F484347

General Info

Members Datasets Scaffolds Average Seq Length
876 466 777 306

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10027115|JGI24735J21928_100271152
Length 333
Sequence MAGLVPAIHASIRGEGRASNAEGGCVSFPDITPELRAAMPALRGRLLANQSLAELTWFRVGGPAQVLFTPADAEDLAYFLGHLSSHIPIYVLGVGSNLIVRDGGLEGVAIRLSPRGFGEVTADGDVLTAGAAALDRRVAEAAEGFRLGGLEFYFGIPGTIGGALRMNAGANGSETKDVLIEAEGVGRDGSRHRLSLADMKFTYRNSXVDSSIIFTRARFRGRHNPPEAIRARMNEVQSHRETAQPIREKTGGSTFKNPPGHSAWKLIDVAGCRGLRIGGAQVSEMHCNFLINTGDASAHDIETLGETVRERVKAHSGIELQWEIKRIGQGGET

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
12 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
13 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2643221651 Afipia sp. Root123D2 Isolate Unclassified
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
20 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
21 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
26 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
27 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
28 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
29 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
30 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
31 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
32 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
33 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
34 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
35 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
36 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
37 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
38 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
39 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
40 2904699407
41 2906610324
42 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
43 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
44 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
45 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
46 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
47 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
48 2922368715
49 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
50 2922425934
51 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
52 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
53 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
54 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
55 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
56 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
57 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
58 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
59 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
60 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
61 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
62 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
63 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
64 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
65 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
66 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
67 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
68 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
69 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
70 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
71 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
72 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
73 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
74 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
75 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
76 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
77 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
78 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
79 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
80 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
81 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
82 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
83 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
84 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
85 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
86 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
87 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
88 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
89 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
90 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
93 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
94 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
103 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
104 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
105 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
106 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
130 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
135 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
136 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
137 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
149 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
219 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
220 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
271 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
409 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
410 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
413 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
414 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
415 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
416 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
421 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
422 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
423 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
426 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
427 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
428 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
429 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
430 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
431 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
432 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
433 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
434 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
435 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
438 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
439 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
440 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
441 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
442 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
443 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
444 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
445 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
446 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
447 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
448 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
449 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
450 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
451 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
452 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
455 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
456 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
457 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
458 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
459 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
460 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
461 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
462 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
463 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
464 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
465 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
466 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.99
Metatranscriptomes 0.11
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 9.25
Rhizoplane 6.05
Rhizosphere 64.38
Stem 0
Stem Tuber 0
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002709 3300001979 Bacteria 7951
2 JGI24735J21928_10027115 3300002067 Bacteria 1718
3 JGI25406J46586_10000580 3300003203 Bacteria 17278
4 JGI25406J46586_10003218 3300003203 Bacteria 7680
5 JGI25153J46596_10026817 3300003215 Bacteria 2031
6 Ga0065165_1004626 3300005262 Bacteria 8358
7 Ga0070658_10345549 3300005327 Bacteria 1273
8 Ga0070676_10075380 3300005328 Bacteria 2034
9 Ga0070680_100035140 3300005336 Bacteria 4045
10 Ga0068868_100222858 3300005338 Bacteria 1579
11 Ga0070661_100073464 3300005344 Bacteria 2518
12 Ga0070668_100013894 3300005347 Bacteria 6021
13 Ga0070668_100124046 3300005347 Bacteria 2067
14 Ga0070669_100097454 3300005353 Bacteria 2213
15 Ga0070675_100136583 3300005354 Bacteria 2093
16 Ga0070667_100002825 3300005367 Bacteria 14992
17 Ga0070667_100232022 3300005367 Bacteria 1646
18 Ga0070709_10001417 3300005434 Bacteria 12994
19 Ga0070709_10007249 3300005434 Bacteria 6077
20 Ga0070709_10074270 3300005434 Bacteria 2203
21 Ga0070709_10078605 3300005434 Bacteria 2147
22 Ga0070714_100000678 3300005435 Bacteria 24075
23 Ga0070714_100018262 3300005435 Bacteria 5694
24 Ga0070714_100048804 3300005435 Bacteria 3601
25 Ga0070714_100073222 3300005435 Bacteria 2968
26 Ga0070714_100143902 3300005435 Bacteria 2143
27 Ga0070714_100537798 3300005435 Bacteria 1117
28 Ga0070713_100022313 3300005436 Bacteria 4890
29 Ga0070713_100094802 3300005436 Bacteria 2574
30 Ga0070713_100193256 3300005436 Bacteria 1835
31 Ga0070713_100441823 3300005436 Bacteria 1220
32 Ga0070710_10000633 3300005437 Bacteria 16752
33 Ga0070710_10002407 3300005437 Bacteria 8862
34 Ga0070711_100001478 3300005439 Bacteria 12909
35 Ga0070711_100002216 3300005439 Bacteria 11029
36 Ga0070711_100011186 3300005439 Bacteria 5564
37 Ga0070711_100027775 3300005439 Bacteria 3718
38 Ga0070711_100063136 3300005439 Bacteria 2584
39 Ga0070711_100242665 3300005439 Bacteria 1409
40 Ga0070663_100047179 3300005455 Bacteria 3051
41 Ga0070663_100062516 3300005455 Bacteria 2684
42 Ga0070663_100149106 3300005455 Bacteria 1792
43 Ga0070662_100126252 3300005457 Bacteria 1967
44 Ga0070662_100301890 3300005457 Bacteria 1301
45 Ga0070679_100024858 3300005530 Bacteria 5870
46 Ga0070679_100128043 3300005530 Bacteria 2520
47 Ga0070684_100005206 3300005535 Bacteria 9945
48 Ga0070684_100287733 3300005535 Bacteria 1506
49 Ga0070684_100300141 3300005535 Bacteria 1474
50 Ga0068853_100010311 3300005539 Bacteria 7556
51 Ga0068853_100020454 3300005539 Bacteria 5504
52 Ga0068853_100038556 3300005539 Bacteria 4071
53 Ga0070693_100191171 3300005547 Bacteria 1324
54 Ga0070665_100002023 3300005548 Bacteria 22800
55 Ga0070665_100028235 3300005548 Bacteria 5651
56 Ga0068855_100038269 3300005563 Bacteria 5699
57 Ga0068855_100049698 3300005563 Bacteria 4944
58 Ga0068855_100061366 3300005563 Bacteria 4393
59 Ga0068855_100079756 3300005563 Bacteria 3796
60 Ga0068855_100436494 3300005563 Bacteria 1431
61 Ga0068857_100012881 3300005577 Bacteria 7286
62 Ga0068857_100028021 3300005577 Bacteria 4968
63 Ga0068857_100102380 3300005577 Bacteria 2570
64 Ga0068854_100054912 3300005578 Bacteria 2866
65 Ga0068856_100042057 3300005614 Bacteria 4494
66 Ga0068856_100096425 3300005614 Bacteria 2946
67 Ga0070702_100068321 3300005615 Bacteria 2091
68 Ga0068852_100164733 3300005616 Bacteria 2073
69 Ga0068859_100002355 3300005617 Bacteria 19231
70 Ga0068859_100069977 3300005617 Bacteria 3544
71 Ga0068864_100047790 3300005618 Bacteria 3677
72 Ga0068864_100129816 3300005618 Bacteria 2262
73 Ga0068861_100032076 3300005719 Bacteria 3865
74 Ga0068851_10001608 3300005834 Bacteria 9920
75 Ga0068863_100050347 3300005841 Bacteria 3949
76 Ga0068858_100021103 3300005842 Bacteria 6084
77 Ga0068858_100293748 3300005842 Bacteria 1549
78 Ga0068860_100000254 3300005843 Bacteria 79465
79 Ga0068860_100008657 3300005843 Bacteria 10138
80 Ga0068860_100051464 3300005843 Bacteria 3919
81 Ga0068862_100070303 3300005844 Bacteria 3022
82 Ga0068862_100250986 3300005844 Bacteria 1612
83 Ga0068862_100271018 3300005844 Bacteria 1552
84 Ga0081455_10018234 3300005937 Bacteria 6696
85 Ga0081455_10042135 3300005937 Bacteria 4008
86 Ga0081455_10053511 3300005937 Bacteria 3448
87 Ga0081455_10146067 3300005937 Bacteria 1829
88 Ga0081538_10040034 3300005981 Bacteria 2995
89 Ga0081540_1001143 3300005983 Bacteria 23424
90 Ga0081540_1003272 3300005983 Bacteria 12881
91 Ga0081540_1009836 3300005983 Bacteria 6542
92 Ga0081540_1018033 3300005983 Bacteria 4346
93 Ga0081540_1032645 3300005983 Bacteria 2839
94 Ga0081540_1034529 3300005983 Bacteria 2726
95 Ga0081539_10000191 3300005985 Bacteria 142387
96 Ga0081539_10000321 3300005985 Bacteria 106887
97 Ga0070717_10000355 3300006028 Bacteria 29408
98 Ga0070717_10045372 3300006028 Bacteria 3593
99 Ga0070717_10073801 3300006028 Bacteria 2852
100 Ga0075365_10126376 3300006038 Bacteria 1767
101 Ga0075368_10035510 3300006042 Bacteria 1945
102 Ga0070715_10000078 3300006163 Bacteria 27243
103 Ga0070715_10058855 3300006163 Bacteria 1679
104 Ga0070716_100003281 3300006173 Bacteria 7598
105 Ga0070716_100026542 3300006173 Bacteria 3103
106 Ga0070712_100011086 3300006175 Bacteria 5706
107 Ga0070712_100035217 3300006175 Bacteria 3398
108 Ga0070712_100212976 3300006175 Bacteria 1525
109 Ga0075362_10032986 3300006177 Bacteria 2250
110 Ga0075367_10085301 3300006178 Bacteria 1916
111 Ga0075367_10093767 3300006178 Bacteria 1829
112 Ga0075369_10030560 3300006186 Bacteria 2269
113 Ga0075366_10031599 3300006195 Bacteria 3116
114 Ga0075366_10180883 3300006195 Bacteria 1281
115 Ga0097621_100001594 3300006237 Bacteria 15517
116 Ga0075370_10122191 3300006353 Bacteria 1517
117 Ga0068871_100000187 3300006358 Bacteria 42079
118 Ga0068871_100114894 3300006358 Bacteria 2268
119 Ga0068871_100520825 3300006358 Bacteria 1074
120 Ga0075434_100192327 3300006871 Bacteria 2061
121 Ga0075434_100478919 3300006871 Bacteria 1266
122 Ga0075429_100274420 3300006880 Bacteria 1476
123 Ga0097620_100002355 3300006931 Bacteria 19231
124 Ga0097620_100069979 3300006931 Bacteria 3544
125 Ga0099824_1021336 3300006942 Bacteria 4546
126 Ga0099822_1000022 3300006943 Bacteria 64942
127 Ga0105240_10022325 3300009093 Bacteria 8392
128 Ga0105240_10048232 3300009093 Bacteria 5384
129 Ga0105240_10095268 3300009093 Bacteria 3630
130 Ga0105240_10312007 3300009093 Bacteria 1796
131 Ga0105240_10349464 3300009093 Bacteria 1678
132 Ga0105247_10140225 3300009101 Bacteria 1583
133 Ga0105247_10163988 3300009101 Bacteria 1473
134 Ga0105247_10194057 3300009101 Bacteria 1361
135 Ga0105241_10020915 3300009174 Bacteria 4836
136 Ga0105241_10056932 3300009174 Bacteria 2998
137 Ga0105248_10206743 3300009177 Bacteria 2212
138 Ga0105248_10263515 3300009177 Bacteria 1940
139 Ga0105248_10507073 3300009177 Bacteria 1360
140 Ga0105238_10035119 3300009551 Bacteria 5099
141 Ga0105238_10038148 3300009551 Bacteria 4881
142 Ga0105238_10059830 3300009551 Bacteria 3815
143 Ga0105238_10206407 3300009551 Bacteria 1941
144 Ga0105238_10355522 3300009551 Bacteria 1454
