F483778

General Info

Members Datasets Scaffolds Average Seq Length
859 270 1718 167

Family's Representative Sequence

Representative Sequence 3300030963|Ga0265768_105053|Ga0265768_1050531
Length 189
Sequence MIPSDGGIARSVVGSAARSAEQMAVRRLNHAVLYVHGLDRTVDFYRTTLGFEVRLEIPGRAAFLRAPGSANDHDLGLFEIGTGRAPDRPAHPGLYHLAWEVGTLADLADARAKLAAAGALVGESDHRVSKSLYAKDPSGIEFEVLWRVPAEDWAAETADGDMILPLDLDAAIARWGQDQATGAAAGSPT

Samples

Sample ID Description Type Environment
1 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
75 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 2.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.68
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265768_105053 3300030963 Bacteria 758
2 Ga0070658_10115677 3300005327 Bacteria 2225
3 Ga0070683_100046191 3300005329 Bacteria 4022
4 Ga0070666_10321067 3300005335 Bacteria 1105
5 Ga0070680_100917305 3300005336 Bacteria 756
6 Ga0070682_100349255 3300005337 Bacteria 1102
7 Ga0068868_100252694 3300005338 Bacteria 1484
8 Ga0068868_100851766 3300005338 Bacteria 826
9 Ga0070660_100029919 3300005339 Bacteria 4083
10 Ga0070689_100061655 3300005340 Bacteria 2917
11 Ga0070691_10012298 3300005341 Bacteria 3918
12 Ga0070691_10067197 3300005341 Bacteria 1734
13 Ga0070687_100026444 3300005343 Bacteria 2794
14 Ga0070661_100031694 3300005344 Bacteria 3823
15 Ga0070661_100986968 3300005344 Bacteria 698
16 Ga0070688_100399629 3300005365 Bacteria 1017
17 Ga0070659_100057640 3300005366 Bacteria 3063
18 Ga0070709_10000127 3300005434 Bacteria 50350
19 Ga0070709_10013588 3300005434 Bacteria 4582
20 Ga0070709_10423202 3300005434 Bacteria 998
21 Ga0070709_10465726 3300005434 Bacteria 954
22 Ga0070709_10915592 3300005434 Bacteria 694
23 Ga0070714_100000318 3300005435 Bacteria 36459
24 Ga0070714_100000566 3300005435 Bacteria 26682
25 Ga0070714_100000689 3300005435 Bacteria 23869
26 Ga0070714_100002268 3300005435 Bacteria 14142
27 Ga0070714_100264058 3300005435 Bacteria 1595
28 Ga0070714_100899174 3300005435 Bacteria 860
29 Ga0070714_101014004 3300005435 Bacteria 808
30 Ga0070713_100002191 3300005436 Bacteria 12652
31 Ga0070713_100002403 3300005436 Bacteria 12211
32 Ga0070713_100037480 3300005436 Bacteria 3920
33 Ga0070713_100092012 3300005436 Bacteria 2610
34 Ga0070713_100111465 3300005436 Bacteria 2386
35 Ga0070713_100151180 3300005436 Bacteria 2065
36 Ga0070713_100389165 3300005436 Bacteria 1300
37 Ga0070713_100955575 3300005436 Bacteria 825
38 Ga0070710_10000177 3300005437 Bacteria 29266
39 Ga0070710_10001432 3300005437 Bacteria 11267
40 Ga0070710_10022781 3300005437 Bacteria 3282
41 Ga0070710_10042888 3300005437 Bacteria 2503
42 Ga0070710_10274564 3300005437 Bacteria 1091
43 Ga0070710_10280696 3300005437 Bacteria 1081
44 Ga0070701_10505582 3300005438 Bacteria 785
45 Ga0070711_100000158 3300005439 Bacteria 36681
46 Ga0070711_100003475 3300005439 Bacteria 9183
47 Ga0070711_100121910 3300005439 Bacteria 1930
48 Ga0070711_100137932 3300005439 Bacteria 1825
49 Ga0070711_101487654 3300005439 Bacteria 590
50 Ga0070705_100039731 3300005440 Bacteria 2671
51 Ga0070694_100124287 3300005444 Bacteria 1855
52 Ga0070708_100014131 3300005445 Bacteria 6563
53 Ga0070708_100029185 3300005445 Bacteria 4755
54 Ga0070708_100046036 3300005445 Bacteria 3847
55 Ga0070708_100085571 3300005445 Bacteria 2862
56 Ga0070708_100109248 3300005445 Bacteria 2540
57 Ga0070708_100116285 3300005445 Bacteria 2462
58 Ga0070708_100156662 3300005445 Bacteria 2121
