F484107

General Info

Members Datasets Scaffolds Average Seq Length
869 352 729 113

Family's Representative Sequence

Representative Sequence 2162886011|MRS1b_contig_3948471|MRS1b_0768.00000710
Length 127
Sequence MEQAFPKCGVFLQGESMDLQVISRDGEPEYAVLPWAQYQALLKAAGFAEKPRPETAQPAPEVAEHPAFDQLGALRTAKCLEVATLARAVGISPSYLELIENGTREPDAAIKRSLAWELGVPGWRGES

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
24 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
25 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
26 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
27 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
28 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
29 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
30 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
31 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
32 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
33 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
34 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
35 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
36 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
37 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
38 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
39 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
40 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
41 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
42 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
43 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
44 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
45 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
46 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
47 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
48 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
49 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
50 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
51 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
52 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
53 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
54 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
55 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
56 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
57 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
58 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
59 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
60 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
61 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
62 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
63 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
64 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
65 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
66 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
67 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
68 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
69 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
70 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
71 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
72 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
73 2773857673 Pseudomonas sp. 443 Isolate Unclassified
74 2784132063 Pseudomonas sp. 424 Isolate Unclassified
75 2784132072 Pseudomonas sp. 460 Isolate Unclassified
76 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
77 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
78 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
79 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
80 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
81 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
82 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
83 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
84 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
85 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
86 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
87 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
88 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
89 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
90 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
91 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
92 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
93 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
94 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
95 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
96 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
97 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
98 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
99 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
100 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
101 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
102 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
103 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
104 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
105 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
106 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
107 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
108 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
109 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
110 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
111 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
112 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
113 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
114 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
115 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
116 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
117 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
118 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
119 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
120 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
121 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
122 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
123 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
124 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
125 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
126 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
127 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
128 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
129 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
130 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
131 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
132 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
133 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
134 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
135 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
136 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
137 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
138 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
139 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
140 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
141 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
142 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
143 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
144 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
145 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
146 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
147 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
148 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
149 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
150 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
151 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
152 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
155 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
159 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
167 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
168 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
169 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
170 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
171 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
180 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
181 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
213 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
228 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
229 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
235 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
236 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
237 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
238 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
239 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
240 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
241 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
242 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
243 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
246 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
247 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
248 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
339 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
340 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
341 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
342 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
343 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
344 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
345 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
346 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
347 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
348 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
349 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
350 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
351 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
352 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.77
Metatranscriptomes 0.12
Isolates 16.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 2.76
Rhizoplane 4.26
Rhizosphere 76.18
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_193 2124908027 Bacteria 1329
2 MRS2a_Contig_783 2124908027 Bacteria 11170
3 MRS2a_Contig_907 2124908027 Bacteria 10129
4 SwRhRL2b_contig_1762711 2162886007 Bacteria 916
5 SwRhRL2b_contig_2731916 2162886007 Bacteria 2361
6 MRS1b_contig_3948471 2162886011 Bacteria 2078
7 JGI25162J39368_1000251 3300002737 Bacteria 52332
8 JGI25162J39368_1001753 3300002737 Bacteria 10374
9 JGI25163J39215_1001256 3300002771 Bacteria 4631
10 JGI25163J39215_1001301 3300002771 Bacteria 4423
11 JGI25164J39214_1000194 3300002772 Bacteria 52332
12 JGI25164J39214_1000860 3300002772 Bacteria 10374
13 JGI25165J46597_1000348 3300003214 Bacteria 52332
14 JGI25165J46597_1001645 3300003214 Bacteria 10374
15 rootH1_10048189 3300003323 Bacteria 1637
16 Ga0006562J51391_1024843 3300003578 Bacteria 1820
17 Ga0055525_1011253 3300003759 Bacteria 755
18 Ga0055536_1000111 3300003781 Bacteria 71634
19 Ga0055536_1010694 3300003781 Bacteria 3607
20 Ga0055536_1015075 3300003781 Bacteria 2669
21 Ga0055536_1058233 3300003781 Bacteria 811
22 Ga0055530_10000146 3300003791 Bacteria 63397
23 Ga0055530_10000299 3300003791 Bacteria 45066
24 Ga0055540_1000289 3300003792 Bacteria 45066
25 Ga0055540_1001173 3300003792 Bacteria 16221
26 Ga0055540_1002941 3300003792 Bacteria 8576
27 Ga0055531_10004949 3300003794 Bacteria 7916
28 Ga0065714_10000069 3300005288 Bacteria 13200
29 Ga0065714_10011147 3300005288 Bacteria 3693
30 Ga0065714_10038993 3300005288 Bacteria 1946
31 Ga0065714_10064686 3300005288 Bacteria 23557
32 Ga0065714_10082993 3300005288 Bacteria 2261
33 Ga0065714_10105771 3300005288 Bacteria 1556
34 Ga0065714_10111534 3300005288 Bacteria 1466
35 Ga0065714_10151507 3300005288 Bacteria 1103
36 Ga0065714_10290456 3300005288 Bacteria 709
37 Ga0065704_10073037 3300005289 Bacteria 7657
38 Ga0065704_10183861 3300005289 Bacteria 1217
39 Ga0065704_10284991 3300005289 Bacteria 915