145 Ga0105238_10568854 3300009551 Bacteria 1139
146 Ga0105249_10285302 3300009553 Bacteria 1650
147 Ga0105239_10028113 3300010375 Bacteria 6188
148 Ga0105239_10053854 3300010375 Bacteria 4412
149 Ga0105239_10056278 3300010375 Bacteria 4314
150 Ga0105239_10090525 3300010375 Bacteria 3375
151 Ga0105239_10102158 3300010375 Bacteria 3173
152 Ga0105239_10111939 3300010375 Bacteria 3026
153 Ga0105239_10118056 3300010375 Bacteria 2944
154 Ga0105246_10056010 3300011119 Bacteria 2723
155 Ga0105246_10400177 3300011119 Bacteria 1140
156 Ga0157370_10044147 3300013104 Bacteria 4286
157 Ga0157370_10451017 3300013104 Bacteria 1182
158 Ga0157369_10012925 3300013105 Bacteria 9461
159 Ga0157369_10043079 3300013105 Bacteria 4921
160 Ga0157369_10577027 3300013105 Bacteria 1162
161 Ga0157374_10032938 3300013296 Bacteria 4723
162 Ga0157374_10073258 3300013296 Bacteria 3233
163 Ga0157378_10092926 3300013297 Bacteria 2745
164 Ga0163162_10072401 3300013306 Bacteria 3501
165 Ga0157375_10329304 3300013308 Bacteria 1692
166 Ga0157380_10005003 3300014326 Bacteria 9242
167 Ga0157376_10016873 3300014969 Bacteria 5555
168 Ga0206353_11993804 3300020082 Bacteria 1445
169 Ga0213874_10030551 3300021377 Bacteria 1553
170 Ga0209677_103126 3300025253 Bacteria 5624
171 Ga0209148_1000424 3300025254 Bacteria 47087
172 Ga0209455_1002609 3300025272 Bacteria 6856
173 Ga0209455_1003259 3300025272 Bacteria 5843
174 Ga0209455_1003833 3300025272 Bacteria 5147
175 Ga0209758_1006158 3300025297 Bacteria 8788
176 Ga0209758_1015210 3300025297 Bacteria 4008
177 Ga0209758_1051017 3300025297 Bacteria 1444
178 Ga0207656_10005032 3300025321 Bacteria 4645
179 Ga0207656_10126493 3300025321 Bacteria 1194
180 Ga0207692_10002540 3300025898 Bacteria 7010
181 Ga0207692_10005603 3300025898 Bacteria 5039
182 Ga0207692_10009587 3300025898 Bacteria 4051
183 Ga0207710_10104909 3300025900 Bacteria 1337
184 Ga0207647_10044552 3300025904 Bacteria 2771
185 Ga0207647_10047587 3300025904 Bacteria 2666
186 Ga0207685_10037090 3300025905 Bacteria 1792
187 Ga0207685_10051652 3300025905 Bacteria 1589
188 Ga0207699_10000390 3300025906 Bacteria 22928
189 Ga0207699_10041162 3300025906 Bacteria 2667
190 Ga0207699_10042253 3300025906 Bacteria 2639
191 Ga0207699_10059991 3300025906 Bacteria 2282
192 Ga0207699_10078773 3300025906 Bacteria 2036
193 Ga0207645_10047695 3300025907 Bacteria 2735
194 Ga0207643_10046129 3300025908 Bacteria 2463
195 Ga0207705_10287390 3300025909 Bacteria 1260
196 Ga0207654_10000323 3300025911 Bacteria 28628
197 Ga0207654_10044099 3300025911 Bacteria 2531
198 Ga0207707_10000178 3300025912 Bacteria 66057
199 Ga0207707_10026300 3300025912 Bacteria 5086
200 Ga0207707_10051598 3300025912 Bacteria 3582
201 Ga0207695_10000497 3300025913 Bacteria 83894
202 Ga0207695_10053725 3300025913 Bacteria 4211
203 Ga0207695_10094476 3300025913 Bacteria 2997
204 Ga0207695_10206404 3300025913 Bacteria 1877
205 Ga0207671_10009091 3300025914 Bacteria 8349
206 Ga0207671_10120899 3300025914 Bacteria 2002
207 Ga0207693_10003503 3300025915 Bacteria 13399
208 Ga0207693_10010089 3300025915 Bacteria 7672
209 Ga0207693_10018008 3300025915 Bacteria 5629
210 Ga0207693_10018488 3300025915 Bacteria 5551
211 Ga0207693_10296888 3300025915 Bacteria 1266
212 Ga0207663_10006434 3300025916 Bacteria 6008
213 Ga0207663_10014546 3300025916 Bacteria 4312
214 Ga0207663_10021194 3300025916 Bacteria 3696
215 Ga0207663_10274823 3300025916 Bacteria 1249
216 Ga0207660_10098702 3300025917 Bacteria 2179
217 Ga0207657_10029030 3300025919 Bacteria 5040
218 Ga0207657_10517855 3300025919 Bacteria 934
219 Ga0207652_10019378 3300025921 Bacteria 5594
220 Ga0207652_10055858 3300025921 Bacteria 3397
221 Ga0207652_10212256 3300025921 Bacteria 1743
222 Ga0207652_10520426 3300025921 Bacteria 1070
223 Ga0207681_10012277 3300025923 Bacteria 5283
224 Ga0207681_10063702 3300025923 Bacteria 2543
225 Ga0207681_10224707 3300025923 Bacteria 1454
226 Ga0207694_10000212 3300025924 Bacteria 56506
227 Ga0207694_10324074 3300025924 Bacteria 1272
228 Ga0207650_10110677 3300025925 Bacteria 2125
229 Ga0207650_10459274 3300025925 Bacteria 1061
230 Ga0207687_10146388 3300025927 Bacteria 1798
231 Ga0207700_10012153 3300025928 Bacteria 5537
232 Ga0207700_10021574 3300025928 Bacteria 4401
233 Ga0207700_10031891 3300025928 Bacteria 3750
234 Ga0207700_10158137 3300025928 Bacteria 1880
235 Ga0207700_10164177 3300025928 Bacteria 1847
236 Ga0207664_10148771 3300025929 Bacteria 1988
237 Ga0207644_10292129 3300025931 Bacteria 1311
238 Ga0207690_10125891 3300025932 Bacteria 1868
239 Ga0207690_10345078 3300025932 Bacteria 1176
240 Ga0207709_10045101 3300025935 Bacteria 2668
241 Ga0207665_10000361 3300025939 Bacteria 31561
242 Ga0207665_10132205 3300025939 Bacteria 1773
243 Ga0207665_10252552 3300025939 Bacteria 1303
244 Ga0207711_10071760 3300025941 Bacteria 3005
245 Ga0207711_10380882 3300025941 Bacteria 1309
246 Ga0207689_10192800 3300025942 Bacteria 1681
247 Ga0207661_10004270 3300025944 Bacteria 10004
248 Ga0207661_10354884 3300025944 Bacteria 1323
249 Ga0207679_10005298 3300025945 Bacteria 8091
250 Ga0207679_10082436 3300025945 Bacteria 2462
251 Ga0207679_10439769 3300025945 Bacteria 1155
252 Ga0207667_10037608 3300025949 Bacteria 5172
253 Ga0207667_10047369 3300025949 Bacteria 4550
254 Ga0207651_10037284 3300025960 Bacteria 3184
255 Ga0207668_10001774 3300025972 Bacteria 12598
256 Ga0207668_10076711 3300025972 Bacteria 2407
257 Ga0207668_10086130 3300025972 Bacteria 2294
258 Ga0207640_10016944 3300025981 Bacteria 4251
259 Ga0207640_10085163 3300025981 Bacteria 2173
260 Ga0207703_10126978 3300026035 Bacteria 2197
261 Ga0207639_10002809 3300026041 Bacteria 11682
262 Ga0207639_10010472 3300026041 Bacteria 6423
263 Ga0207639_10065321 3300026041 Bacteria 2824
264 Ga0207678_10042373 3300026067 Bacteria 3943
265 Ga0207678_10093916 3300026067 Bacteria 2562
266 Ga0207678_10098556 3300026067 Bacteria 2497
267 Ga0207678_10325072 3300026067 Bacteria 1324
268 Ga0207678_10435243 3300026067 Bacteria 1139
269 Ga0207678_10600210 3300026067 Bacteria 965
270 Ga0207702_10000003 3300026078 Bacteria 434196
271 Ga0207641_10174404 3300026088 Bacteria 1965
272 Ga0207676_10114976 3300026095 Bacteria 2258
273 Ga0207674_10004756 3300026116 Bacteria 16280
274 Ga0207674_10057562 3300026116 Bacteria 3940
275 Ga0207674_10082897 3300026116 Bacteria 3207
276 Ga0207675_100033143 3300026118 Bacteria 4813
277 Ga0207675_100201522 3300026118 Bacteria 1912
278 Ga0207675_100255536 3300026118 Bacteria 1697
279 Ga0207683_10046756 3300026121 Bacteria 3789
280 Ga0207683_10088917 3300026121 Bacteria 2749
281 Ga0207683_10119774 3300026121 Bacteria 2362
282 Ga0207683_10185080 3300026121 Bacteria 1889
283 Ga0207683_10213368 3300026121 Bacteria 1757
284 Ga0207698_10054008 3300026142 Bacteria 3088
285 Ga0209589_1000006 3300027357 Bacteria 436292
286 Ga0209489_100007 3300027361 Bacteria 436292
287 Ga0209700_100008 3300027363 Bacteria 436292
288 Ga0268266_10001115 3300028379 Bacteria 33566
289 Ga0268266_10006027 3300028379 Bacteria 11179
290 Ga0268266_10025765 3300028379 Bacteria 5004
291 Ga0268266_10039703 3300028379 Bacteria 4009
292 Ga0268266_10064115 3300028379 Bacteria 3173
293 Ga0268266_10254562 3300028379 Bacteria 1625
294 Ga0268265_10010132 3300028380 Bacteria 6365
295 Ga0268265_10060191 3300028380 Bacteria 2909
296 Ga0268264_10000093 3300028381 Bacteria 232057
297 Ga0268264_10013096 3300028381 Bacteria 6820
298 Ga0307515_10039862 3300028794 Bacteria 7450
299 Ga0307515_10231953 3300028794 Bacteria 1636
300 Ga0307511_10057782 3300030521 Bacteria 3010
301 Ga0265330_10015314 3300031235 Bacteria 3549
302 Ga0265332_10026695 3300031238 Bacteria 2532
303 Ga0265328_10071431 3300031239 Bacteria 1276
304 Ga0265325_10005212 3300031241 Bacteria 8068
305 Ga0265329_10048276 3300031242 Bacteria 1358
306 Ga0265340_10002779 3300031247 Bacteria 9978
307 Ga0307513_10156811 3300031456 Bacteria 2175
308 Ga0307509_10148592 3300031507 Bacteria 2264
309 Ga0307509_10162576 3300031507 Bacteria 2127
310 Ga0307408_100166051 3300031548 Bacteria 1758
311 Ga0307508_10000034 3300031616 Bacteria 160115
312 Ga0307508_10047091 3300031616 Bacteria 3847
313 Ga0307508_10057194 3300031616 Bacteria 3451
314 Ga0265342_10006824 3300031712 Bacteria 8440
315 Ga0265342_10009227 3300031712 Bacteria 6978
316 Ga0307516_10095646 3300031730 Bacteria 2792
317 Ga0307507_10022844 3300033179 Bacteria 6890
318 Ga0307510_10036621 3300033180 Bacteria 5458
319 Ga0315911_1000010 3300033442 Bacteria 322197
320 Ga0373926_0011513 3300035083 Bacteria 2977
321 Ga0373934_0009105 3300035086 Bacteria 3714
322 Ga0373934_0034650 3300035086 Bacteria 1984
323 Ga0373944_0010032 3300035089 Bacteria 2576
324 Ga0373952_0014882 3300035092 Bacteria 1563
325 Ga0373923_0002407 3300035111 Bacteria 5748
326 Ga0373936_0016254 3300035113 Bacteria 2862
327 Ga0373953_0001359 3300035117 Bacteria 7040
328 Ga0373953_0010088 3300035117 Bacteria 3275
329 Ga0373953_0010516 3300035117 Bacteria 3223
330 Ga0373954_0004556 3300035118 Bacteria 5968
331 Ga0373956_0003668 3300035119 Bacteria 6201
332 Ga0373957_0001068 3300035120 Bacteria 7227
333 Ga0373943_0007994 3300035170 Bacteria 4747
334 Ga0373955_0000880 3300035172 Bacteria 12889
335 Ga0373924_0012841 3300035410 Bacteria 3136
336 Ga0373924_0023108 3300035410 Bacteria 2435
337 Ga0373935_0018309 3300035692 Bacteria 4258
338 Ga0373927_0009651 3300035695 Bacteria 6471
339 Ga0373927_0012044 3300035695 Bacteria 5753
340 Ga0373927_0062867 3300035695 Bacteria 2401
341 Ga0373927_0066443 3300035695 Bacteria 2333
342 Ga0373933_0002191 3300035724 Bacteria 11169
343 Ga0373933_0038369 3300035724 Bacteria 2814
344 Ga0373933_0097404 3300035724 Bacteria 1822
345 Ga0373933_0169902 3300035724 Bacteria 1387
346 Ga0373947_0140362 3300035725 Bacteria 1549
347 Ga0373937_0006578 3300036401 Bacteria 10035
348 Ga0373937_0022213 3300036401 Bacteria 5702
349 Ga0373937_0051281 3300036401 Bacteria 3782
350 Ga0373925_0045644 3300037068 Bacteria 3255
351 Ga0395900_0086570 3300037418 Bacteria 3220
352 Ga0395898_0031255 3300037466 Bacteria 5322
353 Ga0395898_0134726 3300037466 Bacteria 2365
354 Ga0395905_0162178 3300037471 Bacteria 2101
355 Ga0395905_0169899 3300037471 Bacteria 2048
356 Ga0395901_0015985 3300038443 Bacteria 7647
357 Ga0395901_0060097 3300038443 Bacteria 3954
358 Ga0400483_108494 3300039062 Bacteria 4669
359 Ga0400483_110392 3300039062 Bacteria 37401
360 Ga0400483_151200 3300039062 Bacteria 17559
361 Ga0400483_193036 3300039062 Bacteria 3660
362 Ga0436365_0487598 3300039437 Bacteria 1139
363 Ga0436365_1446014 3300039437 Bacteria 2887
364 Ga0436365_1446425 3300039437 Bacteria 5355
365 Ga0436365_1701898 3300039437 Bacteria 2070
366 Ga0436365_1714523 3300039437 Bacteria 1910
367 Ga0436365_1936932 3300039437 Bacteria 1810
368 Ga0436360_0953942 3300039438 Bacteria 4699
369 Ga0436360_0973324 3300039438 Bacteria 3801
370 Ga0436363_0302413 3300039450 Bacteria 1568
371 Ga0436362_0646134 3300039453 Bacteria 7178
372 Ga0451807_0866641 3300041486 Bacteria 1641
373 Ga0439435_0005933 3300042436 Bacteria 2717
374 Ga0439459_0023512 3300042438 Bacteria 1202
375 Ga0466965_0180922 3300044683 Bacteria 1112
376 Ga0466963_0091098 3300044694 Bacteria 2076
377 Ga0466957_0029287 3300044842 Bacteria 3282
378 Ga0466967_0040069 3300045976 Bacteria 4031
379 Ga0495617_032623 3300046452 Bacteria 1748
380 Ga0495592_0008207 3300046454 Bacteria 7841
381 Ga0495592_0029636 3300046454 Bacteria 4143
382 Ga0495592_0125717 3300046454 Bacteria 1799
383 Ga0495603_0061679 3300046455 Bacteria 2214
384 Ga0495603_0086657 3300046455 Bacteria 1833
385 Ga0495603_0088431 3300046455 Bacteria 1813
386 Ga0495629_0006765 3300046459 Bacteria 8473
387 Ga0495629_0018324 3300046459 Bacteria 5012
388 Ga0495629_0047563 3300046459 Bacteria 3009
389 Ga0495638_0001021 3300046460 Bacteria 27811
390 Ga0495638_0102154 3300046460 Bacteria 1713
391 Ga0495638_0126696 3300046460 Bacteria 1504
392 Ga0495641_0006337 3300046461 Bacteria 7689
393 Ga0495641_0018952 3300046461 Bacteria 3536
394 Ga0495651_0003972 3300046462 Bacteria 11306
395 Ga0495651_0008150 3300046462 Bacteria 8034
396 Ga0495653_0012753 3300046463 Bacteria 6862
397 Ga0495653_0025837 3300046463 Bacteria 4712
398 Ga0495580_0284450 3300046472 Bacteria 1128
399 Ga0495582_0024440 3300046473 Bacteria 3306
400 Ga0495639_0002472 3300046475 Bacteria 8065
401 Ga0495639_0027091 3300046475 Bacteria 2536
402 Ga0495639_0080635 3300046475 Bacteria 1515
403 Ga0495662_0121133 3300046476 Bacteria 1284
404 Ga0495664_0065658 3300046477 Bacteria 2163
405 Ga0495584_0078966 3300046491 Bacteria 1656
406 Ga0495585_0047515 3300046492 Bacteria 2390
407 Ga0495594_0046705 3300046499 Bacteria 2378
408 Ga0495596_0019838 3300046500 Bacteria 2757
409 Ga0495607_0052733 3300046501 Bacteria 2354
410 Ga0495606_0021592 3300046507 Bacteria 4713
411 Ga0495606_0050798 3300046507 Bacteria 2709
412 Ga0495606_0204293 3300046507 Bacteria 1124
413 Ga0495606_0247399 3300046507 Bacteria 991
414 Ga0495608_0025279 3300046511 Bacteria 4053
415 Ga0495608_0297531 3300046511 Bacteria 999
416 Ga0495610_0013797 3300046512 Bacteria 4780
417 Ga0495616_0117031 3300046513 Bacteria 1233
418 Ga0495628_0005097 3300046516 Bacteria 11546
419 Ga0495628_0076574 3300046516 Bacteria 2603
420 Ga0495630_0060622 3300046517 Bacteria 2840
421 Ga0495631_0122414 3300046518 Bacteria 1119
422 Ga0495643_0063690 3300046522 Bacteria 1949
423 Ga0495643_0187015 3300046522 Bacteria 1002
424 Ga0495648_0002765 3300046524 Bacteria 15842
425 Ga0495652_0036021 3300046529 Bacteria 4304
426 Ga0495652_0036122 3300046529 Bacteria 4297
427 Ga0495652_0140267 3300046529 Bacteria 1901
428 Ga0495640_0034231 3300046533 Bacteria 3604
429 Ga0495640_0036139 3300046533 Bacteria 3491
430 Ga0495640_0043919 3300046533 Bacteria 3109
431 Ga0495587_0018218 3300046536 Bacteria 4355
432 Ga0495587_0078413 3300046536 Bacteria 1916
433 Ga0495587_0156150 3300046536 Bacteria 1299
434 Ga0495609_0047335 3300046538 Bacteria 1924
435 Ga0495609_0060831 3300046538 Bacteria 1669
436 Ga0495621_0021779 3300046539 Bacteria 2117
437 Ga0495645_0020761 3300046543 Bacteria 4744
438 Ga0495645_0057669 3300046543 Bacteria 2818
439 Ga0495633_0104201 3300046558 Bacteria 1316
440 Ga0495667_0005829 3300046559 Bacteria 8350
441 Ga0495667_0038334 3300046559 Bacteria 3191
442 Ga0495667_0126163 3300046559 Bacteria 1651
443 Ga0495668_0020542 3300046616 Bacteria 3797
444 Ga0495668_0100746 3300046616 Bacteria 1580
445 Ga0495668_0117104 3300046616 Bacteria 1457
446 Ga0495634_0015616 3300046642 Bacteria 5449
447 Ga0495634_0180564 3300046642 Bacteria 1321
448 Ga0495611_0063207 3300046648 Bacteria 1684
449 Ga0495625_0104873 3300046660 Bacteria 1937
450 Ga0495625_0134358 3300046660 Bacteria 1673
451 Ga0495625_0283504 3300046660 Bacteria 1065
452 Ga0495635_0003846 3300046663 Bacteria 10429
453 Ga0495635_0273525 3300046663 Bacteria 1135
454 Ga0495588_0014080 3300046674 Bacteria 3823
455 Ga0495588_0054866 3300046674 Bacteria 2056
456 Ga0495657_0003492 3300046675 Bacteria 12822
457 Ga0495657_0006927 3300046675 Bacteria 8808
458 Ga0495657_0068527 3300046675 Bacteria 2324
459 Ga0495657_0135230 3300046675 Bacteria 1541
460 Ga0495599_0001556 3300046678 Bacteria 13209
