F484229

General Info

Members Datasets Scaffolds Average Seq Length
872 210 872 279

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0038125|Ga0466964_0038125_1004_1918
Length 304
Sequence MCAGRNVGYIPKPISTGGPMDSVEELQREPEPVRSSDAVQVQAGAYLLELSLDWIVLRASENIHQLLHESHVTLIDEPLGRFVHAQALHDLRNLFSRLSGTTGIGRAYGIRLTDDPDLVDVAFQLSGGCVILEIVPSVGAFGECFGSVGXXXSGLSSTHGRALLDNAVRRMRALTGYDRVTLVCGNERAESSRGAFVAPNAMEDVPIILADVDAKSVPLFPRDAEDASAAAALMRAPDPAPLGRLRDQDIRACIRVPFAFDGISGEFRCDSRTPREPCFELHAAAELFAQLFAMRLEIDELKNG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
171 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.08
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002638 3300001904 Bacteria 3145
2 JGI24741J21665_1003963 3300001915 Bacteria 3389
3 JGI24740J21852_10000524 3300001979 Bacteria 16364
4 JGI24739J22299_10003933 3300001989 Bacteria 5684
5 JGI24739J22299_10022381 3300001989 Bacteria 2243
6 JGI24737J22298_10000013 3300001990 Bacteria 50248
7 JGI24737J22298_10004701 3300001990 Bacteria 4747
8 JGI24737J22298_10011601 3300001990 Bacteria 2884
9 JGI24737J22298_10033652 3300001990 Bacteria 1591
10 JGI24735J21928_10007239 3300002067 Bacteria 3620
11 JGI24735J21928_10021938 3300002067 Bacteria 1947
12 JGI24745J21846_1000406 3300002073 Bacteria 3796
13 JGI24744J21845_10000820 3300002077 Bacteria 5849
14 rootH1_10202900 3300003323 Bacteria 1243
15 Ga0070658_10005366 3300005327 Bacteria 10403
16 Ga0070658_10015623 3300005327 Bacteria 6071
17 Ga0070658_10018278 3300005327 Bacteria 5611
18 Ga0070658_10036564 3300005327 Bacteria 3958
19 Ga0070658_10038774 3300005327 Bacteria 3842
20 Ga0070658_10052230 3300005327 Bacteria 3314
21 Ga0070658_10085350 3300005327 Bacteria 2596
22 Ga0070658_10172212 3300005327 Bacteria 1819
23 Ga0070658_10243857 3300005327 Bacteria 1523
24 Ga0070658_10455538 3300005327 Bacteria 1102
25 Ga0070676_10026474 3300005328 Bacteria 3284
26 Ga0070676_10038899 3300005328 Bacteria 2749
27 Ga0070676_10113521 3300005328 Bacteria 1691
28 Ga0070683_100004214 3300005329 Bacteria 11788
29 Ga0070683_100019383 3300005329 Bacteria 6041
30 Ga0070683_100395403 3300005329 Bacteria 1318
31 Ga0070690_100078537 3300005330 Bacteria 2156
32 Ga0070670_100008324 3300005331 Bacteria 8840
33 Ga0070670_100015506 3300005331 Bacteria 6544
34 Ga0070670_100059784 3300005331 Bacteria 3271
35 Ga0070670_100160232 3300005331 Bacteria 1950
36 Ga0070670_100192242 3300005331 Bacteria 1773
37 Ga0070677_10008665 3300005333 Bacteria 3430
38 Ga0068869_100017634 3300005334 Bacteria 4844
39 Ga0068869_100300457 3300005334 Bacteria 1296
40 Ga0070666_10000676 3300005335 Bacteria 20635
41 Ga0070666_10005096 3300005335 Bacteria 8039
42 Ga0070666_10012189 3300005335 Bacteria 5416
43 Ga0070666_10056343 3300005335 Bacteria 2654
44 Ga0070666_10258447 3300005335 Bacteria 1234
45 Ga0070680_100009837 3300005336 Bacteria 7360
46 Ga0070680_100015497 3300005336 Bacteria 5978
47 Ga0070680_100023111 3300005336 Bacteria 4956
48 Ga0070680_100046334 3300005336 Bacteria 3537
49 Ga0070680_100087880 3300005336 Bacteria 2571
50 Ga0070680_100227350 3300005336 Bacteria 1575
51 Ga0070680_100344839 3300005336 Bacteria 1266
52 Ga0070682_100156184 3300005337 Bacteria 1571
53 Ga0068868_100001197 3300005338 Bacteria 17815
54 Ga0068868_100005097 3300005338 Bacteria 9220
55 Ga0068868_100170341 3300005338 Bacteria 1802
56 Ga0070660_100002755 3300005339 Bacteria 12069
57 Ga0070660_100039600 3300005339 Bacteria 3583
58 Ga0070660_100074699 3300005339 Bacteria 2652
59 Ga0070660_100150219 3300005339 Bacteria 1873
60 Ga0070660_100163330 3300005339 Bacteria 1795
61 Ga0070660_100196960 3300005339 Bacteria 1633
62 Ga0070660_100241684 3300005339 Bacteria 1471
63 Ga0070660_100263745 3300005339 Bacteria 1407
64 Ga0070660_100316924 3300005339 Bacteria 1280
65 Ga0070660_100322021 3300005339 Bacteria 1270
66 Ga0070660_100483902 3300005339 Bacteria 1028
67 Ga0070661_100016675 3300005344 Bacteria 5197
68 Ga0070661_100043607 3300005344 Bacteria 3276
69 Ga0070661_100060728 3300005344 Bacteria 2773
70 Ga0070661_100091662 3300005344 Bacteria 2251
71 Ga0070661_100207239 3300005344 Bacteria 1500
72 Ga0070661_100221700 3300005344 Bacteria 1451
73 Ga0070661_100276005 3300005344 Bacteria 1303
74 Ga0070661_100399998 3300005344 Bacteria 1086
75 Ga0070661_100503560 3300005344 Unclassified 970
76 Ga0070692_10009097 3300005345 Bacteria 4463
77 Ga0070692_10096125 3300005345 Bacteria 1618
78 Ga0070692_10111785 3300005345 Bacteria 1512
79 Ga0070668_100197844 3300005347 Bacteria 1649
80 Ga0070668_100333857 3300005347 Bacteria 1279
81 Ga0070668_100463393 3300005347 Unclassified 1092
82 Ga0070669_100048989 3300005353 Bacteria 3085
83 Ga0070669_100083839 3300005353 Bacteria 2377
84 Ga0070675_100056604 3300005354 Bacteria 3231
85 Ga0070675_100075957 3300005354 Bacteria 2794
86 Ga0070675_100211219 3300005354 Bacteria 1687
87 Ga0070671_100000664 3300005355 Bacteria 24709
88 Ga0070671_100000884 3300005355 Bacteria 21921
89 Ga0070671_100001626 3300005355 Bacteria 16939
90 Ga0070671_100002896 3300005355 Bacteria 13357
91 Ga0070671_100003087 3300005355 Bacteria 12960
92 Ga0070671_100030518 3300005355 Bacteria 4448
93 Ga0070671_100056620 3300005355 Bacteria 3262
94 Ga0070671_100062806 3300005355 Bacteria 3092
95 Ga0070671_100082777 3300005355 Bacteria 2684
96 Ga0070671_100215920 3300005355 Bacteria 1627
97 Ga0070674_100011775 3300005356 Bacteria 5338
98 Ga0070674_100061405 3300005356 Bacteria 2623
99 Ga0070674_100130024 3300005356 Bacteria 1876
100 Ga0070673_100015057 3300005364 Bacteria 5414
101 Ga0070673_100021034 3300005364 Bacteria 4720
102 Ga0070673_100062799 3300005364 Bacteria 2953
103 Ga0070673_100330222 3300005364 Bacteria 1349
104 Ga0070673_100382049 3300005364 Bacteria 1256
105 Ga0070659_100012489 3300005366 Bacteria 6298
106 Ga0070659_100028070 3300005366 Bacteria 4343
107 Ga0070659_100032340 3300005366 Bacteria 4056
108 Ga0070659_100162611 3300005366 Bacteria 1826
109 Ga0070659_100348733 3300005366 Bacteria 1241
110 Ga0070659_100371080 3300005366 Bacteria 1204
111 Ga0070667_100005169 3300005367 Bacteria 10915
112 Ga0070667_100005732 3300005367 Bacteria 10377
113 Ga0070667_100005958 3300005367 Bacteria 10137
114 Ga0070667_100017920 3300005367 Bacteria 5869
115 Ga0070667_100026954 3300005367 Bacteria 4780
116 Ga0070667_100036617 3300005367 Bacteria 4114
117 Ga0070667_100171827 3300005367 Bacteria 1914
118 Ga0070667_100176152 3300005367 Bacteria 1890
119 Ga0070709_10004417 3300005434 Bacteria 7585
120 Ga0070714_100023934 3300005435 Bacteria 5023
121 Ga0070714_100037609 3300005435 Bacteria 4068
122 Ga0070714_100064796 3300005435 Bacteria 3146
123 Ga0070714_100150835 3300005435 Bacteria 2095
124 Ga0070713_100308898 3300005436 Bacteria 1458
125 Ga0070713_100423523 3300005436 Bacteria 1246
126 Ga0070663_100011022 3300005455 Bacteria 5657
127 Ga0070663_100013613 3300005455 Bacteria 5192
128 Ga0070663_100028501 3300005455 Bacteria 3802
129 Ga0070663_100066675 3300005455 Bacteria 2609
130 Ga0070663_100101816 3300005455 Bacteria 2144
131 Ga0070663_100457815 3300005455 Bacteria 1053
132 Ga0070678_100002351 3300005456 Bacteria 10333
133 Ga0070678_100003214 3300005456 Bacteria 9068
134 Ga0070678_100056269 3300005456 Bacteria 2876
135 Ga0070678_100080405 3300005456 Bacteria 2468
136 Ga0070662_100011952 3300005457 Bacteria 5741
137 Ga0070662_100016897 3300005457 Bacteria 4905
138 Ga0070662_100039121 3300005457 Bacteria 3373
139 Ga0070662_100109320 3300005457 Bacteria 2104
140 Ga0070662_100136256 3300005457 Bacteria 1898
141 Ga0070662_100269653 3300005457 Bacteria 1374
142 Ga0070681_10049774 3300005458 Bacteria 4183
143 Ga0070681_10074862 3300005458 Bacteria 3347
144 Ga0070681_10314258 3300005458 Bacteria 1476
145 Ga0070681_10343364 3300005458 Bacteria 1403
146 Ga0068867_100057431 3300005459 Bacteria 2882
147 Ga0068867_100077433 3300005459 Bacteria 2499
148 Ga0070685_10313855 3300005466 Bacteria 1060
149 Ga0070679_100140850 3300005530 Bacteria 2391
150 Ga0070679_100156215 3300005530 Bacteria 2256
151 Ga0070679_100213358 3300005530 Bacteria 1893
152 Ga0070679_100323750 3300005530 Bacteria 1490
153 Ga0070684_100033771 3300005535 Bacteria 4371
154 Ga0070684_100129989 3300005535 Bacteria 2271
155 Ga0070684_100166981 3300005535 Bacteria 1998
156 Ga0068853_100034134 3300005539 Bacteria 4317
157 Ga0068853_100058528 3300005539 Bacteria 3326
158 Ga0068853_100066522 3300005539 Bacteria 3130
159 Ga0068853_100220830 3300005539 Bacteria 1730
160 Ga0068853_100283103 3300005539 Bacteria 1529
161 Ga0068853_100283753 3300005539 Bacteria 1527
162 Ga0068853_100717263 3300005539 Unclassified 954
163 Ga0070672_100021632 3300005543 Bacteria 4710
164 Ga0070672_100038203 3300005543 Bacteria 3667
165 Ga0070672_100377224 3300005543 Bacteria 1212
166 Ga0070672_100393883 3300005543 Bacteria 1186
167 Ga0070696_100304558 3300005546 Bacteria 1221
168 Ga0070693_100196213 3300005547 Bacteria 1308
169 Ga0070665_100007593 3300005548 Bacteria 11027
170 Ga0070665_100032978 3300005548 Bacteria 5210
171 Ga0070665_100170233 3300005548 Bacteria 2179
172 Ga0070665_100200788 3300005548 Bacteria 1994
173 Ga0068855_100082151 3300005563 Bacteria 3735
174 Ga0068855_100162666 3300005563 Bacteria 2532
175 Ga0068855_100301565 3300005563 Bacteria 1774
176 Ga0068855_100310754 3300005563 Bacteria 1744
177 Ga0070664_100001029 3300005564 Bacteria 21907
178 Ga0070664_100004698 3300005564 Bacteria 10954
179 Ga0070664_100005620 3300005564 Bacteria 10089
180 Ga0070664_100010503 3300005564 Bacteria 7503
181 Ga0070664_100022153 3300005564 Bacteria 5241
182 Ga0070664_100046784 3300005564 Bacteria 3655
183 Ga0070664_100052712 3300005564 Bacteria 3446
184 Ga0070664_100061139 3300005564 Bacteria 3209
185 Ga0070664_100070073 3300005564 Bacteria 3002
186 Ga0070664_100214000 3300005564 Bacteria 1722
187 Ga0070664_100429283 3300005564 Bacteria 1211
188 Ga0068857_100006626 3300005577 Bacteria 9948
189 Ga0068857_100042369 3300005577 Bacteria 4038
190 Ga0068857_100223251 3300005577 Bacteria 1721
191 Ga0068857_100457837 3300005577 Bacteria 1193
192 Ga0068854_100010446 3300005578 Bacteria 6021
193 Ga0068854_100022935 3300005578 Bacteria 4259
194 Ga0068854_100034546 3300005578 Bacteria 3533
195 Ga0068854_100089106 3300005578 Bacteria 2292
196 Ga0068854_100122320 3300005578 Bacteria 1978
197 Ga0068854_100239537 3300005578 Bacteria 1444
198 Ga0068856_100037398 3300005614 Bacteria 4763
199 Ga0068856_100117722 3300005614 Bacteria 2658
200 Ga0068856_100125251 3300005614 Bacteria 2572
201 Ga0068856_100249193 3300005614 Bacteria 1791
202 Ga0068856_100327452 3300005614 Bacteria 1550
203 Ga0068856_100334534 3300005614 Bacteria 1532
204 Ga0068856_100433279 3300005614 Bacteria 1335
205 Ga0068856_100519778 3300005614 Bacteria 1211
206 Ga0068856_100545126 3300005614 Bacteria 1181
207 Ga0068852_100000577 3300005616 Bacteria 24126
208 Ga0068852_100003793 3300005616 Bacteria 10601
209 Ga0068852_100031038 3300005616 Bacteria 4404
210 Ga0068852_100042423 3300005616 Bacteria 3852
211 Ga0068852_100070324 3300005616 Bacteria 3070
212 Ga0068852_100075881 3300005616 Bacteria 2967
213 Ga0068852_100174400 3300005616 Bacteria 2018
214 Ga0068852_100202793 3300005616 Bacteria 1877
215 Ga0068852_100340511 3300005616 Bacteria 1461
216 Ga0068859_100000689 3300005617 Bacteria 33880
217 Ga0068859_100033751 3300005617 Bacteria 5138
218 Ga0068859_100104271 3300005617 Bacteria 2895
219 Ga0068859_100126120 3300005617 Bacteria 2629
220 Ga0068859_100339635 3300005617 Bacteria 1596
221 Ga0068864_100001152 3300005618 Bacteria 21995
222 Ga0068864_100009641 3300005618 Bacteria 7966
223 Ga0068864_100019212 3300005618 Bacteria 5712
224 Ga0068864_100041771 3300005618 Bacteria 3922
225 Ga0068864_100087574 3300005618 Bacteria 2742
226 Ga0068864_100094296 3300005618 Bacteria 2645
227 Ga0068864_100257891 3300005618 Bacteria 1621
228 Ga0068864_100383637 3300005618 Unclassified 1332
229 Ga0068864_100497469 3300005618 Bacteria 1172
230 Ga0068866_10102341 3300005718 Bacteria 1582
231 Ga0068866_10162074 3300005718 Bacteria 1305
232 Ga0068851_10016082 3300005834 Bacteria 3575
233 Ga0068851_10035033 3300005834 Bacteria 2508
234 Ga0068851_10191352 3300005834 Bacteria 1137
235 Ga0068863_100004516 3300005841 Bacteria 13729