40 Ga0065704_10606492 3300005289 Bacteria 604
41 Ga0065712_10001766 3300005290 Bacteria 11896
42 Ga0065712_10067928 3300005290 Bacteria 20363
43 Ga0065715_10094643 3300005293 Bacteria 4282
44 Ga0070669_100202872 3300005353 Bacteria 1561
45 Ga0070669_101134644 3300005353 Bacteria 674
46 Ga0070705_101126583 3300005440 Bacteria 643
47 Ga0070708_101881932 3300005445 Bacteria 555
48 Ga0070662_100572778 3300005457 Bacteria 948
49 Ga0070696_101313308 3300005546 Bacteria 614
50 Ga0070665_100051049 3300005548 Bacteria 4149
51 Ga0070702_100509976 3300005615 Bacteria 885
52 Ga0075364_10105851 3300006051 Bacteria 1874
53 Ga0075364_10232005 3300006051 Bacteria 1253
54 Ga0075364_10243832 3300006051 Bacteria 1221
55 Ga0075364_10414776 3300006051 Bacteria 919
56 Ga0075364_10490996 3300006051 Bacteria 839
57 Ga0075432_10000789 3300006058 Bacteria 9856
58 Ga0075432_10102837 3300006058 Bacteria 1057
59 Ga0075362_10037682 3300006177 Bacteria 2121
60 Ga0075362_10209091 3300006177 Bacteria 951
61 Ga0075369_10112721 3300006186 Bacteria 1226
62 Ga0075369_10435474 3300006186 Bacteria 620
63 Ga0075369_10467794 3300006186 Bacteria 598
64 Ga0075436_100184217 3300006914 Bacteria 1476
65 Ga0075436_100345011 3300006914 Bacteria 1072
66 Ga0075436_100458810 3300006914 Bacteria 928
67 Ga0079104_1000364 3300006946 Bacteria 54402
68 Ga0079104_1000433 3300006946 Bacteria 47726
69 Ga0099826_10002763 3300006948 Bacteria 11515
70 Ga0105251_10000275 3300009011 Bacteria 51691
71 Ga0105251_10062588 3300009011 Bacteria 1747
72 Ga0105251_10085321 3300009011 Bacteria 1456
73 Ga0105251_10194446 3300009011 Bacteria 914
74 Ga0105244_10000248 3300009036 Bacteria 55384
75 Ga0105244_10005297 3300009036 Bacteria 8589
76 Ga0105244_10011284 3300009036 Bacteria 5371
77 Ga0105244_10031869 3300009036 Bacteria 2796
78 Ga0105244_10240268 3300009036 Bacteria 846
79 Ga0105250_10006487 3300009092 Bacteria 5112
80 Ga0105250_10044793 3300009092 Bacteria 1774
81 Ga0105250_10068220 3300009092 Bacteria 1435
82 Ga0105243_10010628 3300009148 Bacteria 6983
83 Ga0105243_10040324 3300009148 Bacteria 3646
84 Ga0105243_11562492 3300009148 Bacteria 685
85 Ga0105243_12803598 3300009148 Bacteria 528
86 Ga0105242_10171444 3300009176 Bacteria 1907
87 Ga0105248_11312542 3300009177 Bacteria 818
88 Ga0105249_10496225 3300009553 Bacteria 1265
89 Ga0105246_10004562 3300011119 Bacteria 8431
90 Ga0105246_10005719 3300011119 Bacteria 7590
91 Ga0105246_10025064 3300011119 Bacteria 3885
92 Ga0157336_1003446 3300012477 Bacteria 952
93 Ga0157345_1000436 3300012498 Bacteria 4152
94 Ga0157347_1023504 3300012502 Bacteria 735
95 Ga0157373_10044119 3300013100 Bacteria 3183
96 Ga0157373_10327641 3300013100 Bacteria 1090
97 Ga0157371_10003281 3300013102 Bacteria 14813
98 Ga0157371_10015666 3300013102 Bacteria 5678
99 Ga0157371_11034915 3300013102 Bacteria 627
100 Ga0157370_10113142 3300013104 Bacteria 2537
101 Ga0157370_10163114 3300013104 Bacteria 2073
102 Ga0157370_10275197 3300013104 Bacteria 1555
103 Ga0157370_10357647 3300013104 Bacteria 1346
104 Ga0157370_11048068 3300013104 Bacteria 738
105 Ga0157370_11245586 3300013104 Bacteria 671
106 Ga0157369_10397523 3300013105 Bacteria 1430
107 Ga0157369_10548403 3300013105 Bacteria 1195
108 Ga0157369_11721306 3300013105 Bacteria 637
109 Ga0163162_10035007 3300013306 Bacteria 4999
110 Ga0163162_10171692 3300013306 Bacteria 2293
111 Ga0157372_10068996 3300013307 Bacteria 3976
112 Ga0163163_11946750 3300014325 Bacteria 648
113 Ga0182008_10001718 3300014497 Bacteria 14379
114 Ga0182008_10008321 3300014497 Bacteria 5670
115 Ga0182008_10020748 3300014497 Bacteria 3380
116 Ga0182008_10103634 3300014497 Bacteria 1407
117 Ga0182008_10233673 3300014497 Bacteria 944
118 Ga0182008_10341183 3300014497 Bacteria 792
119 Ga0182006_1001417 3300015261 Bacteria 14494
120 Ga0182006_1019569 3300015261 Bacteria 2848
121 Ga0182006_1024298 3300015261 Bacteria 2500
122 Ga0182006_1036406 3300015261 Bacteria 1957
123 Ga0182006_1049587 3300015261 Bacteria 1620
124 Ga0182006_1130359 3300015261 Bacteria 865
125 Ga0182007_10015589 3300015262 Bacteria 2829
126 Ga0182007_10057208 3300015262 Bacteria 1280
127 Ga0182007_10070850 3300015262 Bacteria 1142
128 Ga0182005_1000759 3300015265 Bacteria 14736
129 Ga0182005_1004592 3300015265 Bacteria 4433
130 Ga0182005_1017508 3300015265 Bacteria 1983
131 Ga0182005_1059341 3300015265 Bacteria 1045
132 Ga0182005_1111553 3300015265 Bacteria 773
133 Ga0182005_1248255 3300015265 Bacteria 550
134 Ga0163161_10025687 3300017792 Bacteria 4171
135 Ga0163161_10056305 3300017792 Bacteria 2856
136 Ga0163161_10085137 3300017792 Bacteria 2332
137 Ga0163161_10324813 3300017792 Bacteria 1217
138 Ga0209760_100064 3300025207 Bacteria 91180
139 Ga0209760_100347 3300025207 Bacteria 13318
140 Ga0209563_100399 3300025230 Bacteria 15541
141 Ga0207427_100008 3300025231 Bacteria 740731
142 Ga0207427_100082 3300025231 Bacteria 142809
143 Ga0209437_100006 3300025233 Bacteria 1042724
144 Ga0209437_100014 3300025233 Bacteria 740714
145 Ga0209233_1000008 3300025261 Bacteria 1356712
146 Ga0209233_1000105 3300025261 Bacteria 272035
147 Ga0209130_1019320 3300025284 Bacteria 1582
148 Ga0209675_1000731 3300025291 Bacteria 22310
149 Ga0209676_1000006 3300025292 Bacteria 1039588
150 Ga0209676_1000016 3300025292 Bacteria 655561
151 Ga0209676_1004571 3300025292 Bacteria 7658
152 Ga0209676_1005738 3300025292 Bacteria 6368
153 Ga0209676_1006944 3300025292 Bacteria 5455
154 Ga0209050_1000070 3300025298 Bacteria 296366
155 Ga0209050_1000399 3300025298 Bacteria 81236
156 Ga0209050_1000477 3300025298 Bacteria 70798
157 Ga0209050_1007067 3300025298 Bacteria 6434
158 Ga0209051_1000043 3300025303 Bacteria 305473
159 Ga0209051_1000086 3300025303 Bacteria 183550
160 Ga0209051_1000106 3300025303 Bacteria 159222
161 Ga0209051_1019498 3300025303 Bacteria 2956
162 Ga0209257_1000604 3300025304 Bacteria 59301
163 Ga0209257_1018965 3300025304 Bacteria 2614
164 Ga0209257_1063163 3300025304 Bacteria 999
165 Ga0207696_1000025 3300025711 Bacteria 418650
166 Ga0207696_1006919 3300025711 Bacteria 4503
167 Ga0207696_1012548 3300025711 Bacteria 2991
168 Ga0207696_1013435 3300025711 Bacteria 2853
169 Ga0207655_1002157 3300025728 Bacteria 16397
170 Ga0207655_1002640 3300025728 Bacteria 14176
171 Ga0207655_1003563 3300025728 Bacteria 11530
172 Ga0207655_1009548 3300025728 Bacteria 6010
173 Ga0207655_1014753 3300025728 Bacteria 4392
174 Ga0207655_1018515 3300025728 Bacteria 3688
175 Ga0207655_1063803 3300025728 Bacteria 1409
176 Ga0207655_1067464 3300025728 Bacteria 1347
177 Ga0207655_1132662 3300025728 Bacteria 810
178 Ga0207713_1000102 3300025735 Bacteria 139512
179 Ga0207713_1005358 3300025735 Bacteria 8054
180 Ga0207713_1008525 3300025735 Bacteria 5892
181 Ga0207713_1019765 3300025735 Bacteria 3284
182 Ga0207713_1047166 3300025735 Bacteria 1745
183 Ga0207681_10105378 3300025923 Bacteria 2041
184 Ga0207706_11440052 3300025933 Bacteria 564
185 Ga0207686_10393607 3300025934 Bacteria 1054
186 Ga0207709_10000053 3300025935 Bacteria 225514
187 Ga0207709_10000835 3300025935 Bacteria 23621
188 Ga0207711_11505142 3300025941 Bacteria 616
189 Ga0207712_10228689 3300025961 Bacteria 1491
190 Ga0209281_1000010 3300027111 Bacteria 726106
191 Ga0209281_1000331 3300027111 Bacteria 81645
192 Ga0209281_1002522 3300027111 Bacteria 7200
193 Ga0209968_1005777 3300027526 Bacteria 1859
194 Ga0209982_1069011 3300027552 Bacteria 578
195 Ga0209983_1016141 3300027665 Bacteria 1541
196 Ga0209282_1054974 3300027666 Bacteria 2255
197 Ga0207428_10057752 3300027907 Bacteria 3081
198 Ga0207428_10083894 3300027907 Bacteria 2484
199 Ga0207428_10513335 3300027907 Bacteria 869
200 Ga0268266_10666782 3300028379 Bacteria 1001
201 Ga0307517_10113051 3300028786 Bacteria 2052
202 Ga0307511_10249185 3300030521 Bacteria 856
203 Ga0314311_1176820 3300030733 Bacteria 4563
204 Ga0316178_1034228 3300030735 Bacteria 7328
205 Ga0316183_1037443 3300030742 Bacteria 906
206 Ga0316183_1104304 3300030742 Bacteria 1271
207 Ga0307408_100028393 3300031548 Bacteria 3865
208 Ga0307408_100034080 3300031548 Bacteria 3562
209 Ga0307408_100126970 3300031548 Bacteria 1984
210 Ga0307408_100333564 3300031548 Bacteria 1281
211 Ga0307516_10395295 3300031730 Bacteria 1042
212 Ga0307405_10013918 3300031731 Bacteria 4307
213 Ga0307405_10045295 3300031731 Bacteria 2694
214 Ga0307405_10074347 3300031731 Bacteria 2197
215 Ga0307405_10174549 3300031731 Bacteria 1536
216 Ga0307413_10185672 3300031824 Bacteria 1487
217 Ga0307413_10194717 3300031824 Bacteria 1458
218 Ga0307413_10265778 3300031824 Bacteria 1281
219 Ga0307406_10019854 3300031901 Bacteria 3948
220 Ga0307406_10022675 3300031901 Bacteria 3727
221 Ga0307407_10046902 3300031903 Bacteria 2448
222 Ga0307407_10284618 3300031903 Bacteria 1146
223 Ga0307412_10002698 3300031911 Bacteria 9852
224 Ga0307412_10027829 3300031911 Bacteria 3530
225 Ga0307412_10096848 3300031911 Bacteria 2077
226 Ga0307412_10141147 3300031911 Bacteria 1764
227 Ga0307409_100047876 3300031995 Bacteria 3249
228 Ga0307416_100376448 3300032002 Bacteria 1448
229 Ga0307416_101417461 3300032002 Bacteria 800
230 Ga0307414_10040975 3300032004 Bacteria 3132
231 Ga0307414_10050400 3300032004 Bacteria 2883
232 Ga0307414_10239738 3300032004 Bacteria 1500
233 Ga0307414_11689284 3300032004 Bacteria 590
234 Ga0307411_10090202 3300032005 Bacteria 2137
235 Ga0307411_10097732 3300032005 Bacteria 2068
236 Ga0307411_10419268 3300032005 Bacteria 1111
237 Ga0307411_10442976 3300032005 Bacteria 1084
238 Ga0307510_10013331 3300033180 Bacteria 9748
239 Ga0237819_01597 3300038705 Bacteria 5636
240 Ga0439438_004838 3300041405 Bacteria 5069
241 Ga0439438_006452 3300041405 Bacteria 4131
242 Ga0439438_006859 3300041405 Bacteria 3966
243 Ga0439438_009308 3300041405 Bacteria 3187
244 Ga0439438_015239 3300041405 Bacteria 2266
245 Ga0439438_017552 3300041405 Bacteria 2056
246 Ga0439447_004944 3300041407 Bacteria 4506
247 Ga0439447_007429 3300041407 Bacteria 3480
248 Ga0439447_018437 3300041407 Bacteria 1880
249 Ga0439447_022173 3300041407 Bacteria 1665
250 Ga0439447_048986 3300041407 Bacteria 1012
251 Ga0439466_0004037 3300041411 Bacteria 5666
252 Ga0439466_0004382 3300041411 Bacteria 5445
253 Ga0439466_0005171 3300041411 Bacteria 4995
254 Ga0439466_0016750 3300041411 Bacteria 2645
255 Ga0439466_0032524 3300041411 Bacteria 1777
256 Ga0439466_0057539 3300041411 Bacteria 1259
257 Ga0439466_0062860 3300041411 Bacteria 1192
258 Ga0439466_0086290 3300041411 Bacteria 986
259 Ga0451841_1211142 3300041498 Bacteria 589
260 Ga0439431_0002752 3300041997 Bacteria 3865
261 Ga0439445_0010690 3300042004 Bacteria 2177
262 Ga0439432_006051 3300042006 Bacteria 4339
263 Ga0439432_013526 3300042006 Bacteria 2774
264 Ga0439432_019120 3300042006 Bacteria 2284
265 Ga0439432_042608 3300042006 Bacteria 1434
266 Ga0439432_153831 3300042006 Bacteria 674
267 Ga0439432_161218 3300042006 Bacteria 656
268 Ga0439451_000750 3300042009 Bacteria 6160
269 Ga0439451_002969 3300042009 Bacteria 3446
270 Ga0439451_003819 3300042009 Bacteria 3059
271 Ga0439451_013994 3300042009 Bacteria 1618
272 Ga0439452_000536 3300042010 Bacteria 20320
273 Ga0439452_001378 3300042010 Bacteria 10010
274 Ga0439452_002923 3300042010 Bacteria 6095
275 Ga0439452_007042 3300042010 Bacteria 3468
276 Ga0439452_010070 3300042010 Bacteria 2763
277 Ga0439452_010226 3300042010 Bacteria 2739
278 Ga0439452_020550 3300042010 Bacteria 1731
279 Ga0439456_015462 3300042013 Bacteria 1593
280 Ga0439456_053345 3300042013 Bacteria 884
281 Ga0439456_055652 3300042013 Bacteria 866
282 Ga0439456_100747 3300042013 Bacteria 653
283 Ga0439456_156560 3300042013 Bacteria 532
284 Ga0439463_000259 3300042016 Bacteria 14533
285 Ga0439463_008968 3300042016 Bacteria 2463
286 Ga0439463_009073 3300042016 Bacteria 2448
287 Ga0439463_009814 3300042016 Bacteria 2352
288 Ga0439463_020249 3300042016 Bacteria 1658
289 Ga0450911_004525 3300042115 Bacteria 2272
290 Ga0450911_004606 3300042115 Bacteria 2238
291 Ga0450922_003353 3300042124 Bacteria 1478
292 Ga0450902_003425 3300042137 Bacteria 2311
293 Ga0450902_006460 3300042137 Bacteria 1795
294 Ga0450902_052346 3300042137 Bacteria 702