461 Ga0495599_0022511 3300046678 Bacteria 3935
462 Ga0495623_0002296 3300046679 Bacteria 12741
463 Ga0495623_0009107 3300046679 Bacteria 6440
464 Ga0495623_0122808 3300046679 Bacteria 1562
465 Ga0495646_0001918 3300046680 Bacteria 12509
466 Ga0495646_0011250 3300046680 Bacteria 5683
467 Ga0495669_0059741 3300046684 Bacteria 1722
468 Ga0495613_0030472 3300046689 Bacteria 4007
469 Ga0495613_0032215 3300046689 Bacteria 3893
470 Ga0495613_0054197 3300046689 Bacteria 2949
471 Ga0495670_0093478 3300046691 Bacteria 1541
472 Ga0495670_0169746 3300046691 Bacteria 1148
473 Ga0495649_0062818 3300046694 Bacteria 1996
474 Ga0495600_0002229 3300046809 Bacteria 11033
475 Ga0495600_0077649 3300046809 Bacteria 2168
476 Ga0495600_0088708 3300046809 Bacteria 2017
477 Ga0495581_0016881 3300047315 Bacteria 4243
478 Ga0495604_0005469 3300047317 Bacteria 10075
479 Ga0495604_0007916 3300047317 Bacteria 8417
480 Ga0495604_0064832 3300047317 Bacteria 2782
481 Ga0495674_0020768 3300047319 Bacteria 6080
482 Ga0495674_0021792 3300047319 Bacteria 5921
483 Ga0495674_0060078 3300047319 Bacteria 3317
484 Ga0495674_0087826 3300047319 Bacteria 2660
485 Ga0495672_0139134 3300047320 Bacteria 1270
486 Ga0495676_0029475 3300047321 Bacteria 4672
487 Ga0495680_0012862 3300047322 Bacteria 7332
488 Ga0495680_0032224 3300047322 Bacteria 4257
489 Ga0495683_0066605 3300047323 Bacteria 1774
490 Ga0495675_0002807 3300047444 Bacteria 10441
491 Ga0495675_0003321 3300047444 Bacteria 9678
492 Ga0495681_0082699 3300047470 Bacteria 1430
493 Ga0495684_0000893 3300047471 Bacteria 24119
494 Ga0495684_0009436 3300047471 Bacteria 7533
495 Ga0495684_0043713 3300047471 Bacteria 3431
496 Ga0495686_0073671 3300047472 Bacteria 2097
497 Ga0495686_0083618 3300047472 Bacteria 1946
498 Ga0495593_0005088 3300047673 Bacteria 7774
499 Ga0495602_0030283 3300048088 Bacteria 5136
500 Ga0495602_0049097 3300048088 Bacteria 3783
501 Ga0495602_0073245 3300048088 Bacteria 2916
502 Ga0495602_0086090 3300048088 Bacteria 2624
503 Ga0496100_0026796 3300048903 Bacteria 3537
504 Ga0496100_0054241 3300048903 Bacteria 2614
505 Ga0496100_0279396 3300048903 Bacteria 1244
506 Ga0496101_0005889 3300048904 Bacteria 7849
507 Ga0496101_0040575 3300048904 Bacteria 3315
508 Ga0496101_0138157 3300048904 Bacteria 1856
509 Ga0496102_0018779 3300048905 Bacteria 6081
510 Ga0496102_0079901 3300048905 Bacteria 3012
511 Ga0496102_0162404 3300048905 Bacteria 2102
512 Ga0496102_0222773 3300048905 Bacteria 1778
513 Ga0496102_0262307 3300048905 Bacteria 1629
514 Ga0496102_0512470 3300048905 Bacteria 1122
515 Ga0496103_0005710 3300048906 Bacteria 7435
516 Ga0496103_0067665 3300048906 Bacteria 2231
517 Ga0496104_0015916 3300048907 Bacteria 6825
518 Ga0496104_0119316 3300048907 Bacteria 2532
519 Ga0496105_0034901 3300048908 Bacteria 4138
520 Ga0496105_0051207 3300048908 Bacteria 3411
521 Ga0496105_0171635 3300048908 Bacteria 1777
522 Ga0496106_0000649 3300048909 Bacteria 24884
523 Ga0496106_0032306 3300048909 Bacteria 3902
524 Ga0496106_0049265 3300048909 Bacteria 3173
525 Ga0496106_0226889 3300048909 Bacteria 1490
526 Ga0496107_0037532 3300048910 Bacteria 3477
527 Ga0496107_0051082 3300048910 Bacteria 2981
528 Ga0496107_0173474 3300048910 Bacteria 1600
529 Ga0496108_0065905 3300048911 Bacteria 3053
530 Ga0496109_0044561 3300048912 Bacteria 4024
531 Ga0496109_0174830 3300048912 Bacteria 2015
532 Ga0496110_0013275 3300048913 Bacteria 6803
533 Ga0496110_0021544 3300048913 Bacteria 5460
534 Ga0496110_0051830 3300048913 Bacteria 3606
535 Ga0496110_0100133 3300048913 Bacteria 2598
536 Ga0496110_0199664 3300048913 Bacteria 1817
537 Ga0496110_0431895 3300048913 Bacteria 1200
538 Ga0496111_0203791 3300048914 Bacteria 1470
539 Ga0496111_0282788 3300048914 Bacteria 1230
540 Ga0496112_0000008 3300048915 Bacteria 310323
541 Ga0496112_0035784 3300048915 Bacteria 4839
542 Ga0496113_0013405 3300048916 Bacteria 5553
543 Ga0496113_0066226 3300048916 Bacteria 2735
544 Ga0496113_0083617 3300048916 Bacteria 2449
545 Ga0496113_0092620 3300048916 Bacteria 2331
546 Ga0496114_0015763 3300048917 Bacteria 6082
547 Ga0496114_0028100 3300048917 Bacteria 4613
548 Ga0496114_0071880 3300048917 Bacteria 2908
549 Ga0496114_0195583 3300048917 Bacteria 1770
550 Ga0496115_0007272 3300048918 Bacteria 8144
551 Ga0496115_0142336 3300048918 Bacteria 1979
552 Ga0496115_0306974 3300048918 Bacteria 1300
553 Ga0496116_0003364 3300048919 Bacteria 15879
554 Ga0496117_0035578 3300048920 Bacteria 3736
555 Ga0496117_0047573 3300048920 Bacteria 3074
556 Ga0496117_0166291 3300048920 Bacteria 1286
557 Ga0496118_0095087 3300048921 Bacteria 2035
558 Ga0496118_0099053 3300048921 Bacteria 1977
559 Ga0496118_0156878 3300048921 Bacteria 1414
560 Ga0496118_0205002 3300048921 Bacteria 1163
561 Ga0496120_0060061 3300048923 Bacteria 2128
562 Ga0496120_0070691 3300048923 Bacteria 1919
563 Ga0496121_0000476 3300048924 Bacteria 78015
564 Ga0496121_0001497 3300048924 Bacteria 39336
565 Ga0496121_0001742 3300048924 Bacteria 35564
566 Ga0496121_0003089 3300048924 Bacteria 24095
567 Ga0496121_0015642 3300048924 Bacteria 7916
568 Ga0496121_0017380 3300048924 Bacteria 7352
569 Ga0496121_0037277 3300048924 Bacteria 4321
570 Ga0496121_0050475 3300048924 Bacteria 3514
571 Ga0496121_0050757 3300048924 Bacteria 3501
572 Ga0496121_0077328 3300048924 Bacteria 2650
573 Ga0496121_0124804 3300048924 Bacteria 1937
574 Ga0496121_0267741 3300048924 Bacteria 1176
575 Ga0496121_0281920 3300048924 Bacteria 1136
576 Ga0496122_0024662 3300048925 Bacteria 5257
577 Ga0496122_0189533 3300048925 Bacteria 1216
578 Ga0496124_0001128 3300048927 Bacteria 42017
579 Ga0496124_0127389 3300048927 Bacteria 2027
580 Ga0496125_0000154 3300048928 Bacteria 152240
581 Ga0496125_0118101 3300048928 Bacteria 1900
582 Ga0496126_0002744 3300048929 Bacteria 23267
583 Ga0496126_0006113 3300048929 Bacteria 13500
584 Ga0496126_0007435 3300048929 Bacteria 12015
585 Ga0496126_0015910 3300048929 Bacteria 7552
586 Ga0496126_0020832 3300048929 Bacteria 6418
587 Ga0496126_0032430 3300048929 Bacteria 4920
588 Ga0496126_0039244 3300048929 Bacteria 4396
589 Ga0496126_0134713 3300048929 Bacteria 2132
590 Ga0496126_0140461 3300048929 Bacteria 2079
591 Ga0496126_0182221 3300048929 Bacteria 1783
592 Ga0496126_0199175 3300048929 Bacteria 1692
593 Ga0496126_0200806 3300048929 Bacteria 1684
594 Ga0496126_0214027 3300048929 Bacteria 1621
595 Ga0496126_0281315 3300048929 Bacteria 1378
596 Ga0495682_0026452 3300049460 Bacteria 2154
597 Ga0501031_0009852 3300049568 Bacteria 6221
598 Ga0501031_0022023 3300049568 Bacteria 4153
599 Ga0501032_0003534 3300049569 Bacteria 11926
600 Ga0501032_0046657 3300049569 Bacteria 2927
601 Ga0501033_0000249 3300049570 Bacteria 52045
602 Ga0501033_0036543 3300049570 Bacteria 3680
603 Ga0501033_0057802 3300049570 Bacteria 2865
604 Ga0501033_0169880 3300049570 Bacteria 1566
605 Ga0501033_0191694 3300049570 Bacteria 1462
606 Ga0501034_0001938 3300049571 Bacteria 26206
607 Ga0501034_0063839 3300049571 Bacteria 3696
608 Ga0501034_0150382 3300049571 Bacteria 2304
609 Ga0501034_0276657 3300049571 Bacteria 1618
610 Ga0501036_0004433 3300049572 Bacteria 11343
611 Ga0501036_0005117 3300049572 Bacteria 10599
612 Ga0501036_0026547 3300049572 Bacteria 4889
613 Ga0501036_0190494 3300049572 Bacteria 1725
614 Ga0501037_0000112 3300049573 Bacteria 75698
615 Ga0501037_0025895 3300049573 Bacteria 4332
616 Ga0501037_0091560 3300049573 Bacteria 2199
617 Ga0501037_0152526 3300049573 Bacteria 1651
618 Ga0501038_0000160 3300049574 Bacteria 57443
619 Ga0501038_0049308 3300049574 Bacteria 3641
620 Ga0501039_0011683 3300049575 Bacteria 6689
621 Ga0501040_0002958 3300049576 Bacteria 10996
622 Ga0501042_0074151 3300049578 Bacteria 2435
623 Ga0501043_0000278 3300049579 Bacteria 46214
624 Ga0501043_0022578 3300049579 Bacteria 4933
625 Ga0501046_0000937 3300049580 Bacteria 28581
626 Ga0501046_0008812 3300049580 Bacteria 8763
627 Ga0501047_0000275 3300049581 Bacteria 59536
628 Ga0501047_0003622 3300049581 Bacteria 14557
629 Ga0501047_0009938 3300049581 Bacteria 8998
630 Ga0501047_0018665 3300049581 Bacteria 6650
631 Ga0501047_0099683 3300049581 Bacteria 2784
632 Ga0501047_0101290 3300049581 Bacteria 2760
633 Ga0501047_0102492 3300049581 Bacteria 2741
634 Ga0501047_0265762 3300049581 Bacteria 1562
635 Ga0501047_0347074 3300049581 Bacteria 1321
636 Ga0501048_0001248 3300049582 Bacteria 19253
637 Ga0501048_0011414 3300049582 Bacteria 6626
638 Ga0501048_0068204 3300049582 Bacteria 2513
639 Ga0501067_0000258 3300049583 Bacteria 28937
640 Ga0501067_0022138 3300049583 Bacteria 3516
641 Ga0501068_0004146 3300049584 Bacteria 7852
642 Ga0501068_0084222 3300049584 Bacteria 1955
643 Ga0501070_0002548 3300049586 Bacteria 15964
644 Ga0501070_0024977 3300049586 Bacteria 5011
645 Ga0501070_0032601 3300049586 Bacteria 4360
646 Ga0501070_0053073 3300049586 Bacteria 3364
647 Ga0501070_0093858 3300049586 Bacteria 2482
648 Ga0501071_0206207 3300049587 Bacteria 1477
649 Ga0501072_0002502 3300049588 Bacteria 13767
650 Ga0501072_0002947 3300049588 Bacteria 12810
651 Ga0501072_0006863 3300049588 Bacteria 8639
652 Ga0501073_0000103 3300049589 Bacteria 53962
653 Ga0501073_0014367 3300049589 Bacteria 5752
654 Ga0501073_0039136 3300049589 Bacteria 3361
655 Ga0501073_0086595 3300049589 Bacteria 2179
656 Ga0501073_0180032 3300049589 Bacteria 1463
657 Ga0501074_0000456 3300049590 Bacteria 24566
658 Ga0501074_0001612 3300049590 Bacteria 15274
659 Ga0501074_0057260 3300049590 Bacteria 2808
660 Ga0501074_0057827 3300049590 Bacteria 2794
661 Ga0501074_0081415 3300049590 Bacteria 2322
662 Ga0501075_0003570 3300049591 Bacteria 10418
663 Ga0501076_0053630 3300049592 Bacteria 3195
664 Ga0501079_0000451 3300049741 Bacteria 26871
665 Ga0501079_0124241 3300049741 Bacteria 2007
666 Ga0501080_0000082 3300049742 Bacteria 63972
667 Ga0501080_0002998 3300049742 Bacteria 14886
668 Ga0501080_0034657 3300049742 Bacteria 4714
669 Ga0501081_0192605 3300049743 Bacteria 1477
670 Ga0501083_0013394 3300049744 Bacteria 5732
671 Ga0501083_0013677 3300049744 Bacteria 5675
672 Ga0501083_0053952 3300049744 Bacteria 2698
673 Ga0501083_0268914 3300049744 Bacteria 1109
674 Ga0501035_0000766 3300049822 Bacteria 34513
675 Ga0501035_0004610 3300049822 Bacteria 13074
676 Ga0501035_0110139 3300049822 Bacteria 2413
677 Ga0501035_0164948 3300049822 Bacteria 1916
678 Ga0501035_0231809 3300049822 Bacteria 1573
679 Ga0501044_0000418 3300049823 Bacteria 52554
680 Ga0501044_0028251 3300049823 Bacteria 5921
681 Ga0501044_0034063 3300049823 Bacteria 5345
682 Ga0501044_0124034 3300049823 Bacteria 2581
683 Ga0501044_0124517 3300049823 Bacteria 2576
684 Ga0501044_0189651 3300049823 Bacteria 2019
685 Ga0501045_0003999 3300049824 Bacteria 10152
686 Ga0501045_0012804 3300049824 Bacteria 5910
687 Ga0501045_0054354 3300049824 Bacteria 2927
688 nmdc:mga03683_35265_c1 3300050489 Bacteria 2028
689 nmdc:mga00v17_38224_c1 3300050491 Bacteria 2869
690 nmdc:mga0yw44_11164_c1 3300050492 Bacteria 4621
691 nmdc:mga0yw44_1397_c1 3300050492 Bacteria 9573
692 nmdc:mga0yw44_20742_c1 3300050492 Bacteria 3653
693 nmdc:mga0yw44_21662_c1 3300050492 Bacteria 2327
694 nmdc:mga0k408_163396_c1 3300050493 Bacteria 1327
695 nmdc:mga06z11_84367_c1 3300050494 Bacteria 1712
696 nmdc:mga06z11_96152_c1 3300050494 Bacteria 1617
697 nmdc:mga07m45_45292_c1 3300050496 Bacteria 2470
698 nmdc:mga05p37_62404_c1 3300050507 Bacteria 4586
699 nmdc:mga08y16_184530_c1 3300050511 Bacteria 2165
700 nmdc:mga0n895_58282_c1 3300050512 Bacteria 3807
701 nmdc:mga0rr50_138146_c1 3300050513 Bacteria 1958
702 nmdc:mga0rr50_27857_c1 3300050513 Bacteria 3963
703 nmdc:mga0a205_387614_c1 3300050515 Bacteria 1262
704 Ga0495601_0009529 3300053077 Bacteria 5749
705 Ga0495612_0030040 3300053078 Bacteria 2189
706 Ga0500635_0033309 3300053080 Bacteria 1680
707 Ga0495655_0015009 3300053083 Bacteria 1637
708 Ga0495595_0002085 3300053084 Bacteria 7774
709 Ga0495619_0005598 3300053085 Bacteria 7970
710 Ga0495619_0104527 3300053085 Bacteria 1930
711 Ga0495619_0105479 3300053085 Bacteria 1921
712 Ga0495619_0257420 3300053085 Bacteria 1209
713 Ga0500578_0082036 3300053086 Bacteria 2050
714 Ga0500643_005226 3300053087 Bacteria 5646
715 Ga0500643_060145 3300053087 Bacteria 1068
716 Ga0500644_0112491 3300053088 Bacteria 1050
717 Ga0500647_0094389 3300053091 Bacteria 1431
718 Ga0500647_0134900 3300053091 Bacteria 1162
719 Ga0500566_0000157 3300053094 Bacteria 34534
720 Ga0500566_0000185 3300053094 Bacteria 32171
721 Ga0500566_0001146 3300053094 Bacteria 15389
722 Ga0500566_0001213 3300053094 Bacteria 15085
723 Ga0500566_0068124 3300053094 Bacteria 2002
724 Ga0500566_0102983 3300053094 Bacteria 1562
725 Ga0500641_0004632 3300053096 Bacteria 4861
726 Ga0500650_0004834 3300053098 Bacteria 4933
727 Ga0500556_0006938 3300053104 Bacteria 3227
728 Ga0500562_044263 3300053108 Bacteria 1185
729 Ga0500569_007652 3300053109 Bacteria 2434
730 Ga0500572_000384 3300053111 Bacteria 15705
731 Ga0500594_0016712 3300053118 Bacteria 1787
732 Ga0500595_003818 3300053119 Bacteria 6928
733 Ga0500595_006228 3300053119 Bacteria 5095
734 Ga0500595_022133 3300053119 Bacteria 2256
735 Ga0500595_075549 3300053119 Bacteria 993
736 Ga0500607_081709 3300053121 Bacteria 1646
737 Ga0500608_000908 3300053122 Bacteria 10662
738 Ga0500608_056020 3300053122 Bacteria 1889
739 Ga0500614_001219 3300053123 Bacteria 6263
740 Ga0500652_000531 3300053131 Bacteria 13423
741 Ga0500658_0004847 3300053134 Bacteria 5018
742 Ga0500658_0155431 3300053134 Bacteria 1033
743 Ga0500559_0000863 3300053136 Bacteria 19480
744 Ga0500559_0002089 3300053136 Bacteria 10664
745 Ga0500559_0004212 3300053136 Bacteria 6885
746 Ga0500559_0049182 3300053136 Bacteria 1856
747 Ga0500568_0002109 3300053139 Bacteria 12007
748 Ga0500568_0018137 3300053139 Bacteria 3088
749 Ga0500573_0093412 3300053140 Bacteria 1697
750 Ga0500577_0000693 3300053142 Bacteria 8639
751 Ga0500603_002337 3300053150 Bacteria 4164
752 Ga0500603_061618 3300053150 Bacteria 1050
753 Ga0500604_0005246 3300053151 Bacteria 3425
754 Ga0500616_0000180 3300053153 Bacteria 106053
755 Ga0500619_020846 3300053154 Bacteria 1879
756 Ga0500620_013290 3300053155 Bacteria 2267
757 Ga0500622_0012310 3300053156 Bacteria 4635
758 Ga0500627_0030591 3300053158 Bacteria 2255
759 Ga0500630_137357 3300053159 Bacteria 1057
760 Ga0500633_0115050 3300053160 Bacteria 998
761 Ga0500634_0039122 3300053161 Bacteria 2578
762 Ga0500638_001014 3300053162 Bacteria 8145
763 Ga0500639_000010 3300053163 Bacteria 136747
764 Ga0500636_0001916 3300053177 Bacteria 11425
765 Ga0500637_0000121 3300053178 Bacteria 28204
766 Ga0500637_0029199 3300053178 Bacteria 3057
767 Ga0500609_006195 3300053731 Bacteria 1630
768 Ga0500596_000760 3300053735 Bacteria 6344
769 Ga0500596_002495 3300053735 Bacteria 3628
770 Ga0500601_000076 3300053737 Bacteria 20083
771 Ga0501084_0003972 3300054114 Bacteria 12046
772 Ga0501084_0039395 3300054114 Bacteria 3953
773 Ga0500661_000452 3300055283 Bacteria 7586
774 Ga0501082_0029862 3300060353 Bacteria 4696
775 Ga0501082_0070440 3300060353 Bacteria 3011
776 Ga0501082_0089240 3300060353 Bacteria 2661
777 Ga0530510_0066561 3300061734 Bacteria 2612

