bacteria | 9479577 |
| 870 | 8055159771 | 8055157932 | Bacteria | 6429399 |
| 871 | 8055174947 | 8055172936 | Bacteria | 9305943 |
| 872 | 8055417823 | 8055412473 | Bacteria | 6257500 |
| 873 | 8056211410 | 8056207758 | Bacteria | 8639239 |
| 874 | 8056673323 | 8056667051 | Bacteria | 6953971 |
| 875 | 8056830730 | 8056829672 | Bacteria | 9045328 |
| 876 | 8056834826 | 8056829672 | Bacteria | 9045328 |
| 877 | LJQas_1006008 | |||
| 878 | JGI24740J21852_10022565 | |||
| 879 | JGI25152J39213_1000564 | |||
| 880 | rootL2_10182415 | |||
| 881 | JGI25160J50197_1014019 | |||
| 882 | Ga0055542_1004126 | |||
| 883 | Ga0055540_1002891 | |||
| 884 | Ga0055540_1005551 | |||
| 885 | Ga0055540_1007668 | |||
| 886 | Ga0065714_10017933 | |||
| 887 | Ga0065714_10019874 | |||
| 888 | Ga0070676_10128473 | |||
| 889 | Ga0070683_100047725 | |||
| 890 | Ga0070670_100043661 | |||
| 891 | Ga0070670_100063897 | |||
| 892 | Ga0070666_10082066 | |||
| 893 | Ga0070680_100029410 | |||
| 894 | Ga0070682_100045910 | |||
| 895 | Ga0070687_100018156 | |||
| 896 | Ga0070692_10003998 | |||
| 897 | Ga0070692_10057589 | |||
| 898 | Ga0070668_100180512 | |||
| 899 | Ga0070669_100039627 | |||
| 900 | Ga0070669_100113981 | |||
| 901 | Ga0070675_100126521 | |||
| 902 | Ga0070671_100055122 | |||
| 903 | Ga0070671_100104983 | |||
| 904 | Ga0070673_100157025 | |||
| 905 | Ga0070659_100075973 | |||
| 906 | Ga0070714_100169521 | |||
| 907 | Ga0070713_100102826 | |||
| 908 | Ga0070710_10003528 | |||
| 909 | Ga0070711_100110460 | |||
| 910 | Ga0070705_100209077 | |||
| 911 | Ga0070700_100002168 | |||
| 912 | Ga0070678_100012916 | |||
| 913 | Ga0070681_10090418 | |||
| 914 | Ga0068867_100095786 | |||
| 915 | Ga0070707_100010754 | |||
| 916 | Ga0070707_100057882 | |||
| 917 | Ga0070698_100000415 | |||
| 918 | Ga0070698_100035998 | |||
| 919 | Ga0070679_100006189 | |||
| 920 | Ga0070679_100062892 | |||
| 921 | Ga0070679_100184078 | |||
| 922 | Ga0070684_100043610 | |||
| 923 | Ga0070684_100077247 | |||
| 924 | Ga0070684_100134260 | |||
| 925 | Ga0070697_100029208 | |||
| 926 | Ga0070672_100001302 | |||
| 927 | Ga0070672_100139221 | |||
| 928 | Ga0070665_100001255 | |||
| 929 | Ga0068857_100011946 | |||
| 930 | Ga0070702_100082705 | |||
| 931 | Ga0068852_100010223 | |||
| 932 | Ga0068852_100078292 | |||
| 933 | Ga0068864_100056722 | |||
| 934 | Ga0068866_10016695 | |||
| 935 | Ga0068861_100095487 | |||
| 936 | Ga0081455_10014512 | |||
| 937 | Ga0081540_1012199 | |||
| 938 | Ga0075365_10030556 | |||
| 939 | Ga0075365_10180105 | |||
| 940 | Ga0075365_10242208 | |||
| 941 | Ga0075432_10000424 | |||
| 942 | Ga0070715_10081209 | |||
| 943 | Ga0070716_100012164 | |||
| 944 | Ga0075367_10001514 | |||
| 945 | Ga0068865_100048815 | |||
| 946 | Ga0099826_10084204 | |||
| 947 | Ga0105251_10021678 | |||
| 948 | Ga0105251_10024199 | |||
| 949 | Ga0105244_10003027 | |||
| 950 | Ga0105244_10098294 | |||
| 951 | Ga0111539_10255520 | |||
| 952 | Ga0105245_10085548 | |||
| 953 | Ga0105245_10235075 | |||
| 954 | Ga0105243_10010279 | |||
| 955 | Ga0105243_10015649 | |||
| 956 | Ga0105243_10034709 | |||
| 957 | Ga0105243_10078234 | |||
| 958 | Ga0105243_10113935 | |||
| 959 | Ga0105248_10053041 | |||
| 960 | Ga0105248_10061347 | |||
| 961 | Ga0105238_10207521 | |||
| 962 | Ga0105238_10288892 | |||
| 963 | Ga0105249_10010275 | |||
| 964 | Ga0105249_10159649 | |||
| 965 | Ga0105239_10011607 | |||
| 966 | Ga0105239_10279011 | |||
| 967 | Ga0105246_10001152 | |||
| 968 | Ga0105246_10002505 | |||
| 969 | Ga0105246_10027246 | |||
| 970 | Ga0105246_10112250 | |||
| 971 | Ga0105246_10276060 | |||
| 972 | Ga0157371_10085290 | |||
| 973 | Ga0157369_10342459 | |||
| 974 | Ga0163162_10020143 | |||
| 975 | Ga0163162_10196031 | |||
| 976 | Ga0157380_10170889 | |||