295 Ga0450902_065294 3300042137 Bacteria 632
296 Ga0450904_001245 3300042139 Bacteria 3811
297 Ga0450905_004292 3300042142 Bacteria 1885
298 Ga0450905_019801 3300042142 Bacteria 987
299 Ga0450906_059561 3300042145 Bacteria 678
300 Ga0450907_000605 3300042146 Bacteria 9519
301 Ga0450910_000819 3300042147 Bacteria 3755
302 Ga0450909_002097 3300042185 Bacteria 2814
303 Ga0450909_006706 3300042185 Bacteria 1659
304 Ga0439460_0000587 3300042461 Bacteria 7993
305 Ga0439460_0002227 3300042461 Bacteria 4657
306 Ga0439440_0004265 3300042993 Bacteria 2804
307 Ga0495617_000354 3300046452 Bacteria 25300
308 Ga0495617_006638 3300046452 Bacteria 4047
309 Ga0495617_013597 3300046452 Bacteria 2769
310 Ga0495617_018794 3300046452 Bacteria 2337
311 Ga0495617_030873 3300046452 Bacteria 1800
312 Ga0495617_072960 3300046452 Bacteria 1128
313 Ga0495627_000040 3300046453 Bacteria 195248
314 Ga0495627_004421 3300046453 Bacteria 5885
315 Ga0495627_054837 3300046453 Bacteria 1191
316 Ga0495603_0118840 3300046455 Bacteria 1540
317 Ga0495590_0007559 3300046457 Bacteria 4184
318 Ga0495590_0116653 3300046457 Bacteria 955
319 Ga0495591_000601 3300046458 Bacteria 27265
320 Ga0495591_001720 3300046458 Bacteria 13044
321 Ga0495591_002481 3300046458 Bacteria 10233
322 Ga0495591_006984 3300046458 Bacteria 4878
323 Ga0495591_007237 3300046458 Bacteria 4749
324 Ga0495591_008768 3300046458 Bacteria 4102
325 Ga0495591_012497 3300046458 Bacteria 3159
326 Ga0495591_013088 3300046458 Bacteria 3055
327 Ga0495591_017094 3300046458 Bacteria 2501
328 Ga0495591_019992 3300046458 Bacteria 2225
329 Ga0495591_026444 3300046458 Bacteria 1802
330 Ga0495638_0004120 3300046460 Bacteria 11116
331 Ga0495638_0019380 3300046460 Bacteria 4501
332 Ga0495638_0020940 3300046460 Bacteria 4317
333 Ga0495638_0043105 3300046460 Bacteria 2847
334 Ga0495638_0171460 3300046460 Bacteria 1244
335 Ga0495638_0436937 3300046460 Bacteria 671
336 Ga0495653_0022033 3300046463 Bacteria 5156
337 Ga0495653_0066447 3300046463 Bacteria 2712
338 Ga0495653_0070326 3300046463 Bacteria 2619
339 Ga0495653_0124040 3300046463 Bacteria 1836
340 Ga0495650_0000620 3300046471 Bacteria 48027
341 Ga0495650_0001179 3300046471 Bacteria 27791
342 Ga0495650_0010663 3300046471 Bacteria 5109
343 Ga0495650_0011563 3300046471 Bacteria 4824
344 Ga0495650_0014210 3300046471 Bacteria 4158
345 Ga0495650_0014518 3300046471 Bacteria 4092
346 Ga0495650_0058726 3300046471 Bacteria 1551
347 Ga0495605_0000048 3300046474 Bacteria 170182
348 Ga0495605_0000094 3300046474 Bacteria 112717
349 Ga0495605_0001365 3300046474 Bacteria 16105
350 Ga0495605_0001925 3300046474 Bacteria 13206
351 Ga0495605_0002006 3300046474 Bacteria 12862
352 Ga0495605_0008567 3300046474 Bacteria 5779
353 Ga0495605_0010056 3300046474 Bacteria 5299
354 Ga0495605_0010665 3300046474 Bacteria 5135
355 Ga0495605_0025498 3300046474 Bacteria 3080
356 Ga0495605_0058722 3300046474 Bacteria 1848
357 Ga0495605_0081532 3300046474 Bacteria 1513
358 Ga0495639_0000646 3300046475 Bacteria 16084
359 Ga0495584_0002088 3300046491 Bacteria 11457
360 Ga0495584_0002764 3300046491 Bacteria 9810
361 Ga0495584_0007502 3300046491 Bacteria 5686
362 Ga0495584_0014876 3300046491 Bacteria 3964
363 Ga0495584_0023654 3300046491 Bacteria 3115
364 Ga0495584_0025126 3300046491 Bacteria 3019
365 Ga0495584_0039095 3300046491 Bacteria 2397
366 Ga0495584_0083439 3300046491 Bacteria 1609
367 Ga0495585_0000245 3300046492 Bacteria 56106
368 Ga0495585_0003262 3300046492 Bacteria 11051
369 Ga0495585_0004003 3300046492 Bacteria 9704
370 Ga0495585_0018104 3300046492 Bacteria 4064
371 Ga0495585_0148734 3300046492 Bacteria 1222
372 Ga0495594_0016722 3300046499 Bacteria 3866
373 Ga0495594_0037895 3300046499 Bacteria 2631
374 Ga0495596_0001228 3300046500 Bacteria 14950
375 Ga0495596_0044377 3300046500 Bacteria 1749
376 Ga0495607_0000607 3300046501 Bacteria 34837
377 Ga0495607_0000972 3300046501 Bacteria 26545
378 Ga0495607_0001001 3300046501 Bacteria 26020
379 Ga0495607_0001113 3300046501 Bacteria 24369
380 Ga0495607_0007357 3300046501 Bacteria 7627
381 Ga0495607_0009646 3300046501 Bacteria 6523
382 Ga0495607_0022780 3300046501 Bacteria 3929
383 Ga0495607_0034408 3300046501 Bacteria 3074
384 Ga0495607_0039031 3300046501 Bacteria 2838
385 Ga0495607_0059207 3300046501 Bacteria 2185
386 Ga0495607_0069734 3300046501 Bacteria 1966
387 Ga0495607_0070460 3300046501 Bacteria 1954
388 Ga0495607_0128813 3300046501 Bacteria 1319
389 Ga0495607_0553521 3300046501 Bacteria 504
390 Ga0495583_0000096 3300046506 Bacteria 151090
391 Ga0495583_0002375 3300046506 Bacteria 16249
392 Ga0495583_0008065 3300046506 Bacteria 6494
393 Ga0495583_0008482 3300046506 Bacteria 6275
394 Ga0495583_0015320 3300046506 Bacteria 4174
395 Ga0495583_0018235 3300046506 Bacteria 3698
396 Ga0495583_0019239 3300046506 Bacteria 3569
397 Ga0495583_0077349 3300046506 Bacteria 1451
398 Ga0495583_0084264 3300046506 Bacteria 1377
399 Ga0495606_0000167 3300046507 Bacteria 115739
400 Ga0495606_0000320 3300046507 Bacteria 82551
401 Ga0495606_0005753 3300046507 Bacteria 11721
402 Ga0495606_0007505 3300046507 Bacteria 9736
403 Ga0495606_0017162 3300046507 Bacteria 5485
404 Ga0495606_0019938 3300046507 Bacteria 4964
405 Ga0495606_0022587 3300046507 Bacteria 4578
406 Ga0495606_0043807 3300046507 Bacteria 2980
407 Ga0495606_0061605 3300046507 Bacteria 2398
408 Ga0495606_0140681 3300046507 Bacteria 1425
409 Ga0495606_0262914 3300046507 Bacteria 951
410 Ga0495606_0544509 3300046507 Bacteria 579
411 Ga0495610_0008699 3300046512 Bacteria 6534
412 Ga0495610_0009186 3300046512 Bacteria 6275
413 Ga0495610_0012329 3300046512 Bacteria 5154
414 Ga0495610_0018857 3300046512 Bacteria 3878
415 Ga0495610_0019133 3300046512 Bacteria 3840
416 Ga0495610_0039203 3300046512 Bacteria 2398
417 Ga0495610_0120310 3300046512 Bacteria 1151
418 Ga0495616_0000775 3300046513 Bacteria 23344
419 Ga0495616_0011609 3300046513 Bacteria 5040
420 Ga0495616_0016156 3300046513 Bacteria 4136
421 Ga0495616_0016445 3300046513 Bacteria 4094
422 Ga0495616_0052287 3300046513 Bacteria 2034
423 Ga0495616_0216953 3300046513 Bacteria 834
424 Ga0495616_0442662 3300046513 Bacteria 527
425 Ga0495620_0000001 3300046515 Bacteria 386508
426 Ga0495620_0000317 3300046515 Bacteria 34436
427 Ga0495620_0004722 3300046515 Bacteria 7656
428 Ga0495620_0006329 3300046515 Bacteria 6517
429 Ga0495620_0007405 3300046515 Bacteria 5961
430 Ga0495620_0008170 3300046515 Bacteria 5630
431 Ga0495620_0010918 3300046515 Bacteria 4767
432 Ga0495620_0018577 3300046515 Bacteria 3440
433 Ga0495620_0059802 3300046515 Bacteria 1591
434 Ga0495631_0000521 3300046518 Bacteria 25829
435 Ga0495631_0005806 3300046518 Bacteria 6436
436 Ga0495631_0011032 3300046518 Bacteria 4459
437 Ga0495631_0011192 3300046518 Bacteria 4419
438 Ga0495631_0038158 3300046518 Bacteria 2137
439 Ga0495631_0332036 3300046518 Bacteria 647
440 Ga0495632_0004194 3300046519 Bacteria 9859
441 Ga0495632_0004466 3300046519 Bacteria 9499
442 Ga0495632_0006127 3300046519 Bacteria 7793
443 Ga0495632_0037786 3300046519 Bacteria 2447
444 Ga0495632_0048727 3300046519 Bacteria 2096
445 Ga0495632_0056154 3300046519 Bacteria 1925
446 Ga0495632_0099109 3300046519 Bacteria 1374
447 Ga0495632_0144032 3300046519 Bacteria 1104
448 Ga0495632_0242811 3300046519 Bacteria 809
449 Ga0495632_0326545 3300046519 Bacteria 677
450 Ga0495637_0000630 3300046520 Bacteria 24850
451 Ga0495637_0003166 3300046520 Bacteria 8786
452 Ga0495637_0003965 3300046520 Bacteria 7740
453 Ga0495637_0004789 3300046520 Bacteria 6984
454 Ga0495637_0005401 3300046520 Bacteria 6522
455 Ga0495637_0011336 3300046520 Bacteria 4286
456 Ga0495637_0018301 3300046520 Bacteria 3251
457 Ga0495637_0024841 3300046520 Bacteria 2708
458 Ga0495637_0031711 3300046520 Bacteria 2334
459 Ga0495637_0036743 3300046520 Bacteria 2130
460 Ga0495637_0042214 3300046520 Bacteria 1952
461 Ga0495637_0063165 3300046520 Bacteria 1514
462 Ga0495637_0066229 3300046520 Bacteria 1468
463 Ga0495637_0067199 3300046520 Bacteria 1455
464 Ga0495643_0012829 3300046522 Bacteria 5040
465 Ga0495643_0024876 3300046522 Bacteria 3393
466 Ga0495643_0072187 3300046522 Bacteria 1810
467 Ga0495643_0110436 3300046522 Bacteria 1398
468 Ga0495643_0143417 3300046522 Bacteria 1189
469 Ga0495643_0168268 3300046522 Bacteria 1073
470 Ga0495644_0003541 3300046523 Bacteria 6174
471 Ga0495648_0004402 3300046524 Bacteria 12044
472 Ga0495648_0005088 3300046524 Bacteria 11032
473 Ga0495648_0011215 3300046524 Bacteria 6765
474 Ga0495648_0017640 3300046524 Bacteria 5092
475 Ga0495648_0019337 3300046524 Bacteria 4792
476 Ga0495648_0020943 3300046524 Bacteria 4546
477 Ga0495648_0032163 3300046524 Bacteria 3446
478 Ga0495648_0035114 3300046524 Bacteria 3253
479 Ga0495648_0132476 3300046524 Bacteria 1323
480 Ga0495648_0202696 3300046524 Bacteria 992
481 Ga0495648_0230605 3300046524 Bacteria 906
482 Ga0495648_0406317 3300046524 Bacteria 607
483 Ga0495666_0005246 3300046526 Bacteria 6537
484 Ga0495666_0017304 3300046526 Bacteria 3591
485 Ga0495654_0001051 3300046530 Bacteria 20203
486 Ga0495654_0003292 3300046530 Bacteria 9954
487 Ga0495654_0011145 3300046530 Bacteria 4881
488 Ga0495654_0011198 3300046530 Bacteria 4866
489 Ga0495654_0029095 3300046530 Bacteria 2819
490 Ga0495654_0035972 3300046530 Bacteria 2490
491 Ga0495654_0052932 3300046530 Bacteria 1974
492 Ga0495654_0080493 3300046530 Bacteria 1528
493 Ga0495654_0220370 3300046530 Bacteria 802
494 Ga0495654_0257124 3300046530 Bacteria 725
495 Ga0495587_0006949 3300046536 Bacteria 7351
496 Ga0495609_0000012 3300046538 Bacteria 333994
497 Ga0495609_0000079 3300046538 Bacteria 118997
498 Ga0495609_0001537 3300046538 Bacteria 15132
499 Ga0495609_0009048 3300046538 Bacteria 4842
500 Ga0495609_0012056 3300046538 Bacteria 4103
501 Ga0495609_0013359 3300046538 Bacteria 3880
502 Ga0495609_0025438 3300046538 Bacteria 2714
503 Ga0495597_0005181 3300046542 Bacteria 6942
504 Ga0495597_0006006 3300046542 Bacteria 6327
505 Ga0495597_0022446 3300046542 Bacteria 2927
506 Ga0495597_0061898 3300046542 Bacteria 1629
507 Ga0495597_0097851 3300046542 Bacteria 1239
508 Ga0495645_0048161 3300046543 Bacteria 3105
509 Ga0495622_0003354 3300046557 Bacteria 7560
510 Ga0495622_0006883 3300046557 Bacteria 5278
511 Ga0495622_0007214 3300046557 Bacteria 5162
512 Ga0495622_0095330 3300046557 Bacteria 1366
513 Ga0495622_0118511 3300046557 Bacteria 1209
514 Ga0495633_0000034 3300046558 Bacteria 185552
515 Ga0495633_0003503 3300046558 Bacteria 10412
516 Ga0495633_0009726 3300046558 Bacteria 5285
517 Ga0495656_0012972 3300046615 Bacteria 3089
518 Ga0495668_0003859 3300046616 Bacteria 10956
519 Ga0495668_0181402 3300046616 Bacteria 1153
520 Ga0495668_0313310 3300046616 Bacteria 860
521 Ga0495611_0000656 3300046648 Bacteria 19743
522 Ga0495611_0003561 3300046648 Bacteria 6845
523 Ga0495611_0008446 3300046648 Bacteria 4359
524 Ga0495611_0063205 3300046648 Bacteria 1684
525 Ga0495625_0016308 3300046660 Bacteria 5850
526 Ga0495625_0021556 3300046660 Bacteria 4958
527 Ga0495625_0033597 3300046660 Bacteria 3791
528 Ga0495635_0010205 3300046663 Bacteria 6566
529 Ga0495659_0000843 3300046664 Bacteria 10900
530 Ga0495659_0058888 3300046664 Bacteria 1414
531 Ga0495661_0000004 3300046665 Bacteria 555340
532 Ga0495661_0000099 3300046665 Bacteria 106462
533 Ga0495661_0000146 3300046665 Bacteria 82292
534 Ga0495661_0027639 3300046665 Bacteria 3639
535 Ga0495661_0029961 3300046665 Bacteria 3468
536 Ga0495661_0045676 3300046665 Bacteria 2677
537 Ga0495661_0055985 3300046665 Bacteria 2361
538 Ga0495623_0014423 3300046679 Bacteria 5114
539 Ga0495646_0003771 3300046680 Bacteria 9475
540 Ga0495646_0018359 3300046680 Bacteria 4430
541 Ga0495646_0040329 3300046680 Bacteria 2876
542 Ga0495669_0008384 3300046684 Bacteria 4345
543 Ga0495613_0043455 3300046689 Bacteria 3324
544 Ga0495624_0021771 3300046690 Bacteria 4247
545 Ga0495670_0004393 3300046691 Bacteria 6915
546 Ga0495670_0007818 3300046691 Bacteria 5257
547 Ga0495670_0013231 3300046691 Bacteria 4057
548 Ga0495670_0024324 3300046691 Bacteria 2993
549 Ga0495670_0085367 3300046691 Bacteria 1611
550 Ga0495670_0503858 3300046691 Bacteria 657