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100002023 Ga0070665_1000020232 266
2 3300025912 Ga0207707_10026300 Ga0207707_100263003 266
3 3300028379 Ga0268266_10001115 Ga0268266_1000111516 266
4 3300006177 Ga0075362_10032986 Ga0075362_100329863 267
5 3300006237 Ga0097621_100001594 Ga0097621_1000015945 267
6 3300006358 Ga0068871_100000187 Ga0068871_10000018724 267
7 3300010375 Ga0105239_10102158 Ga0105239_101021582 280
8 3300049568 Ga0501031_0009852 Ga0501031_0009852_19_936 280
9 3300049571 Ga0501034_0276657 Ga0501034_0276657_43_960 280
10 3300049572 Ga0501036_0190494 Ga0501036_0190494_117_1034 280
11 3300049586 Ga0501070_0093858 Ga0501070_0093858_240_1157 280
12 3300049743 Ga0501081_0192605 Ga0501081_0192605_105_1022 280
13 3300060353 Ga0501082_0089240 Ga0501082_0089240_230_1147 280
14 3300048929 Ga0496126_0281315 Ga0496126_0281315_332_1183 282
15 3300039438 Ga0436360_0953942 Ga0436360_0953942_856_1773 283
16 3300048088 Ga0495602_0086090 Ga0495602_0086090_11_865 284
17 3300006871 Ga0075434_100478919 Ga0075434_1004789191 286
18 3300048903 Ga0496100_0279396 Ga0496100_0279396_371_1231 286
19 3300050515 nmdc:mga0a205_387614_c1 nmdc:mga0a205_387614_c1_224_1147 286
20 3300053087 Ga0500643_005226 Ga0500643_005226_2975_3892 287
21 3300025923 Ga0207681_10012277 Ga0207681_100122775 288
22 3300044694 Ga0466963_0091098 Ga0466963_0091098_296_1165 288
23 3300044842 Ga0466957_0029287 Ga0466957_0029287_1446_2315 288
24 3300045976 Ga0466967_0040069 Ga0466967_0040069_3107_3976 288
25 3300049581 Ga0501047_0102492 Ga0501047_0102492_290_1189 288
26 3300049583 Ga0501067_0022138 Ga0501067_0022138_2048_2947 288
27 3300049588 Ga0501072_0002502 Ga0501072_0002502_382_1281 288
28 3300049589 Ga0501073_0014367 Ga0501073_0014367_1523_2422 288
29 3300049590 Ga0501074_0081415 Ga0501074_0081415_889_1788 288
30 3300054114 Ga0501084_0039395 Ga0501084_0039395_2620_3519 288
31 3300060353 Ga0501082_0070440 Ga0501082_0070440_39_938 288
32 iso_pu_bacteria 2517093001 2517100589 288
33 iso_pu_bacteria 2744054633 2745076931 288
34 3300049581 Ga0501047_0347074 Ga0501047_0347074_121_993 289
35 3300049744 Ga0501083_0268914 Ga0501083_0268914_197_1084 291
36 3300014326 Ga0157380_10005003 Ga0157380_100050032 292
37 3300025919 Ga0207657_10517855 Ga0207657_105178551 292
38 3300026067 Ga0207678_10435243 Ga0207678_104352432 292
39 3300031507 Ga0307509_10148592 Ga0307509_101485922 292
40 3300031730 Ga0307516_10095646 Ga0307516_100956462 292
41 3300039437 Ga0436365_0487598 Ga0436365_0487598_233_1111 292
42 3300046675 Ga0495657_0135230 Ga0495657_0135230_317_1240 292
43 3300048921 Ga0496118_0205002 Ga0496118_0205002_264_1142 292
44 3300005336 Ga0070680_100035140 Ga0070680_1000351402 293
45 3300005535 Ga0070684_100005206 Ga0070684_1000052065 293
46 3300046454 Ga0495592_0125717 Ga0495592_0125717_429_1310 293
47 3300046462 Ga0495651_0003972 Ga0495651_0003972_621_1502 293
48 3300046463 Ga0495653_0025837 Ga0495653_0025837_2998_3879 293
49 3300046476 Ga0495662_0121133 Ga0495662_0121133_325_1206 293
50 3300046507 Ga0495606_0050798 Ga0495606_0050798_29_910 293
51 3300046507 Ga0495606_0204293 Ga0495606_0204293_227_1108 293
52 3300046507 Ga0495606_0247399 Ga0495606_0247399_23_904 293
53 3300046529 Ga0495652_0140267 Ga0495652_0140267_75_956 293
54 3300046533 Ga0495640_0036139 Ga0495640_0036139_1514_2395 293
55 3300046536 Ga0495587_0078413 Ga0495587_0078413_620_1501 293
56 3300046543 Ga0495645_0020761 Ga0495645_0020761_1036_1917 293
57 3300046559 Ga0495667_0038334 Ga0495667_0038334_2258_3139 293
58 3300046559 Ga0495667_0126163 Ga0495667_0126163_16_897 293
59 3300046642 Ga0495634_0180564 Ga0495634_0180564_399_1280 293
60 3300046675 Ga0495657_0003492 Ga0495657_0003492_7364_8245 293
61 3300046678 Ga0495599_0022511 Ga0495599_0022511_203_1084 293
62 3300046679 Ga0495623_0002296 Ga0495623_0002296_7860_8741 293
63 3300046689 Ga0495613_0032215 Ga0495613_0032215_2110_2991 293
64 3300046809 Ga0495600_0077649 Ga0495600_0077649_236_1117 293
65 3300047317 Ga0495604_0005469 Ga0495604_0005469_2443_3324 293
66 3300047319 Ga0495674_0060078 Ga0495674_0060078_2360_3241 293
67 3300047322 Ga0495680_0032224 Ga0495680_0032224_513_1394 293
68 3300047444 Ga0495675_0002807 Ga0495675_0002807_269_1150 293
69 3300047471 Ga0495684_0043713 Ga0495684_0043713_76_957 293
70 3300048088 Ga0495602_0049097 Ga0495602_0049097_2672_3553 293
71 3300048921 Ga0496118_0095087 Ga0496118_0095087_344_1225 293
72 3300048921 Ga0496118_0099053 Ga0496118_0099053_21_902 293
73 3300048929 Ga0496126_0015910 Ga0496126_0015910_5699_6616 293
74 3300053085 Ga0495619_0105479 Ga0495619_0105479_987_1868 293
75 3300053094 Ga0500566_0001146 Ga0500566_0001146_4258_5223 293
76 3300053109 Ga0500569_007652 Ga0500569_007652_1540_2421 293
77 3300053119 Ga0500595_003818 Ga0500595_003818_2746_3711 293
78 3300053119 Ga0500595_006228 Ga0500595_006228_881_1762 293
79 3300053134 Ga0500658_0155431 Ga0500658_0155431_127_1008 293
80 3300053162 Ga0500638_001014 Ga0500638_001014_4023_4988 293
81 3300053178 Ga0500637_0000121 Ga0500637_0000121_16288_17253 293
82 3300055283 Ga0500661_000452 Ga0500661_000452_3926_4891 293
83 3300005434 Ga0070709_10074270 Ga0070709_100742702 294
84 3300005436 Ga0070713_100193256 Ga0070713_1001932562 294
85 3300025272 Ga0209455_1003259 Ga0209455_10032594 294
86 3300025932 Ga0207690_10345078 Ga0207690_103450782 294
87 3300028379 Ga0268266_10254562 Ga0268266_102545622 294
88 3300031241 Ga0265325_10005212 Ga0265325_100052125 294
89 3300031712 Ga0265342_10009227 Ga0265342_100092275 294
90 3300035724 Ga0373933_0097404 Ga0373933_0097404_492_1412 294
91 3300036401 Ga0373937_0022213 Ga0373937_0022213_1798_2718 294
92 3300046539 Ga0495621_0021779 Ga0495621_0021779_775_1665 294
93 3300046679 Ga0495623_0122808 Ga0495623_0122808_69_995 294
94 3300005577 Ga0068857_100028021 Ga0068857_1000280214 295
95 3300009093 Ga0105240_10022325 Ga0105240_100223254 295
96 3300009174 Ga0105241_10020915 Ga0105241_100209152 295
97 3300009551 Ga0105238_10038148 Ga0105238_100381482 295
98 3300010375 Ga0105239_10056278 Ga0105239_100562781 295
99 3300049823 Ga0501044_0189651 Ga0501044_0189651_547_1467 295
100 3300005435 Ga0070714_100537798 Ga0070714_1005377982 297
101 3300005436 Ga0070713_100094802 Ga0070713_1000948022 297
102 3300025928 Ga0207700_10158137 Ga0207700_101581372 297
103 3300025945 Ga0207679_10005298 Ga0207679_100052983 297
104 3300046460 Ga0495638_0001021 Ga0495638_0001021_12964_13866 297
105 3300049589 Ga0501073_0180032 Ga0501073_0180032_144_1043 297
106 3300039437 Ga0436365_1446014 Ga0436365_1446014_196_1146 298
107 3300049570 Ga0501033_0169880 Ga0501033_0169880_355_1275 298
108 3300049581 Ga0501047_0003622 Ga0501047_0003622_8182_9102 298
109 3300049822 Ga0501035_0004610 Ga0501035_0004610_674_1594 298
110 3300049823 Ga0501044_0124034 Ga0501044_0124034_284_1204 298
111 3300005347 Ga0070668_100013894 Ga0070668_1000138944 299
112 3300005367 Ga0070667_100002825 Ga0070667_1000028254 299
113 3300005617 Ga0068859_100002355 Ga0068859_1000023557 299
114 3300005841 Ga0068863_100050347 Ga0068863_1000503472 299
115 3300005843 Ga0068860_100008657 Ga0068860_1000086575 299
116 3300005844 Ga0068862_100070303 Ga0068862_1000703033 299
117 3300006931 Ga0097620_100002355 Ga0097620_1000023557 299
118 3300025923 Ga0207681_10224707 Ga0207681_102247072 299
119 3300025925 Ga0207650_10110677 Ga0207650_101106773 299
120 3300025931 Ga0207644_10292129 Ga0207644_102921292 299
121 3300025972 Ga0207668_10001774 Ga0207668_100017743 299
122 3300026088 Ga0207641_10174404 Ga0207641_101744042 299
123 3300026118 Ga0207675_100255536 Ga0207675_1002555362 299
124 3300028381 Ga0268264_10013096 Ga0268264_100130965 299
125 3300049581 Ga0501047_0265762 Ga0501047_0265762_66_986 300
126 3300005563 Ga0068855_100436494 Ga0068855_1004364942 301
127 3300025949 Ga0207667_10037608 Ga0207667_100376084 301
128 3300049568 Ga0501031_0022023 Ga0501031_0022023_2104_3024 301
129 3300049572 Ga0501036_0005117 Ga0501036_0005117_238_1158 301
130 3300049573 Ga0501037_0152526 Ga0501037_0152526_189_1109 301
131 3300049576 Ga0501040_0002958 Ga0501040_0002958_8927_9847 301
132 3300049582 Ga0501048_0068204 Ga0501048_0068204_282_1202 301
133 3300049584 Ga0501068_0084222 Ga0501068_0084222_886_1806 301
134 3300049587 Ga0501071_0206207 Ga0501071_0206207_133_1053 301
135 3300049588 Ga0501072_0002947 Ga0501072_0002947_10225_11145 301
136 3300049590 Ga0501074_0057260 Ga0501074_0057260_1596_2516 301
137 3300049591 Ga0501075_0003570 Ga0501075_0003570_150_1070 301
138 3300049592 Ga0501076_0053630 Ga0501076_0053630_1449_2369 301
139 3300049741 Ga0501079_0124241 Ga0501079_0124241_751_1671 301
140 3300049822 Ga0501035_0231809 Ga0501035_0231809_32_952 301
141 3300049824 Ga0501045_0003999 Ga0501045_0003999_8366_9286 301
142 3300060353 Ga0501082_0029862 Ga0501082_0029862_2617_3537 301
143 3300061734 Ga0530510_0066561 Ga0530510_0066561_1360_2280 301
144 iso_pu_bacteria 2513237104 2513716916 301
145 iso_pu_bacteria 2517572143 2517894741 301
146 iso_pu_bacteria 2524023228 2524534490 301
147 iso_pu_bacteria 2602042107 2603862619 301
148 iso_pu_bacteria 2667528175 2671119155 301
149 iso_pu_bacteria 2824661429 2824668264 301
150 iso_pu_bacteria 2841957949 2841960220 301
151 iso_pu_bacteria 2881364244 2881370679 301
152 iso_pu_bacteria 2885374607 2885378764 301
153 iso_pu_bacteria 2903748898 2903751424 301
154 iso_pu_bacteria 2904699407 2904705787 301
155 iso_pu_bacteria 2906610324 2906611461 301
156 iso_pu_bacteria 2908739725 2908745053 301
157 iso_pu_bacteria 2935630451 2935632176 301
158 iso_pu_bacteria 2935694250 2935699714 301
159 iso_pu_bacteria 2941507105 2941508124 301
160 iso_pu_bacteria 2941515067 2941515371 301
161 iso_pu_bacteria 2941523033 2941524054 301
162 iso_pu_bacteria 3005474847 3005477606 301
163 iso_pu_bacteria 8006933436 8006933611 301
164 iso_pu_bacteria 8006973647 8006983284 301
165 iso_pu_bacteria 8019555841 8019559548 301
166 3300039062 Ga0400483_108494 Ga0400483_108494_2598_3536 302
167 3300039062 Ga0400483_110392 Ga0400483_110392_34530_35468 302
168 3300039062 Ga0400483_151200 Ga0400483_151200_12847_13785 302
169 3300039062 Ga0400483_193036 Ga0400483_193036_2628_3566 302
170 iso_pu_bacteria 2513237101 2513697430 302
171 iso_pu_bacteria 2513237137 2513861039 302
172 iso_pu_bacteria 2524023210 2524464073 302
173 iso_pu_bacteria 2528768022 2528849822 302
174 iso_pu_bacteria 2617270735 2617350774 302
175 iso_pu_bacteria 2643221651 2644287350 302
176 iso_pu_bacteria 2824773399 2824780544 302
177 iso_pu_bacteria 2857524615 2857529967 302
178 iso_pu_bacteria 2874604998 2874612591 302
179 iso_pu_bacteria 2879099564 2879101351 302
180 iso_pu_bacteria 2885383462 2885384488 302
181 iso_pu_bacteria 2889033259 2889033620 302
182 iso_pu_bacteria 2919073203 2919077179 302
183 iso_pu_bacteria 2922361189 2922366989 302
184 iso_pu_bacteria 2922368715 2922371194 302
185 iso_pu_bacteria 2922386360 2922390230 302
186 iso_pu_bacteria 2929615660 2929619578 302