236 Ga0068863_100006440 3300005841 Bacteria 11514
237 Ga0068863_100034025 3300005841 Bacteria 4854
238 Ga0068863_100058157 3300005841 Bacteria 3659
239 Ga0068863_100371655 3300005841 Bacteria 1395
240 Ga0068858_100000956 3300005842 Bacteria 29895
241 Ga0068858_100014786 3300005842 Bacteria 7343
242 Ga0068858_100015797 3300005842 Bacteria 7100
243 Ga0068858_100065826 3300005842 Bacteria 3354
244 Ga0068858_100079042 3300005842 Bacteria 3056
245 Ga0068858_100138989 3300005842 Bacteria 2280
246 Ga0068860_100020647 3300005843 Bacteria 6381
247 Ga0068860_100039503 3300005843 Bacteria 4514
248 Ga0068860_100101168 3300005843 Bacteria 2750
249 Ga0068860_100105955 3300005843 Bacteria 2685
250 Ga0068862_100007859 3300005844 Bacteria 8823
251 Ga0068862_100013464 3300005844 Bacteria 6771
252 Ga0068862_100069269 3300005844 Bacteria 3045
253 Ga0081539_10039556 3300005985 Bacteria 2780
254 Ga0070717_10029647 3300006028 Bacteria 4391
255 Ga0070717_10373070 3300006028 Bacteria 1278
256 Ga0097621_100026196 3300006237 Bacteria 4571
257 Ga0097621_100031637 3300006237 Bacteria 4200
258 Ga0068871_100012548 3300006358 Bacteria 6254
259 Ga0068871_100025919 3300006358 Bacteria 4569
260 Ga0068871_100098606 3300006358 Bacteria 2445
261 Ga0068865_100001644 3300006881 Bacteria 13101
262 Ga0068865_100224798 3300006881 Bacteria 1469
263 Ga0097620_100000689 3300006931 Bacteria 33880
264 Ga0097620_100033752 3300006931 Bacteria 5138
265 Ga0097620_100104266 3300006931 Bacteria 2895
266 Ga0097620_100126116 3300006931 Bacteria 2629
267 Ga0097620_100339649 3300006931 Bacteria 1596
268 Ga0105250_10015441 3300009092 Bacteria 3126
269 Ga0105240_10035361 3300009093 Bacteria 6440
270 Ga0105240_10065735 3300009093 Bacteria 4501
271 Ga0111539_10122757 3300009094 Bacteria 3044
272 Ga0105245_10022225 3300009098 Bacteria 5568
273 Ga0105245_10122449 3300009098 Bacteria 2431
274 Ga0105245_10479925 3300009098 Bacteria 1256
275 Ga0105245_10642608 3300009098 Unclassified 1091
276 Ga0105247_10191850 3300009101 Unclassified 1368
277 Ga0114129_10364199 3300009147 Bacteria 1912
278 Ga0105243_10227272 3300009148 Bacteria 1653
279 Ga0105243_10353928 3300009148 Bacteria 1349
280 Ga0105243_10524241 3300009148 Bacteria 1127
281 Ga0105242_10018851 3300009176 Bacteria 5403
282 Ga0105248_10001002 3300009177 Bacteria 31241
283 Ga0105248_10005826 3300009177 Bacteria 13544
284 Ga0105248_10030936 3300009177 Bacteria 5980
285 Ga0105248_10067362 3300009177 Bacteria 4019
286 Ga0105248_10070621 3300009177 Bacteria 3921
287 Ga0105248_10077998 3300009177 Bacteria 3725
288 Ga0105248_10084103 3300009177 Bacteria 3579
289 Ga0105248_10090603 3300009177 Bacteria 3443
290 Ga0105248_10093609 3300009177 Bacteria 3384
291 Ga0105248_10112097 3300009177 Bacteria 3077
292 Ga0105248_10488538 3300009177 Bacteria 1388
293 Ga0105237_10018421 3300009545 Bacteria 7225
294 Ga0105237_10035498 3300009545 Bacteria 5045
295 Ga0105237_10269410 3300009545 Bacteria 1706
296 Ga0105238_10037548 3300009551 Bacteria 4924
297 Ga0105238_10040241 3300009551 Bacteria 4737
298 Ga0105238_10042416 3300009551 Bacteria 4606
299 Ga0105238_10051640 3300009551 Bacteria 4135
300 Ga0105238_10067836 3300009551 Bacteria 3568
301 Ga0105238_10110112 3300009551 Bacteria 2735
302 Ga0105249_10001380 3300009553 Bacteria 21246
303 Ga0105246_10083280 3300011119 Bacteria 2285
304 Ga0157373_10023244 3300013100 Bacteria 4495
305 Ga0157373_10061431 3300013100 Bacteria 2661
306 Ga0157373_10066352 3300013100 Bacteria 2553
307 Ga0157373_10069473 3300013100 Bacteria 2490
308 Ga0157373_10075737 3300013100 Bacteria 2374
309 Ga0157373_10112484 3300013100 Bacteria 1914
310 Ga0157373_10120726 3300013100 Bacteria 1842
311 Ga0157373_10128495 3300013100 Bacteria 1782
312 Ga0157373_10261453 3300013100 Bacteria 1225
313 Ga0157371_10040984 3300013102 Bacteria 3306
314 Ga0157371_10041654 3300013102 Bacteria 3277
315 Ga0157371_10052053 3300013102 Bacteria 2908
316 Ga0157371_10054334 3300013102 Bacteria 2844
317 Ga0157371_10073995 3300013102 Bacteria 2413
318 Ga0157371_10160322 3300013102 Bacteria 1606
319 Ga0157371_10283807 3300013102 Bacteria 1196
320 Ga0157370_10080853 3300013104 Bacteria 3059
321 Ga0157370_10155594 3300013104 Bacteria 2127
322 Ga0157370_10191926 3300013104 Bacteria 1896
323 Ga0157370_10322617 3300013104 Bacteria 1424
324 Ga0157369_10010390 3300013105 Bacteria 10608
325 Ga0157369_10011942 3300013105 Bacteria 9866
326 Ga0157369_10035441 3300013105 Bacteria 5471
327 Ga0157369_10038821 3300013105 Bacteria 5205
328 Ga0157369_10055708 3300013105 Bacteria 4268
329 Ga0157369_10061040 3300013105 Bacteria 4065
330 Ga0157369_10133596 3300013105 Bacteria 2628
331 Ga0157369_10376586 3300013105 Bacteria 1473
332 Ga0157374_10007222 3300013296 Bacteria 9465
333 Ga0157374_10110356 3300013296 Bacteria 2645
334 Ga0157374_10246770 3300013296 Bacteria 1756
335 Ga0157374_10247914 3300013296 Bacteria 1752
336 Ga0157378_10037238 3300013297 Bacteria 4308
337 Ga0163162_10042791 3300013306 Bacteria 4534
338 Ga0163162_10213197 3300013306 Bacteria 2061
339 Ga0163162_10219784 3300013306 Bacteria 2030
340 Ga0163162_10246790 3300013306 Bacteria 1917
341 Ga0163162_10689459 3300013306 Bacteria 1144
342 Ga0157372_10007422 3300013307 Bacteria 11660
343 Ga0157372_10083422 3300013307 Bacteria 3620
344 Ga0157372_10210930 3300013307 Bacteria 2251
345 Ga0157372_10275577 3300013307 Bacteria 1955
346 Ga0157372_10364220 3300013307 Bacteria 1684
347 Ga0157375_10010594 3300013308 Bacteria 8118
348 Ga0157375_10135660 3300013308 Bacteria 2584
349 Ga0157375_10365258 3300013308 Bacteria 1610
350 Ga0157375_10600699 3300013308 Bacteria 1259
351 Ga0163163_10020424 3300014325 Bacteria 6235
352 Ga0163163_10040748 3300014325 Bacteria 4538
353 Ga0163163_10131304 3300014325 Bacteria 2545
354 Ga0157377_10018471 3300014745 Bacteria 3624
355 Ga0157379_10006841 3300014968 Bacteria 9857
356 Ga0157379_10033779 3300014968 Bacteria 4562
357 Ga0157379_10213413 3300014968 Bacteria 1748
358 Ga0157376_10039502 3300014969 Bacteria 3850
359 Ga0157376_10224855 3300014969 Bacteria 1740
360 Ga0213876_10006690 3300021384 Bacteria 6290
361 Ga0207697_10057005 3300025315 Bacteria 1621
362 Ga0207656_10024973 3300025321 Bacteria 2422
363 Ga0207682_10007943 3300025893 Bacteria 4212
364 Ga0207642_10049318 3300025899 Bacteria 1892
365 Ga0207642_10079403 3300025899 Bacteria 1589
366 Ga0207642_10195273 3300025899 Bacteria 1114
367 Ga0207688_10060406 3300025901 Bacteria 2135
368 Ga0207680_10002229 3300025903 Bacteria 9038
369 Ga0207680_10003700 3300025903 Bacteria 7187
370 Ga0207680_10040423 3300025903 Bacteria 2713
371 Ga0207680_10049908 3300025903 Bacteria 2494
372 Ga0207680_10227541 3300025903 Bacteria 1281
373 Ga0207647_10003811 3300025904 Bacteria 11268
374 Ga0207647_10008425 3300025904 Bacteria 7395
375 Ga0207647_10013267 3300025904 Bacteria 5719
376 Ga0207647_10016504 3300025904 Bacteria 5038
377 Ga0207647_10029232 3300025904 Bacteria 3569
378 Ga0207699_10047346 3300025906 Bacteria 2521
379 Ga0207645_10008330 3300025907 Bacteria 7240
380 Ga0207705_10000411 3300025909 Bacteria 37615
381 Ga0207705_10014958 3300025909 Bacteria 5577
382 Ga0207705_10019381 3300025909 Bacteria 4864
383 Ga0207705_10030597 3300025909 Bacteria 3841
384 Ga0207705_10035273 3300025909 Bacteria 3579
385 Ga0207705_10040619 3300025909 Bacteria 3337
386 Ga0207705_10100402 3300025909 Bacteria 2128
387 Ga0207705_10192418 3300025909 Bacteria 1543
388 Ga0207705_10223356 3300025909 Bacteria 1431
389 Ga0207705_10353249 3300025909 Bacteria 1133
390 Ga0207707_10150726 3300025912 Bacteria 2033
391 Ga0207707_10151296 3300025912 Bacteria 2029
392 Ga0207695_10088310 3300025913 Bacteria 3121
393 Ga0207695_10098154 3300025913 Bacteria 2929
394 Ga0207671_10204783 3300025914 Bacteria 1542
395 Ga0207660_10000036 3300025917 Bacteria 65280
396 Ga0207660_10001501 3300025917 Bacteria 15725
397 Ga0207660_10051929 3300025917 Bacteria 2916
398 Ga0207660_10075252 3300025917 Bacteria 2466
399 Ga0207660_10367520 3300025917 Bacteria 1155
400 Ga0207662_10072605 3300025918 Bacteria 2086
401 Ga0207657_10007272 3300025919 Bacteria 11370
402 Ga0207657_10010450 3300025919 Bacteria 9262
403 Ga0207657_10016388 3300025919 Bacteria 7150
404 Ga0207657_10019147 3300025919 Bacteria 6509
405 Ga0207657_10023458 3300025919 Bacteria 5744
406 Ga0207657_10023914 3300025919 Bacteria 5674
407 Ga0207657_10028629 3300025919 Bacteria 5079
408 Ga0207657_10056094 3300025919 Bacteria 3400
409 Ga0207657_10057021 3300025919 Bacteria 3368
410 Ga0207657_10067205 3300025919 Bacteria 3049
411 Ga0207657_10069615 3300025919 Bacteria 2985
412 Ga0207657_10071442 3300025919 Bacteria 2939
413 Ga0207657_10078578 3300025919 Bacteria 2778
414 Ga0207657_10150130 3300025919 Bacteria 1899
415 Ga0207657_10213360 3300025919 Bacteria 1548
416 Ga0207657_10249069 3300025919 Bacteria 1417
417 Ga0207657_10253108 3300025919 Bacteria 1403
418 Ga0207657_10332226 3300025919 Bacteria 1200
419 Ga0207649_10006427 3300025920 Bacteria 6381
420 Ga0207649_10017384 3300025920 Bacteria 4075
421 Ga0207649_10029313 3300025920 Bacteria 3250
422 Ga0207649_10036279 3300025920 Bacteria 2968
423 Ga0207649_10044459 3300025920 Bacteria 2719
424 Ga0207649_10052003 3300025920 Bacteria 2539
425 Ga0207649_10053207 3300025920 Bacteria 2515
426 Ga0207649_10161134 3300025920 Bacteria 1554
427 Ga0207649_10181229 3300025920 Bacteria 1474
428 Ga0207649_10202153 3300025920 Bacteria 1404
429 Ga0207649_10328697 3300025920 Unclassified 1125
430 Ga0207652_10071163 3300025921 Bacteria 3022
431 Ga0207652_10235671 3300025921 Bacteria 1649
432 Ga0207681_10015054 3300025923 Bacteria 4821
433 Ga0207681_10100821 3300025923 Bacteria 2082
434 Ga0207681_10178126 3300025923 Bacteria 1617
435 Ga0207694_10002513 3300025924 Bacteria 14900
436 Ga0207694_10021915 3300025924 Bacteria 4844
437 Ga0207694_10151306 3300025924 Bacteria 1870
438 Ga0207650_10066095 3300025925 Bacteria 2711
439 Ga0207650_10123074 3300025925 Bacteria 2022
440 Ga0207650_10135604 3300025925 Bacteria 1930
441 Ga0207650_10427091 3300025925 Bacteria 1100
442 Ga0207659_10035972 3300025926 Bacteria 3426
443 Ga0207659_10049072 3300025926 Bacteria 2992
444 Ga0207659_10195652 3300025926 Bacteria 1611
445 Ga0207659_10222125 3300025926 Bacteria 1519
446 Ga0207687_10019493 3300025927 Bacteria 4494
447 Ga0207687_10093741 3300025927 Bacteria 2196
448 Ga0207687_10231362 3300025927 Bacteria 1460
449 Ga0207700_10199742 3300025928 Bacteria 1684
450 Ga0207700_10386356 3300025928 Bacteria 1225
451 Ga0207664_10018003 3300025929 Bacteria 5190
452 Ga0207664_10034182 3300025929 Bacteria 3914
453 Ga0207664_10038150 3300025929 Bacteria 3724
454 Ga0207664_10083082 3300025929 Bacteria 2610
455 Ga0207664_10258131 3300025929 Bacteria 1523
456 Ga0207644_10000363 3300025931 Bacteria 29548
457 Ga0207644_10002454 3300025931 Bacteria 11961
458 Ga0207644_10002516 3300025931 Bacteria 11787
459 Ga0207644_10011287 3300025931 Bacteria 5905
460 Ga0207644_10024987 3300025931 Bacteria 4104
461 Ga0207644_10028945 3300025931 Bacteria 3839
462 Ga0207644_10040839 3300025931 Bacteria 3280
463 Ga0207644_10104735 3300025931 Bacteria 2130
464 Ga0207644_10156215 3300025931 Bacteria 1769
465 Ga0207644_10171595 3300025931 Bacteria 1693
466 Ga0207644_10221671 3300025931 Bacteria 1499
467 Ga0207644_10440397 3300025931 Bacteria 1069
468 Ga0207690_10008457 3300025932 Bacteria 6111
469 Ga0207690_10029438 3300025932 Bacteria 3492
470 Ga0207690_10096763 3300025932 Bacteria 2100
471 Ga0207690_10097813 3300025932 Bacteria 2089
472 Ga0207690_10199008 3300025932 Bacteria 1520
473 Ga0207706_10000675 3300025933 Bacteria 35813
474 Ga0207706_10002920 3300025933 Bacteria 16518
475 Ga0207706_10003928 3300025933 Bacteria 14103
476 Ga0207706_10023469 3300025933 Bacteria 5539
477 Ga0207706_10070662 3300025933 Bacteria 3071
478 Ga0207706_10072826 3300025933 Bacteria 3021
479 Ga0207706_10169561 3300025933 Bacteria 1918
480 Ga0207706_10226593 3300025933 Bacteria 1636
481 Ga0207706_10288140 3300025933 Bacteria 1432
482 Ga0207706_10343857 3300025933 Bacteria 1297
483 Ga0207709_10044907 3300025935 Bacteria 2673
484 Ga0207669_10006534 3300025937 Bacteria 5340
485 Ga0207669_10022578 3300025937 Bacteria 3345
486 Ga0207704_10005890 3300025938 Bacteria 5675