551 Ga0495671_0002173 3300046692 Bacteria 12496
552 Ga0495671_0003269 3300046692 Bacteria 10051
553 Ga0495671_0012344 3300046692 Bacteria 4670
554 Ga0495671_0019227 3300046692 Bacteria 3614
555 Ga0495671_0023597 3300046692 Bacteria 3212
556 Ga0495671_0029086 3300046692 Bacteria 2840
557 Ga0495671_0053508 3300046692 Bacteria 2003
558 Ga0495671_0054184 3300046692 Bacteria 1988
559 Ga0495649_0005423 3300046694 Bacteria 8116
560 Ga0495649_0005464 3300046694 Bacteria 8075
561 Ga0495649_0014357 3300046694 Bacteria 4541
562 Ga0495649_0016909 3300046694 Bacteria 4127
563 Ga0495649_0017741 3300046694 Bacteria 4014
564 Ga0495649_0025888 3300046694 Bacteria 3266
565 Ga0495649_0028551 3300046694 Bacteria 3091
566 Ga0495649_0151815 3300046694 Bacteria 1216
567 Ga0495589_0002520 3300046794 Bacteria 10205
568 Ga0495589_0002693 3300046794 Bacteria 9819
569 Ga0495589_0002714 3300046794 Bacteria 9790
570 Ga0495589_0009866 3300046794 Bacteria 4961
571 Ga0495589_0018110 3300046794 Bacteria 3613
572 Ga0495600_0233487 3300046809 Bacteria 1173
573 Ga0495660_0002517 3300046810 Bacteria 11684
574 Ga0495660_0009860 3300046810 Bacteria 5556
575 Ga0495660_0010879 3300046810 Bacteria 5286
576 Ga0495660_0014485 3300046810 Bacteria 4560
577 Ga0495660_0032191 3300046810 Bacteria 2945
578 Ga0495660_0048607 3300046810 Bacteria 2319
579 Ga0495660_0049879 3300046810 Bacteria 2282
580 Ga0495660_0051467 3300046810 Bacteria 2241
581 Ga0495660_0062200 3300046810 Bacteria 2001
582 Ga0495660_0064487 3300046810 Bacteria 1957
583 Ga0495660_0066167 3300046810 Bacteria 1927
584 Ga0495660_0192646 3300046810 Bacteria 978
585 Ga0495660_0197656 3300046810 Bacteria 962
586 Ga0495660_0298340 3300046810 Bacteria 731
587 Ga0495604_0066836 3300047317 Bacteria 2733
588 Ga0495604_0077619 3300047317 Bacteria 2495
589 Ga0495636_0000266 3300047318 Bacteria 20690
590 Ga0495636_0024374 3300047318 Bacteria 2453
591 Ga0495674_0025256 3300047319 Bacteria 5450
592 Ga0495672_0003102 3300047320 Bacteria 14510
593 Ga0495672_0003872 3300047320 Bacteria 12582
594 Ga0495672_0016498 3300047320 Bacteria 4973
595 Ga0495672_0020413 3300047320 Bacteria 4344
596 Ga0495672_0021688 3300047320 Bacteria 4186
597 Ga0495672_0022599 3300047320 Bacteria 4085
598 Ga0495672_0025637 3300047320 Bacteria 3768
599 Ga0495672_0031303 3300047320 Bacteria 3323
600 Ga0495672_0033624 3300047320 Bacteria 3175
601 Ga0495672_0093408 3300047320 Bacteria 1647
602 Ga0495672_0154352 3300047320 Bacteria 1187
603 Ga0495672_0187036 3300047320 Bacteria 1044
604 Ga0495676_0000016 3300047321 Bacteria 196310
605 Ga0495676_0007637 3300047321 Bacteria 9916
606 Ga0495680_0018278 3300047322 Bacteria 5956
607 Ga0495680_0028233 3300047322 Bacteria 4601
608 Ga0495680_0128328 3300047322 Bacteria 1865
609 Ga0495683_0000034 3300047323 Bacteria 148959
610 Ga0495683_0000621 3300047323 Bacteria 26501
611 Ga0495683_0002272 3300047323 Bacteria 11724
612 Ga0495683_0007868 3300047323 Bacteria 5718
613 Ga0495683_0444073 3300047323 Bacteria 533
614 Ga0495687_003839 3300047443 Bacteria 10574
615 Ga0495687_010649 3300047443 Bacteria 5025
616 Ga0495675_0019286 3300047444 Bacteria 4332
617 Ga0495675_0160476 3300047444 Bacteria 1384
618 Ga0495679_000087 3300047446 Bacteria 85691
619 Ga0495679_000377 3300047446 Bacteria 34132
620 Ga0495679_002899 3300047446 Bacteria 8492
621 Ga0495673_0000855 3300047469 Bacteria 28276
622 Ga0495673_0003116 3300047469 Bacteria 11101
623 Ga0495673_0003247 3300047469 Bacteria 10834
624 Ga0495673_0005026 3300047469 Bacteria 8106
625 Ga0495673_0010022 3300047469 Bacteria 5190
626 Ga0495673_0015142 3300047469 Bacteria 3983
627 Ga0495673_0023110 3300047469 Bacteria 3032
628 Ga0495673_0025347 3300047469 Bacteria 2849
629 Ga0495673_0033143 3300047469 Bacteria 2400
630 Ga0495673_0041011 3300047469 Bacteria 2086
631 Ga0495673_0046857 3300047469 Bacteria 1913
632 Ga0495673_0051203 3300047469 Bacteria 1809
633 Ga0495673_0062022 3300047469 Bacteria 1598
634 Ga0495673_0067939 3300047469 Bacteria 1507
635 Ga0495673_0079343 3300047469 Bacteria 1362
636 Ga0495673_0334880 3300047469 Bacteria 536
637 Ga0495681_0005202 3300047470 Bacteria 8743
638 Ga0495681_0009799 3300047470 Bacteria 5859
639 Ga0495681_0011392 3300047470 Bacteria 5294
640 Ga0495681_0012460 3300047470 Bacteria 4994
641 Ga0495681_0014027 3300047470 Bacteria 4620
642 Ga0495681_0016937 3300047470 Bacteria 4064
643 Ga0495681_0017593 3300047470 Bacteria 3961
644 Ga0495681_0026918 3300047470 Bacteria 2983
645 Ga0495681_0027656 3300047470 Bacteria 2930
646 Ga0495681_0031870 3300047470 Bacteria 2660
647 Ga0495681_0057433 3300047470 Bacteria 1807
648 Ga0495681_0092556 3300047470 Bacteria 1332
649 Ga0495681_0318792 3300047470 Bacteria 597
650 Ga0495684_0032034 3300047471 Bacteria 4035
651 Ga0495686_0023134 3300047472 Bacteria 4102
652 Ga0495686_0036493 3300047472 Bacteria 3154
653 Ga0495686_0072546 3300047472 Bacteria 2116
654 Ga0495686_0349574 3300047472 Bacteria 804
655 Ga0495593_0025675 3300047673 Bacteria 3260
656 Ga0495593_0030572 3300047673 Bacteria 2946
657 Ga0495602_0041611 3300048088 Bacteria 4195
658 Ga0495626_0000098 3300048091 Bacteria 113821
659 Ga0495626_0000950 3300048091 Bacteria 25191
660 Ga0495626_0002932 3300048091 Bacteria 11353
661 Ga0495626_0007199 3300048091 Bacteria 6219
662 Ga0495626_0013169 3300048091 Bacteria 4308
663 Ga0495626_0013442 3300048091 Bacteria 4253
664 Ga0495626_0014566 3300048091 Bacteria 4051
665 Ga0495626_0016306 3300048091 Bacteria 3776
666 Ga0495626_0035403 3300048091 Bacteria 2382
667 Ga0496102_0020546 3300048905 Bacteria 5834
668 Ga0496110_0357251 3300048913 Bacteria 1331
669 Ga0496112_0243402 3300048915 Bacteria 1751
670 Ga0496116_0001043 3300048919 Bacteria 33784
671 Ga0496116_0005334 3300048919 Bacteria 11981
672 Ga0496116_0018153 3300048919 Bacteria 5432
673 Ga0496116_0029051 3300048919 Bacteria 3992
674 Ga0496117_0014519 3300048920 Bacteria 6779
675 Ga0496117_0124578 3300048920 Bacteria 1576
676 Ga0496117_0126028 3300048920 Bacteria 1562
677 Ga0496117_0169420 3300048920 Bacteria 1269
678 Ga0496118_0060569 3300048921 Bacteria 2809
679 Ga0496118_0081963 3300048921 Bacteria 2262
680 Ga0496118_0140360 3300048921 Bacteria 1533
681 Ga0496118_0283097 3300048921 Bacteria 921
682 Ga0496119_0037768 3300048922 Bacteria 3131
683 Ga0496119_0286679 3300048922 Bacteria 817
684 Ga0496121_0001822 3300048924 Bacteria 34380
685 Ga0496121_0004179 3300048924 Bacteria 19722
686 Ga0496121_0026654 3300048924 Bacteria 5435
687 Ga0496121_0029008 3300048924 Bacteria 5132
688 Ga0496121_0518844 3300048924 Bacteria 752
689 Ga0496122_0005165 3300048925 Bacteria 15725
690 Ga0496122_0014333 3300048925 Bacteria 7672
691 Ga0496122_0028852 3300048925 Bacteria 4694
692 Ga0496122_0045344 3300048925 Bacteria 3418
693 Ga0496122_0103293 3300048925 Bacteria 1897
694 Ga0496123_0004089 3300048926 Bacteria 15683
695 Ga0496123_0017533 3300048926 Bacteria 5754
696 Ga0496123_0037041 3300048926 Bacteria 3449
697 Ga0496123_0068921 3300048926 Bacteria 2224
698 Ga0496123_0073330 3300048926 Bacteria 2124
699 Ga0496124_0000132 3300048927 Bacteria 155405
700 Ga0496124_0010500 3300048927 Bacteria 9368
701 Ga0496124_0038730 3300048927 Bacteria 4137
702 Ga0496124_0067852 3300048927 Bacteria 2966
703 Ga0496124_0167998 3300048927 Bacteria 1702
704 Ga0496124_0323332 3300048927 Bacteria 1103
705 Ga0496124_0384757 3300048927 Bacteria 980
706 Ga0496125_0029893 3300048928 Bacteria 4885
707 Ga0496125_0122192 3300048928 Bacteria 1854
708 Ga0496125_0140407 3300048928 Bacteria 1681
709 Ga0496126_0084686 3300048929 Bacteria 2796
710 Ga0495678_000049 3300049459 Bacteria 163929
711 Ga0495678_000918 3300049459 Bacteria 25900
712 Ga0495678_002417 3300049459 Bacteria 12714
713 Ga0495678_004853 3300049459 Bacteria 7617
714 Ga0495678_006577 3300049459 Bacteria 6161
715 Ga0495678_006901 3300049459 Bacteria 5960
716 Ga0495678_015979 3300049459 Bacteria 3444
717 Ga0495678_017157 3300049459 Bacteria 3289
718 Ga0495678_050137 3300049459 Bacteria 1619
719 Ga0495682_0000346 3300049460 Bacteria 34097
720 Ga0495682_0004020 3300049460 Bacteria 6398
721 Ga0495682_0117291 3300049460 Bacteria 953
722 Ga0495682_0157363 3300049460 Bacteria 809
723 nmdc:mga03683_180789_c1 3300050489 Bacteria 962
724 nmdc:mga00v17_139626_c1 3300050491 Bacteria 1553
725 nmdc:mga00v17_403992_c1 3300050491 Bacteria 888
726 nmdc:mga0sz30_390946_c1 3300050516 Bacteria 623
727 Ga0500618_023157 3300053125 Bacteria 1506
728 Ga0500573_0008105 3300053140 Bacteria 5777
729 Ga0500586_081189 3300053145 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0436937 Ga0495638_0436937_162_509 95
2 3300046474 Ga0495605_0000094 Ga0495605_0000094_57827_58177 95
3 3300046501 Ga0495607_0034408 Ga0495607_0034408_1702_2049 95
4 3300046691 Ga0495670_0085367 Ga0495670_0085367_1010_1360 96
5 3300006946 Ga0079104_1000433 Ga0079104_10004335 98
6 3300027111 Ga0209281_1000331 Ga0209281_100033162 98
7 3300046507 Ga0495606_0022587 Ga0495606_0022587_2859_3203 100
8 3300046810 Ga0495660_0197656 Ga0495660_0197656_120_464 100
9 3300048921 Ga0496118_0140360 Ga0496118_0140360_512_862 100
10 3300048924 Ga0496121_0001822 Ga0496121_0001822_30521_30871 100
11 3300048925 Ga0496122_0103293 Ga0496122_0103293_1301_1651 100
12 3300048926 Ga0496123_0073330 Ga0496123_0073330_452_802 100
13 3300015261 Ga0182006_1130359 Ga0182006_11303592 103
14 3300046501 Ga0495607_0009646 Ga0495607_0009646_4885_5232 103
15 iso_pu_bacteria 2826581358 2826584497 103
16 iso_pu_bacteria 2842815866 2842818051 103
17 iso_pu_bacteria 2990196909 2990200200 103
18 3300046452 Ga0495617_072960 Ga0495617_072960_287_637 105
19 3300046471 Ga0495650_0000620 Ga0495650_0000620_5434_5784 105
20 3300046491 Ga0495584_0014876 Ga0495584_0014876_869_1219 105
21 3300046507 Ga0495606_0000167 Ga0495606_0000167_9665_10015 105
22 3300046520 Ga0495637_0000630 Ga0495637_0000630_5486_5836 105
23 3300046522 Ga0495643_0110436 Ga0495643_0110436_287_637 105
24 3300046557 Ga0495622_0118511 Ga0495622_0118511_453_803 105
25 3300046665 Ga0495661_0000099 Ga0495661_0000099_89897_90247 105
26 3300046692 Ga0495671_0054184 Ga0495671_0054184_1179_1529 105
27 3300046694 Ga0495649_0014357 Ga0495649_0014357_4028_4378 105
28 3300046810 Ga0495660_0062200 Ga0495660_0062200_722_1072 105
29 3300046810 Ga0495660_0066167 Ga0495660_0066167_648_998 105
30 3300047320 Ga0495672_0033624 Ga0495672_0033624_1660_2010 105
31 3300047321 Ga0495676_0000016 Ga0495676_0000016_63375_63725 105
32 3300047469 Ga0495673_0041011 Ga0495673_0041011_1210_1560 105
33 3300047469 Ga0495673_0334880 Ga0495673_0334880_125_475 105
34 3300047470 Ga0495681_0092556 Ga0495681_0092556_230_580 105
35 3300048927 Ga0496124_0384757 Ga0496124_0384757_443_820 105
36 3300049459 Ga0495678_002417 Ga0495678_002417_4325_4675 105
37 3300003759 Ga0055525_1011253 Ga0055525_10112532 106
38 3300025230 Ga0209563_100399 Ga0209563_1003994 106
39 3300046524 Ga0495648_0230605 Ga0495648_0230605_42_392 106
40 3300046648 Ga0495611_0000656 Ga0495611_0000656_17859_18209 106
41 3300047472 Ga0495686_0072546 Ga0495686_0072546_1265_1615 106
42 iso_pu_bacteria 2599185155 2599328585 107
43 iso_pu_bacteria 2842849001 2842849313 107
44 iso_pu_bacteria 2599185307 2599974287 108
45 iso_pu_bacteria 2600255283 2601626571 108
46 iso_pu_bacteria 3007855910 3007856299 108
47 iso_pu_bacteria 2511231004 2511254587 109
48 iso_pu_bacteria 2511231008 2511277327 109
49 iso_pu_bacteria 2511231010 2511287356 109
50 iso_pu_bacteria 2511231011 2511297039 109
51 iso_pu_bacteria 2511231012 2511301900 109
52 iso_pu_bacteria 2511231014 2511317128 109
53 iso_pu_bacteria 2511231015 2511319830 109
54 iso_pu_bacteria 2511231016 2511328808 109
55 iso_pu_bacteria 2511231017 2511331577 109
56 iso_pu_bacteria 2511231018 2511339044 109
57 iso_pu_bacteria 2511231019 2511345005 109
58 iso_pu_bacteria 2511231020 2511353312 109
59 iso_pu_bacteria 2511231021 2511357343 109
60 iso_pu_bacteria 2511231022 2511362892 109
61 iso_pu_bacteria 2511231023 2511366969 109
62 iso_pu_bacteria 2511231031 2511416197 109
63 iso_pu_bacteria 2554235341 2555671413 109
64 iso_pu_bacteria 2599185188 2599503320 109
65 iso_pu_bacteria 2599185257 2599803954 109