187 iso_pu_bacteria 2929624759 2929627952 302
188 iso_pu_bacteria 2932784394 2932785908 302
189 iso_pu_bacteria 2932809354 2932817279 302
190 iso_pu_bacteria 2932818245 2932826876 302
191 iso_pu_bacteria 2932828146 2932830952 302
192 iso_pu_bacteria 2933577622 2933581498 302
193 iso_pu_bacteria 2935616580 2935621017 302
194 iso_pu_bacteria 2935638405 2935640093 302
195 iso_pu_bacteria 2935665750 2935667068 302
196 iso_pu_bacteria 2935684952 2935690200 302
197 iso_pu_bacteria 2935703347 2935704824 302
198 iso_pu_bacteria 2935713505 2935718103 302
199 iso_pu_bacteria 2935722832 2935726747 302
200 iso_pu_bacteria 2935732158 2935735516 302
201 iso_pu_bacteria 2935741537 2935745213 302
202 iso_pu_bacteria 2935750917 2935755211 302
203 iso_pu_bacteria 2935760218 2935762272 302
204 iso_pu_bacteria 2935801545 2935803774 302
205 iso_pu_bacteria 2935810662 2935811690 302
206 iso_pu_bacteria 2935827899 2935829576 302
207 iso_pu_bacteria 2935837841 2935843090 302
208 iso_pu_bacteria 2935855204 2935858824 302
209 iso_pu_bacteria 2935864058 2935866778 302
210 iso_pu_bacteria 2935873716 2935876909 302
211 iso_pu_bacteria 2935959822 2935962046 302
212 iso_pu_bacteria 2935992306 2935993454 302
213 iso_pu_bacteria 2936002035 2936004349 302
214 iso_pu_bacteria 2936037263 2936038272 302
215 iso_pu_bacteria 2940556831 2940561508 302
216 iso_pu_bacteria 2941538514 2941544314 302
217 iso_pu_bacteria 8006964411 8006966525 302
218 iso_pu_bacteria 8016511872 8016516433 302
219 iso_pu_bacteria 8017057580 8017060104 302
220 iso_pu_bacteria 8019576017 8019579614 302
221 iso_pu_bacteria 8019586578 8019587325 302
222 iso_pu_bacteria 8019597564 8019604016 302
223 iso_pu_bacteria 8019608314 8019614512 302
224 iso_pu_bacteria 8055742211 8055749164 302
225 iso_pu_bacteria 2728368998 2728747604 303
226 iso_pu_bacteria 2791355197 2793071216 303
227 iso_pu_bacteria 2876808645 2876812895 303
228 iso_pu_bacteria 2879110137 2879118032 303
229 iso_pu_bacteria 2893066018 2893069390 303
230 iso_pu_bacteria 2904690495 2904697725 303
231 iso_pu_bacteria 2908756301 2908757178 303
232 iso_pu_bacteria 2922425934 2922427896 303
233 3300042438 Ga0439459_0023512 Ga0439459_0023512_254_1168 304
234 iso_pu_bacteria 2508501128 2509148873 304
235 iso_pu_bacteria 2513237096 2513655024 304
236 iso_pu_bacteria 2513237098 2513677794 304
237 iso_pu_bacteria 2513237141 2513892083 304
238 iso_pu_bacteria 2513237145 2513915953 304
239 iso_pu_bacteria 2524023205 2524438187 304
240 iso_pu_bacteria 2903768456 2903773624 304
241 iso_pu_bacteria 2906635258 2906641701 304
242 iso_pu_bacteria 2906660503 2906660803 304
243 iso_pu_bacteria 8056681323 8056682384 304
244 3300005262 Ga0065165_1004626 Ga0065165_10046264 305
245 3300005434 Ga0070709_10078605 Ga0070709_100786052 305
246 3300005436 Ga0070713_100441823 Ga0070713_1004418231 305
247 3300005439 Ga0070711_100002216 Ga0070711_1000022163 305
248 3300005439 Ga0070711_100063136 Ga0070711_1000631362 305
249 3300005563 Ga0068855_100049698 Ga0068855_1000496983 305
250 3300005843 Ga0068860_100000254 Ga0068860_10000025445 305
251 3300005983 Ga0081540_1003272 Ga0081540_10032724 305
252 3300006175 Ga0070712_100212976 Ga0070712_1002129761 305
253 3300006195 Ga0075366_10031599 Ga0075366_100315991 305
254 3300009177 Ga0105248_10507073 Ga0105248_105070732 305
255 3300009551 Ga0105238_10035119 Ga0105238_100351192 305
256 3300010375 Ga0105239_10090525 Ga0105239_100905253 305
257 3300010375 Ga0105239_10118056 Ga0105239_101180563 305
258 3300011119 Ga0105246_10056010 Ga0105246_100560104 305
259 3300013105 Ga0157369_10043079 Ga0157369_100430792 305
260 3300013296 Ga0157374_10032938 Ga0157374_100329384 305
261 3300025898 Ga0207692_10009587 Ga0207692_100095873 305
262 3300025904 Ga0207647_10044552 Ga0207647_100445521 305
263 3300025906 Ga0207699_10042253 Ga0207699_100422532 305
264 3300025915 Ga0207693_10018488 Ga0207693_100184885 305
265 3300025916 Ga0207663_10021194 Ga0207663_100211943 305
266 3300025917 Ga0207660_10098702 Ga0207660_100987022 305
267 3300025939 Ga0207665_10252552 Ga0207665_102525522 305
268 3300025941 Ga0207711_10380882 Ga0207711_103808822 305
269 3300028381 Ga0268264_10000093 Ga0268264_10000093114 305
270 3300031616 Ga0307508_10000034 Ga0307508_10000034124 305
271 3300031616 Ga0307508_10057194 Ga0307508_100571943 305
272 3300046461 Ga0495641_0006337 Ga0495641_0006337_72_989 305
273 3300046513 Ga0495616_0117031 Ga0495616_0117031_43_960 305
274 3300046522 Ga0495643_0063690 Ga0495643_0063690_358_1275 305
275 3300048905 Ga0496102_0222773 Ga0496102_0222773_405_1322 305
276 3300048906 Ga0496103_0005710 Ga0496103_0005710_76_996 305
277 3300048909 Ga0496106_0032306 Ga0496106_0032306_620_1537 305
278 3300048910 Ga0496107_0037532 Ga0496107_0037532_538_1455 305
279 3300048910 Ga0496107_0051082 Ga0496107_0051082_1960_2877 305
280 3300048912 Ga0496109_0174830 Ga0496109_0174830_128_1045 305
281 3300048913 Ga0496110_0431895 Ga0496110_0431895_55_972 305
282 3300048916 Ga0496113_0092620 Ga0496113_0092620_1091_2008 305
283 3300048918 Ga0496115_0142336 Ga0496115_0142336_805_1728 305
284 3300048919 Ga0496116_0003364 Ga0496116_0003364_13275_14192 305
285 3300048921 Ga0496118_0156878 Ga0496118_0156878_50_967 305
286 3300048924 Ga0496121_0001497 Ga0496121_0001497_31047_31964 305
287 3300048924 Ga0496121_0124804 Ga0496121_0124804_995_1912 305
288 3300048924 Ga0496121_0281920 Ga0496121_0281920_173_1093 305
289 3300048925 Ga0496122_0189533 Ga0496122_0189533_242_1159 305
290 3300048927 Ga0496124_0127389 Ga0496124_0127389_1093_2010 305
291 3300048929 Ga0496126_0200806 Ga0496126_0200806_20_937 305
292 3300049570 Ga0501033_0036543 Ga0501033_0036543_1414_2331 305
293 3300049571 Ga0501034_0063839 Ga0501034_0063839_1203_2120 305
294 3300049573 Ga0501037_0091560 Ga0501037_0091560_445_1362 305
295 3300049574 Ga0501038_0049308 Ga0501038_0049308_1044_1961 305
296 3300049579 Ga0501043_0022578 Ga0501043_0022578_3003_3920 305
297 3300049580 Ga0501046_0008812 Ga0501046_0008812_5804_6721 305
298 3300049581 Ga0501047_0009938 Ga0501047_0009938_5801_6718 305
299 3300049744 Ga0501083_0013677 Ga0501083_0013677_1759_2676 305
300 3300049822 Ga0501035_0110139 Ga0501035_0110139_614_1531 305
301 3300049823 Ga0501044_0028251 Ga0501044_0028251_1921_2838 305
302 3300050493 nmdc:mga0k408_163396_c1 nmdc:mga0k408_163396_c1_43_960 305
303 iso_pu_bacteria 2738541281 2738744680 305
304 iso_pu_bacteria 2738543032 2739353910 305
305 3300003203 JGI25406J46586_10000580 JGI25406J46586_1000058017 306
306 3300003203 JGI25406J46586_10003218 JGI25406J46586_100032184 306
307 3300003215 JGI25153J46596_10026817 JGI25153J46596_100268171 306
308 3300005327 Ga0070658_10345549 Ga0070658_103455492 306
309 3300005353 Ga0070669_100097454 Ga0070669_1000974542 306
310 3300005367 Ga0070667_100232022 Ga0070667_1002320222 306
311 3300005434 Ga0070709_10001417 Ga0070709_100014176 306
312 3300005435 Ga0070714_100018262 Ga0070714_1000182624 306
313 3300005435 Ga0070714_100048804 Ga0070714_1000488042 306
314 3300005435 Ga0070714_100073222 Ga0070714_1000732223 306
315 3300005435 Ga0070714_100143902 Ga0070714_1001439022 306
316 3300005437 Ga0070710_10000633 Ga0070710_100006338 306
317 3300005439 Ga0070711_100001478 Ga0070711_1000014783 306
318 3300005455 Ga0070663_100062516 Ga0070663_1000625162 306
319 3300005530 Ga0070679_100128043 Ga0070679_1001280432 306
320 3300005535 Ga0070684_100287733 Ga0070684_1002877332 306
321 3300005548 Ga0070665_100028235 Ga0070665_1000282354 306
322 3300005563 Ga0068855_100079756 Ga0068855_1000797564 306
323 3300005842 Ga0068858_100293748 Ga0068858_1002937482 306
324 3300005844 Ga0068862_100271018 Ga0068862_1002710182 306
325 3300005937 Ga0081455_10018234 Ga0081455_100182347 306
326 3300005937 Ga0081455_10042135 Ga0081455_100421352 306
327 3300005937 Ga0081455_10146067 Ga0081455_101460674 306
328 3300005981 Ga0081538_10040034 Ga0081538_100400343 306
329 3300005983 Ga0081540_1001143 Ga0081540_10011439 306
330 3300005983 Ga0081540_1009836 Ga0081540_10098363 306
331 3300005983 Ga0081540_1034529 Ga0081540_10345293 306
332 3300005985 Ga0081539_10000191 Ga0081539_10000191145 306
333 3300005985 Ga0081539_10000321 Ga0081539_1000032187 306
334 3300006028 Ga0070717_10000355 Ga0070717_100003552 306
335 3300006028 Ga0070717_10073801 Ga0070717_100738012 306
336 3300006038 Ga0075365_10126376 Ga0075365_101263763 306
337 3300006163 Ga0070715_10058855 Ga0070715_100588552 306
338 3300006173 Ga0070716_100026542 Ga0070716_1000265423 306
339 3300006175 Ga0070712_100011086 Ga0070712_1000110862 306
340 3300006178 Ga0075367_10093767 Ga0075367_100937672 306
341 3300006871 Ga0075434_100192327 Ga0075434_1001923272 306
342 3300006880 Ga0075429_100274420 Ga0075429_1002744202 306
343 3300009093 Ga0105240_10349464 Ga0105240_103494642 306
344 3300009101 Ga0105247_10140225 Ga0105247_101402251 306
345 3300009101 Ga0105247_10194057 Ga0105247_101940571 306
346 3300009551 Ga0105238_10355522 Ga0105238_103555222 306
347 3300009553 Ga0105249_10285302 Ga0105249_102853022 306
348 3300013104 Ga0157370_10044147 Ga0157370_100441472 306
349 3300013104 Ga0157370_10451017 Ga0157370_104510172 306
350 3300013105 Ga0157369_10012925 Ga0157369_100129252 306
351 3300013306 Ga0163162_10072401 Ga0163162_100724011 306
352 3300020082 Ga0206353_11993804 Ga0206353_119938041 306
353 3300025254 Ga0209148_1000424 Ga0209148_100042441 306
354 3300025272 Ga0209455_1002609 Ga0209455_10026095 306
355 3300025297 Ga0209758_1051017 Ga0209758_10510171 306
356 3300025898 Ga0207692_10005603 Ga0207692_100056031 306
357 3300025904 Ga0207647_10047587 Ga0207647_100475872 306
358 3300025905 Ga0207685_10037090 Ga0207685_100370902 306
359 3300025905 Ga0207685_10051652 Ga0207685_100516522 306
360 3300025906 Ga0207699_10000390 Ga0207699_100003908 306
361 3300025906 Ga0207699_10078773 Ga0207699_100787732 306
362 3300025908 Ga0207643_10046129 Ga0207643_100461292 306
363 3300025912 Ga0207707_10051598 Ga0207707_100515983 306
364 3300025913 Ga0207695_10053725 Ga0207695_100537254 306
365 3300025914 Ga0207671_10009091 Ga0207671_100090915 306
366 3300025915 Ga0207693_10018008 Ga0207693_100180085 306
367 3300025916 Ga0207663_10006434 Ga0207663_100064343 306
368 3300025919 Ga0207657_10029030 Ga0207657_100290305 306
369 3300025921 Ga0207652_10055858 Ga0207652_100558582 306
370 3300025921 Ga0207652_10212256 Ga0207652_102122562 306
371 3300025921 Ga0207652_10520426 Ga0207652_105204262 306
372 3300025923 Ga0207681_10063702 Ga0207681_100637022 306
373 3300025925 Ga0207650_10459274 Ga0207650_104592741 306
374 3300025928 Ga0207700_10021574 Ga0207700_100215742 306
375 3300025928 Ga0207700_10031891 Ga0207700_100318912 306
376 3300025932 Ga0207690_10125891 Ga0207690_101258912 306
377 3300025935 Ga0207709_10045101 Ga0207709_100451012 306
378 3300025939 Ga0207665_10132205 Ga0207665_101322052 306
379 3300025944 Ga0207661_10004270 Ga0207661_100042704 306
380 3300025944 Ga0207661_10354884 Ga0207661_103548842 306