487 Ga0207704_10013434 3300025938 Bacteria 4097
488 Ga0207704_10051393 3300025938 Bacteria 2492
489 Ga0207691_10003690 3300025940 Bacteria 14849
490 Ga0207691_10012624 3300025940 Bacteria 8095
491 Ga0207691_10077969 3300025940 Bacteria 2983
492 Ga0207691_10078995 3300025940 Bacteria 2961
493 Ga0207691_10152350 3300025940 Bacteria 2032
494 Ga0207691_10309403 3300025940 Bacteria 1356
495 Ga0207711_10000044 3300025941 Bacteria 157113
496 Ga0207711_10000823 3300025941 Bacteria 30322
497 Ga0207711_10003130 3300025941 Bacteria 14420
498 Ga0207711_10012411 3300025941 Bacteria 7083
499 Ga0207711_10020573 3300025941 Bacteria 5505
500 Ga0207711_10026745 3300025941 Bacteria 4843
501 Ga0207711_10028040 3300025941 Bacteria 4735
502 Ga0207711_10030719 3300025941 Bacteria 4531
503 Ga0207711_10050920 3300025941 Bacteria 3546
504 Ga0207689_10222549 3300025942 Bacteria 1559
505 Ga0207661_10004518 3300025944 Bacteria 9755
506 Ga0207661_10005086 3300025944 Bacteria 9228
507 Ga0207661_10133387 3300025944 Bacteria 2130
508 Ga0207679_10009063 3300025945 Bacteria 6358
509 Ga0207679_10009330 3300025945 Bacteria 6282
510 Ga0207679_10013192 3300025945 Bacteria 5413
511 Ga0207679_10052797 3300025945 Bacteria 2983
512 Ga0207679_10135252 3300025945 Bacteria 1984
513 Ga0207679_10139830 3300025945 Bacteria 1955
514 Ga0207679_10475026 3300025945 Bacteria 1112
515 Ga0207667_10056687 3300025949 Bacteria 4115
516 Ga0207667_10066211 3300025949 Bacteria 3766
517 Ga0207667_10067634 3300025949 Bacteria 3721
518 Ga0207667_10185552 3300025949 Bacteria 2135
519 Ga0207667_10216208 3300025949 Bacteria 1964
520 Ga0207667_10270232 3300025949 Bacteria 1738
521 Ga0207667_10284314 3300025949 Bacteria 1690
522 Ga0207667_10286467 3300025949 Bacteria 1683
523 Ga0207667_10435479 3300025949 Bacteria 1333
524 Ga0207651_10000166 3300025960 Bacteria 28419
525 Ga0207651_10006858 3300025960 Bacteria 6012
526 Ga0207651_10031851 3300025960 Bacteria 3377
527 Ga0207651_10032128 3300025960 Bacteria 3367
528 Ga0207712_10020548 3300025961 Bacteria 4325
529 Ga0207668_10039580 3300025972 Bacteria 3175
530 Ga0207668_10253601 3300025972 Bacteria 1430
531 Ga0207668_10384916 3300025972 Bacteria 1182
532 Ga0207640_10016302 3300025981 Bacteria 4319
533 Ga0207640_10040849 3300025981 Bacteria 2946
534 Ga0207640_10173358 3300025981 Bacteria 1610
535 Ga0207640_10291379 3300025981 Bacteria 1287
536 Ga0207658_10002505 3300025986 Bacteria 13372
537 Ga0207658_10003675 3300025986 Bacteria 10817
538 Ga0207658_10014302 3300025986 Bacteria 5434
539 Ga0207658_10018292 3300025986 Bacteria 4837
540 Ga0207658_10018346 3300025986 Bacteria 4831
541 Ga0207658_10018749 3300025986 Bacteria 4783
542 Ga0207658_10201571 3300025986 Bacteria 1661
543 Ga0207677_10002780 3300026023 Bacteria 9243
544 Ga0207677_10004055 3300026023 Bacteria 7823
545 Ga0207677_10004994 3300026023 Bacteria 7161
546 Ga0207677_10136302 3300026023 Bacteria 1872
547 Ga0207703_10000661 3300026035 Bacteria 34492
548 Ga0207703_10006599 3300026035 Bacteria 9258
549 Ga0207703_10023410 3300026035 Bacteria 4851
550 Ga0207703_10142077 3300026035 Bacteria 2084
551 Ga0207639_10000306 3300026041 Bacteria 34858
552 Ga0207639_10026561 3300026041 Bacteria 4207
553 Ga0207639_10027036 3300026041 Bacteria 4175
554 Ga0207639_10048078 3300026041 Bacteria 3227
555 Ga0207639_10148182 3300026041 Bacteria 1963
556 Ga0207639_10360184 3300026041 Bacteria 1301
557 Ga0207678_10000439 3300026067 Bacteria 37786
558 Ga0207678_10024959 3300026067 Bacteria 5220
559 Ga0207678_10028951 3300026067 Bacteria 4834
560 Ga0207678_10050246 3300026067 Bacteria 3603
561 Ga0207678_10073557 3300026067 Bacteria 2929
562 Ga0207678_10087063 3300026067 Bacteria 2669
563 Ga0207678_10099193 3300026067 Bacteria 2488
564 Ga0207678_10124660 3300026067 Bacteria 2198
565 Ga0207678_10143426 3300026067 Bacteria 2038
566 Ga0207678_10550519 3300026067 Bacteria 1009
567 Ga0207702_10030767 3300026078 Bacteria 4472
568 Ga0207702_10043546 3300026078 Bacteria 3769
569 Ga0207702_10057480 3300026078 Bacteria 3306
570 Ga0207702_10092036 3300026078 Bacteria 2657
571 Ga0207702_10198823 3300026078 Bacteria 1857
572 Ga0207702_10285936 3300026078 Bacteria 1560
573 Ga0207702_10392289 3300026078 Bacteria 1337
574 Ga0207702_10719838 3300026078 Bacteria 984
575 Ga0207641_10002463 3300026088 Bacteria 17101
576 Ga0207641_10010171 3300026088 Bacteria 7736
577 Ga0207641_10024243 3300026088 Bacteria 5002
578 Ga0207641_10097244 3300026088 Bacteria 2587
579 Ga0207641_10158041 3300026088 Bacteria 2058
580 Ga0207641_10352923 3300026088 Bacteria 1402
581 Ga0207648_10014845 3300026089 Bacteria 7183
582 Ga0207648_10024765 3300026089 Bacteria 5353
583 Ga0207648_10218253 3300026089 Bacteria 1694
584 Ga0207648_10331052 3300026089 Bacteria 1370
585 Ga0207676_10001310 3300026095 Bacteria 18517
586 Ga0207676_10007642 3300026095 Bacteria 7671
587 Ga0207676_10035878 3300026095 Bacteria 3768
588 Ga0207676_10052624 3300026095 Bacteria 3184
589 Ga0207676_10100444 3300026095 Bacteria 2397
590 Ga0207676_10253464 3300026095 Bacteria 1585
591 Ga0207674_10002878 3300026116 Bacteria 21384
592 Ga0207674_10030328 3300026116 Bacteria 5686
593 Ga0207674_10052967 3300026116 Bacteria 4137
594 Ga0207674_10064009 3300026116 Bacteria 3710
595 Ga0207674_10066654 3300026116 Bacteria 3626
596 Ga0207675_100317564 3300026118 Bacteria 1520
597 Ga0207683_10002606 3300026121 Bacteria 15748
598 Ga0207683_10012389 3300026121 Bacteria 7276
599 Ga0207683_10025493 3300026121 Bacteria 5102
600 Ga0207683_10078373 3300026121 Bacteria 2928
601 Ga0207683_10100638 3300026121 Bacteria 2580
602 Ga0207698_10004929 3300026142 Bacteria 8183
603 Ga0207698_10015731 3300026142 Bacteria 5078
604 Ga0207698_10020927 3300026142 Bacteria 4514
605 Ga0207698_10042826 3300026142 Bacteria 3387
606 Ga0207698_10044848 3300026142 Bacteria 3326
607 Ga0207698_10121640 3300026142 Bacteria 2211
608 Ga0207698_10129410 3300026142 Bacteria 2154
609 Ga0207698_10157482 3300026142 Bacteria 1981
610 Ga0207698_10444922 3300026142 Bacteria 1249
611 Ga0207698_10544565 3300026142 Bacteria 1136
612 Ga0268266_10093477 3300028379 Bacteria 2639
613 Ga0268265_10003541 3300028380 Bacteria 11174
614 Ga0268265_10010882 3300028380 Bacteria 6145
615 Ga0268265_10012680 3300028380 Bacteria 5719
616 Ga0268264_10001254 3300028381 Bacteria 24199
617 Ga0268264_10028624 3300028381 Bacteria 4559
618 Ga0268264_10039179 3300028381 Bacteria 3916
619 Ga0268264_10077941 3300028381 Bacteria 2824
620 Ga0268264_10156223 3300028381 Bacteria 2050
621 Ga0307405_10162015 3300031731 Bacteria 1585
622 Ga0307405_10225825 3300031731 Bacteria 1377
623 Ga0307413_10133598 3300031824 Bacteria 1702
624 Ga0307410_10005338 3300031852 Bacteria 6790
625 Ga0307412_10062488 3300031911 Bacteria 2508
626 Ga0307412_10070165 3300031911 Bacteria 2388
627 Ga0307409_100005503 3300031995 Bacteria 7305
628 Ga0307409_100061489 3300031995 Bacteria 2935
629 Ga0307409_100160550 3300031995 Bacteria 1965
630 Ga0307409_100188457 3300031995 Bacteria 1833
631 Ga0307414_10126656 3300032004 Bacteria 1974
632 Ga0307411_10018942 3300032005 Bacteria 3962
633 Ga0307411_10030159 3300032005 Bacteria 3321
634 Ga0307411_10186745 3300032005 Bacteria 1578
635 Ga0307411_10504383 3300032005 Bacteria 1023
636 Ga0307415_100019430 3300032126 Bacteria 4125
637 Ga0307415_100043061 3300032126 Bacteria 3009
638 Ga0373935_0013853 3300035692 Bacteria 4869
639 Ga0373935_0132785 3300035692 Bacteria 1674
640 Ga0373947_0121493 3300035725 Bacteria 1659
641 Ga0373937_0279096 3300036401 Bacteria 1577
642 Ga0373925_0350685 3300037068 Bacteria 1198
643 Ga0395899_0000103 3300037312 Bacteria 147274
644 Ga0395899_0001279 3300037312 Bacteria 21800
645 Ga0395899_0005202 3300037312 Bacteria 10122
646 Ga0395899_0010498 3300037312 Bacteria 7092
647 Ga0395899_0023741 3300037312 Bacteria 4640
648 Ga0395899_0025159 3300037312 Bacteria 4496
649 Ga0395899_0053577 3300037312 Bacteria 2986
650 Ga0395899_0054910 3300037312 Bacteria 2946
651 Ga0395899_0062624 3300037312 Bacteria 2739
652 Ga0395899_0063581 3300037312 Bacteria 2714
653 Ga0395899_0078481 3300037312 Bacteria 2406
654 Ga0395899_0085344 3300037312 Bacteria 2294
655 Ga0395899_0106990 3300037312 Bacteria 2013
656 Ga0395899_0119727 3300037312 Bacteria 1887
657 Ga0395899_0139245 3300037312 Bacteria 1728
658 Ga0395899_0156233 3300037312 Bacteria 1614
659 Ga0395900_0000093 3300037418 Bacteria 166505
660 Ga0395900_0001087 3300037418 Bacteria 34570
661 Ga0395900_0003281 3300037418 Bacteria 17510
662 Ga0395900_0003905 3300037418 Bacteria 15923
663 Ga0395900_0004026 3300037418 Bacteria 15685
664 Ga0395900_0004347 3300037418 Bacteria 15032
665 Ga0395900_0009855 3300037418 Bacteria 9788
666 Ga0395900_0010507 3300037418 Bacteria 9469
667 Ga0395900_0033598 3300037418 Bacteria 5279
668 Ga0395900_0037815 3300037418 Bacteria 4975
669 Ga0395900_0046196 3300037418 Bacteria 4484
670 Ga0395900_0050830 3300037418 Bacteria 4269
671 Ga0395900_0053572 3300037418 Bacteria 4152
672 Ga0395900_0057572 3300037418 Bacteria 4001
673 Ga0395900_0060445 3300037418 Bacteria 3899
674 Ga0395900_0070212 3300037418 Bacteria 3601
675 Ga0395900_0075454 3300037418 Bacteria 3466
676 Ga0395900_0094640 3300037418 Bacteria 3069
677 Ga0395900_0104546 3300037418 Bacteria 2909
678 Ga0395900_0132636 3300037418 Bacteria 2552
679 Ga0395900_0228092 3300037418 Bacteria 1874
680 Ga0395900_0240935 3300037418 Bacteria 1814
681 Ga0395900_0289679 3300037418 Bacteria 1626
682 Ga0395900_0358796 3300037418 Bacteria 1429
683 Ga0395900_0530119 3300037418 Bacteria 1124
684 Ga0395900_0551028 3300037418 Bacteria 1098
685 Ga0395898_0000053 3300037466 Bacteria 279600
686 Ga0395898_0001084 3300037466 Bacteria 42107
687 Ga0395898_0008724 3300037466 Bacteria 10696
688 Ga0395898_0009735 3300037466 Bacteria 10077
689 Ga0395898_0011199 3300037466 Bacteria 9335
690 Ga0395898_0029949 3300037466 Bacteria 5449
691 Ga0395898_0031048 3300037466 Bacteria 5343
692 Ga0395898_0045522 3300037466 Bacteria 4313
693 Ga0395898_0068570 3300037466 Bacteria 3432
694 Ga0395898_0127017 3300037466 Bacteria 2443
695 Ga0395898_0137692 3300037466 Bacteria 2337
696 Ga0395898_0143023 3300037466 Bacteria 2290
697 Ga0395898_0150867 3300037466 Bacteria 2224
698 Ga0395898_0163653 3300037466 Bacteria 2128
699 Ga0395898_0853863 3300037466 Unclassified 849
700 Ga0395905_0000031 3300037471 Bacteria 286757
701 Ga0395905_0001373 3300037471 Bacteria 29537
702 Ga0395905_0001557 3300037471 Bacteria 27411
703 Ga0395905_0002160 3300037471 Bacteria 22295
704 Ga0395905_0003217 3300037471 Bacteria 17577
705 Ga0395905_0003655 3300037471 Bacteria 16315
706 Ga0395905_0006008 3300037471 Bacteria 12291
707 Ga0395905_0009029 3300037471 Bacteria 9781
708 Ga0395905_0009309 3300037471 Bacteria 9608
709 Ga0395905_0016575 3300037471 Bacteria 7004
710 Ga0395905_0018649 3300037471 Bacteria 6581
711 Ga0395905_0035726 3300037471 Bacteria 4667
712 Ga0395905_0045471 3300037471 Bacteria 4117
713 Ga0395905_0049113 3300037471 Bacteria 3953
714 Ga0395905_0058079 3300037471 Bacteria 3618
715 Ga0395905_0117745 3300037471 Bacteria 2496
716 Ga0395905_0120051 3300037471 Bacteria 2471
717 Ga0395905_0147441 3300037471 Bacteria 2214
718 Ga0395905_0174780 3300037471 Bacteria 2016
719 Ga0395905_0204795 3300037471 Bacteria 1849
720 Ga0395905_0235046 3300037471 Bacteria 1713
721 Ga0395905_0239784 3300037471 Bacteria 1694
722 Ga0395905_0270354 3300037471 Bacteria 1585
723 Ga0395905_0317169 3300037471 Bacteria 1448
724 Ga0395905_0321342 3300037471 Bacteria 1437
725 Ga0395905_0352208 3300037471 Bacteria 1365
726 Ga0395905_0478752 3300037471 Bacteria 1144
727 Ga0395901_0000603 3300038443 Bacteria 41824
728 Ga0395901_0001133 3300038443 Bacteria 28265
729 Ga0395901_0002677 3300038443 Bacteria 17972
730 Ga0395901_0003099 3300038443 Bacteria 16722
731 Ga0395901_0008972 3300038443 Bacteria 10122
732 Ga0395901_0014644 3300038443 Bacteria 7969
733 Ga0395901_0039195 3300038443 Bacteria 4903
734 Ga0395901_0042522 3300038443 Bacteria 4711
735 Ga0395901_0057939 3300038443 Bacteria 4029
736 Ga0395901_0096675 3300038443 Bacteria 3095
737 Ga0395901_0108522 3300038443 Bacteria 2914
738 Ga0395901_0119578 3300038443 Bacteria 2768
739 Ga0395901_0123436 3300038443 Bacteria 2721
740 Ga0395901_0123755 3300038443 Bacteria 2717