| 977 | Ga0157377_10003750 | |||
| 978 | Ga0157379_10019033 | |||
| 979 | Ga0183367_1003 | |||
| 980 | Ga0183367_1004 | |||
| 981 | Ga0163161_10020014 | |||
| 982 | Ga0206356_10752756 | |||
| 983 | Ga0206350_10749295 | |||
| 984 | Ga0206353_10539143 | |||
| 985 | Ga0213875_10001608 | |||
| 986 | Ga0213875_10001884 | |||
| 987 | Ga0213875_10002648 | |||
| 988 | Ga0213875_10003198 | |||
| 989 | Ga0224712_10008931 | |||
| 990 | Ga0209148_1004095 | |||
| 991 | Ga0209129_1000448 | |||
| 992 | Ga0209025_1001977 | |||
| 993 | Ga0207426_1000996 | |||
| 994 | Ga0207426_1001844 | |||
| 995 | Ga0207426_1008971 | |||
| 996 | Ga0207426_1015577 | |||
| 997 | Ga0209051_1000569 | |||
| 998 | Ga0209051_1005041 | |||
| 999 | Ga0209051_1008251 | |||
| 1000 | Ga0209051_1010666 | |||
| 1001 | Ga0209051_1022562 | |||
| 1002 | Ga0207697_10002395 | |||
| 1003 | Ga0207697_10011335 | |||
| 1004 | Ga0207655_1034402 | |||
| 1005 | Ga0207688_10031078 | |||
| 1006 | Ga0207647_10006174 | |||
| 1007 | Ga0207699_10104347 | |||
| 1008 | Ga0207645_10076255 | |||
| 1009 | Ga0207705_10067528 | |||
| 1010 | Ga0207684_10031140 | |||
| 1011 | Ga0207707_10068043 | |||
| 1012 | Ga0207657_10009534 | |||
| 1013 | Ga0207657_10168981 | |||
| 1014 | Ga0207652_10059261 | |||
| 1015 | Ga0207646_10061476 | |||
| 1016 | Ga0207681_10105877 | |||
| 1017 | Ga0207650_10258405 | |||
| 1018 | Ga0207650_10309582 | |||
| 1019 | Ga0207659_10332160 | |||
| 1020 | Ga0207659_10339784 | |||
| 1021 | Ga0207700_10119803 | |||
| 1022 | Ga0207664_10014646 | |||
| 1023 | Ga0207690_10114019 | |||
| 1024 | Ga0207706_10330019 | |||
| 1025 | Ga0207709_10064881 | |||
| 1026 | Ga0207709_10077337 | |||
| 1027 | Ga0207709_10104325 | |||
| 1028 | Ga0207709_10226924 | |||
| 1029 | Ga0207669_10060376 | |||
| 1030 | Ga0207669_10203960 | |||
| 1031 | Ga0207704_10085325 | |||
| 1032 | Ga0207665_10006521 | |||
| 1033 | Ga0207691_10004085 | |||
| 1034 | Ga0207691_10005260 | |||
| 1035 | Ga0207691_10016690 | |||
| 1036 | Ga0207679_10149555 | |||
| 1037 | Ga0207667_10241581 | |||
| 1038 | Ga0207712_10342985 | |||
| 1039 | Ga0207668_10164577 | |||
| 1040 | Ga0207639_10108233 | |||
| 1041 | Ga0207678_10075994 | |||
| 1042 | Ga0207708_10000344 | |||
| 1043 | Ga0207702_10047904 | |||
| 1044 | Ga0207648_10006022 | |||
| 1045 | Ga0207674_10010339 | |||
| 1046 | Ga0207674_10041217 | |||
| 1047 | Ga0207675_100026825 | |||
| 1048 | Ga0207683_10009698 | |||
| 1049 | Ga0207698_10040586 | |||
| 1050 | Ga0207698_10152692 | |||
| 1051 | Ga0209813_10008271 | |||
| 1052 | Ga0207428_10070863 | |||
| 1053 | Ga0207428_10096726 | |||
| 1054 | Ga0268266_10003222 | |||
| 1055 | Ga0268266_10168223 | |||
| 1056 | Ga0265337_1000828 | |||
| 1057 | Ga0265319_1014199 | |||
| 1058 | Ga0265334_10001841 | |||
| 1059 | Ga0265318_10028543 | |||
| 1060 | Ga0307517_10005154 | |||
| 1061 | Ga0307517_10052524 | |||
| 1062 | Ga0307515_10000287 | |||
| 1063 | Ga0265338_10001152 | |||
| 1064 | Ga0265338_10001947 | |||
| 1065 | Ga0265324_10009980 | |||
| 1066 | Ga0307511_10054014 | |||
| 1067 | Ga0307511_10107460 | |||
| 1068 | Ga0316177_1202800 | |||
| 1069 | Ga0265332_10002553 | |||
| 1070 | Ga0265325_10016263 | |||
| 1071 | Ga0265327_10001401 | |||
| 1072 | Ga0265316_10036129 | |||
| 1073 | Ga0307509_10018420 | |||
| 1074 | Ga0307509_10181895 | |||
| 1075 | Ga0307408_100047312 | |||
| 1076 | Ga0307408_100052488 | |||
| 1077 | Ga0307408_100087671 | |||
| 1078 | Ga0307408_100159007 | |||
| 1079 | Ga0307508_10003098 | |||
| 1080 | Ga0307508_10005246 | |||
| 1081 | Ga0307508_10030795 | |||
| 1082 | Ga0307508_10104562 | |||
| 1083 | Ga0265314_10042418 | |||
| 1084 | Ga0307405_10043756 | |||
| 1085 | Ga0307405_10200291 | |||
| 1086 | Ga0307413_10031521 | |||
| 1087 | Ga0307413_10078550 | |||
| 1088 | Ga0307518_10073508 | |||