381 3300025972 Ga0207668_10076711 Ga0207668_100767112 306
382 3300026041 Ga0207639_10010472 Ga0207639_100104722 306
383 3300026067 Ga0207678_10325072 Ga0207678_103250722 306
384 3300026067 Ga0207678_10600210 Ga0207678_106002101 306
385 3300026118 Ga0207675_100201522 Ga0207675_1002015222 306
386 3300028379 Ga0268266_10025765 Ga0268266_100257652 306
387 3300028379 Ga0268266_10039703 Ga0268266_100397033 306
388 3300028380 Ga0268265_10010132 Ga0268265_100101323 306
389 3300028380 Ga0268265_10060191 Ga0268265_100601913 306
390 3300028794 Ga0307515_10039862 Ga0307515_100398625 306
391 3300028794 Ga0307515_10231953 Ga0307515_102319531 306
392 3300030521 Ga0307511_10057782 Ga0307511_100577821 306
393 3300031235 Ga0265330_10015314 Ga0265330_100153143 306
394 3300031242 Ga0265329_10048276 Ga0265329_100482762 306
395 3300031247 Ga0265340_10002779 Ga0265340_100027797 306
396 3300031456 Ga0307513_10156811 Ga0307513_101568112 306
397 3300031616 Ga0307508_10047091 Ga0307508_100470912 306
398 3300031712 Ga0265342_10006824 Ga0265342_100068247 306
399 3300033179 Ga0307507_10022844 Ga0307507_100228442 306
400 3300033442 Ga0315911_1000010 Ga0315911_1000010166 306
401 3300035083 Ga0373926_0011513 Ga0373926_0011513_656_1576 306
402 3300035086 Ga0373934_0034650 Ga0373934_0034650_379_1299 306
403 3300035089 Ga0373944_0010032 Ga0373944_0010032_1221_2141 306
404 3300035113 Ga0373936_0016254 Ga0373936_0016254_260_1180 306
405 3300035117 Ga0373953_0010088 Ga0373953_0010088_1877_2797 306
406 3300035117 Ga0373953_0010516 Ga0373953_0010516_85_1005 306
407 3300035170 Ga0373943_0007994 Ga0373943_0007994_555_1475 306
408 3300035410 Ga0373924_0012841 Ga0373924_0012841_134_1054 306
409 3300035692 Ga0373935_0018309 Ga0373935_0018309_969_1892 306
410 3300035695 Ga0373927_0009651 Ga0373927_0009651_2578_3501 306
411 3300035695 Ga0373927_0012044 Ga0373927_0012044_4607_5527 306
412 3300035724 Ga0373933_0038369 Ga0373933_0038369_1156_2076 306
413 3300035724 Ga0373933_0169902 Ga0373933_0169902_78_998 306
414 3300035725 Ga0373947_0140362 Ga0373947_0140362_163_1086 306
415 3300036401 Ga0373937_0051281 Ga0373937_0051281_497_1417 306
416 3300037068 Ga0373925_0045644 Ga0373925_0045644_87_1010 306
417 3300037418 Ga0395900_0086570 Ga0395900_0086570_176_1096 306
418 3300037466 Ga0395898_0031255 Ga0395898_0031255_149_1069 306
419 3300038443 Ga0395901_0015985 Ga0395901_0015985_4495_5415 306
420 3300039437 Ga0436365_1446425 Ga0436365_1446425_4223_5146 306
421 3300039437 Ga0436365_1701898 Ga0436365_1701898_1052_1993 306
422 3300039438 Ga0436360_0973324 Ga0436360_0973324_2779_3699 306
423 3300039453 Ga0436362_0646134 Ga0436362_0646134_2715_3638 306
424 3300041486 Ga0451807_0866641 Ga0451807_0866641_19_984 306
425 3300042436 Ga0439435_0005933 Ga0439435_0005933_942_1913 306
426 3300046454 Ga0495592_0029636 Ga0495592_0029636_3165_4085 306
427 3300046455 Ga0495603_0086657 Ga0495603_0086657_595_1518 306
428 3300046455 Ga0495603_0088431 Ga0495603_0088431_550_1470 306
429 3300046459 Ga0495629_0018324 Ga0495629_0018324_3036_3956 306
430 3300046459 Ga0495629_0047563 Ga0495629_0047563_1876_2796 306
431 3300046460 Ga0495638_0102154 Ga0495638_0102154_10_978 306
432 3300046473 Ga0495582_0024440 Ga0495582_0024440_879_1799 306
433 3300046475 Ga0495639_0002472 Ga0495639_0002472_5579_6499 306
434 3300046477 Ga0495664_0065658 Ga0495664_0065658_1113_2033 306
435 3300046491 Ga0495584_0078966 Ga0495584_0078966_20_940 306
436 3300046501 Ga0495607_0052733 Ga0495607_0052733_623_1591 306
437 3300046507 Ga0495606_0021592 Ga0495606_0021592_1300_2220 306
438 3300046511 Ga0495608_0297531 Ga0495608_0297531_23_943 306
439 3300046512 Ga0495610_0013797 Ga0495610_0013797_2064_3032 306
440 3300046516 Ga0495628_0076574 Ga0495628_0076574_1134_2054 306
441 3300046517 Ga0495630_0060622 Ga0495630_0060622_1517_2437 306
442 3300046522 Ga0495643_0187015 Ga0495643_0187015_58_978 306
443 3300046524 Ga0495648_0002765 Ga0495648_0002765_13854_14777 306
444 3300046529 Ga0495652_0036021 Ga0495652_0036021_1786_2706 306
445 3300046533 Ga0495640_0034231 Ga0495640_0034231_89_1009 306
446 3300046536 Ga0495587_0156150 Ga0495587_0156150_285_1205 306
447 3300046538 Ga0495609_0060831 Ga0495609_0060831_78_998 306
448 3300046543 Ga0495645_0057669 Ga0495645_0057669_975_1895 306
449 3300046616 Ga0495668_0117104 Ga0495668_0117104_187_1107 306
450 3300046660 Ga0495625_0104873 Ga0495625_0104873_956_1876 306
451 3300046660 Ga0495625_0134358 Ga0495625_0134358_544_1512 306
452 3300046660 Ga0495625_0283504 Ga0495625_0283504_10_930 306
453 3300046663 Ga0495635_0273525 Ga0495635_0273525_160_1080 306
454 3300046674 Ga0495588_0014080 Ga0495588_0014080_1226_2146 306
455 3300046675 Ga0495657_0068527 Ga0495657_0068527_1047_1967 306
456 3300046680 Ga0495646_0011250 Ga0495646_0011250_4230_5150 306
457 3300046684 Ga0495669_0059741 Ga0495669_0059741_570_1490 306
458 3300046689 Ga0495613_0054197 Ga0495613_0054197_1098_2018 306
459 3300046691 Ga0495670_0093478 Ga0495670_0093478_299_1219 306
460 3300046694 Ga0495649_0062818 Ga0495649_0062818_623_1543 306
461 3300046809 Ga0495600_0088708 Ga0495600_0088708_96_1016 306
462 3300047315 Ga0495581_0016881 Ga0495581_0016881_1195_2115 306
463 3300047317 Ga0495604_0064832 Ga0495604_0064832_274_1194 306
464 3300047319 Ga0495674_0020768 Ga0495674_0020768_263_1183 306
465 3300047319 Ga0495674_0087826 Ga0495674_0087826_1238_2158 306
466 3300047323 Ga0495683_0066605 Ga0495683_0066605_649_1569 306
467 3300047470 Ga0495681_0082699 Ga0495681_0082699_255_1178 306
468 3300047471 Ga0495684_0009436 Ga0495684_0009436_350_1270 306
469 3300047472 Ga0495686_0073671 Ga0495686_0073671_1043_1963 306
470 3300047472 Ga0495686_0083618 Ga0495686_0083618_929_1897 306
471 3300048088 Ga0495602_0073245 Ga0495602_0073245_976_1896 306
472 3300048905 Ga0496102_0512470 Ga0496102_0512470_156_1076 306
473 3300048907 Ga0496104_0015916 Ga0496104_0015916_1990_2910 306
474 3300048908 Ga0496105_0034901 Ga0496105_0034901_1355_2275 306
475 3300048909 Ga0496106_0000649 Ga0496106_0000649_18132_19055 306
476 3300048914 Ga0496111_0203791 Ga0496111_0203791_138_1058 306
477 3300048917 Ga0496114_0071880 Ga0496114_0071880_1884_2804 306
478 3300048918 Ga0496115_0306974 Ga0496115_0306974_369_1289 306
479 3300048920 Ga0496117_0035578 Ga0496117_0035578_1445_2368 306
480 3300048923 Ga0496120_0070691 Ga0496120_0070691_664_1584 306
481 3300048924 Ga0496121_0000476 Ga0496121_0000476_67481_68404 306
482 3300048924 Ga0496121_0001742 Ga0496121_0001742_17652_18620 306
483 3300048924 Ga0496121_0003089 Ga0496121_0003089_18539_19459 306
484 3300048924 Ga0496121_0015642 Ga0496121_0015642_5122_6042 306
485 3300048924 Ga0496121_0050475 Ga0496121_0050475_1379_2299 306
486 3300048924 Ga0496121_0267741 Ga0496121_0267741_65_988 306
487 3300048925 Ga0496122_0024662 Ga0496122_0024662_1598_2521 306
488 3300048927 Ga0496124_0001128 Ga0496124_0001128_36587_37510 306
489 3300048928 Ga0496125_0000154 Ga0496125_0000154_40935_41855 306
490 3300048928 Ga0496125_0118101 Ga0496125_0118101_838_1758 306
491 3300048929 Ga0496126_0002744 Ga0496126_0002744_20040_20963 306
492 3300048929 Ga0496126_0006113 Ga0496126_0006113_3987_4907 306
493 3300048929 Ga0496126_0007435 Ga0496126_0007435_8601_9524 306
494 3300048929 Ga0496126_0020832 Ga0496126_0020832_3572_4492 306
495 3300048929 Ga0496126_0039244 Ga0496126_0039244_1643_2566 306
496 3300048929 Ga0496126_0134713 Ga0496126_0134713_211_1134 306
497 3300048929 Ga0496126_0140461 Ga0496126_0140461_411_1331 306
498 3300048929 Ga0496126_0199175 Ga0496126_0199175_302_1225 306
499 3300048929 Ga0496126_0214027 Ga0496126_0214027_25_948 306
500 3300049460 Ga0495682_0026452 Ga0495682_0026452_722_1642 306
501 3300049569 Ga0501032_0003534 Ga0501032_0003534_3877_4803 306
502 3300049570 Ga0501033_0000249 Ga0501033_0000249_25605_26531 306
503 3300049571 Ga0501034_0001938 Ga0501034_0001938_5556_6482 306
504 3300049572 Ga0501036_0004433 Ga0501036_0004433_5472_6398 306
505 3300049573 Ga0501037_0000112 Ga0501037_0000112_27068_27994 306
506 3300049574 Ga0501038_0000160 Ga0501038_0000160_45755_46681 306
507 3300049575 Ga0501039_0011683 Ga0501039_0011683_4318_5244 306
508 3300049579 Ga0501043_0000278 Ga0501043_0000278_28912_29838 306
509 3300049580 Ga0501046_0000937 Ga0501046_0000937_4420_5346 306
510 3300049581 Ga0501047_0000275 Ga0501047_0000275_39522_40448 306
511 3300049581 Ga0501047_0099683 Ga0501047_0099683_750_1670 306
512 3300049581 Ga0501047_0101290 Ga0501047_0101290_549_1520 306
513 3300049582 Ga0501048_0001248 Ga0501048_0001248_7019_7945 306
514 3300049583 Ga0501067_0000258 Ga0501067_0000258_11055_11981 306
515 3300049584 Ga0501068_0004146 Ga0501068_0004146_4642_5568 306
516 3300049586 Ga0501070_0002548 Ga0501070_0002548_6990_7916 306
517 3300049586 Ga0501070_0032601 Ga0501070_0032601_1423_2394 306
518 3300049586 Ga0501070_0053073 Ga0501070_0053073_232_1152 306
519 3300049588 Ga0501072_0006863 Ga0501072_0006863_7507_8433 306
520 3300049589 Ga0501073_0000103 Ga0501073_0000103_19936_20862 306
521 3300049589 Ga0501073_0039136 Ga0501073_0039136_428_1399 306
522 3300049590 Ga0501074_0000456 Ga0501074_0000456_22702_23628 306
523 3300049590 Ga0501074_0057827 Ga0501074_0057827_297_1268 306
524 3300049741 Ga0501079_0000451 Ga0501079_0000451_14429_15355 306
525 3300049742 Ga0501080_0002998 Ga0501080_0002998_10686_11612 306
526 3300049742 Ga0501080_0034657 Ga0501080_0034657_1945_2865 306
527 3300049744 Ga0501083_0013394 Ga0501083_0013394_4628_5554 306
528 3300049822 Ga0501035_0000766 Ga0501035_0000766_19936_20862 306
529 3300049822 Ga0501035_0164948 Ga0501035_0164948_105_1025 306
530 3300049823 Ga0501044_0000418 Ga0501044_0000418_46068_46994 306
531 3300049823 Ga0501044_0124517 Ga0501044_0124517_750_1670 306
532 3300049824 Ga0501045_0012804 Ga0501045_0012804_1314_2240 306
533 3300050489 nmdc:mga03683_35265_c1 nmdc:mga03683_35265_c1_915_1835 306
534 3300050491 nmdc:mga00v17_38224_c1 nmdc:mga00v17_38224_c1_132_1052 306
535 3300050492 nmdc:mga0yw44_11164_c1 nmdc:mga0yw44_11164_c1_659_1579 306
536 3300050492 nmdc:mga0yw44_20742_c1 nmdc:mga0yw44_20742_c1_2140_3060 306
537 3300050494 nmdc:mga06z11_96152_c1 nmdc:mga06z11_96152_c1_687_1607 306
538 3300050512 nmdc:mga0n895_58282_c1 nmdc:mga0n895_58282_c1_1035_1955 306
539 3300050513 nmdc:mga0rr50_27857_c1 nmdc:mga0rr50_27857_c1_1364_2284 306
540 3300053078 Ga0495612_0030040 Ga0495612_0030040_866_1786 306
541 3300053080 Ga0500635_0033309 Ga0500635_0033309_471_1394 306
542 3300053083 Ga0495655_0015009 Ga0495655_0015009_567_1487 306
543 3300053085 Ga0495619_0257420 Ga0495619_0257420_132_1052 306
544 3300053086 Ga0500578_0082036 Ga0500578_0082036_317_1237 306
545 3300053088 Ga0500644_0112491 Ga0500644_0112491_70_990 306
546 3300053091 Ga0500647_0094389 Ga0500647_0094389_69_992 306
547 3300053091 Ga0500647_0134900 Ga0500647_0134900_51_971 306
548 3300053094 Ga0500566_0000157 Ga0500566_0000157_2641_3609 306
549 3300053094 Ga0500566_0000185 Ga0500566_0000185_1788_2708 306