741 Ga0395901_0131462 3300038443 Bacteria 2630
742 Ga0395901_0142096 3300038443 Bacteria 2522
743 Ga0395901_0188260 3300038443 Bacteria 2164
744 Ga0395901_0225536 3300038443 Bacteria 1957
745 Ga0395901_0366808 3300038443 Bacteria 1484
746 Ga0395901_0367007 3300038443 Viruses 1483
747 Ga0395901_0382061 3300038443 Bacteria 1449
748 Ga0395901_0404813 3300038443 Bacteria 1401
749 Ga0395901_0484144 3300038443 Bacteria 1262
750 Ga0395901_0907418 3300038443 Bacteria 862
751 Ga0436365_1031341 3300039437 Bacteria 7602
752 Ga0450905_002771 3300042142 Bacteria 2272
753 Ga0450889_000038 3300042144 Bacteria 11551
754 Ga0466969_0072363 3300044656 Bacteria 1656
755 Ga0466969_0114136 3300044656 Bacteria 1262
756 Ga0466972_0068038 3300044658 Bacteria 1701
757 Ga0466966_0011567 3300044684 Bacteria 5852
758 Ga0466966_0018719 3300044684 Bacteria 4562
759 Ga0466966_0023517 3300044684 Bacteria 4033
760 Ga0466966_0025227 3300044684 Bacteria 3884
761 Ga0466966_0142584 3300044684 Bacteria 1463
762 Ga0466961_0008318 3300044693 Bacteria 6604
763 Ga0466961_0035591 3300044693 Bacteria 3198
764 Ga0466961_0045566 3300044693 Bacteria 2806
765 Ga0466961_0100530 3300044693 Bacteria 1822
766 Ga0466961_0170275 3300044693 Bacteria 1355
767 Ga0466963_0004008 3300044694 Bacteria 8513
768 Ga0466963_0017722 3300044694 Bacteria 4441
769 Ga0466963_0023766 3300044694 Bacteria 3897
770 Ga0466963_0027163 3300044694 Bacteria 3663
771 Ga0466963_0047120 3300044694 Bacteria 2845
772 Ga0466963_0053549 3300044694 Bacteria 2679
773 Ga0466963_0098974 3300044694 Bacteria 1994
774 Ga0466964_0038125 3300044706 Bacteria 1932
775 Ga0466964_0050661 3300044706 Bacteria 1703
776 Ga0466964_0068795 3300044706 Bacteria 1492
777 Ga0466971_0065103 3300044719 Bacteria 1650
778 Ga0466970_0027973 3300044765 Bacteria 2961
779 Ga0466970_0050934 3300044765 Bacteria 2209
780 Ga0466970_0052142 3300044765 Bacteria 2184
781 Ga0466957_0002767 3300044842 Bacteria 9490
782 Ga0466957_0003104 3300044842 Bacteria 9038
783 Ga0466957_0067746 3300044842 Bacteria 2202
784 Ga0466960_0041486 3300044901 Bacteria 2180
785 Ga0466959_0003260 3300045049 Bacteria 10572
786 Ga0466959_0006304 3300045049 Bacteria 8201
787 Ga0466959_0043161 3300045049 Bacteria 3326
788 Ga0466959_0141605 3300045049 Bacteria 1699
789 Ga0466959_0142840 3300045049 Bacteria 1690
790 Ga0466958_0015633 3300045836 Bacteria 4353
791 Ga0466958_0040231 3300045836 Bacteria 2809
792 Ga0466958_0062872 3300045836 Bacteria 2263
793 Ga0466958_0066236 3300045836 Bacteria 2205
794 Ga0466958_0073248 3300045836 Bacteria 2098
795 Ga0466958_0123034 3300045836 Bacteria 1625
796 Ga0466967_0001599 3300045976 Bacteria 13345
797 Ga0466967_0017957 3300045976 Bacteria 5638
798 Ga0466967_0049403 3300045976 Bacteria 3678
799 Ga0466967_0079338 3300045976 Bacteria 2959
800 Ga0466967_0173482 3300045976 Bacteria 2030
801 Ga0466967_0210490 3300045976 Bacteria 1844
802 Ga0466967_0319203 3300045976 Bacteria 1498
803 Ga0466967_0326438 3300045976 Bacteria 1481
804 Ga0466967_0332547 3300045976 Bacteria 1467
805 Ga0466967_0596232 3300045976 Bacteria 1090
806 Ga0495642_0017894 3300046528 Bacteria 2770
807 Ga0495598_0024174 3300046537 Bacteria 1644
808 Ga0495621_0001481 3300046539 Bacteria 6088
809 Ga0495621_0001498 3300046539 Bacteria 6061
810 Ga0495668_0115368 3300046616 Bacteria 1469
811 Ga0495669_0004007 3300046684 Bacteria 6057
812 Ga0495669_0022875 3300046684 Bacteria 2717
813 Ga0495669_0023118 3300046684 Bacteria 2704
814 Ga0495669_0108540 3300046684 Bacteria 1294
815 Ga0495677_0100070 3300047445 Bacteria 1097
816 Ga0496100_0014032 3300048903 Bacteria 4641
817 Ga0496100_0030457 3300048903 Bacteria 3347
818 Ga0496101_0000292 3300048904 Bacteria 34928
819 Ga0496101_0019936 3300048904 Bacteria 4586
820 Ga0496101_0031499 3300048904 Bacteria 3729
821 Ga0496101_0036190 3300048904 Bacteria 3496
822 Ga0496101_0192162 3300048904 Bacteria 1576
823 Ga0496102_0218082 3300048905 Bacteria 1798
824 Ga0496102_0642680 3300048905 Unclassified 984
825 Ga0496103_0080772 3300048906 Bacteria 2045
826 Ga0496103_0166562 3300048906 Bacteria 1414
827 Ga0496104_0256284 3300048907 Bacteria 1662
828 Ga0496104_0682709 3300048907 Unclassified 935
829 Ga0496105_0115489 3300048908 Bacteria 2214
830 Ga0496105_0135825 3300048908 Bacteria 2026
831 Ga0496106_0022837 3300048909 Bacteria 4647
832 Ga0496106_0046123 3300048909 Bacteria 3275
833 Ga0496106_0078986 3300048909 Bacteria 2526
834 Ga0496107_0017907 3300048910 Bacteria 4987
835 Ga0496107_0025777 3300048910 Bacteria 4165
836 Ga0496107_0050258 3300048910 Bacteria 3005
837 Ga0496107_0080830 3300048910 Bacteria 2370
838 Ga0496107_0166045 3300048910 Bacteria 1637
839 Ga0496108_0001754 3300048911 Bacteria 17237
840 Ga0496108_0003426 3300048911 Bacteria 12718
841 Ga0496108_0007959 3300048911 Bacteria 8596
842 Ga0496108_0093312 3300048911 Bacteria 2560
843 Ga0496108_0225836 3300048911 Bacteria 1627
844 Ga0496109_0007818 3300048912 Bacteria 9057
845 Ga0496109_0020230 3300048912 Bacteria 5878
846 Ga0496109_0054181 3300048912 Bacteria 3659
847 Ga0496110_0002222 3300048913 Bacteria 14506
848 Ga0496110_0038385 3300048913 Bacteria 4167
849 Ga0496110_0053278 3300048913 Bacteria 3556
850 Ga0496110_0207002 3300048913 Bacteria 1783
851 Ga0496111_0000323 3300048914 Bacteria 23780
852 Ga0496112_0000161 3300048915 Bacteria 42407
853 Ga0496112_0016491 3300048915 Bacteria 6922
854 Ga0496112_0023708 3300048915 Bacteria 5870
855 Ga0496112_0027774 3300048915 Bacteria 5458
856 Ga0496112_0036040 3300048915 Bacteria 4822
857 Ga0496112_0067070 3300048915 Bacteria 3541
858 Ga0496112_0144277 3300048915 Bacteria 2349
859 Ga0496112_0236047 3300048915 Bacteria 1782
860 Ga0496112_0472434 3300048915 Unclassified 1191
861 Ga0496113_0003356 3300048916 Bacteria 9561
862 Ga0496113_0005013 3300048916 Bacteria 8210
863 Ga0496113_0008314 3300048916 Bacteria 6754
864 Ga0496113_0099405 3300048916 Bacteria 2253
865 Ga0496114_0000019 3300048917 Bacteria 244365
866 Ga0496114_0071166 3300048917 Bacteria 2922
867 Ga0496114_0489477 3300048917 Bacteria 1088
868 Ga0496115_0000488 3300048918 Bacteria 31339
869 Ga0501225_0006056 3300049705 Bacteria 3535
870 Ga0501268_011181 3300049765 Bacteria 1412
871 nmdc:mga08y16_161643_c1 3300050511 Bacteria 2327
872 Ga0466962_0003431 3300061719 Bacteria 7545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10226593 Ga0207706_102265932 215
2 3300025940 Ga0207691_10077969 Ga0207691_100779693 228
3 3300037471 Ga0395905_0478752 Ga0395905_0478752_142_1002 240
4 3300048915 Ga0496112_0472434 Ga0496112_0472434_454_1176 240
5 3300037471 Ga0395905_0317169 Ga0395905_0317169_473_1318 242
6 3300005355 Ga0070671_100000884 Ga0070671_10000088421 244
7 3300025931 Ga0207644_10011287 Ga0207644_100112873 244
8 3300005367 Ga0070667_100036617 Ga0070667_1000366172 246
9 3300005564 Ga0070664_100001029 Ga0070664_10000102913 246
10 3300005842 Ga0068858_100138989 Ga0068858_1001389892 246
11 3300005843 Ga0068860_100039503 Ga0068860_1000395033 246
12 3300009177 Ga0105248_10067362 Ga0105248_100673622 246
13 3300013306 Ga0163162_10213197 Ga0163162_102131972 246
14 3300025941 Ga0207711_10012411 Ga0207711_100124113 246
15 3300025986 Ga0207658_10018292 Ga0207658_100182923 246
16 3300028381 Ga0268264_10156223 Ga0268264_101562232 246
17 3300046537 Ga0495598_0024174 Ga0495598_0024174_119_976 247
18 3300046539 Ga0495621_0001498 Ga0495621_0001498_1850_2707 247
19 3300046684 Ga0495669_0022875 Ga0495669_0022875_1515_2372 247
20 3300046684 Ga0495669_0108540 Ga0495669_0108540_283_1170 248
21 3300037466 Ga0395898_0853863 Ga0395898_0853863_39_839 250
22 3300038443 Ga0395901_0907418 Ga0395901_0907418_51_851 250
23 3300025941 Ga0207711_10026745 Ga0207711_100267455 251
24 3300037418 Ga0395900_0001087 Ga0395900_0001087_131_988 251
25 3300038443 Ga0395901_0000603 Ga0395901_0000603_23638_24495 251
26 3300046616 Ga0495668_0115368 Ga0495668_0115368_518_1369 251
27 3300005336 Ga0070680_100009837 Ga0070680_1000098371 252
28 3300005344 Ga0070661_100207239 Ga0070661_1002072391 252
29 3300005436 Ga0070713_100423523 Ga0070713_1004235232 252
30 3300005530 Ga0070679_100156215 Ga0070679_1001562152 252
31 3300005548 Ga0070665_100170233 Ga0070665_1001702332 252
32 3300005564 Ga0070664_100429283 Ga0070664_1004292831 252
33 3300005614 Ga0068856_100519778 Ga0068856_1005197782 252
34 3300005618 Ga0068864_100094296 Ga0068864_1000942962 252
35 3300009093 Ga0105240_10035361 Ga0105240_100353612 252
36 3300009177 Ga0105248_10488538 Ga0105248_104885382 252
37 3300013100 Ga0157373_10075737 Ga0157373_100757374 252
38 3300013104 Ga0157370_10322617 Ga0157370_103226172 252
39 3300013306 Ga0163162_10246790 Ga0163162_102467902 252
40 3300013307 Ga0157372_10210930 Ga0157372_102109302 252
41 3300025913 Ga0207695_10098154 Ga0207695_100981541 252
42 3300025917 Ga0207660_10000036 Ga0207660_1000003635 252
43 3300025917 Ga0207660_10001501 Ga0207660_1000150117 252
44 3300025919 Ga0207657_10150130 Ga0207657_101501302 252
45 3300025928 Ga0207700_10386356 Ga0207700_103863562 252
46 3300025929 Ga0207664_10018003 Ga0207664_100180034 252
47 3300025931 Ga0207644_10221671 Ga0207644_102216712 252
48 3300025932 Ga0207690_10097813 Ga0207690_100978132 252
49 3300025949 Ga0207667_10435479 Ga0207667_104354791 252
50 3300026095 Ga0207676_10035878 Ga0207676_100358782 252
51 3300026121 Ga0207683_10078373 Ga0207683_100783732 252
52 3300026142 Ga0207698_10129410 Ga0207698_101294103 252
53 3300032005 Ga0307411_10186745 Ga0307411_101867452 252
54 3300032126 Ga0307415_100019430 Ga0307415_1000194302 252
55 3300037418 Ga0395900_0075454 Ga0395900_0075454_2352_3209 252
56 3300037418 Ga0395900_0530119 Ga0395900_0530119_10_837 252
57 3300038443 Ga0395901_0404813 Ga0395901_0404813_16_843 252
58 3300048915 Ga0496112_0027774 Ga0496112_0027774_940_1803 252
59 3300001990 JGI24737J22298_10033652 JGI24737J22298_100336522 253
60 3300005335 Ga0070666_10012189 Ga0070666_100121892 253
61 3300005339 Ga0070660_100241684 Ga0070660_1002416842 253
62 3300005366 Ga0070659_100162611 Ga0070659_1001626112 253
63 3300005367 Ga0070667_100017920 Ga0070667_1000179202 253
64 3300005435 Ga0070714_100023934 Ga0070714_1000239343 253
65 3300005455 Ga0070663_100011022 Ga0070663_1000110227 253
66 3300005455 Ga0070663_100457815 Ga0070663_1004578151 253
67 3300005564 Ga0070664_100022153 Ga0070664_1000221535 253
68 3300005578 Ga0068854_100022935 Ga0068854_1000229352 253
69 3300021384 Ga0213876_10006690 Ga0213876_100066904 253
70 3300025903 Ga0207680_10003700 Ga0207680_100037003 253
71 3300025919 Ga0207657_10010450 Ga0207657_100104503 253
72 3300025919 Ga0207657_10071442 Ga0207657_100714423 253
73 3300025920 Ga0207649_10029313 Ga0207649_100293132 253
74 3300025926 Ga0207659_10222125 Ga0207659_102221252 253
75 3300025929 Ga0207664_10038150 Ga0207664_100381502 253
76 3300025933 Ga0207706_10169561 Ga0207706_101695612 253
77 3300025945 Ga0207679_10013192 Ga0207679_100131925 253
78 3300025981 Ga0207640_10016302 Ga0207640_100163024 253
79 3300026067 Ga0207678_10024959 Ga0207678_100249594 253
80 3300026067 Ga0207678_10550519 Ga0207678_105505191 253
81 3300026095 Ga0207676_10052624 Ga0207676_100526243 253
82 3300031995 Ga0307409_100061489 Ga0307409_1000614892 253
83 3300032005 Ga0307411_10504383 Ga0307411_105043831 253
84 3300037418 Ga0395900_0037815 Ga0395900_0037815_137_994 253
85 3300037418 Ga0395900_0358796 Ga0395900_0358796_165_1022 253
86 3300037466 Ga0395898_0045522 Ga0395898_0045522_2013_2870 253
87 3300037471 Ga0395905_0204795 Ga0395905_0204795_193_1050 253
88 3300039437 Ga0436365_1031341 Ga0436365_1031341_1441_2292 253
89 3300049765 Ga0501268_011181 Ga0501268_011181_47_928 253
90 3300002067 JGI24735J21928_10007239 JGI24735J21928_100072394 254
91 3300005331 Ga0070670_100008324 Ga0070670_1000083242 254
92 3300005339 Ga0070660_100196960 Ga0070660_1001969602 254
93 3300005339 Ga0070660_100263745 Ga0070660_1002637452 254
94 3300005344 Ga0070661_100016675 Ga0070661_1000166756 254
95 3300005354 Ga0070675_100211219 Ga0070675_1002112192 254
96 3300005355 Ga0070671_100002896 Ga0070671_1000028963 254
97 3300005356 Ga0070674_100130024 Ga0070674_1001300242 254
98 3300005364 Ga0070673_100330222 Ga0070673_1003302222 254
99 3300005456 Ga0070678_100003214 Ga0070678_1000032142 254