66 iso_pu_bacteria 2599185300 2599934797 109
67 iso_pu_bacteria 2599185356 2600213880 109
68 iso_pu_bacteria 2600255313 2601774046 109
69 iso_pu_bacteria 2600255318 2601795589 109
70 iso_pu_bacteria 2603880185 2606075657 109
71 iso_pu_bacteria 2603880199 2606128430 109
72 iso_pu_bacteria 2623620443 2624479526 109
73 iso_pu_bacteria 2643221565 2643841667 109
74 iso_pu_bacteria 2643221589 2643952660 109
75 iso_pu_bacteria 2643221602 2644022422 109
76 iso_pu_bacteria 2643221633 2644187456 109
77 iso_pu_bacteria 2713897148 2715754085 109
78 iso_pu_bacteria 2713897149 2715757793 109
79 iso_pu_bacteria 2738541271 2738691394 109
80 iso_pu_bacteria 2738543004 2739201239 109
81 iso_pu_bacteria 2738543015 2739261197 109
82 iso_pu_bacteria 2738543016 2739267169 109
83 iso_pu_bacteria 2738543025 2739316671 109
84 iso_pu_bacteria 2773857673 2774137683 109
85 iso_pu_bacteria 2784132063 2784265564 109
86 iso_pu_bacteria 2784132072 2784316024 109
87 iso_pu_bacteria 2808606377 2808927456 109
88 iso_pu_bacteria 2808606381 2808950005 109
89 iso_pu_bacteria 2808606382 2808957279 109
90 iso_pu_bacteria 2808606445 2809216462 109
91 iso_pu_bacteria 2818991456 2819654706 109
92 iso_pu_bacteria 2818991464 2819702105 109
93 iso_pu_bacteria 2825651385 2825656407 109
94 iso_pu_bacteria 2842832357 2842832603 109
95 iso_pu_bacteria 2842843487 2842848311 109
96 iso_pu_bacteria 2842854478 2842856793 109
97 iso_pu_bacteria 2844665904 2844671933 109
98 iso_pu_bacteria 2852657418 2852659010 109
99 iso_pu_bacteria 2860339153 2860339925 109
100 iso_pu_bacteria 2878029506 2878031530 109
101 iso_pu_bacteria 2880230671 2880232400 109
102 iso_pu_bacteria 2904518522 2904521709 109
103 iso_pu_bacteria 2904550169 2904553106 109
104 iso_pu_bacteria 2913036834 2913041179 109
105 iso_pu_bacteria 2917070673 2917075279 109
106 iso_pu_bacteria 2919063839 2919063999 109
107 iso_pu_bacteria 2919385768 2919386493 109
108 iso_pu_bacteria 2919456309 2919457022 109
109 iso_pu_bacteria 2919481497 2919484234 109
110 iso_pu_bacteria 2919487758 2919491224 109
111 iso_pu_bacteria 2919697872 2919702769 109
112 iso_pu_bacteria 2923153595 2923158106 109
113 iso_pu_bacteria 2923586266 2923590163 109
114 iso_pu_bacteria 2929144301 2929148632 109
115 iso_pu_bacteria 2931369376 2931373929 109
116 iso_pu_bacteria 2931396565 2931400181 109
117 iso_pu_bacteria 2935353572 2935356267 109
118 iso_pu_bacteria 2939636861 2939639650 109
119 iso_pu_bacteria 2969304461 2969306314 109
120 iso_pu_bacteria 2974289157 2974292032 109
121 iso_pu_bacteria 2984286254 2984288072 109
122 iso_pu_bacteria 2998139840 2998141708 109
123 iso_pu_bacteria 3007395558 3007397409 109
124 iso_pu_bacteria 3007511990 3007515676 109
125 iso_pu_bacteria 3007614139 3007616787 109
126 iso_pu_bacteria 3007619802 3007624629 109
127 iso_pu_bacteria 3007718800 3007722422 109
128 iso_pu_bacteria 3007861166 3007863053 109
129 iso_pu_bacteria 3007866637 3007870564 109
130 iso_pu_bacteria 8015687852 8015692202 109
131 iso_pu_bacteria 8019769354 8019773014 109
132 iso_pu_bacteria 8029995093 8029999049 109
133 iso_pu_bacteria 8055770955 8055775411 109
134 iso_pu_bacteria 8056125926 8056130095 109
135 iso_pu_bacteria 8056155041 8056156140 109
136 iso_pu_bacteria 8056166840 8056169284 109
137 iso_pu_bacteria 8056172158 8056175469 109
138 iso_pu_bacteria 8056177738 8056181233 109
139 iso_pu_bacteria 8056569372 8056571440 109
140 iso_pu_bacteria 8057798959 8057804227 109
141 3300009011 Ga0105251_10085321 Ga0105251_100853212 110
142 3300013104 Ga0157370_10275197 Ga0157370_102751973 110
143 3300046458 Ga0495591_006984 Ga0495591_006984_2357_2689 110
144 3300046471 Ga0495650_0014210 Ga0495650_0014210_1011_1343 110
145 3300046474 Ga0495605_0000048 Ga0495605_0000048_75568_75900 110
146 3300046499 Ga0495594_0016722 Ga0495594_0016722_1164_1496 110
147 3300046506 Ga0495583_0000096 Ga0495583_0000096_61722_62054 110
148 3300046507 Ga0495606_0000320 Ga0495606_0000320_527_877 110
149 3300046512 Ga0495610_0120310 Ga0495610_0120310_278_610 110
150 3300046513 Ga0495616_0052287 Ga0495616_0052287_1085_1417 110
151 3300046515 Ga0495620_0000001 Ga0495620_0000001_26771_27103 110
152 3300046518 Ga0495631_0011192 Ga0495631_0011192_2700_3032 110
153 3300046520 Ga0495637_0063165 Ga0495637_0063165_122_454 110
154 3300046524 Ga0495648_0132476 Ga0495648_0132476_107_439 110
155 3300046538 Ga0495609_0000012 Ga0495609_0000012_64412_64744 110
156 3300046542 Ga0495597_0005181 Ga0495597_0005181_6086_6418 110
157 3300046558 Ga0495633_0000034 Ga0495633_0000034_123527_123859 110
158 3300046648 Ga0495611_0003561 Ga0495611_0003561_5712_6044 110
159 3300046665 Ga0495661_0000004 Ga0495661_0000004_493259_493591 110
160 3300046691 Ga0495670_0024324 Ga0495670_0024324_2591_2923 110
161 3300046692 Ga0495671_0053508 Ga0495671_0053508_875_1207 110
162 3300046794 Ga0495589_0002693 Ga0495589_0002693_8024_8356 110
163 3300046810 Ga0495660_0009860 Ga0495660_0009860_3161_3493 110
164 3300047323 Ga0495683_0000034 Ga0495683_0000034_87096_87428 110
165 3300047446 Ga0495679_000377 Ga0495679_000377_7067_7399 110
166 3300047469 Ga0495673_0051203 Ga0495673_0051203_1280_1612 110
167 3300047470 Ga0495681_0014027 Ga0495681_0014027_1426_1758 110
168 3300048925 Ga0496122_0014333 Ga0496122_0014333_2263_2595 110
169 3300048926 Ga0496123_0037041 Ga0496123_0037041_2263_2595 110
170 3300049459 Ga0495678_000049 Ga0495678_000049_102046_102378 110
171 3300053125 Ga0500618_023157 Ga0500618_023157_817_1149 110
172 2162886011 MRS1b_contig_3948471 MRS1b_0768.00000710 111
173 3300005290 Ga0065712_10067928 Ga0065712_100679285 111
174 3300009036 Ga0105244_10000248 Ga0105244_1000024837 111
175 3300011119 Ga0105246_10004562 Ga0105246_100045623 111
176 3300025728 Ga0207655_1003563 Ga0207655_10035634 111
177 3300042006 Ga0439432_161218 Ga0439432_161218_34_372 111
178 3300042137 Ga0450902_052346 Ga0450902_052346_31_366 111
179 3300046453 Ga0495627_000040 Ga0495627_000040_93421_93768 111
180 3300046474 Ga0495605_0010665 Ga0495605_0010665_3271_3615 111
181 3300046474 Ga0495605_0081532 Ga0495605_0081532_348_695 111
182 3300046501 Ga0495607_0000972 Ga0495607_0000972_3562_3909 111
183 3300046530 Ga0495654_0080493 Ga0495654_0080493_1060_1404 111
184 3300046616 Ga0495668_0313310 Ga0495668_0313310_69_416 111
185 3300046810 Ga0495660_0010879 Ga0495660_0010879_430_777 111
186 3300047320 Ga0495672_0154352 Ga0495672_0154352_454_801 111
187 3300048927 Ga0496124_0038730 Ga0496124_0038730_3444_3785 111
188 3300053140 Ga0500573_0008105 Ga0500573_0008105_2745_3092 111
189 3300053145 Ga0500586_081189 Ga0500586_081189_569_916 111
190 3300005288 Ga0065714_10111534 Ga0065714_101115343 112
191 3300005288 Ga0065714_10290456 Ga0065714_102904562 112
192 3300009011 Ga0105251_10000275 Ga0105251_1000027528 112
193 3300009036 Ga0105244_10011284 Ga0105244_100112844 112
194 3300013105 Ga0157369_10548403 Ga0157369_105484034 112
195 3300015265 Ga0182005_1059341 Ga0182005_10593411 112
196 3300015265 Ga0182005_1248255 Ga0182005_12482551 112
197 3300025728 Ga0207655_1002157 Ga0207655_10021576 112
198 3300025735 Ga0207713_1000102 Ga0207713_100010220 112
199 3300031731 Ga0307405_10013918 Ga0307405_100139184 112
200 3300041405 Ga0439438_004838 Ga0439438_004838_1347_1685 112
201 3300041405 Ga0439438_009308 Ga0439438_009308_1403_1741 112
202 3300041411 Ga0439466_0057539 Ga0439466_0057539_635_973 112
203 3300042006 Ga0439432_013526 Ga0439432_013526_1171_1509 112
204 3300042013 Ga0439456_156560 Ga0439456_156560_107_457 112
205 3300042016 Ga0439463_008968 Ga0439463_008968_616_966 112
206 3300042016 Ga0439463_020249 Ga0439463_020249_945_1295 112
207 3300042137 Ga0450902_065294 Ga0450902_065294_89_436 112
208 3300042142 Ga0450905_019801 Ga0450905_019801_96_440 112
209 3300042145 Ga0450906_059561 Ga0450906_059561_257_595 112
210 3300042185 Ga0450909_006706 Ga0450909_006706_944_1282 112
211 3300046453 Ga0495627_054837 Ga0495627_054837_637_987 112
212 3300046457 Ga0495590_0116653 Ga0495590_0116653_126_476 112
213 3300046458 Ga0495591_000601 Ga0495591_000601_23286_23636 112
214 3300046458 Ga0495591_001720 Ga0495591_001720_1723_2073 112
215 3300046458 Ga0495591_012497 Ga0495591_012497_857_1207 112
216 3300046458 Ga0495591_019992 Ga0495591_019992_584_934 112
217 3300046471 Ga0495650_0001179 Ga0495650_0001179_5954_6304 112
218 3300046474 Ga0495605_0001365 Ga0495605_0001365_4593_4943 112
219 3300046474 Ga0495605_0010056 Ga0495605_0010056_2643_2993 112
220 3300046491 Ga0495584_0083439 Ga0495584_0083439_1073_1423 112
221 3300046492 Ga0495585_0148734 Ga0495585_0148734_26_376 112
222 3300046501 Ga0495607_0000607 Ga0495607_0000607_30507_30857 112
223 3300046501 Ga0495607_0001113 Ga0495607_0001113_22100_22444 112
224 3300046501 Ga0495607_0039031 Ga0495607_0039031_1945_2295 112
225 3300046501 Ga0495607_0059207 Ga0495607_0059207_343_693 112
226 3300046501 Ga0495607_0070460 Ga0495607_0070460_1170_1517 112
227 3300046501 Ga0495607_0128813 Ga0495607_0128813_404_754 112
228 3300046506 Ga0495583_0002375 Ga0495583_0002375_13963_14313 112
229 3300046506 Ga0495583_0008065 Ga0495583_0008065_5807_6157 112
230 3300046506 Ga0495583_0008482 Ga0495583_0008482_1799_2149 112
231 3300046506 Ga0495583_0018235 Ga0495583_0018235_1841_2191 112
232 3300046506 Ga0495583_0019239 Ga0495583_0019239_1276_1626 112
233 3300046507 Ga0495606_0262914 Ga0495606_0262914_546_896 112
234 3300046507 Ga0495606_0544509 Ga0495606_0544509_185_535 112
235 3300046512 Ga0495610_0009186 Ga0495610_0009186_1683_2033 112
236 3300046512 Ga0495610_0039203 Ga0495610_0039203_409_759 112
237 3300046513 Ga0495616_0442662 Ga0495616_0442662_146_496 112
238 3300046515 Ga0495620_0000317 Ga0495620_0000317_3598_3948 112
239 3300046515 Ga0495620_0004722 Ga0495620_0004722_2852_3202 112
240 3300046515 Ga0495620_0008170 Ga0495620_0008170_3442_3783 112
241 3300046515 Ga0495620_0059802 Ga0495620_0059802_648_998 112
242 3300046518 Ga0495631_0011032 Ga0495631_0011032_1607_1957 112
243 3300046518 Ga0495631_0038158 Ga0495631_0038158_1585_1935 112
244 3300046519 Ga0495632_0004466 Ga0495632_0004466_3481_3831 112
245 3300046519 Ga0495632_0048727 Ga0495632_0048727_811_1161 112
246 3300046519 Ga0495632_0144032 Ga0495632_0144032_111_455 112
247 3300046519 Ga0495632_0242811 Ga0495632_0242811_32_382 112
248 3300046519 Ga0495632_0326545 Ga0495632_0326545_298_648 112
249 3300046520 Ga0495637_0003965 Ga0495637_0003965_5470_5820 112
250 3300046520 Ga0495637_0024841 Ga0495637_0024841_779_1129 112
251 3300046522 Ga0495643_0024876 Ga0495643_0024876_1588_1938 112
252 3300046523 Ga0495644_0003541 Ga0495644_0003541_5032_5382 112
253 3300046524 Ga0495648_0035114 Ga0495648_0035114_1945_2295 112
254 3300046524 Ga0495648_0406317 Ga0495648_0406317_232_582 112
255 3300046530 Ga0495654_0220370 Ga0495654_0220370_401_751 112
256 3300046538 Ga0495609_0000079 Ga0495609_0000079_104321_104671 112
257 3300046538 Ga0495609_0001537 Ga0495609_0001537_2054_2404 112
258 3300046538 Ga0495609_0025438 Ga0495609_0025438_1429_1779 112
259 3300046542 Ga0495597_0061898 Ga0495597_0061898_681_1031 112
260 3300046543 Ga0495645_0048161 Ga0495645_0048161_303_650 112
261 3300046616 Ga0495668_0181402 Ga0495668_0181402_544_894 112
262 3300046665 Ga0495661_0000146 Ga0495661_0000146_67362_67712 112
263 3300046665 Ga0495661_0045676 Ga0495661_0045676_1412_1762 112
264 3300046665 Ga0495661_0055985 Ga0495661_0055985_660_1010 112
265 3300046692 Ga0495671_0002173 Ga0495671_0002173_3554_3904 112
266 3300046810 Ga0495660_0032191 Ga0495660_0032191_752_1102 112
267 3300046810 Ga0495660_0298340 Ga0495660_0298340_116_466 112
268 3300047320 Ga0495672_0031303 Ga0495672_0031303_1432_1779 112
269 3300047320 Ga0495672_0093408 Ga0495672_0093408_1118_1468 112
270 3300047446 Ga0495679_000087 Ga0495679_000087_1265_1615 112
271 3300047469 Ga0495673_0000855 Ga0495673_0000855_23853_24200 112
272 3300047469 Ga0495673_0005026 Ga0495673_0005026_740_1090 112
273 3300047469 Ga0495673_0010022 Ga0495673_0010022_3496_3837 112
274 3300047469 Ga0495673_0033143 Ga0495673_0033143_592_942 112
275 3300047469 Ga0495673_0046857 Ga0495673_0046857_101_451 112
276 3300047469 Ga0495673_0062022 Ga0495673_0062022_57_407 112