550 3300053094 Ga0500566_0001213 Ga0500566_0001213_14083_15003 306
551 3300053094 Ga0500566_0068124 Ga0500566_0068124_296_1219 306
552 3300053094 Ga0500566_0102983 Ga0500566_0102983_254_1174 306
553 3300053096 Ga0500641_0004632 Ga0500641_0004632_751_1719 306
554 3300053098 Ga0500650_0004834 Ga0500650_0004834_401_1369 306
555 3300053104 Ga0500556_0006938 Ga0500556_0006938_145_1065 306
556 3300053108 Ga0500562_044263 Ga0500562_044263_102_1070 306
557 3300053119 Ga0500595_022133 Ga0500595_022133_356_1276 306
558 3300053119 Ga0500595_075549 Ga0500595_075549_43_966 306
559 3300053121 Ga0500607_081709 Ga0500607_081709_91_1011 306
560 3300053122 Ga0500608_000908 Ga0500608_000908_1343_2266 306
561 3300053122 Ga0500608_056020 Ga0500608_056020_437_1357 306
562 3300053123 Ga0500614_001219 Ga0500614_001219_2265_3185 306
563 3300053131 Ga0500652_000531 Ga0500652_000531_2082_3050 306
564 3300053134 Ga0500658_0004847 Ga0500658_0004847_488_1456 306
565 3300053136 Ga0500559_0002089 Ga0500559_0002089_5040_5963 306
566 3300053136 Ga0500559_0004212 Ga0500559_0004212_5909_6829 306
567 3300053136 Ga0500559_0049182 Ga0500559_0049182_369_1292 306
568 3300053139 Ga0500568_0002109 Ga0500568_0002109_3239_4207 306
569 3300053139 Ga0500568_0018137 Ga0500568_0018137_1143_2066 306
570 3300053140 Ga0500573_0093412 Ga0500573_0093412_401_1324 306
571 3300053150 Ga0500603_002337 Ga0500603_002337_78_998 306
572 3300053150 Ga0500603_061618 Ga0500603_061618_114_1037 306
573 3300053151 Ga0500604_0005246 Ga0500604_0005246_1054_2022 306
574 3300053153 Ga0500616_0000180 Ga0500616_0000180_74083_75051 306
575 3300053154 Ga0500619_020846 Ga0500619_020846_502_1422 306
576 3300053155 Ga0500620_013290 Ga0500620_013290_99_1019 306
577 3300053156 Ga0500622_0012310 Ga0500622_0012310_40_960 306
578 3300053158 Ga0500627_0030591 Ga0500627_0030591_869_1837 306
579 3300053159 Ga0500630_137357 Ga0500630_137357_62_982 306
580 3300053160 Ga0500633_0115050 Ga0500633_0115050_45_965 306
581 3300053163 Ga0500639_000010 Ga0500639_000010_189_1109 306
582 3300053177 Ga0500636_0001916 Ga0500636_0001916_7083_8003 306
583 3300053178 Ga0500637_0029199 Ga0500637_0029199_43_966 306
584 3300053731 Ga0500609_006195 Ga0500609_006195_18_938 306
585 3300053735 Ga0500596_000760 Ga0500596_000760_43_966 306
586 3300053735 Ga0500596_002495 Ga0500596_002495_568_1488 306
587 3300053737 Ga0500601_000076 Ga0500601_000076_16119_17039 306
588 3300054114 Ga0501084_0003972 Ga0501084_0003972_4405_5331 306
589 3300005328 Ga0070676_10075380 Ga0070676_100753802 307
590 3300005338 Ga0068868_100222858 Ga0068868_1002228581 307
591 3300005344 Ga0070661_100073464 Ga0070661_1000734642 307
592 3300005347 Ga0070668_100124046 Ga0070668_1001240462 307
593 3300005354 Ga0070675_100136583 Ga0070675_1001365832 307
594 3300005434 Ga0070709_10007249 Ga0070709_100072495 307
595 3300005435 Ga0070714_100000678 Ga0070714_10000067811 307
596 3300005436 Ga0070713_100022313 Ga0070713_1000223132 307
597 3300005437 Ga0070710_10002407 Ga0070710_100024076 307
598 3300005439 Ga0070711_100011186 Ga0070711_1000111863 307
599 3300005439 Ga0070711_100027775 Ga0070711_1000277751 307
600 3300005439 Ga0070711_100242665 Ga0070711_1002426651 307
601 3300005455 Ga0070663_100047179 Ga0070663_1000471792 307
602 3300005455 Ga0070663_100149106 Ga0070663_1001491062 307
603 3300005457 Ga0070662_100301890 Ga0070662_1003018902 307
604 3300005530 Ga0070679_100024858 Ga0070679_1000248584 307
605 3300005535 Ga0070684_100300141 Ga0070684_1003001412 307
606 3300005539 Ga0068853_100038556 Ga0068853_1000385564 307
607 3300005547 Ga0070693_100191171 Ga0070693_1001911712 307
608 3300005577 Ga0068857_100102380 Ga0068857_1001023802 307
609 3300005615 Ga0070702_100068321 Ga0070702_1000683212 307
610 3300005617 Ga0068859_100069977 Ga0068859_1000699774 307
611 3300005618 Ga0068864_100047790 Ga0068864_1000477902 307
612 3300005618 Ga0068864_100129816 Ga0068864_1001298162 307
613 3300005719 Ga0068861_100032076 Ga0068861_1000320762 307
614 3300005842 Ga0068858_100021103 Ga0068858_1000211035 307
615 3300005843 Ga0068860_100051464 Ga0068860_1000514643 307
616 3300005844 Ga0068862_100250986 Ga0068862_1002509862 307
617 3300005937 Ga0081455_10053511 Ga0081455_100535112 307
618 3300005983 Ga0081540_1018033 Ga0081540_10180334 307
619 3300005983 Ga0081540_1032645 Ga0081540_10326452 307
620 3300006028 Ga0070717_10045372 Ga0070717_100453723 307
621 3300006042 Ga0075368_10035510 Ga0075368_100355102 307
622 3300006163 Ga0070715_10000078 Ga0070715_1000007816 307
623 3300006173 Ga0070716_100003281 Ga0070716_1000032816 307
624 3300006175 Ga0070712_100035217 Ga0070712_1000352173 307
625 3300006186 Ga0075369_10030560 Ga0075369_100305602 307
626 3300006195 Ga0075366_10180883 Ga0075366_101808832 307
627 3300006353 Ga0075370_10122191 Ga0075370_101221912 307
628 3300006358 Ga0068871_100114894 Ga0068871_1001148942 307
629 3300006931 Ga0097620_100069979 Ga0097620_1000699794 307
630 3300006942 Ga0099824_1021336 Ga0099824_10213363 307
631 3300006943 Ga0099822_1000022 Ga0099822_100002211 307
632 3300009093 Ga0105240_10312007 Ga0105240_103120072 307
633 3300009101 Ga0105247_10163988 Ga0105247_101639882 307
634 3300009174 Ga0105241_10056932 Ga0105241_100569322 307
635 3300009177 Ga0105248_10206743 Ga0105248_102067432 307
636 3300009177 Ga0105248_10263515 Ga0105248_102635152 307
637 3300009551 Ga0105238_10059830 Ga0105238_100598303 307
638 3300009551 Ga0105238_10568854 Ga0105238_105688542 307
639 3300010375 Ga0105239_10053854 Ga0105239_100538544 307
640 3300010375 Ga0105239_10111939 Ga0105239_101119392 307
641 3300011119 Ga0105246_10400177 Ga0105246_104001771 307
642 3300013105 Ga0157369_10577027 Ga0157369_105770272 307
643 3300013296 Ga0157374_10073258 Ga0157374_100732583 307
644 3300013297 Ga0157378_10092926 Ga0157378_100929262 307
645 3300013308 Ga0157375_10329304 Ga0157375_103293042 307
646 3300014969 Ga0157376_10016873 Ga0157376_100168734 307
647 3300025253 Ga0209677_103126 Ga0209677_1031264 307
648 3300025272 Ga0209455_1003833 Ga0209455_10038335 307
649 3300025297 Ga0209758_1006158 Ga0209758_10061585 307
650 3300025297 Ga0209758_1015210 Ga0209758_10152103 307
651 3300025321 Ga0207656_10126493 Ga0207656_101264932 307
652 3300025898 Ga0207692_10002540 Ga0207692_100025406 307
653 3300025900 Ga0207710_10104909 Ga0207710_101049092 307
654 3300025906 Ga0207699_10041162 Ga0207699_100411621 307
655 3300025906 Ga0207699_10059991 Ga0207699_100599911 307
656 3300025907 Ga0207645_10047695 Ga0207645_100476952 307
657 3300025909 Ga0207705_10287390 Ga0207705_102873902 307
658 3300025911 Ga0207654_10044099 Ga0207654_100440992 307
659 3300025912 Ga0207707_10000178 Ga0207707_100001788 307
660 3300025913 Ga0207695_10094476 Ga0207695_100944762 307
661 3300025913 Ga0207695_10206404 Ga0207695_102064042 307
662 3300025915 Ga0207693_10003503 Ga0207693_100035037 307
663 3300025915 Ga0207693_10010089 Ga0207693_100100892 307
664 3300025915 Ga0207693_10296888 Ga0207693_102968882 307
665 3300025916 Ga0207663_10014546 Ga0207663_100145462 307
666 3300025916 Ga0207663_10274823 Ga0207663_102748231 307
667 3300025921 Ga0207652_10019378 Ga0207652_100193783 307
668 3300025924 Ga0207694_10324074 Ga0207694_103240742 307
669 3300025927 Ga0207687_10146388 Ga0207687_101463882 307
670 3300025928 Ga0207700_10012153 Ga0207700_100121535 307
671 3300025928 Ga0207700_10164177 Ga0207700_101641772 307
672 3300025929 Ga0207664_10148771 Ga0207664_101487712 307
673 3300025939 Ga0207665_10000361 Ga0207665_1000036113 307
674 3300025941 Ga0207711_10071760 Ga0207711_100717602 307
675 3300025942 Ga0207689_10192800 Ga0207689_101928002 307
676 3300025945 Ga0207679_10082436 Ga0207679_100824362 307
677 3300025945 Ga0207679_10439769 Ga0207679_104397692 307
678 3300025960 Ga0207651_10037284 Ga0207651_100372842 307
679 3300025972 Ga0207668_10086130 Ga0207668_100861302 307
680 3300025981 Ga0207640_10085163 Ga0207640_100851632 307
681 3300026035 Ga0207703_10126978 Ga0207703_101269782 307
682 3300026067 Ga0207678_10042373 Ga0207678_100423732 307
683 3300026067 Ga0207678_10093916 Ga0207678_100939162 307
684 3300026095 Ga0207676_10114976 Ga0207676_101149762 307
685 3300026116 Ga0207674_10057562 Ga0207674_100575624 307
686 3300026116 Ga0207674_10082897 Ga0207674_100828972 307
687 3300026118 Ga0207675_100033143 Ga0207675_1000331433 307
688 3300026121 Ga0207683_10046756 Ga0207683_100467563 307
689 3300026121 Ga0207683_10088917 Ga0207683_100889172 307
690 3300026121 Ga0207683_10119774 Ga0207683_101197741 307
691 3300026121 Ga0207683_10185080 Ga0207683_101850802 307
692 3300026121 Ga0207683_10213368 Ga0207683_102133681 307
693 3300027357 Ga0209589_1000006 Ga0209589_1000006371 307
694 3300027361 Ga0209489_100007 Ga0209489_100007371 307
695 3300027363 Ga0209700_100008 Ga0209700_100008371 307
696 3300028379 Ga0268266_10006027 Ga0268266_100060273 307
697 3300028379 Ga0268266_10064115 Ga0268266_100641153 307
698 3300031238 Ga0265332_10026695 Ga0265332_100266952 307
699 3300031239 Ga0265328_10071431 Ga0265328_100714312 307
700 3300031507 Ga0307509_10162576 Ga0307509_101625762 307
701 3300031548 Ga0307408_100166051 Ga0307408_1001660512 307
702 3300033180 Ga0307510_10036621 Ga0307510_100366212 307
703 3300035086 Ga0373934_0009105 Ga0373934_0009105_1704_2672 307
704 3300035092 Ga0373952_0014882 Ga0373952_0014882_585_1508 307
705 3300035111 Ga0373923_0002407 Ga0373923_0002407_1453_2421 307
706 3300035117 Ga0373953_0001359 Ga0373953_0001359_4064_4987 307
707 3300035118 Ga0373954_0004556 Ga0373954_0004556_2575_3543 307
708 3300035119 Ga0373956_0003668 Ga0373956_0003668_1313_2236 307
709 3300035120 Ga0373957_0001068 Ga0373957_0001068_979_1947 307
710 3300035172 Ga0373955_0000880 Ga0373955_0000880_6857_7825 307
711 3300035410 Ga0373924_0023108 Ga0373924_0023108_293_1216 307
712 3300035695 Ga0373927_0066443 Ga0373927_0066443_492_1418 307
713 3300035724 Ga0373933_0002191 Ga0373933_0002191_4746_5669 307
714 3300036401 Ga0373937_0006578 Ga0373937_0006578_4527_5495 307
715 3300037471 Ga0395905_0162178 Ga0395905_0162178_1042_1965 307
716 3300037471 Ga0395905_0169899 Ga0395905_0169899_1029_1955 307
717 3300039437 Ga0436365_1714523 Ga0436365_1714523_509_1432 307
718 3300044683 Ga0466965_0180922 Ga0466965_0180922_147_1070 307
719 3300046452 Ga0495617_032623 Ga0495617_032623_309_1232 307
720 3300046454 Ga0495592_0008207 Ga0495592_0008207_1975_2943 307
721 3300046455 Ga0495603_0061679 Ga0495603_0061679_287_1210 307
722 3300046459 Ga0495629_0006765 Ga0495629_0006765_1879_2802 307
723 3300046460 Ga0495638_0126696 Ga0495638_0126696_371_1294 307
724 3300046461 Ga0495641_0018952 Ga0495641_0018952_2060_2983 307
725 3300046462 Ga0495651_0008150 Ga0495651_0008150_2801_3724 307
726 3300046463 Ga0495653_0012753 Ga0495653_0012753_3117_4085 307
727 3300046472 Ga0495580_0284450 Ga0495580_0284450_165_1088 307
728 3300046475 Ga0495639_0027091 Ga0495639_0027091_1189_2112 307