100 3300005456 Ga0070678_100056269 Ga0070678_1000562692 254
101 3300005457 Ga0070662_100136256 Ga0070662_1001362562 254
102 3300005539 Ga0068853_100034134 Ga0068853_1000341343 254
103 3300005543 Ga0070672_100393883 Ga0070672_1003938832 254
104 3300005564 Ga0070664_100070073 Ga0070664_1000700732 254
105 3300005577 Ga0068857_100042369 Ga0068857_1000423693 254
106 3300005616 Ga0068852_100031038 Ga0068852_1000310382 254
107 3300005618 Ga0068864_100019212 Ga0068864_1000192125 254
108 3300006028 Ga0070717_10029647 Ga0070717_100296474 254
109 3300009545 Ga0105237_10269410 Ga0105237_102694102 254
110 3300009551 Ga0105238_10042416 Ga0105238_100424164 254
111 3300013296 Ga0157374_10246770 Ga0157374_102467702 254
112 3300013306 Ga0163162_10689459 Ga0163162_106894591 254
113 3300013307 Ga0157372_10007422 Ga0157372_1000742210 254
114 3300025904 Ga0207647_10016504 Ga0207647_100165042 254
115 3300025914 Ga0207671_10204783 Ga0207671_102047832 254
116 3300025919 Ga0207657_10016388 Ga0207657_100163886 254
117 3300025919 Ga0207657_10249069 Ga0207657_102490692 254
118 3300025920 Ga0207649_10006427 Ga0207649_100064272 254
119 3300025924 Ga0207694_10002513 Ga0207694_1000251310 254
120 3300025925 Ga0207650_10427091 Ga0207650_104270912 254
121 3300025926 Ga0207659_10195652 Ga0207659_101956521 254
122 3300025931 Ga0207644_10002454 Ga0207644_100024545 254
123 3300025933 Ga0207706_10002920 Ga0207706_100029208 254
124 3300025933 Ga0207706_10072826 Ga0207706_100728262 254
125 3300025940 Ga0207691_10152350 Ga0207691_101523502 254
126 3300026041 Ga0207639_10000306 Ga0207639_1000030624 254
127 3300026095 Ga0207676_10100444 Ga0207676_101004442 254
128 3300026121 Ga0207683_10025493 Ga0207683_100254933 254
129 3300026142 Ga0207698_10004929 Ga0207698_100049297 254
130 3300031731 Ga0307405_10162015 Ga0307405_101620152 254
131 3300031824 Ga0307413_10133598 Ga0307413_101335981 254
132 3300031995 Ga0307409_100188457 Ga0307409_1001884572 254
133 3300032004 Ga0307414_10126656 Ga0307414_101266562 254
134 3300032005 Ga0307411_10030159 Ga0307411_100301592 254
135 3300037312 Ga0395899_0139245 Ga0395899_0139245_556_1410 254
136 3300037471 Ga0395905_0147441 Ga0395905_0147441_600_1454 254
137 3300038443 Ga0395901_0039195 Ga0395901_0039195_315_1169 254
138 3300045976 Ga0466967_0326438 Ga0466967_0326438_554_1411 254
139 3300049705 Ga0501225_0006056 Ga0501225_0006056_633_1514 254
140 3300005328 Ga0070676_10026474 Ga0070676_100264742 255
141 3300005336 Ga0070680_100227350 Ga0070680_1002273502 255
142 3300005336 Ga0070680_100344839 Ga0070680_1003448391 255
143 3300005337 Ga0070682_100156184 Ga0070682_1001561842 255
144 3300005338 Ga0068868_100005097 Ga0068868_1000050976 255
145 3300005364 Ga0070673_100382049 Ga0070673_1003820492 255
146 3300005435 Ga0070714_100037609 Ga0070714_1000376092 255
147 3300005435 Ga0070714_100150835 Ga0070714_1001508352 255
148 3300005436 Ga0070713_100308898 Ga0070713_1003088982 255
149 3300005535 Ga0070684_100129989 Ga0070684_1001299893 255
150 3300005563 Ga0068855_100162666 Ga0068855_1001626664 255
151 3300005578 Ga0068854_100122320 Ga0068854_1001223202 255
152 3300009098 Ga0105245_10022225 Ga0105245_100222252 255
153 3300009177 Ga0105248_10112097 Ga0105248_101120972 255
154 3300009551 Ga0105238_10067836 Ga0105238_100678364 255
155 3300013100 Ga0157373_10061431 Ga0157373_100614312 255
156 3300013102 Ga0157371_10052053 Ga0157371_100520532 255
157 3300013104 Ga0157370_10191926 Ga0157370_101919262 255
158 3300013296 Ga0157374_10110356 Ga0157374_101103562 255
159 3300013308 Ga0157375_10600699 Ga0157375_106006992 255
160 3300025919 Ga0207657_10078578 Ga0207657_100785783 255
161 3300025927 Ga0207687_10019493 Ga0207687_100194934 255
162 3300025928 Ga0207700_10199742 Ga0207700_101997422 255
163 3300025929 Ga0207664_10083082 Ga0207664_100830822 255
164 3300025929 Ga0207664_10258131 Ga0207664_102581312 255
165 3300025949 Ga0207667_10286467 Ga0207667_102864672 255
166 3300026023 Ga0207677_10002780 Ga0207677_100027804 255
167 3300026116 Ga0207674_10030328 Ga0207674_100303287 255
168 3300026142 Ga0207698_10544565 Ga0207698_105445652 255
169 3300037312 Ga0395899_0001279 Ga0395899_0001279_17078_17938 255
170 3300037418 Ga0395900_0004347 Ga0395900_0004347_10574_11434 255
171 3300037418 Ga0395900_0070212 Ga0395900_0070212_1173_2033 255
172 3300037418 Ga0395900_0551028 Ga0395900_0551028_164_1021 255
173 3300037466 Ga0395898_0009735 Ga0395898_0009735_788_1648 255
174 3300037466 Ga0395898_0150867 Ga0395898_0150867_879_1739 255
175 3300037471 Ga0395905_0001373 Ga0395905_0001373_17703_18593 255
176 3300037471 Ga0395905_0001557 Ga0395905_0001557_4943_5803 255
177 3300037471 Ga0395905_0321342 Ga0395905_0321342_191_1054 255
178 3300038443 Ga0395901_0014644 Ga0395901_0014644_3247_4107 255
179 3300038443 Ga0395901_0382061 Ga0395901_0382061_248_1108 255
180 3300044693 Ga0466961_0045566 Ga0466961_0045566_1350_2210 255
181 3300044694 Ga0466963_0004008 Ga0466963_0004008_1202_2062 255
182 3300044694 Ga0466963_0017722 Ga0466963_0017722_2010_2870 255
183 3300044842 Ga0466957_0002767 Ga0466957_0002767_7600_8460 255
184 3300045049 Ga0466959_0141605 Ga0466959_0141605_302_1162 255
185 3300045836 Ga0466958_0062872 Ga0466958_0062872_723_1583 255
186 3300061719 Ga0466962_0003431 Ga0466962_0003431_5820_6680 255
187 3300001915 JGI24741J21665_1003963 JGI24741J21665_10039633 256
188 3300002067 JGI24735J21928_10021938 JGI24735J21928_100219382 256
189 3300005331 Ga0070670_100059784 Ga0070670_1000597844 256
190 3300005335 Ga0070666_10005096 Ga0070666_100050962 256
191 3300005345 Ga0070692_10111785 Ga0070692_101117852 256
192 3300005354 Ga0070675_100075957 Ga0070675_1000759573 256
193 3300005355 Ga0070671_100062806 Ga0070671_1000628062 256
194 3300005364 Ga0070673_100015057 Ga0070673_1000150576 256
195 3300005367 Ga0070667_100026954 Ga0070667_1000269545 256
196 3300005456 Ga0070678_100002351 Ga0070678_10000235110 256
197 3300005457 Ga0070662_100039121 Ga0070662_1000391213 256
198 3300005543 Ga0070672_100038203 Ga0070672_1000382034 256
199 3300005546 Ga0070696_100304558 Ga0070696_1003045582 256
200 3300005548 Ga0070665_100032978 Ga0070665_1000329785 256
201 3300005563 Ga0068855_100082151 Ga0068855_1000821512 256
202 3300005564 Ga0070664_100046784 Ga0070664_1000467844 256
203 3300005577 Ga0068857_100223251 Ga0068857_1002232512 256
204 3300005614 Ga0068856_100125251 Ga0068856_1001252512 256
205 3300005614 Ga0068856_100545126 Ga0068856_1005451261 256
206 3300005616 Ga0068852_100070324 Ga0068852_1000703242 256
207 3300005618 Ga0068864_100041771 Ga0068864_1000417714 256
208 3300005834 Ga0068851_10035033 Ga0068851_100350333 256
209 3300005841 Ga0068863_100034025 Ga0068863_1000340252 256
210 3300005842 Ga0068858_100014786 Ga0068858_1000147864 256
211 3300005985 Ga0081539_10039556 Ga0081539_100395562 256
212 3300006237 Ga0097621_100031637 Ga0097621_1000316372 256
213 3300006358 Ga0068871_100098606 Ga0068871_1000986062 256
214 3300009177 Ga0105248_10070621 Ga0105248_100706212 256
215 3300009177 Ga0105248_10093609 Ga0105248_100936093 256
216 3300013102 Ga0157371_10054334 Ga0157371_100543343 256
217 3300013104 Ga0157370_10080853 Ga0157370_100808532 256
218 3300013105 Ga0157369_10011942 Ga0157369_100119423 256
219 3300013296 Ga0157374_10007222 Ga0157374_100072224 256
220 3300013306 Ga0163162_10219784 Ga0163162_102197843 256
221 3300013308 Ga0157375_10010594 Ga0157375_100105944 256
222 3300014325 Ga0163163_10040748 Ga0163163_100407484 256
223 3300025903 Ga0207680_10040423 Ga0207680_100404231 256
224 3300025904 Ga0207647_10029232 Ga0207647_100292322 256
225 3300025909 Ga0207705_10030597 Ga0207705_100305973 256
226 3300025909 Ga0207705_10353249 Ga0207705_103532492 256
227 3300025912 Ga0207707_10150726 Ga0207707_101507262 256
228 3300025919 Ga0207657_10067205 Ga0207657_100672053 256
229 3300025920 Ga0207649_10017384 Ga0207649_100173845 256
230 3300025925 Ga0207650_10066095 Ga0207650_100660953 256
231 3300025931 Ga0207644_10028945 Ga0207644_100289451 256
232 3300025933 Ga0207706_10000675 Ga0207706_100006754 256
233 3300025933 Ga0207706_10070662 Ga0207706_100706623 256
234 3300025940 Ga0207691_10003690 Ga0207691_100036903 256
235 3300025941 Ga0207711_10030719 Ga0207711_100307192 256
236 3300025945 Ga0207679_10139830 Ga0207679_101398303 256
237 3300026035 Ga0207703_10142077 Ga0207703_101420773 256
238 3300026067 Ga0207678_10124660 Ga0207678_101246602 256
239 3300026078 Ga0207702_10043546 Ga0207702_100435462 256
240 3300026088 Ga0207641_10097244 Ga0207641_100972442 256
241 3300026089 Ga0207648_10218253 Ga0207648_102182532 256
242 3300026095 Ga0207676_10007642 Ga0207676_100076424 256
243 3300026116 Ga0207674_10052967 Ga0207674_100529672 256
244 3300026121 Ga0207683_10002606 Ga0207683_100026064 256
245 3300028379 Ga0268266_10093477 Ga0268266_100934772 256
246 3300037312 Ga0395899_0106990 Ga0395899_0106990_574_1437 256
247 3300037418 Ga0395900_0046196 Ga0395900_0046196_2910_3773 256
248 3300037418 Ga0395900_0289679 Ga0395900_0289679_567_1430 256
249 3300037466 Ga0395898_0031048 Ga0395898_0031048_2466_3329 256
250 3300037471 Ga0395905_0035726 Ga0395905_0035726_3544_4407 256
251 3300037471 Ga0395905_0270354 Ga0395905_0270354_11_874 256
252 3300038443 Ga0395901_0123436 Ga0395901_0123436_276_1139 256
253 3300038443 Ga0395901_0142096 Ga0395901_0142096_1140_2003 256
254 3300044706 Ga0466964_0068795 Ga0466964_0068795_113_988 256
255 3300048903 Ga0496100_0030457 Ga0496100_0030457_1039_1899 256
256 3300048904 Ga0496101_0019936 Ga0496101_0019936_648_1508 256
257 3300048904 Ga0496101_0192162 Ga0496101_0192162_349_1209 256
258 3300048909 Ga0496106_0078986 Ga0496106_0078986_363_1223 256
259 3300048910 Ga0496107_0050258 Ga0496107_0050258_1792_2652 256
260 3300048911 Ga0496108_0225836 Ga0496108_0225836_555_1415 256
261 3300048912 Ga0496109_0007818 Ga0496109_0007818_5898_6758 256
262 3300048915 Ga0496112_0036040 Ga0496112_0036040_1549_2409 256
263 3300048917 Ga0496114_0071166 Ga0496114_0071166_1809_2669 256
264 3300005331 Ga0070670_100192242 Ga0070670_1001922422 257
265 3300005335 Ga0070666_10258447 Ga0070666_102584472 257
266 3300005336 Ga0070680_100046334 Ga0070680_1000463344 257
267 3300005345 Ga0070692_10096125 Ga0070692_100961251 257
268 3300005347 Ga0070668_100197844 Ga0070668_1001978442 257
269 3300005355 Ga0070671_100056620 Ga0070671_1000566203 257
270 3300005367 Ga0070667_100176152 Ga0070667_1001761522 257
271 3300005457 Ga0070662_100016897 Ga0070662_1000168973 257
272 3300005458 Ga0070681_10314258 Ga0070681_103142582 257
273 3300005530 Ga0070679_100323750 Ga0070679_1003237501 257
274 3300005578 Ga0068854_100239537 Ga0068854_1002395371 257
275 3300005616 Ga0068852_100000577 Ga0068852_10000057711 257
276 3300005718 Ga0068866_10102341 Ga0068866_101023412 257
277 3300006881 Ga0068865_100224798 Ga0068865_1002247981 257
278 3300013102 Ga0157371_10073995 Ga0157371_100739951 257
279 3300013105 Ga0157369_10055708 Ga0157369_100557085 257
280 3300013307 Ga0157372_10364220 Ga0157372_103642202 257
281 3300025899 Ga0207642_10079403 Ga0207642_100794032 257
282 3300025903 Ga0207680_10227541 Ga0207680_102275412 257
283 3300025912 Ga0207707_10151296 Ga0207707_101512962 257
284 3300025917 Ga0207660_10075252 Ga0207660_100752522 257
285 3300025921 Ga0207652_10071163 Ga0207652_100711632 257
286 3300025925 Ga0207650_10135604 Ga0207650_101356042 257
287 3300025931 Ga0207644_10040839 Ga0207644_100408393 257
288 3300025933 Ga0207706_10023469 Ga0207706_100234692 257
289 3300025938 Ga0207704_10051393 Ga0207704_100513932 257
290 3300025949 Ga0207667_10185552 Ga0207667_101855522 257
291 3300025972 Ga0207668_10253601 Ga0207668_102536012 257
292 3300025981 Ga0207640_10291379 Ga0207640_102913792 257
293 3300026067 Ga0207678_10087063 Ga0207678_100870632 257
294 3300026067 Ga0207678_10099193 Ga0207678_100991934 257
295 3300026078 Ga0207702_10285936 Ga0207702_102859362 257
296 3300026121 Ga0207683_10100638 Ga0207683_101006382 257
297 3300026142 Ga0207698_10020927 Ga0207698_100209274 257
298 3300037471 Ga0395905_0239784 Ga0395905_0239784_585_1445 257
299 3300044693 Ga0466961_0170275 Ga0466961_0170275_396_1268 257
300 3300044694 Ga0466963_0027163 Ga0466963_0027163_2346_3203 257
301 3300044765 Ga0466970_0050934 Ga0466970_0050934_641_1513 257