277 3300047472 Ga0495686_0349574 Ga0495686_0349574_129_479 112
278 3300048091 Ga0495626_0000098 Ga0495626_0000098_13798_14148 112
279 3300048913 Ga0496110_0357251 Ga0496110_0357251_517_867 112
280 3300048919 Ga0496116_0029051 Ga0496116_0029051_712_1062 112
281 3300048920 Ga0496117_0124578 Ga0496117_0124578_607_957 112
282 3300048920 Ga0496117_0169420 Ga0496117_0169420_166_516 112
283 3300048921 Ga0496118_0283097 Ga0496118_0283097_337_687 112
284 3300048924 Ga0496121_0518844 Ga0496121_0518844_237_587 112
285 3300048925 Ga0496122_0005165 Ga0496122_0005165_2578_2928 112
286 3300048926 Ga0496123_0004089 Ga0496123_0004089_2578_2928 112
287 3300048927 Ga0496124_0010500 Ga0496124_0010500_4136_4486 112
288 3300048927 Ga0496124_0323332 Ga0496124_0323332_178_528 112
289 3300049459 Ga0495678_000918 Ga0495678_000918_53_403 112
290 3300049459 Ga0495678_050137 Ga0495678_050137_53_403 112
291 3300049460 Ga0495682_0000346 Ga0495682_0000346_30377_30727 112
292 2124908027 MRS2a_Contig_193 MRS2a_00092840 113
293 2124908027 MRS2a_Contig_783 MRS2a_00640260 113
294 2124908027 MRS2a_Contig_907 MRS2a_00749480 113
295 2162886007 SwRhRL2b_contig_1762711 SwRhRL2b_0144.00006610 113
296 2162886007 SwRhRL2b_contig_2731916 SwRhRL2b_0410.00000270 113
297 3300002737 JGI25162J39368_1000251 JGI25162J39368_100025148 113
298 3300002737 JGI25162J39368_1001753 JGI25162J39368_10017536 113
299 3300002771 JGI25163J39215_1001256 JGI25163J39215_10012563 113
300 3300002771 JGI25163J39215_1001301 JGI25163J39215_10013013 113
301 3300002772 JGI25164J39214_1000194 JGI25164J39214_10001946 113
302 3300002772 JGI25164J39214_1000860 JGI25164J39214_10008606 113
303 3300003214 JGI25165J46597_1000348 JGI25165J46597_10003486 113
304 3300003214 JGI25165J46597_1001645 JGI25165J46597_10016456 113
305 3300003323 rootH1_10048189 rootH1_100481892 113
306 3300003578 Ga0006562J51391_1024843 Ga0006562J51391_10248432 113
307 3300003781 Ga0055536_1000111 Ga0055536_100011154 113
308 3300003781 Ga0055536_1010694 Ga0055536_10106944 113
309 3300003781 Ga0055536_1015075 Ga0055536_10150754 113
310 3300003781 Ga0055536_1058233 Ga0055536_10582332 113
311 3300003791 Ga0055530_10000146 Ga0055530_1000014621 113
312 3300003791 Ga0055530_10000299 Ga0055530_100002994 113
313 3300003792 Ga0055540_1000289 Ga0055540_10002894 113
314 3300003792 Ga0055540_1001173 Ga0055540_100117312 113
315 3300003792 Ga0055540_1002941 Ga0055540_10029416 113
316 3300003794 Ga0055531_10004949 Ga0055531_100049496 113
317 3300005288 Ga0065714_10000069 Ga0065714_1000006911 113
318 3300005288 Ga0065714_10011147 Ga0065714_100111474 113
319 3300005288 Ga0065714_10038993 Ga0065714_100389933 113
320 3300005288 Ga0065714_10064686 Ga0065714_1006468618 113
321 3300005288 Ga0065714_10082993 Ga0065714_100829933 113
322 3300005288 Ga0065714_10105771 Ga0065714_101057714 113
323 3300005288 Ga0065714_10151507 Ga0065714_101515072 113
324 3300005289 Ga0065704_10073037 Ga0065704_100730376 113
325 3300005289 Ga0065704_10183861 Ga0065704_101838612 113
326 3300005289 Ga0065704_10284991 Ga0065704_102849911 113
327 3300005289 Ga0065704_10606492 Ga0065704_106064921 113
328 3300005290 Ga0065712_10001766 Ga0065712_100017666 113
329 3300005293 Ga0065715_10094643 Ga0065715_100946435 113
330 3300005353 Ga0070669_100202872 Ga0070669_1002028723 113
331 3300005353 Ga0070669_101134644 Ga0070669_1011346441 113
332 3300005440 Ga0070705_101126583 Ga0070705_1011265832 113
333 3300005445 Ga0070708_101881932 Ga0070708_1018819321 113
334 3300005457 Ga0070662_100572778 Ga0070662_1005727782 113
335 3300005546 Ga0070696_101313308 Ga0070696_1013133082 113
336 3300005548 Ga0070665_100051049 Ga0070665_1000510493 113
337 3300005615 Ga0070702_100509976 Ga0070702_1005099762 113
338 3300006051 Ga0075364_10105851 Ga0075364_101058511 113
339 3300006051 Ga0075364_10232005 Ga0075364_102320052 113
340 3300006051 Ga0075364_10243832 Ga0075364_102438322 113
341 3300006051 Ga0075364_10414776 Ga0075364_104147762 113
342 3300006051 Ga0075364_10490996 Ga0075364_104909962 113
343 3300006058 Ga0075432_10000789 Ga0075432_100007893 113
344 3300006058 Ga0075432_10102837 Ga0075432_101028372 113
345 3300006177 Ga0075362_10037682 Ga0075362_100376824 113
346 3300006177 Ga0075362_10209091 Ga0075362_102090912 113
347 3300006186 Ga0075369_10112721 Ga0075369_101127212 113
348 3300006186 Ga0075369_10435474 Ga0075369_104354742 113
349 3300006186 Ga0075369_10467794 Ga0075369_104677941 113
350 3300006914 Ga0075436_100184217 Ga0075436_1001842173 113
351 3300006914 Ga0075436_100345011 Ga0075436_1003450111 113
352 3300006914 Ga0075436_100458810 Ga0075436_1004588102 113
353 3300006946 Ga0079104_1000364 Ga0079104_100036431 113
354 3300006948 Ga0099826_10002763 Ga0099826_100027638 113
355 3300009011 Ga0105251_10062588 Ga0105251_100625881 113
356 3300009011 Ga0105251_10194446 Ga0105251_101944462 113
357 3300009036 Ga0105244_10005297 Ga0105244_1000529711 113
358 3300009036 Ga0105244_10031869 Ga0105244_100318691 113
359 3300009036 Ga0105244_10240268 Ga0105244_102402682 113
360 3300009092 Ga0105250_10006487 Ga0105250_100064874 113
361 3300009092 Ga0105250_10044793 Ga0105250_100447932 113
362 3300009092 Ga0105250_10068220 Ga0105250_100682201 113
363 3300009148 Ga0105243_10010628 Ga0105243_100106287 113
364 3300009148 Ga0105243_10040324 Ga0105243_100403244 113
365 3300009148 Ga0105243_11562492 Ga0105243_115624922 113
366 3300009148 Ga0105243_12803598 Ga0105243_128035982 113
367 3300009176 Ga0105242_10171444 Ga0105242_101714442 113
368 3300009177 Ga0105248_11312542 Ga0105248_113125422 113
369 3300009553 Ga0105249_10496225 Ga0105249_104962252 113
370 3300011119 Ga0105246_10005719 Ga0105246_100057194 113
371 3300011119 Ga0105246_10025064 Ga0105246_100250643 113
372 3300012477 Ga0157336_1003446 Ga0157336_10034462 113
373 3300012498 Ga0157345_1000436 Ga0157345_10004363 113
374 3300012502 Ga0157347_1023504 Ga0157347_10235042 113
375 3300013100 Ga0157373_10044119 Ga0157373_100441194 113
376 3300013100 Ga0157373_10327641 Ga0157373_103276412 113
377 3300013102 Ga0157371_10003281 Ga0157371_100032813 113
378 3300013102 Ga0157371_10015666 Ga0157371_100156663 113
379 3300013102 Ga0157371_11034915 Ga0157371_110349152 113
380 3300013104 Ga0157370_10113142 Ga0157370_101131423 113
381 3300013104 Ga0157370_10163114 Ga0157370_101631142 113
382 3300013104 Ga0157370_10357647 Ga0157370_103576471 113
383 3300013104 Ga0157370_11048068 Ga0157370_110480682 113
384 3300013104 Ga0157370_11245586 Ga0157370_112455862 113
385 3300013105 Ga0157369_10397523 Ga0157369_103975231 113
386 3300013105 Ga0157369_11721306 Ga0157369_117213061 113
387 3300013306 Ga0163162_10035007 Ga0163162_100350074 113
388 3300013306 Ga0163162_10171692 Ga0163162_101716923 113
389 3300013307 Ga0157372_10068996 Ga0157372_100689964 113
390 3300014325 Ga0163163_11946750 Ga0163163_119467502 113
391 3300014497 Ga0182008_10001718 Ga0182008_1000171816 113
392 3300014497 Ga0182008_10008321 Ga0182008_100083215 113
393 3300014497 Ga0182008_10020748 Ga0182008_100207484 113
394 3300014497 Ga0182008_10103634 Ga0182008_101036343 113
395 3300014497 Ga0182008_10233673 Ga0182008_102336732 113
396 3300014497 Ga0182008_10341183 Ga0182008_103411832 113
397 3300015261 Ga0182006_1001417 Ga0182006_10014173 113
398 3300015261 Ga0182006_1019569 Ga0182006_10195693 113
399 3300015261 Ga0182006_1024298 Ga0182006_10242983 113
400 3300015261 Ga0182006_1036406 Ga0182006_10364062 113
401 3300015261 Ga0182006_1049587 Ga0182006_10495874 113
402 3300015262 Ga0182007_10015589 Ga0182007_100155893 113
403 3300015262 Ga0182007_10057208 Ga0182007_100572082 113
404 3300015262 Ga0182007_10070850 Ga0182007_100708502 113
405 3300015265 Ga0182005_1000759 Ga0182005_10007593 113
406 3300015265 Ga0182005_1004592 Ga0182005_10045924 113
407 3300015265 Ga0182005_1017508 Ga0182005_10175083 113
408 3300015265 Ga0182005_1111553 Ga0182005_11115532 113
409 3300017792 Ga0163161_10025687 Ga0163161_100256873 113
410 3300017792 Ga0163161_10056305 Ga0163161_100563052 113
411 3300017792 Ga0163161_10085137 Ga0163161_100851372 113
412 3300017792 Ga0163161_10324813 Ga0163161_103248131 113
413 3300025207 Ga0209760_100064 Ga0209760_1000646 113
414 3300025207 Ga0209760_100347 Ga0209760_1003476 113
415 3300025231 Ga0207427_100008 Ga0207427_100008176 113
416 3300025231 Ga0207427_100082 Ga0207427_100082128 113
417 3300025233 Ga0209437_100006 Ga0209437_100006259 113
418 3300025233 Ga0209437_100014 Ga0209437_100014535 113
419 3300025261 Ga0209233_1000008 Ga0209233_1000008535 113
420 3300025261 Ga0209233_1000105 Ga0209233_1000105240 113
421 3300025284 Ga0209130_1019320 Ga0209130_10193203 113
422 3300025291 Ga0209675_1000731 Ga0209675_10007314 113
423 3300025292 Ga0209676_1000006 Ga0209676_1000006240 113
424 3300025292 Ga0209676_1000016 Ga0209676_1000016626 113
425 3300025292 Ga0209676_1004571 Ga0209676_10045714 113
426 3300025292 Ga0209676_1005738 Ga0209676_10057383 113
427 3300025292 Ga0209676_1006944 Ga0209676_10069444 113
428 3300025298 Ga0209050_1000070 Ga0209050_1000070279 113
429 3300025298 Ga0209050_1000399 Ga0209050_100039976 113
430 3300025298 Ga0209050_1000477 Ga0209050_100047769 113
431 3300025298 Ga0209050_1007067 Ga0209050_10070673 113
432 3300025303 Ga0209051_1000043 Ga0209051_10000434 113
433 3300025303 Ga0209051_1000086 Ga0209051_1000086112 113
434 3300025303 Ga0209051_1000106 Ga0209051_1000106149 113
435 3300025303 Ga0209051_1019498 Ga0209051_10194983 113
436 3300025304 Ga0209257_1000604 Ga0209257_10006044 113
437 3300025304 Ga0209257_1018965 Ga0209257_10189654 113
438 3300025304 Ga0209257_1063163 Ga0209257_10631632 113
439 3300025711 Ga0207696_1000025 Ga0207696_1000025302 113
440 3300025711 Ga0207696_1006919 Ga0207696_10069193 113
441 3300025711 Ga0207696_1012548 Ga0207696_10125484 113
442 3300025711 Ga0207696_1013435 Ga0207696_10134351 113
443 3300025728 Ga0207655_1002640 Ga0207655_100264012 113
444 3300025728 Ga0207655_1009548 Ga0207655_10095485 113
445 3300025728 Ga0207655_1014753 Ga0207655_10147534 113
446 3300025728 Ga0207655_1018515 Ga0207655_10185151 113
447 3300025728 Ga0207655_1063803 Ga0207655_10638031 113
448 3300025728 Ga0207655_1067464 Ga0207655_10674642 113
449 3300025728 Ga0207655_1132662 Ga0207655_11326622 113
450 3300025735 Ga0207713_1005358 Ga0207713_10053583 113
451 3300025735 Ga0207713_1008525 Ga0207713_10085258 113
452 3300025735 Ga0207713_1019765 Ga0207713_10197654 113
453 3300025735 Ga0207713_1047166 Ga0207713_10471661 113
454 3300025923 Ga0207681_10105378 Ga0207681_101053782 113
455 3300025933 Ga0207706_11440052 Ga0207706_114400521 113
456 3300025934 Ga0207686_10393607 Ga0207686_103936072 113
457 3300025935 Ga0207709_10000053 Ga0207709_10000053221 113
458 3300025935 Ga0207709_10000835 Ga0207709_1000083519 113
459 3300025941 Ga0207711_11505142 Ga0207711_115051422 113
460 3300025961 Ga0207712_10228689 Ga0207712_102286892 113
461 3300027111 Ga0209281_1000010 Ga0209281_1000010553 113
462 3300027111 Ga0209281_1002522 Ga0209281_10025224 113
463 3300027526 Ga0209968_1005777 Ga0209968_10057773 113
464 3300027552 Ga0209982_1069011 Ga0209982_10690112 113
465 3300027665 Ga0209983_1016141 Ga0209983_10161414 113
466 3300027666 Ga0209282_1054974 Ga0209282_10549744 113
467 3300027907 Ga0207428_10057752 Ga0207428_100577523 113
468 3300027907 Ga0207428_10083894 Ga0207428_100838944 113
469 3300027907 Ga0207428_10513335 Ga0207428_105133352 113
470 3300028379 Ga0268266_10666782 Ga0268266_106667823 113
471 3300028786 Ga0307517_10113051 Ga0307517_101130513 113
472 3300030521 Ga0307511_10249185 Ga0307511_102491852 113
473 3300030733 Ga0314311_1176820 Ga0314311_11768203 113
474 3300030735 Ga0316178_1034228 Ga0316178_10342282 113
475 3300030742 Ga0316183_1037443 Ga0316183_10374431 113
476 3300030742 Ga0316183_1104304 Ga0316183_11043042 113
477 3300031548 Ga0307408_100028393 Ga0307408_1000283934 113
478 3300031548 Ga0307408_100034080 Ga0307408_1000340802 113
479 3300031548 Ga0307408_100126970 Ga0307408_1001269703 113
480 3300031548 Ga0307408_100333564 Ga0307408_1003335643 113
481 3300031730 Ga0307516_10395295 Ga0307516_103952952 113
482 3300031731 Ga0307405_10045295 Ga0307405_100452953 113
483 3300031731 Ga0307405_10074347 Ga0307405_100743473 113