59 Ga0070708_100227048 3300005445 Bacteria 1752
60 Ga0070708_100241795 3300005445 Bacteria 1695
61 Ga0070708_100273305 3300005445 Bacteria 1590
62 Ga0070708_100488058 3300005445 Bacteria 1162
63 Ga0070663_100176013 3300005455 Bacteria 1657
64 Ga0070662_100200609 3300005457 Bacteria 1583
65 Ga0070681_10142805 3300005458 Bacteria 2323
66 Ga0070681_11080798 3300005458 Bacteria 723
67 Ga0068867_100501773 3300005459 Bacteria 1043
68 Ga0070706_100002062 3300005467 Bacteria 20535
69 Ga0070706_100003701 3300005467 Bacteria 14955
70 Ga0070706_100006498 3300005467 Bacteria 11035
71 Ga0070706_100007197 3300005467 Bacteria 10459
72 Ga0070706_100015978 3300005467 Bacteria 6933
73 Ga0070706_100024755 3300005467 Bacteria 5526
74 Ga0070706_100028667 3300005467 Bacteria 5127
75 Ga0070706_100061551 3300005467 Bacteria 3466
76 Ga0070706_100092964 3300005467 Bacteria 2798
77 Ga0070706_100151273 3300005467 Bacteria 2166
78 Ga0070706_100151534 3300005467 Bacteria 2164
79 Ga0070706_100276238 3300005467 Bacteria 1568
80 Ga0070706_100638232 3300005467 Bacteria 989
81 Ga0070707_100001992 3300005468 Bacteria 19545
82 Ga0070707_100002252 3300005468 Bacteria 18404
83 Ga0070707_100004968 3300005468 Bacteria 12460
84 Ga0070707_100005544 3300005468 Bacteria 11792
85 Ga0070707_100007290 3300005468 Bacteria 10269
86 Ga0070707_100013838 3300005468 Bacteria 7555
87 Ga0070707_100023182 3300005468 Bacteria 5872
88 Ga0070707_100025462 3300005468 Bacteria 5613
89 Ga0070707_100053299 3300005468 Bacteria 3878
90 Ga0070707_100118012 3300005468 Bacteria 2575
91 Ga0070707_100130794 3300005468 Bacteria 2441
92 Ga0070707_100147526 3300005468 Bacteria 2289
93 Ga0070707_100251380 3300005468 Bacteria 1720
94 Ga0070707_100256143 3300005468 Bacteria 1703
95 Ga0070707_100610766 3300005468 Bacteria 1053
96 Ga0070707_100684032 3300005468 Bacteria 989
97 Ga0070698_100000028 3300005471 Bacteria 98040
98 Ga0070698_100001318 3300005471 Bacteria 27643
99 Ga0070698_100004118 3300005471 Bacteria 15985
100 Ga0070698_100017228 3300005471 Bacteria 7612
101 Ga0070698_100048162 3300005471 Bacteria 4355
102 Ga0070698_100052447 3300005471 Bacteria 4149
103 Ga0070698_100064245 3300005471 Bacteria 3698
104 Ga0070698_100072345 3300005471 Bacteria 3456
105 Ga0070698_100085243 3300005471 Bacteria 3146
106 Ga0070698_100131464 3300005471 Bacteria 2458
107 Ga0070698_100450299 3300005471 Bacteria 1223
108 Ga0070698_100537777 3300005471 Bacteria 1107
109 Ga0070698_100707470 3300005471 Bacteria 950
110 Ga0070698_101051495 3300005471 Bacteria 762
111 Ga0070698_101108604 3300005471 Bacteria 740
112 Ga0070699_100005167 3300005518 Bacteria 11480
113 Ga0070699_100126974 3300005518 Bacteria 2246
114 Ga0070699_100188209 3300005518 Bacteria 1833
115 Ga0070699_100228496 3300005518 Bacteria 1659
116 Ga0070679_100029643 3300005530 Bacteria 5398
117 Ga0070697_100002042 3300005536 Bacteria 15467
118 Ga0070697_100121430 3300005536 Bacteria 2186
119 Ga0070697_100292246 3300005536 Bacteria 1400
120 Ga0070697_100640465 3300005536 Bacteria 936
121 Ga0068853_100181550 3300005539 Bacteria 1908
122 Ga0070686_100067274 3300005544 Bacteria 2333
123 Ga0070696_100070625 3300005546 Bacteria 2457
124 Ga0070693_100029706 3300005547 Bacteria 2983
125 Ga0068855_100593544 3300005563 Bacteria 1195
126 Ga0068855_101016728 3300005563 Unclassified 870
127 Ga0070664_100049942 3300005564 Bacteria 3538
128 Ga0068857_100494255 3300005577 Bacteria 1147
129 Ga0068857_101975898 3300005577 Bacteria 572
130 Ga0068854_100058858 3300005578 Bacteria 2775