302 3300044842 Ga0466957_0003104 Ga0466957_0003104_2756_3613 257
303 3300045836 Ga0466958_0066236 Ga0466958_0066236_176_1033 257
304 3300048911 Ga0496108_0093312 Ga0496108_0093312_32_895 257
305 3300048913 Ga0496110_0207002 Ga0496110_0207002_848_1711 257
306 3300048916 Ga0496113_0099405 Ga0496113_0099405_1344_2207 257
307 3300005327 Ga0070658_10243857 Ga0070658_102438571 258
308 3300005344 Ga0070661_100276005 Ga0070661_1002760052 258
309 3300005367 Ga0070667_100005958 Ga0070667_1000059583 258
310 3300005455 Ga0070663_100066675 Ga0070663_1000666752 258
311 3300005578 Ga0068854_100089106 Ga0068854_1000891062 258
312 3300005844 Ga0068862_100007859 Ga0068862_1000078597 258
313 3300005844 Ga0068862_100013464 Ga0068862_1000134642 258
314 3300009177 Ga0105248_10090603 Ga0105248_100906032 258
315 3300013105 Ga0157369_10038821 Ga0157369_100388212 258
316 3300025919 Ga0207657_10069615 Ga0207657_100696154 258
317 3300025986 Ga0207658_10018346 Ga0207658_100183465 258
318 3300026041 Ga0207639_10027036 Ga0207639_100270361 258
319 3300026067 Ga0207678_10028951 Ga0207678_100289512 258
320 3300028380 Ga0268265_10003541 Ga0268265_100035418 258
321 3300028380 Ga0268265_10012680 Ga0268265_100126803 258
322 3300038443 Ga0395901_0131462 Ga0395901_0131462_246_1106 258
323 3300038443 Ga0395901_0367007 Ga0395901_0367007_57_917 258
324 3300045976 Ga0466967_0596232 Ga0466967_0596232_139_999 258
325 3300048906 Ga0496103_0166562 Ga0496103_0166562_19_795 258
326 3300005327 Ga0070658_10052230 Ga0070658_100522302 259
327 3300005564 Ga0070664_100005620 Ga0070664_1000056201 259
328 3300009094 Ga0111539_10122757 Ga0111539_101227572 259
329 3300013100 Ga0157373_10120726 Ga0157373_101207261 259
330 3300025909 Ga0207705_10035273 Ga0207705_100352735 259
331 3300025919 Ga0207657_10007272 Ga0207657_100072728 259
332 3300025920 Ga0207649_10328697 Ga0207649_103286971 259
333 3300025932 Ga0207690_10199008 Ga0207690_101990082 259
334 3300025945 Ga0207679_10009063 Ga0207679_100090633 259
335 3300026041 Ga0207639_10048078 Ga0207639_100480783 259
336 3300046684 Ga0495669_0004007 Ga0495669_0004007_736_1599 259
337 3300047445 Ga0495677_0100070 Ga0495677_0100070_29_892 259
338 3300048910 Ga0496107_0017907 Ga0496107_0017907_1303_2145 259
339 3300048913 Ga0496110_0038385 Ga0496110_0038385_460_1341 259
340 3300050511 nmdc:mga08y16_161643_c1 nmdc:mga08y16_161643_c1_811_1677 259
341 3300031911 Ga0307412_10062488 Ga0307412_100624882 260
342 3300037312 Ga0395899_0062624 Ga0395899_0062624_604_1461 260
343 3300037466 Ga0395898_0143023 Ga0395898_0143023_1206_2063 260
344 3300037471 Ga0395905_0006008 Ga0395905_0006008_10953_11810 260
345 3300042144 Ga0450889_000038 Ga0450889_000038_10040_10876 260
346 3300005334 Ga0068869_100300457 Ga0068869_1003004572 261
347 3300005353 Ga0070669_100048989 Ga0070669_1000489893 261
348 3300005355 Ga0070671_100215920 Ga0070671_1002159202 261
349 3300005367 Ga0070667_100005169 Ga0070667_1000051699 261
350 3300005466 Ga0070685_10313855 Ga0070685_103138551 261
351 3300005617 Ga0068859_100000689 Ga0068859_10000068919 261
352 3300005618 Ga0068864_100001152 Ga0068864_10000115210 261
353 3300005841 Ga0068863_100004516 Ga0068863_10000451610 261
354 3300005841 Ga0068863_100058157 Ga0068863_1000581573 261
355 3300005842 Ga0068858_100065826 Ga0068858_1000658263 261
356 3300005843 Ga0068860_100020647 Ga0068860_1000206476 261
357 3300006931 Ga0097620_100000689 Ga0097620_10000068919 261
358 3300009092 Ga0105250_10015441 Ga0105250_100154413 261
359 3300009101 Ga0105247_10191850 Ga0105247_101918502 261
360 3300009177 Ga0105248_10005826 Ga0105248_1000582610 261
361 3300009177 Ga0105248_10084103 Ga0105248_100841033 261
362 3300009553 Ga0105249_10001380 Ga0105249_100013803 261
363 3300013306 Ga0163162_10042791 Ga0163162_100427913 261
364 3300014325 Ga0163163_10020424 Ga0163163_100204246 261
365 3300014968 Ga0157379_10006841 Ga0157379_1000684110 261
366 3300025923 Ga0207681_10015054 Ga0207681_100150543 261
367 3300025931 Ga0207644_10156215 Ga0207644_101562152 261
368 3300025941 Ga0207711_10000044 Ga0207711_10000044106 261
369 3300025941 Ga0207711_10003130 Ga0207711_1000313011 261
370 3300025942 Ga0207689_10222549 Ga0207689_102225492 261
371 3300025960 Ga0207651_10032128 Ga0207651_100321283 261
372 3300025961 Ga0207712_10020548 Ga0207712_100205483 261
373 3300025972 Ga0207668_10039580 Ga0207668_100395803 261
374 3300025986 Ga0207658_10003675 Ga0207658_100036755 261
375 3300025986 Ga0207658_10014302 Ga0207658_100143024 261
376 3300026035 Ga0207703_10006599 Ga0207703_100065998 261
377 3300026088 Ga0207641_10002463 Ga0207641_100024636 261
378 3300026088 Ga0207641_10158041 Ga0207641_101580412 261
379 3300026095 Ga0207676_10001310 Ga0207676_1000131017 261
380 3300028381 Ga0268264_10001254 Ga0268264_1000125423 261
381 3300045976 Ga0466967_0332547 Ga0466967_0332547_53_856 261
382 3300005327 Ga0070658_10018278 Ga0070658_100182782 262
383 3300025909 Ga0207705_10014958 Ga0207705_100149584 262
384 3300005327 Ga0070658_10172212 Ga0070658_101722122 263
385 3300005339 Ga0070660_100322021 Ga0070660_1003220212 263
386 3300005347 Ga0070668_100463393 Ga0070668_1004633932 263
387 3300005564 Ga0070664_100214000 Ga0070664_1002140002 263
388 3300005841 Ga0068863_100006440 Ga0068863_1000064403 263
389 3300005841 Ga0068863_100371655 Ga0068863_1003716552 263
390 3300005843 Ga0068860_100101168 Ga0068860_1001011682 263
391 3300013308 Ga0157375_10365258 Ga0157375_103652582 263
392 3300025920 Ga0207649_10202153 Ga0207649_102021532 263
393 3300025945 Ga0207679_10135252 Ga0207679_101352522 263
394 3300025949 Ga0207667_10067634 Ga0207667_100676345 263
395 3300025972 Ga0207668_10384916 Ga0207668_103849162 263
396 3300025986 Ga0207658_10201571 Ga0207658_102015712 263
397 3300026088 Ga0207641_10024243 Ga0207641_100242433 263
398 3300026142 Ga0207698_10444922 Ga0207698_104449222 263
399 3300028381 Ga0268264_10039179 Ga0268264_100391792 263
400 3300037312 Ga0395899_0023741 Ga0395899_0023741_2383_3231 263
401 3300037466 Ga0395898_0068570 Ga0395898_0068570_1410_2258 263
402 3300038443 Ga0395901_0188260 Ga0395901_0188260_683_1540 263
403 3300048910 Ga0496107_0025777 Ga0496107_0025777_1279_2121 263
404 3300005355 Ga0070671_100001626 Ga0070671_1000016265 264
405 3300009177 Ga0105248_10077998 Ga0105248_100779983 264
406 3300025931 Ga0207644_10440397 Ga0207644_104403972 264
407 3300025941 Ga0207711_10050920 Ga0207711_100509202 264
408 3300042142 Ga0450905_002771 Ga0450905_002771_1147_1983 264
409 3300048915 Ga0496112_0023708 Ga0496112_0023708_4182_5033 264
410 3300005455 Ga0070663_100028501 Ga0070663_1000285013 265
411 3300026067 Ga0207678_10050246 Ga0207678_100502462 265
412 3300031731 Ga0307405_10225825 Ga0307405_102258252 265
413 3300031852 Ga0307410_10005338 Ga0307410_100053385 265
414 3300031911 Ga0307412_10070165 Ga0307412_100701652 265
415 3300031995 Ga0307409_100005503 Ga0307409_1000055034 265
416 3300032005 Ga0307411_10018942 Ga0307411_100189423 265
417 3300032126 Ga0307415_100043061 Ga0307415_1000430612 265
418 3300037312 Ga0395899_0063581 Ga0395899_0063581_1713_2510 265
419 3300037418 Ga0395900_0057572 Ga0395900_0057572_487_1284 265
420 3300037466 Ga0395898_0011199 Ga0395898_0011199_3386_4183 265
421 3300038443 Ga0395901_0225536 Ga0395901_0225536_509_1306 265
422 3300005329 Ga0070683_100395403 Ga0070683_1003954032 266
423 3300005336 Ga0070680_100087880 Ga0070680_1000878802 266
424 3300005339 Ga0070660_100039600 Ga0070660_1000396003 266
425 3300005339 Ga0070660_100074699 Ga0070660_1000746993 266
426 3300005344 Ga0070661_100060728 Ga0070661_1000607283 266
427 3300005344 Ga0070661_100399998 Ga0070661_1003999981 266
428 3300005366 Ga0070659_100012489 Ga0070659_1000124893 266
429 3300005457 Ga0070662_100109320 Ga0070662_1001093202 266
430 3300005458 Ga0070681_10343364 Ga0070681_103433641 266
431 3300005530 Ga0070679_100140850 Ga0070679_1001408502 266
432 3300005539 Ga0068853_100220830 Ga0068853_1002208302 266
433 3300005539 Ga0068853_100283103 Ga0068853_1002831032 266
434 3300005614 Ga0068856_100433279 Ga0068856_1004332792 266
435 3300005616 Ga0068852_100174400 Ga0068852_1001744002 266
436 3300005616 Ga0068852_100340511 Ga0068852_1003405112 266
437 3300005834 Ga0068851_10191352 Ga0068851_101913521 266
438 3300013100 Ga0157373_10128495 Ga0157373_101284952 266
439 3300013100 Ga0157373_10261453 Ga0157373_102614532 266
440 3300013104 Ga0157370_10155594 Ga0157370_101555942 266
441 3300013307 Ga0157372_10275577 Ga0157372_102755772 266
442 3300025909 Ga0207705_10019381 Ga0207705_100193812 266
443 3300025919 Ga0207657_10023914 Ga0207657_100239144 266
444 3300025919 Ga0207657_10028629 Ga0207657_100286293 266
445 3300025920 Ga0207649_10181229 Ga0207649_101812292 266
446 3300025921 Ga0207652_10235671 Ga0207652_102356712 266
447 3300025933 Ga0207706_10288140 Ga0207706_102881402 266
448 3300025981 Ga0207640_10173358 Ga0207640_101733582 266
449 3300026041 Ga0207639_10360184 Ga0207639_103601842 266
450 3300026078 Ga0207702_10392289 Ga0207702_103922892 266
451 3300026142 Ga0207698_10042826 Ga0207698_100428262 266
452 3300031995 Ga0307409_100160550 Ga0307409_1001605502 266
453 3300035692 Ga0373935_0013853 Ga0373935_0013853_852_1703 266
454 3300035725 Ga0373947_0121493 Ga0373947_0121493_160_1011 266
455 3300037068 Ga0373925_0350685 Ga0373925_0350685_82_933 266
456 3300037312 Ga0395899_0078481 Ga0395899_0078481_1325_2167 266
457 3300037418 Ga0395900_0060445 Ga0395900_0060445_2407_3249 266
458 3300037466 Ga0395898_0029949 Ga0395898_0029949_3521_4363 266
459 3300037471 Ga0395905_0049113 Ga0395905_0049113_167_1009 266
460 3300038443 Ga0395901_0057939 Ga0395901_0057939_2537_3379 266
461 3300045976 Ga0466967_0017957 Ga0466967_0017957_250_1092 266
462 3300045976 Ga0466967_0079338 Ga0466967_0079338_933_1775 266
463 3300005328 Ga0070676_10113521 Ga0070676_101135212 267
464 3300005347 Ga0070668_100333857 Ga0070668_1003338572 267
465 3300005353 Ga0070669_100083839 Ga0070669_1000838392 267
466 3300005457 Ga0070662_100269653 Ga0070662_1002696532 267
467 3300005459 Ga0068867_100077433 Ga0068867_1000774332 267
468 3300005844 Ga0068862_100069269 Ga0068862_1000692692 267
469 3300009148 Ga0105243_10227272 Ga0105243_102272722 267
470 3300025907 Ga0207645_10008330 Ga0207645_100083302 267
471 3300025923 Ga0207681_10100821 Ga0207681_101008212 267
472 3300025933 Ga0207706_10343857 Ga0207706_103438572 267
473 3300028380 Ga0268265_10010882 Ga0268265_100108824 267
474 3300037312 Ga0395899_0000103 Ga0395899_0000103_53180_54037 267
475 3300037418 Ga0395900_0000093 Ga0395900_0000093_107781_108638 267
476 3300037418 Ga0395900_0053572 Ga0395900_0053572_243_1103 267
477 3300037466 Ga0395898_0000053 Ga0395898_0000053_107781_108638 267
478 3300037466 Ga0395898_0001084 Ga0395898_0001084_6639_7499 267
479 3300037471 Ga0395905_0000031 Ga0395905_0000031_178120_178977 267
480 3300037471 Ga0395905_0002160 Ga0395905_0002160_18919_19779 267
481 3300037471 Ga0395905_0120051 Ga0395905_0120051_1428_2288 267
482 3300038443 Ga0395901_0001133 Ga0395901_0001133_8943_9800 267
483 3300038443 Ga0395901_0003099 Ga0395901_0003099_11014_11874 267
484 3300038443 Ga0395901_0366808 Ga0395901_0366808_106_966 267
485 3300045976 Ga0466967_0210490 Ga0466967_0210490_20_895 267
486 3300048915 Ga0496112_0144277 Ga0496112_0144277_499_1359 267
487 3300048916 Ga0496113_0005013 Ga0496113_0005013_7280_8140 267
488 3300048917 Ga0496114_0000019 Ga0496114_0000019_1775_2626 267
489 3300001989 JGI24739J22299_10022381 JGI24739J22299_100223812 268
490 3300001990 JGI24737J22298_10011601 JGI24737J22298_100116013 268
491 3300002073 JGI24745J21846_1000406 JGI24745J21846_10004062 268
492 3300002077 JGI24744J21845_10000820 JGI24744J21845_100008204 268
493 3300003323 rootH1_10202900 rootH1_102029002 268
494 3300005327 Ga0070658_10015623 Ga0070658_100156232 268
495 3300005327 Ga0070658_10036564 Ga0070658_100365642 268
496 3300005329 Ga0070683_100019383 Ga0070683_1000193832 268
497 3300005330 Ga0070690_100078537 Ga0070690_1000785372 268
498 3300005331 Ga0070670_100015506 Ga0070670_1000155063 268
499 3300005333 Ga0070677_10008665 Ga0070677_100086652 268
500 3300005334 Ga0068869_100017634 Ga0068869_1000176342 268
501 3300005335 Ga0070666_10000676 Ga0070666_1000067611 268