729 3300046475 Ga0495639_0080635 Ga0495639_0080635_340_1308 307
730 3300046492 Ga0495585_0047515 Ga0495585_0047515_387_1310 307
731 3300046499 Ga0495594_0046705 Ga0495594_0046705_423_1346 307
732 3300046500 Ga0495596_0019838 Ga0495596_0019838_1386_2309 307
733 3300046511 Ga0495608_0025279 Ga0495608_0025279_1104_2072 307
734 3300046516 Ga0495628_0005097 Ga0495628_0005097_8136_9059 307
735 3300046518 Ga0495631_0122414 Ga0495631_0122414_124_1047 307
736 3300046529 Ga0495652_0036122 Ga0495652_0036122_1981_2904 307
737 3300046533 Ga0495640_0043919 Ga0495640_0043919_1604_2527 307
738 3300046536 Ga0495587_0018218 Ga0495587_0018218_1452_2420 307
739 3300046538 Ga0495609_0047335 Ga0495609_0047335_710_1633 307
740 3300046558 Ga0495633_0104201 Ga0495633_0104201_241_1164 307
741 3300046559 Ga0495667_0005829 Ga0495667_0005829_1981_2904 307
742 3300046616 Ga0495668_0020542 Ga0495668_0020542_2547_3470 307
743 3300046616 Ga0495668_0100746 Ga0495668_0100746_398_1321 307
744 3300046642 Ga0495634_0015616 Ga0495634_0015616_4097_5020 307
745 3300046648 Ga0495611_0063207 Ga0495611_0063207_65_988 307
746 3300046663 Ga0495635_0003846 Ga0495635_0003846_4067_5035 307
747 3300046674 Ga0495588_0054866 Ga0495588_0054866_687_1610 307
748 3300046675 Ga0495657_0006927 Ga0495657_0006927_5283_6206 307
749 3300046678 Ga0495599_0001556 Ga0495599_0001556_5521_6444 307
750 3300046679 Ga0495623_0009107 Ga0495623_0009107_2717_3685 307
751 3300046680 Ga0495646_0001918 Ga0495646_0001918_7648_8571 307
752 3300046689 Ga0495613_0030472 Ga0495613_0030472_1203_2171 307
753 3300046691 Ga0495670_0169746 Ga0495670_0169746_215_1138 307
754 3300046809 Ga0495600_0002229 Ga0495600_0002229_8736_9659 307
755 3300047317 Ga0495604_0007916 Ga0495604_0007916_2027_2950 307
756 3300047319 Ga0495674_0021792 Ga0495674_0021792_4567_5490 307
757 3300047320 Ga0495672_0139134 Ga0495672_0139134_155_1078 307
758 3300047321 Ga0495676_0029475 Ga0495676_0029475_2547_3470 307
759 3300047322 Ga0495680_0012862 Ga0495680_0012862_2471_3394 307
760 3300047444 Ga0495675_0003321 Ga0495675_0003321_6729_7697 307
761 3300047471 Ga0495684_0000893 Ga0495684_0000893_8159_9082 307
762 3300047673 Ga0495593_0005088 Ga0495593_0005088_3474_4397 307
763 3300048088 Ga0495602_0030283 Ga0495602_0030283_1611_2534 307
764 3300048903 Ga0496100_0026796 Ga0496100_0026796_1143_2066 307
765 3300048903 Ga0496100_0054241 Ga0496100_0054241_1222_2193 307
766 3300048904 Ga0496101_0005889 Ga0496101_0005889_2021_2944 307
767 3300048904 Ga0496101_0040575 Ga0496101_0040575_1888_2814 307
768 3300048905 Ga0496102_0018779 Ga0496102_0018779_4474_5397 307
769 3300048905 Ga0496102_0079901 Ga0496102_0079901_380_1303 307
770 3300048905 Ga0496102_0162404 Ga0496102_0162404_243_1166 307
771 3300048906 Ga0496103_0067665 Ga0496103_0067665_589_1512 307
772 3300048907 Ga0496104_0119316 Ga0496104_0119316_1232_2155 307
773 3300048908 Ga0496105_0051207 Ga0496105_0051207_373_1296 307
774 3300048908 Ga0496105_0171635 Ga0496105_0171635_447_1418 307
775 3300048909 Ga0496106_0049265 Ga0496106_0049265_1190_2113 307
776 3300048909 Ga0496106_0226889 Ga0496106_0226889_251_1177 307
777 3300048910 Ga0496107_0173474 Ga0496107_0173474_558_1481 307
778 3300048911 Ga0496108_0065905 Ga0496108_0065905_665_1588 307
779 3300048912 Ga0496109_0044561 Ga0496109_0044561_1062_1985 307
780 3300048913 Ga0496110_0013275 Ga0496110_0013275_1088_2014 307
781 3300048913 Ga0496110_0021544 Ga0496110_0021544_174_1145 307
782 3300048913 Ga0496110_0051830 Ga0496110_0051830_876_1799 307
783 3300048913 Ga0496110_0100133 Ga0496110_0100133_1175_2098 307
784 3300048914 Ga0496111_0282788 Ga0496111_0282788_135_1061 307
785 3300048915 Ga0496112_0000008 Ga0496112_0000008_10283_11209 307
786 3300048915 Ga0496112_0035784 Ga0496112_0035784_836_1759 307
787 3300048916 Ga0496113_0013405 Ga0496113_0013405_2066_3037 307
788 3300048916 Ga0496113_0066226 Ga0496113_0066226_656_1627 307
789 3300048916 Ga0496113_0083617 Ga0496113_0083617_1229_2152 307
790 3300048917 Ga0496114_0015763 Ga0496114_0015763_1062_1985 307
791 3300048917 Ga0496114_0028100 Ga0496114_0028100_2069_3040 307
792 3300048917 Ga0496114_0195583 Ga0496114_0195583_207_1178 307
793 3300048918 Ga0496115_0007272 Ga0496115_0007272_4342_5265 307
794 3300048920 Ga0496117_0047573 Ga0496117_0047573_69_992 307
795 3300048920 Ga0496117_0166291 Ga0496117_0166291_268_1191 307
796 3300048923 Ga0496120_0060061 Ga0496120_0060061_45_1013 307
797 3300048924 Ga0496121_0017380 Ga0496121_0017380_3316_4299 307
798 3300048924 Ga0496121_0037277 Ga0496121_0037277_1964_2887 307
799 3300048924 Ga0496121_0050757 Ga0496121_0050757_2061_2984 307
800 3300048924 Ga0496121_0077328 Ga0496121_0077328_1370_2293 307
801 3300048929 Ga0496126_0032430 Ga0496126_0032430_3264_4187 307
802 3300049569 Ga0501032_0046657 Ga0501032_0046657_956_1879 307
803 3300049570 Ga0501033_0057802 Ga0501033_0057802_1495_2418 307
804 3300049570 Ga0501033_0191694 Ga0501033_0191694_134_1057 307
805 3300049571 Ga0501034_0150382 Ga0501034_0150382_693_1616 307
806 3300049572 Ga0501036_0026547 Ga0501036_0026547_2687_3610 307
807 3300049573 Ga0501037_0025895 Ga0501037_0025895_1495_2418 307
808 3300049578 Ga0501042_0074151 Ga0501042_0074151_1381_2304 307
809 3300049581 Ga0501047_0018665 Ga0501047_0018665_2096_3019 307
810 3300049582 Ga0501048_0011414 Ga0501048_0011414_253_1176 307
811 3300049586 Ga0501070_0024977 Ga0501070_0024977_1700_2623 307
812 3300049589 Ga0501073_0086595 Ga0501073_0086595_1124_2047 307
813 3300049590 Ga0501074_0001612 Ga0501074_0001612_1916_2839 307
814 3300049742 Ga0501080_0000082 Ga0501080_0000082_6332_7255 307
815 3300049744 Ga0501083_0053952 Ga0501083_0053952_130_1053 307
816 3300049823 Ga0501044_0034063 Ga0501044_0034063_3143_4066 307
817 3300049824 Ga0501045_0054354 Ga0501045_0054354_1975_2898 307
818 3300050492 nmdc:mga0yw44_1397_c1 nmdc:mga0yw44_1397_c1_6488_7411 307
819 3300050492 nmdc:mga0yw44_21662_c1 nmdc:mga0yw44_21662_c1_1139_2062 307
820 3300050494 nmdc:mga06z11_84367_c1 nmdc:mga06z11_84367_c1_505_1428 307
821 3300050496 nmdc:mga07m45_45292_c1 nmdc:mga07m45_45292_c1_1409_2332 307
822 3300050507 nmdc:mga05p37_62404_c1 nmdc:mga05p37_62404_c1_1996_2919 307
823 3300050511 nmdc:mga08y16_184530_c1 nmdc:mga08y16_184530_c1_630_1568 307
824 3300050513 nmdc:mga0rr50_138146_c1 nmdc:mga0rr50_138146_c1_436_1359 307
825 3300053077 Ga0495601_0009529 Ga0495601_0009529_1072_2040 307
826 3300053084 Ga0495595_0002085 Ga0495595_0002085_4381_5349 307
827 3300053085 Ga0495619_0005598 Ga0495619_0005598_2471_3394 307
828 3300053085 Ga0495619_0104527 Ga0495619_0104527_398_1324 307
829 3300053087 Ga0500643_060145 Ga0500643_060145_17_940 307
830 3300053111 Ga0500572_000384 Ga0500572_000384_14700_15623 307
831 3300053118 Ga0500594_0016712 Ga0500594_0016712_741_1709 307
832 3300053136 Ga0500559_0000863 Ga0500559_0000863_1377_2300 307
833 3300053142 Ga0500577_0000693 Ga0500577_0000693_6508_7434 307
834 3300053161 Ga0500634_0039122 Ga0500634_0039122_402_1370 307
835 3300001979 JGI24740J21852_10002709 JGI24740J21852_100027093 308
836 3300002067 JGI24735J21928_10027115 JGI24735J21928_100271152 308
837 3300005457 Ga0070662_100126252 Ga0070662_1001262522 308
838 3300005539 Ga0068853_100010311 Ga0068853_1000103115 308
839 3300005539 Ga0068853_100020454 Ga0068853_1000204544 308
840 3300005563 Ga0068855_100038269 Ga0068855_1000382693 308
841 3300005563 Ga0068855_100061366 Ga0068855_1000613662 308
842 3300005577 Ga0068857_100012881 Ga0068857_1000128815 308
843 3300005578 Ga0068854_100054912 Ga0068854_1000549122 308
844 3300005614 Ga0068856_100042057 Ga0068856_1000420573 308
845 3300005614 Ga0068856_100096425 Ga0068856_1000964252 308
846 3300005616 Ga0068852_100164733 Ga0068852_1001647332 308
847 3300005834 Ga0068851_10001608 Ga0068851_100016086 308
848 3300006178 Ga0075367_10085301 Ga0075367_100853013 308
849 3300006358 Ga0068871_100520825 Ga0068871_1005208251 308
850 3300009093 Ga0105240_10048232 Ga0105240_100482324 308
851 3300009093 Ga0105240_10095268 Ga0105240_100952683 308
852 3300009551 Ga0105238_10206407 Ga0105238_102064073 308
853 3300010375 Ga0105239_10028113 Ga0105239_100281133 308
854 3300021377 Ga0213874_10030551 Ga0213874_100305512 308
855 3300025321 Ga0207656_10005032 Ga0207656_100050322 308
856 3300025911 Ga0207654_10000323 Ga0207654_100003239 308
857 3300025913 Ga0207695_10000497 Ga0207695_1000049715 308
858 3300025914 Ga0207671_10120899 Ga0207671_101208992 308
859 3300025924 Ga0207694_10000212 Ga0207694_1000021243 308
860 3300025949 Ga0207667_10047369 Ga0207667_100473694 308
861 3300025981 Ga0207640_10016944 Ga0207640_100169442 308
862 3300026041 Ga0207639_10002809 Ga0207639_100028097 308
863 3300026041 Ga0207639_10065321 Ga0207639_100653213 308
864 3300026067 Ga0207678_10098556 Ga0207678_100985562 308
865 3300026078 Ga0207702_10000003 Ga0207702_10000003390 308
866 3300026116 Ga0207674_10004756 Ga0207674_1000475610 308
867 3300026142 Ga0207698_10054008 Ga0207698_100540082 308
868 3300035695 Ga0373927_0062867 Ga0373927_0062867_568_1497 308
869 3300037466 Ga0395898_0134726 Ga0395898_0134726_716_1648 308
870 3300038443 Ga0395901_0060097 Ga0395901_0060097_441_1415 308
871 3300039437 Ga0436365_1936932 Ga0436365_1936932_11_937 308
872 3300039450 Ga0436363_0302413 Ga0436363_0302413_117_1043 308
873 3300048904 Ga0496101_0138157 Ga0496101_0138157_839_1792 308
874 3300048905 Ga0496102_0262307 Ga0496102_0262307_226_1179 308
875 3300048913 Ga0496110_0199664 Ga0496110_0199664_530_1483 308
876 3300048929 Ga0496126_0182221 Ga0496126_0182221_519_1469 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

228

327

0.98

PF01565

FAD_binding_4

FAD binding domain

64

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9458 8 304
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9434 10 306
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9395 6 307
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9372 10 306
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9277 8 304
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9818 225 306 3.90.78.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9501 94 219 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9328 94 219 3.30.465.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9287 94 219 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9256 94 219 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A442AS35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate dehydrogenase) 0.9976 103 202 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A3N5RV35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9909 227 304 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A7W2GW92-F1-model_v4 deleted 0.9905 1 308
AF-A0A0Q6EY45-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9881 6 306 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A7W2GW92-F1-model_v4 deleted 0.9873 1 308

Feature Viewer

pLDDT pTM Quality
92.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map