| 1089 | Ga0307518_10086335 | |||
| 1090 | Ga0307410_10015810 | |||
| 1091 | Ga0307410_10137137 | |||
| 1092 | Ga0307410_10161998 | |||
| 1093 | Ga0307410_10242880 | |||
| 1094 | Ga0307406_10057533 | |||
| 1095 | Ga0307406_10255168 | |||
| 1096 | Ga0307407_10009496 | |||
| 1097 | Ga0307407_10028919 | |||
| 1098 | Ga0307412_10023417 | |||
| 1099 | Ga0307412_10066466 | |||
| 1100 | Ga0307412_10089926 | |||
| 1101 | Ga0307412_10116847 | |||
| 1102 | Ga0307412_10172767 | |||
| 1103 | Ga0307409_100011989 | |||
| 1104 | Ga0307409_100072398 | |||
| 1105 | Ga0307409_100077431 | |||
| 1106 | Ga0307409_100154785 | |||
| 1107 | Ga0307409_100186119 | |||
| 1108 | Ga0307416_100051250 | |||
| 1109 | Ga0307416_100110817 | |||
| 1110 | Ga0307416_100156030 | |||
| 1111 | Ga0307416_100173584 | |||
| 1112 | Ga0307416_100269090 | |||
| 1113 | Ga0307416_100433997 | |||
| 1114 | Ga0307414_10085084 | |||
| 1115 | Ga0307414_10129394 | |||
| 1116 | Ga0307411_10064073 | |||
| 1117 | Ga0307415_100065053 | |||
| 1118 | Ga0307415_100156528 | |||
| 1119 | Ga0316585_10047709 | |||
| 1120 | Ga0307507_10011053 | |||
| 1121 | Ga0307507_10012829 | |||
| 1122 | Ga0307510_10033207 | |||
| 1123 | Ga0373941_0018446 | |||
| 1124 | Ga0373954_0004908 | |||
| 1125 | Ga0373956_0003350 | |||
| 1126 | Ga0373956_0008865 | |||
| 1127 | Ga0373957_0020668 | |||
| 1128 | Ga0373942_0000108 | |||
| 1129 | Ga0373962_0001387 | |||
| 1130 | Ga0316574_0086429 | |||
| 1131 | Ga0316574_0152459 | |||
| 1132 | Ga0373935_0146785 | |||
| 1133 | Ga0373933_0044544 | |||
| 1134 | Ga0373937_0069210 | |||
| 1135 | Ga0316584_0113785 | |||
| 1136 | Ga0373925_0000004 | |||
| 1137 | Ga0395899_0000668 | |||
| 1138 | Ga0395899_0189292 | |||
| 1139 | Ga0395900_0028800 | |||
| 1140 | Ga0395900_0031034 | |||
| 1141 | Ga0395900_0031468 | |||
| 1142 | Ga0395900_0056944 | |||
| 1143 | Ga0395900_0204452 | |||
| 1144 | Ga0395900_0301187 | |||
| 1145 | Ga0395898_0002672 | |||
| 1146 | Ga0395898_0002992 | |||
| 1147 | Ga0395898_0008045 | |||
| 1148 | Ga0395898_0008680 | |||
| 1149 | Ga0395898_0009913 | |||
| 1150 | Ga0395898_0012707 | |||
| 1151 | Ga0395898_0019330 | |||
| 1152 | Ga0395898_0037428 | |||
| 1153 | Ga0395898_0092713 | |||
| 1154 | Ga0395898_0240409 | |||
| 1155 | Ga0395905_0051920 | |||
| 1156 | Ga0395905_0072948 | |||
| 1157 | Ga0395905_0085470 | |||
| 1158 | Ga0395905_0354423 | |||
| 1159 | Ga0436364_0002840 | |||
| 1160 | Ga0436364_0183141 | |||
| 1161 | Ga0436364_0222259 | |||
| 1162 | Ga0436364_0464776 | |||
| 1163 | Ga0436364_0585101 | |||
| 1164 | Ga0436364_1115616 | |||
| 1165 | Ga0395901_0011064 | |||
| 1166 | Ga0395901_0030134 | |||
| 1167 | Ga0395901_0059991 | |||
| 1168 | Ga0395901_0285123 | |||
| 1169 | Ga0439436_0032068 | |||
| 1170 | Ga0439436_0045343 | |||
| 1171 | Ga0439466_0013413 | |||
| 1172 | Ga0451793_0113644 | |||
| 1173 | Ga0451793_1224384 | |||
| 1174 | Ga0451843_0286974 | |||
| 1175 | Ga0439433_0020558 | |||
| 1176 | Ga0439442_000330 | |||
| 1177 | Ga0439442_010928 | |||
| 1178 | Ga0439432_015564 | |||
| 1179 | Ga0439432_040014 | |||
| 1180 | Ga0439449_0003551 | |||
| 1181 | Ga0439449_0042080 | |||
| 1182 | Ga0439449_0080337 | |||
| 1183 | Ga0439455_0002123 | |||
| 1184 | Ga0450920_000102 | |||
| 1185 | Ga0450898_004930 | |||
| 1186 | Ga0450903_000028 | |||
| 1187 | Ga0450903_000647 | |||
| 1188 | Ga0450907_000576 | |||
| 1189 | Ga0439458_0000979 | |||
| 1190 | Ga0439458_0002962 | |||
| 1191 | Ga0439434_0000402 | |||
| 1192 | Ga0466969_0011224 | |||
| 1193 | Ga0466969_0017415 | |||
| 1194 | Ga0466969_0123707 | |||
| 1195 | Ga0466972_0003089 | |||
| 1196 | Ga0466972_0007226 | |||
| 1197 | Ga0466972_0008405 | |||
| 1198 | Ga0466972_0012491 | |||
| 1199 | Ga0466972_0049530 | |||
| 1200 | Ga0466972_0055310 | |||