502 3300005335 Ga0070666_10056343 Ga0070666_100563433 268
503 3300005338 Ga0068868_100001197 Ga0068868_1000011974 268
504 3300005338 Ga0068868_100170341 Ga0068868_1001703412 268
505 3300005339 Ga0070660_100316924 Ga0070660_1003169242 268
506 3300005339 Ga0070660_100483902 Ga0070660_1004839021 268
507 3300005344 Ga0070661_100091662 Ga0070661_1000916624 268
508 3300005344 Ga0070661_100503560 Ga0070661_1005035601 268
509 3300005355 Ga0070671_100030518 Ga0070671_1000305184 268
510 3300005355 Ga0070671_100082777 Ga0070671_1000827773 268
511 3300005356 Ga0070674_100011775 Ga0070674_1000117754 268
512 3300005356 Ga0070674_100061405 Ga0070674_1000614052 268
513 3300005364 Ga0070673_100021034 Ga0070673_1000210345 268
514 3300005366 Ga0070659_100032340 Ga0070659_1000323403 268
515 3300005367 Ga0070667_100005732 Ga0070667_1000057325 268
516 3300005434 Ga0070709_10004417 Ga0070709_100044173 268
517 3300005435 Ga0070714_100064796 Ga0070714_1000647963 268
518 3300005456 Ga0070678_100080405 Ga0070678_1000804054 268
519 3300005457 Ga0070662_100011952 Ga0070662_1000119522 268
520 3300005458 Ga0070681_10049774 Ga0070681_100497745 268
521 3300005459 Ga0068867_100057431 Ga0068867_1000574312 268
522 3300005539 Ga0068853_100058528 Ga0068853_1000585282 268
523 3300005539 Ga0068853_100283753 Ga0068853_1002837531 268
524 3300005543 Ga0070672_100021632 Ga0070672_1000216326 268
525 3300005543 Ga0070672_100377224 Ga0070672_1003772242 268
526 3300005547 Ga0070693_100196213 Ga0070693_1001962132 268
527 3300005548 Ga0070665_100200788 Ga0070665_1002007882 268
528 3300005563 Ga0068855_100301565 Ga0068855_1003015652 268
529 3300005563 Ga0068855_100310754 Ga0068855_1003107542 268
530 3300005564 Ga0070664_100010503 Ga0070664_1000105034 268
531 3300005578 Ga0068854_100010446 Ga0068854_1000104462 268
532 3300005614 Ga0068856_100037398 Ga0068856_1000373986 268
533 3300005614 Ga0068856_100334534 Ga0068856_1003345342 268
534 3300005616 Ga0068852_100003793 Ga0068852_10000379311 268
535 3300005617 Ga0068859_100033751 Ga0068859_1000337516 268
536 3300005617 Ga0068859_100339635 Ga0068859_1003396352 268
537 3300005618 Ga0068864_100087574 Ga0068864_1000875744 268
538 3300005618 Ga0068864_100497469 Ga0068864_1004974692 268
539 3300005718 Ga0068866_10162074 Ga0068866_101620742 268
540 3300005834 Ga0068851_10016082 Ga0068851_100160824 268
541 3300005842 Ga0068858_100000956 Ga0068858_10000095632 268
542 3300005843 Ga0068860_100105955 Ga0068860_1001059551 268
543 3300006028 Ga0070717_10373070 Ga0070717_103730701 268
544 3300006237 Ga0097621_100026196 Ga0097621_1000261966 268
545 3300006358 Ga0068871_100025919 Ga0068871_1000259192 268
546 3300006881 Ga0068865_100001644 Ga0068865_1000016443 268
547 3300006931 Ga0097620_100033752 Ga0097620_1000337526 268
548 3300006931 Ga0097620_100339649 Ga0097620_1003396492 268
549 3300009093 Ga0105240_10065735 Ga0105240_100657356 268
550 3300009098 Ga0105245_10122449 Ga0105245_101224492 268
551 3300009098 Ga0105245_10479925 Ga0105245_104799251 268
552 3300009098 Ga0105245_10642608 Ga0105245_106426081 268
553 3300009148 Ga0105243_10353928 Ga0105243_103539282 268
554 3300009148 Ga0105243_10524241 Ga0105243_105242411 268
555 3300009176 Ga0105242_10018851 Ga0105242_100188512 268
556 3300009177 Ga0105248_10001002 Ga0105248_1000100230 268
557 3300009551 Ga0105238_10037548 Ga0105238_100375483 268
558 3300009551 Ga0105238_10040241 Ga0105238_100402416 268
559 3300011119 Ga0105246_10083280 Ga0105246_100832802 268
560 3300013100 Ga0157373_10066352 Ga0157373_100663522 268
561 3300013100 Ga0157373_10112484 Ga0157373_101124843 268
562 3300013102 Ga0157371_10040984 Ga0157371_100409842 268
563 3300013102 Ga0157371_10041654 Ga0157371_100416542 268
564 3300013102 Ga0157371_10283807 Ga0157371_102838072 268
565 3300013105 Ga0157369_10010390 Ga0157369_100103902 268
566 3300013105 Ga0157369_10061040 Ga0157369_100610403 268
567 3300013105 Ga0157369_10376586 Ga0157369_103765862 268
568 3300013297 Ga0157378_10037238 Ga0157378_100372382 268
569 3300013308 Ga0157375_10135660 Ga0157375_101356603 268
570 3300014325 Ga0163163_10131304 Ga0163163_101313042 268
571 3300014745 Ga0157377_10018471 Ga0157377_100184712 268
572 3300014968 Ga0157379_10213413 Ga0157379_102134132 268
573 3300014969 Ga0157376_10039502 Ga0157376_100395022 268
574 3300014969 Ga0157376_10224855 Ga0157376_102248552 268
575 3300025315 Ga0207697_10057005 Ga0207697_100570052 268
576 3300025321 Ga0207656_10024973 Ga0207656_100249732 268
577 3300025893 Ga0207682_10007943 Ga0207682_100079433 268
578 3300025899 Ga0207642_10049318 Ga0207642_100493182 268
579 3300025899 Ga0207642_10195273 Ga0207642_101952731 268
580 3300025901 Ga0207688_10060406 Ga0207688_100604062 268
581 3300025903 Ga0207680_10002229 Ga0207680_100022292 268
582 3300025903 Ga0207680_10049908 Ga0207680_100499081 268
583 3300025904 Ga0207647_10008425 Ga0207647_100084256 268
584 3300025906 Ga0207699_10047346 Ga0207699_100473461 268
585 3300025909 Ga0207705_10040619 Ga0207705_100406192 268
586 3300025909 Ga0207705_10100402 Ga0207705_101004022 268
587 3300025909 Ga0207705_10223356 Ga0207705_102233561 268
588 3300025918 Ga0207662_10072605 Ga0207662_100726052 268
589 3300025919 Ga0207657_10057021 Ga0207657_100570213 268
590 3300025919 Ga0207657_10213360 Ga0207657_102133602 268
591 3300025919 Ga0207657_10332226 Ga0207657_103322261 268
592 3300025920 Ga0207649_10036279 Ga0207649_100362794 268
593 3300025920 Ga0207649_10053207 Ga0207649_100532072 268
594 3300025923 Ga0207681_10178126 Ga0207681_101781262 268
595 3300025924 Ga0207694_10021915 Ga0207694_100219152 268
596 3300025926 Ga0207659_10035972 Ga0207659_100359722 268
597 3300025927 Ga0207687_10093741 Ga0207687_100937412 268
598 3300025927 Ga0207687_10231362 Ga0207687_102313622 268
599 3300025929 Ga0207664_10034182 Ga0207664_100341822 268
600 3300025931 Ga0207644_10000363 Ga0207644_100003637 268
601 3300025931 Ga0207644_10024987 Ga0207644_100249873 268
602 3300025931 Ga0207644_10104735 Ga0207644_101047352 268
603 3300025932 Ga0207690_10096763 Ga0207690_100967631 268
604 3300025933 Ga0207706_10003928 Ga0207706_100039287 268
605 3300025935 Ga0207709_10044907 Ga0207709_100449072 268
606 3300025937 Ga0207669_10006534 Ga0207669_100065343 268
607 3300025937 Ga0207669_10022578 Ga0207669_100225784 268
608 3300025938 Ga0207704_10005890 Ga0207704_100058906 268
609 3300025938 Ga0207704_10013434 Ga0207704_100134342 268
610 3300025940 Ga0207691_10012624 Ga0207691_100126244 268
611 3300025940 Ga0207691_10078995 Ga0207691_100789954 268
612 3300025940 Ga0207691_10309403 Ga0207691_103094032 268
613 3300025941 Ga0207711_10000823 Ga0207711_100008231 268
614 3300025941 Ga0207711_10020573 Ga0207711_100205732 268
615 3300025941 Ga0207711_10028040 Ga0207711_100280402 268
616 3300025944 Ga0207661_10005086 Ga0207661_100050862 268
617 3300025945 Ga0207679_10009330 Ga0207679_100093302 268
618 3300025949 Ga0207667_10216208 Ga0207667_102162082 268
619 3300025949 Ga0207667_10270232 Ga0207667_102702322 268
620 3300025949 Ga0207667_10284314 Ga0207667_102843141 268
621 3300025960 Ga0207651_10000166 Ga0207651_100001668 268
622 3300025960 Ga0207651_10006858 Ga0207651_100068584 268
623 3300025960 Ga0207651_10031851 Ga0207651_100318512 268
624 3300025981 Ga0207640_10040849 Ga0207640_100408492 268
625 3300025986 Ga0207658_10002505 Ga0207658_100025056 268
626 3300025986 Ga0207658_10018749 Ga0207658_100187496 268
627 3300026023 Ga0207677_10004055 Ga0207677_100040556 268
628 3300026023 Ga0207677_10004994 Ga0207677_100049947 268
629 3300026023 Ga0207677_10136302 Ga0207677_101363022 268
630 3300026035 Ga0207703_10000661 Ga0207703_1000066113 268
631 3300026078 Ga0207702_10030767 Ga0207702_100307672 268
632 3300026078 Ga0207702_10198823 Ga0207702_101988232 268
633 3300026088 Ga0207641_10010171 Ga0207641_100101716 268
634 3300026088 Ga0207641_10352923 Ga0207641_103529232 268
635 3300026089 Ga0207648_10014845 Ga0207648_100148454 268
636 3300026089 Ga0207648_10024765 Ga0207648_100247654 268
637 3300026089 Ga0207648_10331052 Ga0207648_103310521 268
638 3300026095 Ga0207676_10253464 Ga0207676_102534642 268
639 3300026116 Ga0207674_10064009 Ga0207674_100640093 268
640 3300026118 Ga0207675_100317564 Ga0207675_1003175642 268
641 3300026121 Ga0207683_10012389 Ga0207683_100123894 268
642 3300026142 Ga0207698_10121640 Ga0207698_101216403 268
643 3300028381 Ga0268264_10028624 Ga0268264_100286246 268
644 3300028381 Ga0268264_10077941 Ga0268264_100779415 268
645 3300035692 Ga0373935_0132785 Ga0373935_0132785_46_903 268
646 3300037312 Ga0395899_0054910 Ga0395899_0054910_1166_2032 268
647 3300037312 Ga0395899_0085344 Ga0395899_0085344_1232_2089 268
648 3300037418 Ga0395900_0003905 Ga0395900_0003905_4305_5162 268
649 3300037418 Ga0395900_0004026 Ga0395900_0004026_986_1852 268
650 3300037418 Ga0395900_0104546 Ga0395900_0104546_371_1228 268
651 3300037471 Ga0395905_0003655 Ga0395905_0003655_6439_7299 268
652 3300037471 Ga0395905_0016575 Ga0395905_0016575_104_961 268
653 3300037471 Ga0395905_0018649 Ga0395905_0018649_1727_2584 268
654 3300037471 Ga0395905_0352208 Ga0395905_0352208_183_1040 268
655 3300038443 Ga0395901_0002677 Ga0395901_0002677_12813_13679 268
656 3300038443 Ga0395901_0119578 Ga0395901_0119578_1725_2582 268
657 3300038443 Ga0395901_0123755 Ga0395901_0123755_304_1161 268
658 3300044684 Ga0466966_0018719 Ga0466966_0018719_1029_1886 268
659 3300044693 Ga0466961_0035591 Ga0466961_0035591_984_1841 268
660 3300044694 Ga0466963_0053549 Ga0466963_0053549_1639_2496 268
661 3300044706 Ga0466964_0038125 Ga0466964_0038125_1004_1918 268
662 3300045049 Ga0466959_0006304 Ga0466959_0006304_2242_3099 268
663 3300045836 Ga0466958_0015633 Ga0466958_0015633_110_967 268
664 3300045976 Ga0466967_0001599 Ga0466967_0001599_2977_3891 268
665 3300045976 Ga0466967_0319203 Ga0466967_0319203_362_1240 268
666 3300046528 Ga0495642_0017894 Ga0495642_0017894_687_1547 268
667 3300046684 Ga0495669_0023118 Ga0495669_0023118_907_1767 268
668 3300048903 Ga0496100_0014032 Ga0496100_0014032_2075_2932 268
669 3300048904 Ga0496101_0000292 Ga0496101_0000292_8287_9144 268
670 3300048905 Ga0496102_0218082 Ga0496102_0218082_884_1741 268
671 3300048906 Ga0496103_0080772 Ga0496103_0080772_340_1197 268
672 3300048907 Ga0496104_0256284 Ga0496104_0256284_472_1329 268
673 3300048907 Ga0496104_0682709 Ga0496104_0682709_13_912 268
674 3300048908 Ga0496105_0115489 Ga0496105_0115489_72_929 268
675 3300048909 Ga0496106_0046123 Ga0496106_0046123_2126_2983 268
676 3300048910 Ga0496107_0080830 Ga0496107_0080830_653_1510 268
677 3300048910 Ga0496107_0166045 Ga0496107_0166045_634_1494 268
678 3300048911 Ga0496108_0001754 Ga0496108_0001754_12131_12988 268
679 3300048912 Ga0496109_0020230 Ga0496109_0020230_230_1087 268
680 3300048913 Ga0496110_0002222 Ga0496110_0002222_6740_7597 268
681 3300048914 Ga0496111_0000323 Ga0496111_0000323_14616_15473 268
682 3300048915 Ga0496112_0000161 Ga0496112_0000161_27669_28526 268
683 3300048915 Ga0496112_0067070 Ga0496112_0067070_1989_2849 268
684 3300048915 Ga0496112_0236047 Ga0496112_0236047_887_1747 268
685 3300048916 Ga0496113_0008314 Ga0496113_0008314_1496_2353 268
686 3300048917 Ga0496114_0489477 Ga0496114_0489477_103_960 268
687 3300001979 JGI24740J21852_10000524 JGI24740J21852_1000052412 269
688 3300005327 Ga0070658_10005366 Ga0070658_100053666 269
689 3300005327 Ga0070658_10085350 Ga0070658_100853503 269
690 3300005327 Ga0070658_10455538 Ga0070658_104555381 269
691 3300005329 Ga0070683_100004214 Ga0070683_1000042147 269
692 3300005331 Ga0070670_100160232 Ga0070670_1001602322 269
693 3300005336 Ga0070680_100015497 Ga0070680_1000154976 269
694 3300005336 Ga0070680_100023111 Ga0070680_1000231113 269
695 3300005339 Ga0070660_100002755 Ga0070660_1000027556 269
696 3300005339 Ga0070660_100150219 Ga0070660_1001502192 269
697 3300005339 Ga0070660_100163330 Ga0070660_1001633302 269
698 3300005344 Ga0070661_100043607 Ga0070661_1000436073 269
699 3300005345 Ga0070692_10009097 Ga0070692_100090973 269
700 3300005354 Ga0070675_100056604 Ga0070675_1000566042 269
701 3300005355 Ga0070671_100000664 Ga0070671_1000006648 269
702 3300005364 Ga0070673_100062799 Ga0070673_1000627992 269
703 3300005366 Ga0070659_100348733 Ga0070659_1003487332 269