484 3300031731 Ga0307405_10174549 Ga0307405_101745492 113
485 3300031824 Ga0307413_10185672 Ga0307413_101856722 113
486 3300031824 Ga0307413_10194717 Ga0307413_101947172 113
487 3300031824 Ga0307413_10265778 Ga0307413_102657781 113
488 3300031901 Ga0307406_10019854 Ga0307406_100198544 113
489 3300031901 Ga0307406_10022675 Ga0307406_100226753 113
490 3300031903 Ga0307407_10046902 Ga0307407_100469024 113
491 3300031903 Ga0307407_10284618 Ga0307407_102846183 113
492 3300031911 Ga0307412_10002698 Ga0307412_100026987 113
493 3300031911 Ga0307412_10027829 Ga0307412_100278292 113
494 3300031911 Ga0307412_10096848 Ga0307412_100968484 113
495 3300031911 Ga0307412_10141147 Ga0307412_101411474 113
496 3300031995 Ga0307409_100047876 Ga0307409_1000478762 113
497 3300032002 Ga0307416_100376448 Ga0307416_1003764483 113
498 3300032002 Ga0307416_101417461 Ga0307416_1014174612 113
499 3300032004 Ga0307414_10040975 Ga0307414_100409752 113
500 3300032004 Ga0307414_10050400 Ga0307414_100504003 113
501 3300032004 Ga0307414_10239738 Ga0307414_102397383 113
502 3300032004 Ga0307414_11689284 Ga0307414_116892842 113
503 3300032005 Ga0307411_10090202 Ga0307411_100902022 113
504 3300032005 Ga0307411_10097732 Ga0307411_100977322 113
505 3300032005 Ga0307411_10419268 Ga0307411_104192682 113
506 3300032005 Ga0307411_10442976 Ga0307411_104429763 113
507 3300033180 Ga0307510_10013331 Ga0307510_100133313 113
508 3300038705 Ga0237819_01597 Ga0237819_01597_2893_3234 113
509 3300041405 Ga0439438_006452 Ga0439438_006452_29_370 113
510 3300041405 Ga0439438_006859 Ga0439438_006859_2262_2603 113
511 3300041405 Ga0439438_015239 Ga0439438_015239_983_1330 113
512 3300041405 Ga0439438_017552 Ga0439438_017552_1058_1399 113
513 3300041407 Ga0439447_004944 Ga0439447_004944_1058_1399 113
514 3300041407 Ga0439447_007429 Ga0439447_007429_2314_2661 113
515 3300041407 Ga0439447_018437 Ga0439447_018437_1059_1400 113
516 3300041407 Ga0439447_022173 Ga0439447_022173_429_770 113
517 3300041407 Ga0439447_048986 Ga0439447_048986_53_394 113
518 3300041411 Ga0439466_0004037 Ga0439466_0004037_4114_4455 113
519 3300041411 Ga0439466_0004382 Ga0439466_0004382_1559_1900 113
520 3300041411 Ga0439466_0005171 Ga0439466_0005171_1242_1583 113
521 3300041411 Ga0439466_0016750 Ga0439466_0016750_855_1202 113
522 3300041411 Ga0439466_0032524 Ga0439466_0032524_28_369 113
523 3300041411 Ga0439466_0062860 Ga0439466_0062860_828_1169 113
524 3300041411 Ga0439466_0086290 Ga0439466_0086290_91_432 113
525 3300041498 Ga0451841_1211142 Ga0451841_1211142_228_569 113
526 3300041997 Ga0439431_0002752 Ga0439431_0002752_975_1316 113
527 3300042004 Ga0439445_0010690 Ga0439445_0010690_624_965 113
528 3300042006 Ga0439432_006051 Ga0439432_006051_2700_3041 113
529 3300042006 Ga0439432_019120 Ga0439432_019120_1058_1399 113
530 3300042006 Ga0439432_042608 Ga0439432_042608_355_696 113
531 3300042006 Ga0439432_153831 Ga0439432_153831_282_623 113
532 3300042009 Ga0439451_000750 Ga0439451_000750_1487_1828 113
533 3300042009 Ga0439451_002969 Ga0439451_002969_1191_1532 113
534 3300042009 Ga0439451_003819 Ga0439451_003819_470_811 113
535 3300042009 Ga0439451_013994 Ga0439451_013994_353_694 113
536 3300042010 Ga0439452_000536 Ga0439452_000536_18568_18915 113
537 3300042010 Ga0439452_001378 Ga0439452_001378_6780_7124 113
538 3300042010 Ga0439452_002923 Ga0439452_002923_1309_1650 113
539 3300042010 Ga0439452_007042 Ga0439452_007042_2283_2624 113
540 3300042010 Ga0439452_010070 Ga0439452_010070_1470_1811 113
541 3300042010 Ga0439452_010226 Ga0439452_010226_1217_1558 113
542 3300042010 Ga0439452_020550 Ga0439452_020550_645_986 113
543 3300042013 Ga0439456_015462 Ga0439456_015462_408_749 113
544 3300042013 Ga0439456_053345 Ga0439456_053345_263_604 113
545 3300042013 Ga0439456_055652 Ga0439456_055652_88_429 113
546 3300042013 Ga0439456_100747 Ga0439456_100747_66_407 113
547 3300042016 Ga0439463_000259 Ga0439463_000259_8256_8597 113
548 3300042016 Ga0439463_009073 Ga0439463_009073_1600_1941 113
549 3300042016 Ga0439463_009814 Ga0439463_009814_657_998 113
550 3300042115 Ga0450911_004525 Ga0450911_004525_1543_1884 113
551 3300042115 Ga0450911_004606 Ga0450911_004606_1356_1697 113
552 3300042124 Ga0450922_003353 Ga0450922_003353_36_377 113
553 3300042137 Ga0450902_003425 Ga0450902_003425_989_1330 113
554 3300042137 Ga0450902_006460 Ga0450902_006460_526_867 113
555 3300042139 Ga0450904_001245 Ga0450904_001245_863_1204 113
556 3300042142 Ga0450905_004292 Ga0450905_004292_1270_1614 113
557 3300042146 Ga0450907_000605 Ga0450907_000605_3483_3824 113
558 3300042147 Ga0450910_000819 Ga0450910_000819_675_1016 113
559 3300042185 Ga0450909_002097 Ga0450909_002097_1553_1894 113
560 3300042461 Ga0439460_0000587 Ga0439460_0000587_889_1230 113
561 3300042461 Ga0439460_0002227 Ga0439460_0002227_3259_3600 113
562 3300042993 Ga0439440_0004265 Ga0439440_0004265_986_1327 113
563 3300046452 Ga0495617_000354 Ga0495617_000354_19734_20075 113
564 3300046452 Ga0495617_006638 Ga0495617_006638_2326_2667 113
565 3300046452 Ga0495617_013597 Ga0495617_013597_1498_1839 113
566 3300046452 Ga0495617_018794 Ga0495617_018794_1468_1809 113
567 3300046452 Ga0495617_030873 Ga0495617_030873_474_815 113
568 3300046453 Ga0495627_004421 Ga0495627_004421_4139_4480 113
569 3300046455 Ga0495603_0118840 Ga0495603_0118840_457_798 113
570 3300046457 Ga0495590_0007559 Ga0495590_0007559_1443_1784 113
571 3300046458 Ga0495591_002481 Ga0495591_002481_4502_4843 113
572 3300046458 Ga0495591_007237 Ga0495591_007237_164_505 113
573 3300046458 Ga0495591_008768 Ga0495591_008768_776_1117 113
574 3300046458 Ga0495591_013088 Ga0495591_013088_23_364 113
575 3300046458 Ga0495591_017094 Ga0495591_017094_2124_2465 113
576 3300046458 Ga0495591_026444 Ga0495591_026444_122_463 113
577 3300046460 Ga0495638_0004120 Ga0495638_0004120_1371_1712 113
578 3300046460 Ga0495638_0019380 Ga0495638_0019380_1881_2222 113
579 3300046460 Ga0495638_0020940 Ga0495638_0020940_965_1306 113
580 3300046460 Ga0495638_0043105 Ga0495638_0043105_1376_1717 113
581 3300046460 Ga0495638_0171460 Ga0495638_0171460_612_953 113
582 3300046463 Ga0495653_0022033 Ga0495653_0022033_4598_4939 113
583 3300046463 Ga0495653_0066447 Ga0495653_0066447_98_439 113
584 3300046463 Ga0495653_0070326 Ga0495653_0070326_22_363 113
585 3300046463 Ga0495653_0124040 Ga0495653_0124040_1293_1634 113
586 3300046471 Ga0495650_0010663 Ga0495650_0010663_912_1253 113
587 3300046471 Ga0495650_0011563 Ga0495650_0011563_704_1045 113
588 3300046471 Ga0495650_0014518 Ga0495650_0014518_1475_1816 113
589 3300046471 Ga0495650_0058726 Ga0495650_0058726_164_505 113
590 3300046474 Ga0495605_0001925 Ga0495605_0001925_1478_1819 113
591 3300046474 Ga0495605_0002006 Ga0495605_0002006_5135_5476 113
592 3300046474 Ga0495605_0008567 Ga0495605_0008567_1359_1700 113
593 3300046474 Ga0495605_0025498 Ga0495605_0025498_914_1255 113
594 3300046474 Ga0495605_0058722 Ga0495605_0058722_612_953 113
595 3300046475 Ga0495639_0000646 Ga0495639_0000646_4995_5336 113
596 3300046491 Ga0495584_0002088 Ga0495584_0002088_5242_5583 113
597 3300046491 Ga0495584_0002764 Ga0495584_0002764_1344_1685 113
598 3300046491 Ga0495584_0007502 Ga0495584_0007502_4027_4368 113
599 3300046491 Ga0495584_0023654 Ga0495584_0023654_618_959 113
600 3300046491 Ga0495584_0025126 Ga0495584_0025126_1299_1640 113
601 3300046491 Ga0495584_0039095 Ga0495584_0039095_1350_1691 113
602 3300046492 Ga0495585_0000245 Ga0495585_0000245_50699_51040 113
603 3300046492 Ga0495585_0003262 Ga0495585_0003262_1308_1649 113
604 3300046492 Ga0495585_0004003 Ga0495585_0004003_1340_1681 113
605 3300046492 Ga0495585_0018104 Ga0495585_0018104_3707_4048 113
606 3300046499 Ga0495594_0037895 Ga0495594_0037895_876_1217 113
607 3300046500 Ga0495596_0001228 Ga0495596_0001228_5053_5394 113
608 3300046500 Ga0495596_0044377 Ga0495596_0044377_867_1208 113
609 3300046501 Ga0495607_0001001 Ga0495607_0001001_19839_20180 113
610 3300046501 Ga0495607_0007357 Ga0495607_0007357_2244_2585 113
611 3300046501 Ga0495607_0022780 Ga0495607_0022780_2654_2995 113
612 3300046501 Ga0495607_0069734 Ga0495607_0069734_495_836 113
613 3300046501 Ga0495607_0553521 Ga0495607_0553521_35_376 113
614 3300046506 Ga0495583_0015320 Ga0495583_0015320_3312_3653 113
615 3300046506 Ga0495583_0077349 Ga0495583_0077349_500_841 113
616 3300046506 Ga0495583_0084264 Ga0495583_0084264_14_355 113
617 3300046507 Ga0495606_0005753 Ga0495606_0005753_6272_6613 113
618 3300046507 Ga0495606_0007505 Ga0495606_0007505_8031_8372 113
619 3300046507 Ga0495606_0017162 Ga0495606_0017162_1405_1746 113
620 3300046507 Ga0495606_0019938 Ga0495606_0019938_33_374 113
621 3300046507 Ga0495606_0043807 Ga0495606_0043807_1630_1971 113
622 3300046507 Ga0495606_0061605 Ga0495606_0061605_1840_2181 113
623 3300046507 Ga0495606_0140681 Ga0495606_0140681_223_564 113
624 3300046512 Ga0495610_0008699 Ga0495610_0008699_1184_1525 113
625 3300046512 Ga0495610_0012329 Ga0495610_0012329_1401_1742 113
626 3300046512 Ga0495610_0018857 Ga0495610_0018857_2135_2476 113
627 3300046512 Ga0495610_0019133 Ga0495610_0019133_897_1238 113
628 3300046513 Ga0495616_0000775 Ga0495616_0000775_5824_6165 113
629 3300046513 Ga0495616_0011609 Ga0495616_0011609_1373_1714 113
630 3300046513 Ga0495616_0016156 Ga0495616_0016156_1350_1691 113
631 3300046513 Ga0495616_0016445 Ga0495616_0016445_1353_1694 113
632 3300046513 Ga0495616_0216953 Ga0495616_0216953_276_617 113
633 3300046515 Ga0495620_0006329 Ga0495620_0006329_1370_1711 113
634 3300046515 Ga0495620_0007405 Ga0495620_0007405_676_1017 113
635 3300046515 Ga0495620_0010918 Ga0495620_0010918_1070_1411 113
636 3300046515 Ga0495620_0018577 Ga0495620_0018577_1311_1652 113
637 3300046518 Ga0495631_0000521 Ga0495631_0000521_3302_3643 113
638 3300046518 Ga0495631_0005806 Ga0495631_0005806_4738_5079 113
639 3300046518 Ga0495631_0332036 Ga0495631_0332036_183_539 113
640 3300046519 Ga0495632_0004194 Ga0495632_0004194_8141_8482 113
641 3300046519 Ga0495632_0006127 Ga0495632_0006127_1563_1904 113
642 3300046519 Ga0495632_0037786 Ga0495632_0037786_874_1221 113
643 3300046519 Ga0495632_0056154 Ga0495632_0056154_29_370 113
644 3300046519 Ga0495632_0099109 Ga0495632_0099109_103_444 113
645 3300046520 Ga0495637_0003166 Ga0495637_0003166_7965_8306 113
646 3300046520 Ga0495637_0004789 Ga0495637_0004789_1641_1982 113
647 3300046520 Ga0495637_0005401 Ga0495637_0005401_6153_6494 113
648 3300046520 Ga0495637_0011336 Ga0495637_0011336_1523_1864 113
649 3300046520 Ga0495637_0018301 Ga0495637_0018301_1528_1869 113
650 3300046520 Ga0495637_0031711 Ga0495637_0031711_1487_1828 113
651 3300046520 Ga0495637_0036743 Ga0495637_0036743_770_1111 113
652 3300046520 Ga0495637_0042214 Ga0495637_0042214_1272_1613 113
653 3300046520 Ga0495637_0066229 Ga0495637_0066229_273_614 113
654 3300046520 Ga0495637_0067199 Ga0495637_0067199_487_828 113
655 3300046522 Ga0495643_0012829 Ga0495643_0012829_479_820 113
656 3300046522 Ga0495643_0072187 Ga0495643_0072187_80_421 113
657 3300046522 Ga0495643_0143417 Ga0495643_0143417_71_412 113
658 3300046522 Ga0495643_0168268 Ga0495643_0168268_298_639 113
659 3300046524 Ga0495648_0004402 Ga0495648_0004402_5436_5777 113
660 3300046524 Ga0495648_0005088 Ga0495648_0005088_7481_7822 113
661 3300046524 Ga0495648_0011215 Ga0495648_0011215_3575_3916 113
662 3300046524 Ga0495648_0017640 Ga0495648_0017640_3906_4247 113
663 3300046524 Ga0495648_0019337 Ga0495648_0019337_46_387 113
664 3300046524 Ga0495648_0020943 Ga0495648_0020943_2811_3152 113
665 3300046524 Ga0495648_0032163 Ga0495648_0032163_1771_2112 113
666 3300046524 Ga0495648_0202696 Ga0495648_0202696_630_971 113
667 3300046526 Ga0495666_0005246 Ga0495666_0005246_4372_4713 113
668 3300046526 Ga0495666_0017304 Ga0495666_0017304_507_848 113
669 3300046530 Ga0495654_0001051 Ga0495654_0001051_14876_15217 113
670 3300046530 Ga0495654_0003292 Ga0495654_0003292_1526_1867 113
671 3300046530 Ga0495654_0011145 Ga0495654_0011145_1463_1804 113
672 3300046530 Ga0495654_0011198 Ga0495654_0011198_1474_1815 113
673 3300046530 Ga0495654_0029095 Ga0495654_0029095_642_983 113
674 3300046530 Ga0495654_0035972 Ga0495654_0035972_1543_1884 113