| 1201 | Ga0466972_0064368 | |||
| 1202 | Ga0466965_0003208 | |||
| 1203 | Ga0466965_0006896 | |||
| 1204 | Ga0466965_0010505 | |||
| 1205 | Ga0466965_0042391 | |||
| 1206 | Ga0466965_0077332 | |||
| 1207 | Ga0466965_0112031 | |||
| 1208 | Ga0466966_0003577 | |||
| 1209 | Ga0466966_0007841 | |||
| 1210 | Ga0466966_0079869 | |||
| 1211 | Ga0466961_0010767 | |||
| 1212 | Ga0466961_0028768 | |||
| 1213 | Ga0466961_0097790 | |||
| 1214 | Ga0466963_0000184 | |||
| 1215 | Ga0466963_0003961 | |||
| 1216 | Ga0466963_0010203 | |||
| 1217 | Ga0466963_0031675 | |||
| 1218 | Ga0466963_0076410 | |||
| 1219 | Ga0466963_0110757 | |||
| 1220 | Ga0466963_0128402 | |||
| 1221 | Ga0466964_0018115 | |||
| 1222 | Ga0466964_0030623 | |||
| 1223 | Ga0466964_0049739 | |||
| 1224 | Ga0466971_0001168 | |||
| 1225 | Ga0466971_0069692 | |||
| 1226 | Ga0466970_0000851 | |||
| 1227 | Ga0466970_0002860 | |||
| 1228 | Ga0466970_0004846 | |||
| 1229 | Ga0466970_0005429 | |||
| 1230 | Ga0466970_0014964 | |||
| 1231 | Ga0466957_0000319 | |||
| 1232 | Ga0466957_0000619 | |||
| 1233 | Ga0466957_0075853 | |||
| 1234 | Ga0466957_0083109 | |||
| 1235 | Ga0466957_0122446 | |||
| 1236 | Ga0466957_0141812 | |||
| 1237 | Ga0466957_0260027 | |||
| 1238 | Ga0466960_0001604 | |||
| 1239 | Ga0466960_0032721 | |||
| 1240 | Ga0466960_0134883 | |||
| 1241 | Ga0466959_0001973 | |||
| 1242 | Ga0466959_0009364 | |||
| 1243 | Ga0451576_0353671 | |||
| 1244 | Ga0466958_0003638 | |||
| 1245 | Ga0466958_0008106 | |||
| 1246 | Ga0466967_0007656 | |||
| 1247 | Ga0466967_0019492 | |||
| 1248 | Ga0466967_0028997 | |||
| 1249 | Ga0466967_0029602 | |||
| 1250 | Ga0466967_0046771 | |||
| 1251 | Ga0466967_0107658 | |||
| 1252 | Ga0466967_0118121 | |||
| 1253 | Ga0466967_0121371 | |||
| 1254 | Ga0466967_0260110 | |||
| 1255 | Ga0466967_0500965 | |||
| 1256 | Ga0495592_0046729 | |||
| 1257 | Ga0495592_0064333 | |||
| 1258 | Ga0495603_0001380 | |||
| 1259 | Ga0495603_0006721 | |||
| 1260 | Ga0495603_0058514 | |||
| 1261 | Ga0495629_0034568 | |||
| 1262 | Ga0495629_0038087 | |||
| 1263 | Ga0495629_0075487 | |||
| 1264 | Ga0495629_0112167 | |||
| 1265 | Ga0495638_0011228 | |||
| 1266 | Ga0495641_0016892 | |||
| 1267 | Ga0495651_0007765 | |||
| 1268 | Ga0495651_0029494 | |||
| 1269 | Ga0495651_0040506 | |||
| 1270 | Ga0495653_0016899 | |||
| 1271 | Ga0495653_0104355 | |||
| 1272 | Ga0495580_0021310 | |||
| 1273 | Ga0495580_0078546 | |||
| 1274 | Ga0495580_0082867 | |||
| 1275 | Ga0495582_0080992 | |||
| 1276 | Ga0495582_0161229 | |||
| 1277 | Ga0495582_0170100 | |||
| 1278 | Ga0495639_0003396 | |||
| 1279 | Ga0495639_0011717 | |||
| 1280 | Ga0495662_0004479 | |||
| 1281 | Ga0495662_0031498 | |||
| 1282 | Ga0495664_0003161 | |||
| 1283 | Ga0495664_0065570 | |||
| 1284 | Ga0495594_0007265 | |||
| 1285 | Ga0495594_0008965 | |||
| 1286 | Ga0495608_0076166 | |||
| 1287 | Ga0495618_0015750 | |||
| 1288 | Ga0495618_0016080 | |||
| 1289 | Ga0495618_0038398 | |||
| 1290 | Ga0495618_0080568 | |||
| 1291 | Ga0495618_0084929 | |||
| 1292 | Ga0495628_0005874 | |||
| 1293 | Ga0495628_0193677 | |||
| 1294 | Ga0495630_0317016 | |||
| 1295 | Ga0495632_0025972 | |||
| 1296 | Ga0495643_0001312 | |||
| 1297 | Ga0495643_0089955 | |||
| 1298 | Ga0495666_0067295 | |||
| 1299 | Ga0495652_0001220 | |||
| 1300 | Ga0495652_0038810 | |||
| 1301 | Ga0495652_0063915 | |||
| 1302 | Ga0495652_0092796 | |||
| 1303 | Ga0495652_0110001 | |||
| 1304 | Ga0495665_0005843 | |||
| 1305 | Ga0495640_0022618 | |||
| 1306 | Ga0495640_0187365 | |||
| 1307 | Ga0495640_0211027 | |||
| 1308 | Ga0495586_0005357 | |||
| 1309 | Ga0495586_0039720 | |||
| 1310 | Ga0495586_0044726 | |||
| 1311 | Ga0495587_0000780 | |||
| 1312 | Ga0495587_0005283 | |||
| 1313 | Ga0495645_0000625 | |||
| 1314 | Ga0495645_0007448 | |||