704 3300005366 Ga0070659_100371080 Ga0070659_1003710801 269
705 3300005455 Ga0070663_100013613 Ga0070663_1000136133 269
706 3300005455 Ga0070663_100101816 Ga0070663_1001018162 269
707 3300005458 Ga0070681_10074862 Ga0070681_100748623 269
708 3300005530 Ga0070679_100213358 Ga0070679_1002133581 269
709 3300005535 Ga0070684_100033771 Ga0070684_1000337712 269
710 3300005535 Ga0070684_100166981 Ga0070684_1001669812 269
711 3300005539 Ga0068853_100066522 Ga0068853_1000665223 269
712 3300005539 Ga0068853_100717263 Ga0068853_1007172631 269
713 3300005564 Ga0070664_100052712 Ga0070664_1000527122 269
714 3300005564 Ga0070664_100061139 Ga0070664_1000611392 269
715 3300005578 Ga0068854_100034546 Ga0068854_1000345464 269
716 3300005614 Ga0068856_100117722 Ga0068856_1001177222 269
717 3300005614 Ga0068856_100327452 Ga0068856_1003274522 269
718 3300005616 Ga0068852_100042423 Ga0068852_1000424233 269
719 3300005616 Ga0068852_100075881 Ga0068852_1000758814 269
720 3300005616 Ga0068852_100202793 Ga0068852_1002027932 269
721 3300005617 Ga0068859_100104271 Ga0068859_1001042712 269
722 3300005618 Ga0068864_100383637 Ga0068864_1003836372 269
723 3300005842 Ga0068858_100015797 Ga0068858_1000157972 269
724 3300006931 Ga0097620_100104266 Ga0097620_1001042662 269
725 3300009177 Ga0105248_10030936 Ga0105248_100309364 269
726 3300009545 Ga0105237_10035498 Ga0105237_100354982 269
727 3300009551 Ga0105238_10051640 Ga0105238_100516403 269
728 3300013100 Ga0157373_10023244 Ga0157373_100232442 269
729 3300013100 Ga0157373_10069473 Ga0157373_100694732 269
730 3300013102 Ga0157371_10160322 Ga0157371_101603222 269
731 3300013105 Ga0157369_10035441 Ga0157369_100354414 269
732 3300013105 Ga0157369_10133596 Ga0157369_101335964 269
733 3300013296 Ga0157374_10247914 Ga0157374_102479143 269
734 3300025904 Ga0207647_10003811 Ga0207647_100038114 269
735 3300025904 Ga0207647_10013267 Ga0207647_100132672 269
736 3300025909 Ga0207705_10000411 Ga0207705_1000041116 269
737 3300025909 Ga0207705_10192418 Ga0207705_101924182 269
738 3300025913 Ga0207695_10088310 Ga0207695_100883104 269
739 3300025917 Ga0207660_10051929 Ga0207660_100519292 269
740 3300025917 Ga0207660_10367520 Ga0207660_103675202 269
741 3300025919 Ga0207657_10019147 Ga0207657_100191473 269
742 3300025919 Ga0207657_10023458 Ga0207657_100234586 269
743 3300025919 Ga0207657_10056094 Ga0207657_100560942 269
744 3300025919 Ga0207657_10253108 Ga0207657_102531082 269
745 3300025920 Ga0207649_10052003 Ga0207649_100520033 269
746 3300025920 Ga0207649_10161134 Ga0207649_101611342 269
747 3300025925 Ga0207650_10123074 Ga0207650_101230742 269
748 3300025926 Ga0207659_10049072 Ga0207659_100490722 269
749 3300025931 Ga0207644_10002516 Ga0207644_100025166 269
750 3300025931 Ga0207644_10171595 Ga0207644_101715951 269
751 3300025932 Ga0207690_10008457 Ga0207690_100084574 269
752 3300025932 Ga0207690_10029438 Ga0207690_100294382 269
753 3300025944 Ga0207661_10004518 Ga0207661_100045183 269
754 3300025944 Ga0207661_10133387 Ga0207661_101333872 269
755 3300025945 Ga0207679_10052797 Ga0207679_100527972 269
756 3300025945 Ga0207679_10475026 Ga0207679_104750262 269
757 3300025949 Ga0207667_10056687 Ga0207667_100566874 269
758 3300025949 Ga0207667_10066211 Ga0207667_100662113 269
759 3300026035 Ga0207703_10023410 Ga0207703_100234104 269
760 3300026041 Ga0207639_10026561 Ga0207639_100265613 269
761 3300026041 Ga0207639_10148182 Ga0207639_101481822 269
762 3300026067 Ga0207678_10000439 Ga0207678_1000043941 269
763 3300026067 Ga0207678_10073557 Ga0207678_100735572 269
764 3300026067 Ga0207678_10143426 Ga0207678_101434262 269
765 3300026078 Ga0207702_10057480 Ga0207702_100574805 269
766 3300026078 Ga0207702_10092036 Ga0207702_100920362 269
767 3300026078 Ga0207702_10719838 Ga0207702_107198381 269
768 3300026116 Ga0207674_10066654 Ga0207674_100666542 269
769 3300026142 Ga0207698_10015731 Ga0207698_100157314 269
770 3300026142 Ga0207698_10044848 Ga0207698_100448483 269
771 3300026142 Ga0207698_10157482 Ga0207698_101574824 269
772 3300036401 Ga0373937_0279096 Ga0373937_0279096_657_1520 269
773 3300037312 Ga0395899_0005202 Ga0395899_0005202_1064_1921 269
774 3300037312 Ga0395899_0010498 Ga0395899_0010498_3712_4566 269
775 3300037312 Ga0395899_0025159 Ga0395899_0025159_1293_2156 269
776 3300037312 Ga0395899_0053577 Ga0395899_0053577_564_1424 269
777 3300037312 Ga0395899_0156233 Ga0395899_0156233_198_1061 269
778 3300037418 Ga0395900_0003281 Ga0395900_0003281_15265_16128 269
779 3300037418 Ga0395900_0009855 Ga0395900_0009855_922_1779 269
780 3300037418 Ga0395900_0010507 Ga0395900_0010507_4031_4885 269
781 3300037418 Ga0395900_0094640 Ga0395900_0094640_529_1392 269
782 3300037418 Ga0395900_0132636 Ga0395900_0132636_1629_2492 269
783 3300037418 Ga0395900_0228092 Ga0395900_0228092_34_894 269
784 3300037466 Ga0395898_0008724 Ga0395898_0008724_3595_4452 269
785 3300037466 Ga0395898_0137692 Ga0395898_0137692_777_1637 269
786 3300037466 Ga0395898_0163653 Ga0395898_0163653_14_877 269
787 3300037471 Ga0395905_0003217 Ga0395905_0003217_8439_9296 269
788 3300037471 Ga0395905_0009029 Ga0395905_0009029_8800_9663 269
789 3300037471 Ga0395905_0117745 Ga0395905_0117745_1062_1916 269
790 3300037471 Ga0395905_0235046 Ga0395905_0235046_179_1060 269
791 3300038443 Ga0395901_0008972 Ga0395901_0008972_1064_1921 269
792 3300038443 Ga0395901_0108522 Ga0395901_0108522_1206_2069 269
793 3300038443 Ga0395901_0484144 Ga0395901_0484144_59_922 269
794 3300044656 Ga0466969_0072363 Ga0466969_0072363_327_1205 269
795 3300044656 Ga0466969_0114136 Ga0466969_0114136_33_893 269
796 3300044658 Ga0466972_0068038 Ga0466972_0068038_575_1441 269
797 3300044684 Ga0466966_0011567 Ga0466966_0011567_1642_2505 269
798 3300044684 Ga0466966_0023517 Ga0466966_0023517_546_1406 269
799 3300044684 Ga0466966_0025227 Ga0466966_0025227_613_1491 269
800 3300044684 Ga0466966_0142584 Ga0466966_0142584_363_1217 269
801 3300044693 Ga0466961_0008318 Ga0466961_0008318_3814_4692 269
802 3300044693 Ga0466961_0100530 Ga0466961_0100530_340_1200 269
803 3300044694 Ga0466963_0023766 Ga0466963_0023766_508_1371 269
804 3300044694 Ga0466963_0047120 Ga0466963_0047120_1866_2726 269
805 3300044694 Ga0466963_0098974 Ga0466963_0098974_861_1724 269
806 3300044706 Ga0466964_0050661 Ga0466964_0050661_794_1654 269
807 3300044719 Ga0466971_0065103 Ga0466971_0065103_134_994 269
808 3300044765 Ga0466970_0027973 Ga0466970_0027973_382_1260 269
809 3300044765 Ga0466970_0052142 Ga0466970_0052142_558_1415 269
810 3300044842 Ga0466957_0067746 Ga0466957_0067746_18_878 269
811 3300044901 Ga0466960_0041486 Ga0466960_0041486_264_1130 269
812 3300045049 Ga0466959_0003260 Ga0466959_0003260_6215_7093 269
813 3300045049 Ga0466959_0043161 Ga0466959_0043161_387_1253 269
814 3300045049 Ga0466959_0142840 Ga0466959_0142840_503_1363 269
815 3300045836 Ga0466958_0040231 Ga0466958_0040231_761_1621 269
816 3300045836 Ga0466958_0073248 Ga0466958_0073248_289_1155 269
817 3300045836 Ga0466958_0123034 Ga0466958_0123034_318_1181 269
818 3300045976 Ga0466967_0173482 Ga0466967_0173482_74_940 269
819 3300046539 Ga0495621_0001481 Ga0495621_0001481_4215_5078 269
820 3300048904 Ga0496101_0036190 Ga0496101_0036190_2337_3200 269
821 3300048905 Ga0496102_0642680 Ga0496102_0642680_79_960 269
822 3300048908 Ga0496105_0135825 Ga0496105_0135825_698_1579 269
823 3300048911 Ga0496108_0003426 Ga0496108_0003426_6580_7440 269
824 3300048912 Ga0496109_0054181 Ga0496109_0054181_137_1000 269
825 3300048915 Ga0496112_0016491 Ga0496112_0016491_4332_5192 269
826 3300048916 Ga0496113_0003356 Ga0496113_0003356_7579_8439 269
827 3300048918 Ga0496115_0000488 Ga0496115_0000488_4083_4946 269
828 3300005618 Ga0068864_100257891 Ga0068864_1002578912 273
829 3300005344 Ga0070661_100221700 Ga0070661_1002217002 274
830 3300005355 Ga0070671_100003087 Ga0070671_1000030876 274
831 3300005366 Ga0070659_100028070 Ga0070659_1000280703 274
832 3300005564 Ga0070664_100004698 Ga0070664_1000046986 274
833 3300005577 Ga0068857_100006626 Ga0068857_10000662611 274
834 3300005577 Ga0068857_100457837 Ga0068857_1004578372 274
835 3300005614 Ga0068856_100249193 Ga0068856_1002491933 274
836 3300005617 Ga0068859_100126120 Ga0068859_1001261204 274
837 3300005618 Ga0068864_100009641 Ga0068864_1000096417 274
838 3300005842 Ga0068858_100079042 Ga0068858_1000790422 274
839 3300006358 Ga0068871_100012548 Ga0068871_1000125483 274
840 3300006931 Ga0097620_100126116 Ga0097620_1001261164 274
841 3300009545 Ga0105237_10018421 Ga0105237_100184214 274
842 3300013307 Ga0157372_10083422 Ga0157372_100834226 274
843 3300014968 Ga0157379_10033779 Ga0157379_100337795 274
844 3300025920 Ga0207649_10044459 Ga0207649_100444593 274
845 3300026116 Ga0207674_10002878 Ga0207674_100028786 274
846 3300037312 Ga0395899_0119727 Ga0395899_0119727_788_1612 274
847 3300037418 Ga0395900_0033598 Ga0395900_0033598_1728_2552 274
848 3300037466 Ga0395898_0127017 Ga0395898_0127017_218_1042 274
849 3300037471 Ga0395905_0009309 Ga0395905_0009309_8567_9391 274
850 3300038443 Ga0395901_0042522 Ga0395901_0042522_3307_4131 274
851 3300045976 Ga0466967_0049403 Ga0466967_0049403_977_1885 274
852 3300048904 Ga0496101_0031499 Ga0496101_0031499_2324_3202 274
853 3300048909 Ga0496106_0022837 Ga0496106_0022837_1492_2370 274
854 3300048911 Ga0496108_0007959 Ga0496108_0007959_4710_5588 274
855 3300048913 Ga0496110_0053278 Ga0496110_0053278_986_1864 274
856 3300001904 JGI24736J21556_1002638 JGI24736J21556_10026381 275
857 3300001989 JGI24739J22299_10003933 JGI24739J22299_100039332 275
858 3300001990 JGI24737J22298_10000013 JGI24737J22298_1000001332 275
859 3300001990 JGI24737J22298_10004701 JGI24737J22298_100047012 275
860 3300005327 Ga0070658_10038774 Ga0070658_100387743 275
861 3300005328 Ga0070676_10038899 Ga0070676_100388991 275
862 3300005367 Ga0070667_100171827 Ga0070667_1001718272 275
863 3300005548 Ga0070665_100007593 Ga0070665_1000075932 275
864 3300009147 Ga0114129_10364199 Ga0114129_103641992 275
865 3300009551 Ga0105238_10110112 Ga0105238_101101123 275
866 3300025924 Ga0207694_10151306 Ga0207694_101513062 275
867 3300037418 Ga0395900_0050830 Ga0395900_0050830_1630_2460 275
868 3300037418 Ga0395900_0240935 Ga0395900_0240935_40_867 275
869 3300037471 Ga0395905_0045471 Ga0395905_0045471_553_1383 275
870 3300037471 Ga0395905_0058079 Ga0395905_0058079_1578_2405 275
871 3300037471 Ga0395905_0174780 Ga0395905_0174780_132_968 275
872 3300038443 Ga0395901_0096675 Ga0395901_0096675_670_1500 275

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e04-assembly1.cif.gz_A rpbphp2 chromophore-binding domain crystallized by homologue-directed mutagenesis. 0.7598 4 269
6g1y-assembly1.cif.gz_B crystal structure of the photosensory core module (pcm) of a bathy phytochrome from agrobacterium fabrum in the pfr state. 0.754 4 274
8afk-assembly1.cif.gz_A structure of irfp variant c15s/n136r/v256c in complex with phycocyanobilin 0.7478 4 270
3zq5-assembly1.cif.gz_A-2 structure of the y263f mutant of the cyanobacterial phytochrome cph1 0.7448 60 274
6g1y-assembly1.cif.gz_B crystal structure of the photosensory core module (pcm) of a bathy phytochrome from agrobacterium fabrum in the pfr state. 0.7413 4 274
ID Description Score Start End Superfamily
af_P52052_1_96_3.30.450.90 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7938 57 100 3.30.450.90
5llyA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7902 107 268 3.30.450.40
af_I1N9G7_9_192_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7338 210 259 3.30.450.40
af_I1MKI1_51_235_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7249 211 259 3.30.450.40
4rq9A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7246 101 268 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A2U1FXZ3-F1-model_v4 deleted 0.8862 2 274
AF-A0A2U1FXZ3-F1-model_v4 deleted 0.8769 2 274
AF-A0A7G9SGN0-F1-model_v4 GAF domain-containing protein 0.8608 1 267 GO:0006355
AF-A0A7G9SGN0-F1-model_v4 GAF domain-containing protein 0.8483 1 267 GO:0006355
AF-A0A2T5H1A2-F1-model_v4 Light-regulated signal transduction histidine kinase (Bacteriophytochrome) 0.837 108 274 GO:0006355
GO:0009584
GO:0009881
GO:0016301

Feature Viewer

pLDDT pTM Quality
84.53 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map