675 3300046530 Ga0495654_0052932 Ga0495654_0052932_625_966 113
676 3300046530 Ga0495654_0257124 Ga0495654_0257124_361_702 113
677 3300046536 Ga0495587_0006949 Ga0495587_0006949_1943_2284 113
678 3300046538 Ga0495609_0009048 Ga0495609_0009048_770_1111 113
679 3300046538 Ga0495609_0012056 Ga0495609_0012056_2223_2564 113
680 3300046538 Ga0495609_0013359 Ga0495609_0013359_1326_1682 113
681 3300046542 Ga0495597_0006006 Ga0495597_0006006_4597_4938 113
682 3300046542 Ga0495597_0022446 Ga0495597_0022446_298_639 113
683 3300046542 Ga0495597_0097851 Ga0495597_0097851_207_548 113
684 3300046557 Ga0495622_0003354 Ga0495622_0003354_5028_5369 113
685 3300046557 Ga0495622_0006883 Ga0495622_0006883_3399_3740 113
686 3300046557 Ga0495622_0007214 Ga0495622_0007214_1402_1743 113
687 3300046557 Ga0495622_0095330 Ga0495622_0095330_988_1329 113
688 3300046558 Ga0495633_0003503 Ga0495633_0003503_3261_3602 113
689 3300046558 Ga0495633_0009726 Ga0495633_0009726_1359_1700 113
690 3300046615 Ga0495656_0012972 Ga0495656_0012972_1786_2127 113
691 3300046616 Ga0495668_0003859 Ga0495668_0003859_6398_6739 113
692 3300046648 Ga0495611_0008446 Ga0495611_0008446_2639_2980 113
693 3300046648 Ga0495611_0063205 Ga0495611_0063205_1331_1672 113
694 3300046660 Ga0495625_0016308 Ga0495625_0016308_1431_1772 113
695 3300046660 Ga0495625_0021556 Ga0495625_0021556_3258_3623 113
696 3300046660 Ga0495625_0033597 Ga0495625_0033597_974_1315 113
697 3300046663 Ga0495635_0010205 Ga0495635_0010205_346_687 113
698 3300046664 Ga0495659_0000843 Ga0495659_0000843_9453_9794 113
699 3300046664 Ga0495659_0058888 Ga0495659_0058888_870_1211 113
700 3300046665 Ga0495661_0027639 Ga0495661_0027639_240_581 113
701 3300046665 Ga0495661_0029961 Ga0495661_0029961_553_894 113
702 3300046679 Ga0495623_0014423 Ga0495623_0014423_3232_3573 113
703 3300046680 Ga0495646_0003771 Ga0495646_0003771_4889_5230 113
704 3300046680 Ga0495646_0018359 Ga0495646_0018359_1156_1497 113
705 3300046680 Ga0495646_0040329 Ga0495646_0040329_2376_2717 113
706 3300046684 Ga0495669_0008384 Ga0495669_0008384_2464_2805 113
707 3300046689 Ga0495613_0043455 Ga0495613_0043455_1856_2197 113
708 3300046690 Ga0495624_0021771 Ga0495624_0021771_1406_1747 113
709 3300046691 Ga0495670_0004393 Ga0495670_0004393_4083_4424 113
710 3300046691 Ga0495670_0007818 Ga0495670_0007818_3768_4109 113
711 3300046691 Ga0495670_0013231 Ga0495670_0013231_1387_1728 113
712 3300046691 Ga0495670_0503858 Ga0495670_0503858_60_401 113
713 3300046692 Ga0495671_0003269 Ga0495671_0003269_1549_1890 113
714 3300046692 Ga0495671_0012344 Ga0495671_0012344_4194_4535 113
715 3300046692 Ga0495671_0019227 Ga0495671_0019227_2627_2968 113
716 3300046692 Ga0495671_0023597 Ga0495671_0023597_506_847 113
717 3300046692 Ga0495671_0029086 Ga0495671_0029086_1633_1974 113
718 3300046694 Ga0495649_0005423 Ga0495649_0005423_1894_2235 113
719 3300046694 Ga0495649_0005464 Ga0495649_0005464_1559_1900 113
720 3300046694 Ga0495649_0016909 Ga0495649_0016909_2435_2776 113
721 3300046694 Ga0495649_0017741 Ga0495649_0017741_3193_3534 113
722 3300046694 Ga0495649_0025888 Ga0495649_0025888_1064_1405 113
723 3300046694 Ga0495649_0028551 Ga0495649_0028551_2475_2816 113
724 3300046694 Ga0495649_0151815 Ga0495649_0151815_691_1032 113
725 3300046794 Ga0495589_0002520 Ga0495589_0002520_5737_6078 113
726 3300046794 Ga0495589_0002714 Ga0495589_0002714_8087_8428 113
727 3300046794 Ga0495589_0009866 Ga0495589_0009866_3138_3479 113
728 3300046794 Ga0495589_0018110 Ga0495589_0018110_585_926 113
729 3300046809 Ga0495600_0233487 Ga0495600_0233487_615_956 113
730 3300046810 Ga0495660_0002517 Ga0495660_0002517_5097_5438 113
731 3300046810 Ga0495660_0014485 Ga0495660_0014485_2897_3238 113
732 3300046810 Ga0495660_0048607 Ga0495660_0048607_563_904 113
733 3300046810 Ga0495660_0049879 Ga0495660_0049879_842_1183 113
734 3300046810 Ga0495660_0051467 Ga0495660_0051467_386_727 113
735 3300046810 Ga0495660_0064487 Ga0495660_0064487_229_570 113
736 3300046810 Ga0495660_0192646 Ga0495660_0192646_545_886 113
737 3300047317 Ga0495604_0066836 Ga0495604_0066836_149_490 113
738 3300047317 Ga0495604_0077619 Ga0495604_0077619_424_765 113
739 3300047318 Ga0495636_0000266 Ga0495636_0000266_2414_2755 113
740 3300047318 Ga0495636_0024374 Ga0495636_0024374_1237_1578 113
741 3300047319 Ga0495674_0025256 Ga0495674_0025256_4034_4375 113
742 3300047320 Ga0495672_0003102 Ga0495672_0003102_8328_8669 113
743 3300047320 Ga0495672_0003872 Ga0495672_0003872_1587_1928 113
744 3300047320 Ga0495672_0016498 Ga0495672_0016498_4436_4777 113
745 3300047320 Ga0495672_0020413 Ga0495672_0020413_2909_3250 113
746 3300047320 Ga0495672_0021688 Ga0495672_0021688_2628_2969 113
747 3300047320 Ga0495672_0022599 Ga0495672_0022599_2376_2717 113
748 3300047320 Ga0495672_0025637 Ga0495672_0025637_93_434 113
749 3300047320 Ga0495672_0187036 Ga0495672_0187036_650_991 113
750 3300047321 Ga0495676_0007637 Ga0495676_0007637_1323_1664 113
751 3300047322 Ga0495680_0018278 Ga0495680_0018278_202_543 113
752 3300047322 Ga0495680_0028233 Ga0495680_0028233_3074_3415 113
753 3300047322 Ga0495680_0128328 Ga0495680_0128328_623_964 113
754 3300047323 Ga0495683_0000621 Ga0495683_0000621_3291_3632 113
755 3300047323 Ga0495683_0002272 Ga0495683_0002272_6283_6624 113
756 3300047323 Ga0495683_0007868 Ga0495683_0007868_977_1318 113
757 3300047323 Ga0495683_0444073 Ga0495683_0444073_31_372 113
758 3300047443 Ga0495687_003839 Ga0495687_003839_9376_9717 113
759 3300047443 Ga0495687_010649 Ga0495687_010649_3119_3460 113
760 3300047444 Ga0495675_0019286 Ga0495675_0019286_3084_3425 113
761 3300047444 Ga0495675_0160476 Ga0495675_0160476_484_825 113
762 3300047446 Ga0495679_002899 Ga0495679_002899_1191_1532 113
763 3300047469 Ga0495673_0003116 Ga0495673_0003116_2393_2734 113
764 3300047469 Ga0495673_0003247 Ga0495673_0003247_6453_6794 113
765 3300047469 Ga0495673_0015142 Ga0495673_0015142_941_1282 113
766 3300047469 Ga0495673_0023110 Ga0495673_0023110_1197_1538 113
767 3300047469 Ga0495673_0025347 Ga0495673_0025347_2295_2636 113
768 3300047469 Ga0495673_0067939 Ga0495673_0067939_61_402 113
769 3300047469 Ga0495673_0079343 Ga0495673_0079343_214_555 113
770 3300047470 Ga0495681_0005202 Ga0495681_0005202_5068_5409 113
771 3300047470 Ga0495681_0009799 Ga0495681_0009799_1380_1721 113
772 3300047470 Ga0495681_0011392 Ga0495681_0011392_3903_4244 113
773 3300047470 Ga0495681_0012460 Ga0495681_0012460_1374_1715 113
774 3300047470 Ga0495681_0016937 Ga0495681_0016937_1480_1821 113
775 3300047470 Ga0495681_0017593 Ga0495681_0017593_2970_3311 113
776 3300047470 Ga0495681_0026918 Ga0495681_0026918_2013_2354 113
777 3300047470 Ga0495681_0027656 Ga0495681_0027656_1084_1425 113
778 3300047470 Ga0495681_0031870 Ga0495681_0031870_1340_1681 113
779 3300047470 Ga0495681_0057433 Ga0495681_0057433_1162_1503 113
780 3300047470 Ga0495681_0318792 Ga0495681_0318792_218_559 113
781 3300047471 Ga0495684_0032034 Ga0495684_0032034_1212_1553 113
782 3300047472 Ga0495686_0023134 Ga0495686_0023134_3181_3522 113
783 3300047472 Ga0495686_0036493 Ga0495686_0036493_2667_3008 113
784 3300047673 Ga0495593_0025675 Ga0495593_0025675_639_980 113
785 3300047673 Ga0495593_0030572 Ga0495593_0030572_663_1004 113
786 3300048088 Ga0495602_0041611 Ga0495602_0041611_2501_2842 113
787 3300048091 Ga0495626_0000950 Ga0495626_0000950_1082_1423 113
788 3300048091 Ga0495626_0002932 Ga0495626_0002932_5766_6107 113
789 3300048091 Ga0495626_0007199 Ga0495626_0007199_5039_5380 113
790 3300048091 Ga0495626_0013169 Ga0495626_0013169_269_610 113
791 3300048091 Ga0495626_0013442 Ga0495626_0013442_2026_2367 113
792 3300048091 Ga0495626_0014566 Ga0495626_0014566_1265_1606 113
793 3300048091 Ga0495626_0016306 Ga0495626_0016306_1299_1640 113
794 3300048091 Ga0495626_0035403 Ga0495626_0035403_548_889 113
795 3300048905 Ga0496102_0020546 Ga0496102_0020546_4191_4532 113
796 3300048915 Ga0496112_0243402 Ga0496112_0243402_1246_1587 113
797 3300048919 Ga0496116_0001043 Ga0496116_0001043_32102_32443 113
798 3300048919 Ga0496116_0005334 Ga0496116_0005334_6605_6946 113
799 3300048919 Ga0496116_0018153 Ga0496116_0018153_1361_1702 113
800 3300048920 Ga0496117_0014519 Ga0496117_0014519_1373_1714 113
801 3300048920 Ga0496117_0126028 Ga0496117_0126028_332_673 113
802 3300048921 Ga0496118_0060569 Ga0496118_0060569_1579_1920 113
803 3300048921 Ga0496118_0081963 Ga0496118_0081963_1317_1658 113
804 3300048922 Ga0496119_0037768 Ga0496119_0037768_1552_1893 113
805 3300048922 Ga0496119_0286679 Ga0496119_0286679_143_484 113
806 3300048924 Ga0496121_0004179 Ga0496121_0004179_18063_18404 113
807 3300048924 Ga0496121_0026654 Ga0496121_0026654_669_1010 113
808 3300048924 Ga0496121_0029008 Ga0496121_0029008_3674_4015 113
809 3300048925 Ga0496122_0028852 Ga0496122_0028852_1214_1555 113
810 3300048925 Ga0496122_0045344 Ga0496122_0045344_1355_1696 113
811 3300048926 Ga0496123_0017533 Ga0496123_0017533_1164_1505 113
812 3300048926 Ga0496123_0068921 Ga0496123_0068921_1428_1769 113
813 3300048927 Ga0496124_0000132 Ga0496124_0000132_154400_154756 113
814 3300048927 Ga0496124_0067852 Ga0496124_0067852_1498_1839 113
815 3300048927 Ga0496124_0167998 Ga0496124_0167998_1282_1623 113
816 3300048928 Ga0496125_0029893 Ga0496125_0029893_1447_1788 113
817 3300048928 Ga0496125_0122192 Ga0496125_0122192_270_611 113
818 3300048928 Ga0496125_0140407 Ga0496125_0140407_165_506 113
819 3300048929 Ga0496126_0084686 Ga0496126_0084686_653_994 113
820 3300049459 Ga0495678_004853 Ga0495678_004853_1433_1774 113
821 3300049459 Ga0495678_006577 Ga0495678_006577_4415_4756 113
822 3300049459 Ga0495678_006901 Ga0495678_006901_4907_5248 113
823 3300049459 Ga0495678_015979 Ga0495678_015979_2446_2787 113
824 3300049459 Ga0495678_017157 Ga0495678_017157_1707_2048 113
825 3300049460 Ga0495682_0004020 Ga0495682_0004020_1361_1702 113
826 3300049460 Ga0495682_0117291 Ga0495682_0117291_93_434 113
827 3300049460 Ga0495682_0157363 Ga0495682_0157363_93_434 113
828 3300050489 nmdc:mga03683_180789_c1 nmdc:mga03683_180789_c1_280_621 113
829 3300050491 nmdc:mga00v17_139626_c1 nmdc:mga00v17_139626_c1_127_468 113
830 3300050491 nmdc:mga00v17_403992_c1 nmdc:mga00v17_403992_c1_281_622 113
831 3300050516 nmdc:mga0sz30_390946_c1 nmdc:mga0sz30_390946_c1_250_591 113
832 iso_pu_bacteria 2511231007 2511270748 113
833 iso_pu_bacteria 2511231156 2511826355 113
834 iso_pu_bacteria 2599185212 2599617076 113
835 iso_pu_bacteria 2599185248 2599771203 113
836 iso_pu_bacteria 2599185289 2599886352 113
837 iso_pu_bacteria 2599185291 2599898066 113
838 iso_pu_bacteria 2599185305 2599960379 113
839 iso_pu_bacteria 2599185306 2599969483 113
840 iso_pu_bacteria 2599185308 2599981567 113
841 iso_pu_bacteria 2599185311 2599994428 113
842 iso_pu_bacteria 2599185313 2600004966 113
843 iso_pu_bacteria 2599185314 2600015405 113
844 iso_pu_bacteria 2599185315 2600017878 113
845 iso_pu_bacteria 2599185316 2600024683 113
846 iso_pu_bacteria 2599185317 2600030622 113
847 iso_pu_bacteria 2599185318 2600038220 113
848 iso_pu_bacteria 2599185319 2600045289 113
849 iso_pu_bacteria 2599185321 2600056793 113
850 iso_pu_bacteria 2599185322 2600061576 113
851 iso_pu_bacteria 2599185323 2600068321 113
852 iso_pu_bacteria 2599185324 2600070039 113
853 iso_pu_bacteria 2599185325 2600077926 113
854 iso_pu_bacteria 2600254930 2600360066 113
855 iso_pu_bacteria 2643221650 2644281838 113
856 iso_pu_bacteria 2651869719 2652544518 113
857 iso_pu_bacteria 2667528170 2671090160 113
858 iso_pu_bacteria 2667528176 2671125190 113
859 iso_pu_bacteria 2675903515 2678264706 113
860 iso_pu_bacteria 2744054620 2745005160 113
861 iso_pu_bacteria 2808606361 2808858936 113
862 iso_pu_bacteria 2808606376 2808927278 113
863 iso_pu_bacteria 2808606378 2808939026 113
864 iso_pu_bacteria 2808606380 2808949398 113
865 iso_pu_bacteria 2808606383 2808967440 113
866 iso_pu_bacteria 2808606389 2809002271 113
867 iso_pu_bacteria 2988728565 2988730221 113
868 iso_pu_bacteria 8019775933 8019780350 113
869 iso_pu_bacteria 8056143049 8056144750 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

69

123

0.86

Feature Viewer

pLDDT pTM Quality
70.16 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map