| 1315 | Ga0495645_0019749 | |||
| 1316 | Ga0495645_0131956 | |||
| 1317 | Ga0495622_0028337 | |||
| 1318 | Ga0495633_0047948 | |||
| 1319 | Ga0495667_0000589 | |||
| 1320 | Ga0495667_0142705 | |||
| 1321 | Ga0495668_0001241 | |||
| 1322 | Ga0495634_0001298 | |||
| 1323 | Ga0495634_0088696 | |||
| 1324 | Ga0495634_0089815 | |||
| 1325 | Ga0495625_0000674 | |||
| 1326 | Ga0495625_0085072 | |||
| 1327 | Ga0495588_0010943 | |||
| 1328 | Ga0495588_0013960 | |||
| 1329 | Ga0495588_0014212 | |||
| 1330 | Ga0495588_0017061 | |||
| 1331 | Ga0495588_0018780 | |||
| 1332 | Ga0495588_0049457 | |||
| 1333 | Ga0495588_0071085 | |||
| 1334 | Ga0495588_0122359 | |||
| 1335 | Ga0495657_0001313 | |||
| 1336 | Ga0495657_0004127 | |||
| 1337 | Ga0495657_0005398 | |||
| 1338 | Ga0495657_0068617 | |||
| 1339 | Ga0495657_0098509 | |||
| 1340 | Ga0495599_0011242 | |||
| 1341 | Ga0495623_0053416 | |||
| 1342 | Ga0495623_0153427 | |||
| 1343 | Ga0495646_0030674 | |||
| 1344 | Ga0495646_0039162 | |||
| 1345 | Ga0495646_0052294 | |||
| 1346 | Ga0495646_0135158 | |||
| 1347 | Ga0495613_0008680 | |||
| 1348 | Ga0495613_0023725 | |||
| 1349 | Ga0495613_0031068 | |||
| 1350 | Ga0495613_0035144 | |||
| 1351 | Ga0495613_0035325 | |||
| 1352 | Ga0495613_0077140 | |||
| 1353 | Ga0495613_0095102 | |||
| 1354 | Ga0495624_0043285 | |||
| 1355 | Ga0495624_0089901 | |||
| 1356 | Ga0495624_0118044 | |||
| 1357 | Ga0495670_0036016 | |||
| 1358 | Ga0495671_0009657 | |||
| 1359 | Ga0495589_0026136 | |||
| 1360 | Ga0495589_0043533 | |||
| 1361 | Ga0495589_0059684 | |||
| 1362 | Ga0495589_0072677 | |||
| 1363 | Ga0495600_0015055 | |||
| 1364 | Ga0495600_0030554 | |||
| 1365 | Ga0495600_0088524 | |||
| 1366 | Ga0495581_0000180 | |||
| 1367 | Ga0495581_0013508 | |||
| 1368 | Ga0495581_0023426 | |||
| 1369 | Ga0495581_0033623 | |||
| 1370 | Ga0495581_0054559 | |||
| 1371 | Ga0495581_0060634 | |||
| 1372 | Ga0495581_0100037 | |||
| 1373 | Ga0495581_0118027 | |||
| 1374 | Ga0495581_0191761 | |||
| 1375 | Ga0495604_0003847 | |||
| 1376 | Ga0495604_0010094 | |||
| 1377 | Ga0495604_0093799 | |||
| 1378 | Ga0495636_0001028 | |||
| 1379 | Ga0495636_0003017 | |||
| 1380 | Ga0495636_0003187 | |||
| 1381 | Ga0495636_0004267 | |||
| 1382 | Ga0495636_0026343 | |||
| 1383 | Ga0495674_0097949 | |||
| 1384 | Ga0495676_0009557 | |||
| 1385 | Ga0495676_0017172 | |||
| 1386 | Ga0495676_0109818 | |||
| 1387 | Ga0495676_0167406 | |||
| 1388 | Ga0495680_0004071 | |||
| 1389 | Ga0495680_0030897 | |||
| 1390 | Ga0495687_003646 | |||
| 1391 | Ga0495687_009699 | |||
| 1392 | Ga0495687_013800 | |||
| 1393 | Ga0495675_0017025 | |||
| 1394 | Ga0495675_0089173 | |||
| 1395 | Ga0495675_0100744 | |||
| 1396 | Ga0495675_0137607 | |||
| 1397 | Ga0495685_000217 | |||
| 1398 | Ga0495685_000379 | |||
| 1399 | Ga0495685_004594 | |||
| 1400 | Ga0495685_008255 | |||
| 1401 | Ga0495685_021565 | |||
| 1402 | Ga0495681_0000539 | |||
| 1403 | Ga0495684_0061052 | |||
| 1404 | Ga0495593_0006519 | |||
| 1405 | Ga0495593_0007619 | |||
| 1406 | Ga0495593_0025856 | |||
| 1407 | Ga0495593_0038476 | |||
| 1408 | Ga0495602_0077445 | |||
| 1409 | Ga0495614_0005289 | |||
| 1410 | Ga0495614_0005327 | |||
| 1411 | Ga0495614_0022556 | |||
| 1412 | Ga0495614_0081593 | |||
| 1413 | Ga0495626_0000930 | |||
| 1414 | Ga0496100_0168919 | |||
| 1415 | Ga0496101_0021141 | |||
| 1416 | Ga0496101_0097312 | |||
| 1417 | Ga0496101_0312280 | |||
| 1418 | Ga0496102_0003332 | |||
| 1419 | Ga0496102_0031780 | |||
| 1420 | Ga0496102_0040238 | |||
| 1421 | Ga0496102_0173650 | |||
| 1422 | Ga0496102_0333936 | |||
| 1423 | Ga0496103_0039094 | |||
| 1424 | Ga0496104_0038820 | |||
| 1425 | Ga0496104_0257633 | |||
| 1426 | Ga0496106_0071584 | |||
| 1427 | Ga0496106_0073226 | |||
| 1428 | Ga0496106_0109089 | |||
| 1429 | Ga0496107_0111213 | |||
| 1430 | Ga0496108_0059332 | |||
| 1431 | Ga0496108_0118726 | |||
| 1432 | Ga0496108_0138358 | |||
| 1433 | Ga0496108_0150889 | |||
| 1434 | Ga0496108_0250406 | |||
| 1435 | Ga0496109_0010492 | |||
| 1436 | Ga0496109_0012909 | |||
| 1437 | Ga0496109_0063641 | |||
| 1438 | Ga0496109_0091864 | |||
| 1439 | Ga0496110_0015615 | |||
| 1440 | Ga0496110_0350854 | |||
| 1441 | Ga0496111_0109993 | |||
| 1442 | Ga0496111_0189592 | |||
| 1443 | Ga0496111_0370464 | |||
| 1444 | Ga0496112_0010348 | |||
| 1445 | Ga0496112_0023592 | |||
| 1446 | Ga0496112_0150097 | |||
| 1447 | Ga0496112_0321906 | |||
| 1448 | Ga0496113_0042260 | |||
| 1449 | Ga0496113_0118312 | |||
| 1450 | Ga0496114_0000523 | |||
| 1451 | Ga0496114_0016774 | |||
| 1452 | Ga0496114_0149008 | |||
| 1453 | Ga0496114_0172838 | |||
| 1454 | Ga0496114_0272719 | |||
| 1455 | Ga0496115_0009426 | |||
| 1456 | Ga0496124_0081618 | |||
| 1457 | Ga0496124_0163388 | |||
| 1458 | Ga0496126_0014945 | |||
| 1459 | Ga0496126_0347198 | |||
| 1460 | Ga0501317_008913 | |||
| 1461 | Ga0501318_001910 | |||
| 1462 | Ga0501318_002651 | |||
| 1463 | Ga0501032_0009671 | |||
| 1464 | Ga0501032_0045906 | |||
| 1465 | Ga0501032_0050144 | |||
| 1466 | Ga0501032_0090277 | |||
| 1467 | Ga0501032_0127279 | |||
| 1468 | Ga0501033_0002155 | |||
| 1469 | Ga0501033_0016026 | |||
| 1470 | Ga0501034_0006642 | |||
| 1471 | Ga0501034_0017406 | |||
| 1472 | Ga0501034_0042464 | |||
| 1473 | Ga0501034_0051344 | |||
| 1474 | Ga0501034_0221030 | |||
| 1475 | Ga0501036_0000774 | |||
| 1476 | Ga0501036_0003007 | |||
| 1477 | Ga0501036_0005567 | |||
| 1478 | Ga0501036_0008555 | |||
| 1479 | Ga0501036_0069750 | |||
| 1480 | Ga0501036_0087052 | |||
| 1481 | Ga0501036_0287098 | |||
| 1482 | Ga0501037_0007927 | |||
| 1483 | Ga0501037_0011721 | |||
| 1484 | Ga0501037_0178807 | |||
| 1485 | Ga0501037_0231453 | |||
| 1486 | Ga0501038_0001037 | |||
| 1487 | Ga0501038_0002536 | |||
| 1488 | Ga0501038_0018586 | |||
| 1489 | Ga0501038_0089268 | |||
| 1490 | Ga0501038_0166775 | |||
| 1491 | Ga0501038_0206621 | |||
| 1492 | Ga0501038_0409832 | |||
| 1493 | Ga0501039_0061924 | |||
| 1494 | Ga0501042_0003369 | |||
| 1495 | Ga0501042_0074685 | |||
| 1496 | Ga0501043_0002134 | |||
| 1497 | Ga0501043_0002303 | |||
| 1498 | Ga0501043_0022882 | |||
| 1499 | Ga0501043_0053435 | |||
| 1500 | Ga0501046_0064418 | |||
| 1501 | Ga0501047_0030168 | |||
| 1502 | Ga0501047_0054229 | |||
| 1503 | Ga0501067_0012919 | |||
| 1504 | Ga0501068_0021266 | |||
| 1505 | Ga0501070_0000581 | |||
| 1506 | Ga0501070_0001853 | |||
| 1507 | Ga0501070_0002822 | |||
| 1508 | Ga0501070_0010509 | |||
| 1509 | Ga0501070_0025748 | |||
| 1510 | Ga0501070_0114748 | |||
| 1511 | Ga0501070_0134279 | |||
| 1512 | Ga0501070_0328109 | |||
| 1513 | Ga0501071_0253090 | |||
| 1514 | Ga0501073_0143765 | |||
| 1515 | Ga0501074_0000701 | |||
| 1516 | Ga0501074_0006411 | |||
| 1517 | Ga0501074_0008606 | |||
| 1518 | Ga0501074_0064424 | |||
| 1519 | Ga0501074_0133091 | |||
| 1520 | Ga0501076_0168883 | |||
| 1521 | Ga0501077_0116703 | |||
| 1522 | Ga0501079_0000273 | |||
| 1523 | Ga0501080_0001250 | |||
| 1524 | Ga0501080_0040138 | |||
| 1525 | Ga0501080_0069805 | |||
| 1526 | Ga0501080_0120778 | |||
| 1527 | Ga0501080_0387650 | |||
| 1528 | Ga0501035_0001796 | |||
| 1529 | Ga0501035_0189363 | |||
| 1530 | Ga0501035_0202195 | |||
| 1531 | Ga0501044_0005003 | |||
| 1532 | Ga0501044_0065849 | |||
| 1533 | Ga0501044_0122235 | |||
| 1534 | Ga0501044_0147342 | |||
| 1535 | Ga0501044_0160030 | |||
| 1536 | Ga0501045_0042782 | |||
| 1537 | Ga0501045_0055560 | |||
| 1538 | nmdc:mga03n38_96907_c1 | |||
| 1539 | nmdc:mga00v17_125686_c1 | |||
| 1540 | nmdc:mga0yw44_114454_c1 | |||
| 1541 | nmdc:mga0yw44_185289_c1 | |||
| 1542 | nmdc:mga0yw44_276917_c1 | |||
| 1543 | nmdc:mga04h51_1007_c1 | |||
| 1544 | nmdc:mga05p37_384066_c1 | |||
| 1545 | nmdc:mga0qj67_38538_c1 | |||
| 1546 | Ga0495601_0001056 | |||
| 1547 | Ga0495612_0064966 | |||
| 1548 | Ga0495612_0070362 | |||
| 1549 | Ga0495655_0004320 | |||
| 1550 | Ga0495619_0045273 | |||
| 1551 | Ga0500578_0119065 | |||
| 1552 | Ga0500553_096763 | |||
| 1553 | Ga0500652_035224 | |||
| 1554 | Ga0500561_0010182 | |||
| 1555 | Ga0500568_0000053 | |||
| 1556 | Ga0500573_0077316 | |||
| 1557 | Ga0500600_0062325 | |||
| 1558 | Ga0500616_0003791 | |||
| 1559 | Ga0500616_0024724 | |||
| 1560 | Ga0500633_0034499 | |||
| 1561 | Ga0500634_0021094 | |||
| 1562 | Ga0501084_0000052 | |||
| 1563 | Ga0501084_0049504 | |||
| 1564 | Ga0587067_019276 | |||
| 1565 | Ga0501082_0153936 | |||
| 1566 | Ga0466962_0000181 | |||
| 1567 | Ga0466962_0000902 | |||
| 1568 | 2808849987 | |||
| 1569 | 2554260255 | |||
| 1570 | 2585297731 | |||
| 1571 | 2585303219 | |||
| 1572 | 2585309639 | |||
| 1573 | 2616693827 | |||
| 1574 | 2623497907 | |||
| 1575 | 2643890166 | |||
| 1576 | 2643890794 | |||
| 1577 | 2643946368 | |||
| 1578 | 2643959222 | |||
| 1579 | 2643959850 | |||
| 1580 | 2644033513 | |||
| 1581 | 2644178381 | |||
| 1582 | 2644262131 | |||
| 1583 | 2644264335 | |||
| 1584 | 2644389285 | |||
| 1585 | 2644434172 | |||
| 1586 | 2644440570 | |||
| 1587 | 2644446894 | |||
| 1588 | 2644627719 | |||
| 1589 | 2644627741 | |||
| 1590 | 2671835278 | |||
| 1591 | 2676484594 | |||
| 1592 | 2691512194 | |||
| 1593 | 2738870082 | |||
| 1594 | 2744954341 | |||
| 1595 | 2753072146 | |||
| 1596 | 2768645204 | |||
| 1597 | 2772647346 | |||
| 1598 | 2774395389 | |||
| 1599 | 2774853434 | |||
| 1600 | 2775655777 | |||
| 1601 | 2775657517 | |||
| 1602 | 2776374812 | |||
| 1603 | 2785346535 | |||
| 1604 | 2785366824 | |||
| 1605 | 2785374045 | |||
| 1606 | 2786667870 | |||
| 1607 | 2786674284 | |||
| 1608 | 2791909865 | |||
| 1609 | 2793977590 | |||
| 1610 | 2795781678 | |||
| 1611 | 2808828722 | |||
| 1612 | 2808845761 | |||
| 1613 | 2808877451 | |||
| 1614 | 2808893716 | |||
| 1615 | 2808898930 | |||
| 1616 | 2808915609 | |||
| 1617 | 2808917880 | |||
| 1618 | 2810363884 | |||
| 1619 | 2811842709 | |||
| 1620 | 2812319551 | |||
| 1621 | 2812321407 | |||
| 1622 | 2812330079 | |||
| 1623 | 2812348510 | |||
| 1624 | 2819743467 | |||
| 1625 | 2844851774 | |||
| 1626 | 2855673297 | |||
| 1627 | 2855681094 | |||
| 1628 | 2856745207 | |||
| 1629 | 2857293511 | |||
| 1630 | 2857743392 | |||
| 1631 | 2858851318 | |||
| 1632 | 2858887572 | |||
| 1633 | 2858892690 | |||
| 1634 | 2861528235 | |||
| 1635 | 2862180493 | |||
| 1636 | 2862282602 | |||
| 1637 | 2862283804 | |||
| 1638 | 2862292886 | |||
| 1639 | 2862390607 | |||
| 1640 | 2862574974 | |||
| 1641 | 2863071955 | |||
| 1642 | 2863410843 | |||
| 1643 | 2866554457 | |||
| 1644 | 2867347660 | |||
| 1645 | 2867432053 | |||
| 1646 | 2867438000 | |||
| 1647 | 2867479539 | |||
| 1648 | 2867507198 | |||
| 1649 | 2869049405 | |||
| 1650 | 2869066982 | |||
| 1651 | 2869070139 | |||
| 1652 | 2873152277 | |||
| 1653 | 2873157777 | |||
| 1654 | 2873321940 | |||
| 1655 | 2877677224 | |||
| 1656 | 2877683722 | |||
| 1657 | 2880500726 | |||
| 1658 | 2884695133 | |||
| 1659 | 2891328823 | |||
| 1660 | 2891404343 | |||
| 1661 | 2891567117 | |||
| 1662 | 2893686684 | |||
| 1663 | 2895446185 | |||
| 1664 | 2904498038 | |||
| 1665 | 2904777396 | |||
| 1666 | 2905926853 | |||
| 1667 | 2905930110 | |||
| 1668 | 2910813425 | |||
| 1669 | 2912723859 | |||
| 1670 | 2912759071 | |||
| 1671 | 2919034768 | |||
| 1672 | 2919054090 | |||
| 1673 | 2919054380 | |||
| 1674 | 2919062086 | |||
| 1675 | 2919448236 | |||
| 1676 | 2919470640 | |||
| 1677 | 2919540233 | |||
| 1678 | 2920880117 | |||
| 1679 | 2920882157 | |||
| 1680 | 2929229238 | |||
| 1681 | 2932428063 | |||
| 1682 | 2933421420 | |||
| 1683 | 2939598227 | |||
| 1684 | 2939601131 | |||
| 1685 | 2939647544 | |||
| 1686 | 2939675472 | |||
| 1687 | 2945917297 | |||
| 1688 | 2945923257 | |||
| 1689 | 2945941349 | |||
| 1690 | 2945960860 | |||
| 1691 | 2945960892 | |||
| 1692 | 2946004296 | |||
| 1693 | 2946024612 | |||
| 1694 | 2946041028 | |||
| 1695 | 2946045892 | |||
| 1696 | 2946061137 | |||
| 1697 | 2946079601 | |||
| 1698 | 2947224854 | |||
| 1699 | 2954002260 | |||
| 1700 | 2954003464 | |||
| 1701 | 2954381950 | |||
| 1702 | 2954389016 | |||
| 1703 | 2954674010 | |||
| 1704 | 2954681127 | |||
| 1705 | 2954683030 | |||
| 1706 | 2954689978 | |||
| 1707 | 2954699755 | |||
| 1708 | 2954712408 | |||
| 1709 | 2954718695 | |||
| 1710 | 2954722356 | |||
| 1711 | 2954728666 | |||
| 1712 | 2954733146 | |||
| 1713 | 2954739495 | |||
| 1714 | 2954741242 | |||
| 1715 | 2954747562 | |||
| 1716 | 2954752026 | |||
| 1717 | 2954758322 | |||
| 1718 | 2954760253 | |||
| 1719 | 2954766679 | |||
| 1720 | 2964328358 | |||
| 1721 | 2974305284 | |||
| 1722 | 2984577372 | |||
| 1723 | 2990064633 | |||
| 1724 | 2990259533 | |||
| 1725 | 2995727388 | |||
| 1726 | 2997456493 | |||
| 1727 | 2997600332 | |||
| 1728 | 3006328171 | |||
| 1729 | 3006428785 | |||
| 1730 | 3006491147 | |||
| 1731 | 3006494953 | |||
| 1732 | 8002788839 | |||
| 1733 | 8004029050 | |||
| 1734 | 8008564971 | |||
| 1735 | 8047716635 | |||
| 1736 | 8047898023 | |||
| 1737 | 8048360870 | |||
| 1738 | 8048374986 | |||
| 1739 | 8048383220 | |||
| 1740 | 8054109925 | |||
| 1741 | 8054162770 | |||
| 1742 | 8054706131 | |||
| 1743 | 8054730363 | |||
| 1744 | 8054738167 | |||
| 1745 | 8055071441 | |||
| 1746 | 8055159771 | |||
| 1747 | 8055174947 | |||
| 1748 | 8055417823 | |||
| 1749 | 8056211410 | |||
| 1750 | 8056673323 | |||
| 1751 | 8056830730 | |||
| 1752 | 8056834826 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1axg-assembly2.cif.gz_D | crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution | 0.9403 | 2 | 331 |
| 1htb-assembly1.cif.gz_B | crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c | 0.94 | 2 | 331 |
| 1p0f-assembly1.cif.gz_B | crystal structure of the binary complex: nadp(h)-dependent vertebrate alcohol dehydrogenase (adh8) with the cofactor nadp | 0.9379 | 2 | 331 |
| 1hdy-assembly1.cif.gz_B | three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences | 0.9376 | 2 | 331 |
| 1qv7-assembly1.cif.gz_B | horse liver alcohol dehydrogenase his51gln/lys228arg mutant complexed with nad+ and 2,3-difluorobenzyl alcohol | 0.9372 | 2 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53533_167_304_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9836 | 165 | 274 | 3.90.180.10 |
| af_B4G1G0_229_356_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.951 | 173 | 267 | 3.40.50.720 |
| 5tnxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9299 | 165 | 273 | 3.40.50.720 |
| af_A1L4Y2_14_383_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9115 | 9 | 325 | 3.90.180.10 |
| 4ejmA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9092 | 170 | 274 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L7FHX7-F1-model_v4 | Mycothiol-dependent formaldehyde dehydrogenase (EC 1.1.1.306) | 0.9891 | 1 | 331 |
GO:0008270
GO:0050607 |
| AF-A0A250V640-F1-model_v4 | Oxidoreductase | 0.9874 | 1 | 331 |
GO:0008270
GO:0016491 |
| AF-A0A6B3HDC4-F1-model_v4 | Zinc-binding dehydrogenase | 0.9864 | 178 | 304 |
|
| AF-L7FHX7-F1-model_v4 | Mycothiol-dependent formaldehyde dehydrogenase (EC 1.1.1.306) | 0.9861 | 1 | 331 |
GO:0008270
GO:0050607 |
| AF-A0A250V640-F1-model_v4 | Oxidoreductase | 0.9845 | 1 | 331 |
GO:0008270
GO:0016491 |