131 Ga0068856_100039845 3300005614 Bacteria 4613
132 Ga0068856_100185635 3300005614 Bacteria 2093
133 Ga0068856_100271265 3300005614 Bacteria 1712
134 Ga0070702_100058569 3300005615 Bacteria 2232
135 Ga0068852_100219060 3300005616 Bacteria 1809
136 Ga0068859_100030304 3300005617 Bacteria 5428
137 Ga0068859_100282990 3300005617 Bacteria 1751
138 Ga0068864_100085848 3300005618 Bacteria 2768
139 Ga0068864_100097455 3300005618 Bacteria 2603
140 Ga0068864_100351693 3300005618 Bacteria 1390
141 Ga0068863_100143487 3300005841 Bacteria 2283
142 Ga0068858_100065730 3300005842 Bacteria 3356
143 Ga0068858_100120587 3300005842 Bacteria 2452
144 Ga0081540_1000216 3300005983 Bacteria 61035
145 Ga0081540_1000960 3300005983 Bacteria 26024
146 Ga0070717_10003861 3300006028 Bacteria 10776
147 Ga0070717_10004122 3300006028 Bacteria 10477
148 Ga0070717_10008107 3300006028 Bacteria 7836
149 Ga0070717_10009432 3300006028 Bacteria 7334
150 Ga0070717_10022198 3300006028 Bacteria 5014
151 Ga0070717_10075374 3300006028 Bacteria 2822
152 Ga0070717_10098100 3300006028 Bacteria 2483
153 Ga0070717_10132644 3300006028 Bacteria 2143
154 Ga0070717_10159909 3300006028 Bacteria 1953
155 Ga0070717_10521892 3300006028 Bacteria 1074
156 Ga0070717_11030664 3300006028 Bacteria 749
157 Ga0070715_10032738 3300006163 Bacteria 2120
158 Ga0070715_10042596 3300006163 Bacteria 1909
159 Ga0070715_10093759 3300006163 Bacteria 1387
160 Ga0070715_10189375 3300006163 Bacteria 1037
161 Ga0070715_10288025 3300006163 Bacteria 874
162 Ga0070716_100001172 3300006173 Bacteria 11550
163 Ga0070716_100003016 3300006173 Bacteria 7853
164 Ga0070716_100049433 3300006173 Bacteria 2382
165 Ga0070716_100283914 3300006173 Bacteria 1143
166 Ga0070712_100001943 3300006175 Bacteria 12660
167 Ga0070712_100006067 3300006175 Bacteria 7481
168 Ga0070712_100008832 3300006175 Bacteria 6345
169 Ga0070712_100012663 3300006175 Bacteria 5369
170 Ga0070712_100041588 3300006175 Bacteria 3156
171 Ga0070712_100148281 3300006175 Bacteria 1798
172 Ga0070712_100374659 3300006175 Bacteria 1170
173 Ga0097621_100154910 3300006237 Bacteria 1966
174 Ga0097621_100171431 3300006237 Bacteria 1871
175 Ga0097621_100348972 3300006237 Bacteria 1316
176 Ga0068871_100138867 3300006358 Bacteria 2065
177 Ga0068871_100874859 3300006358 Bacteria 832
178 Ga0075428_100721512 3300006844 Bacteria 1061
179 Ga0075433_10115068 3300006852 Bacteria 2386
180 Ga0075433_10291091 3300006852 Bacteria 1446
181 Ga0075433_10330213 3300006852 Bacteria 1349
182 Ga0075434_100084234 3300006871 Bacteria 3178
183 Ga0075434_100658828 3300006871 Bacteria 1065
184 Ga0075434_101012586 3300006871 Bacteria 845
185 Ga0075436_100010622 3300006914 Bacteria 6315
186 Ga0075436_100044827 3300006914 Bacteria 3051
187 Ga0097620_100030304 3300006931 Bacteria 5428
188 Ga0097620_100282976 3300006931 Bacteria 1751
189 Ga0075435_100002113 3300007076 Bacteria 13073
190 Ga0075435_100078981 3300007076 Bacteria 2699
191 Ga0075435_100102297 3300007076 Bacteria 2375
192 Ga0075435_100102313 3300007076 Bacteria 2374
193 Ga0075435_100102785 3300007076 Bacteria 2369
194 Ga0075435_100306850 3300007076 Bacteria 1358
195 Ga0099794_10059797 3300007265 Bacteria 1849
196 Ga0099794_10087098 3300007265 Bacteria 1547
197 Ga0105240_10342987 3300009093 Bacteria 1696
198 Ga0105240_10585422 3300009093 Bacteria 1230
199 Ga0111539_10138806 3300009094 Bacteria 2847
200 Ga0105245_10014529 3300009098 Bacteria 6856
201 Ga0105245_10342681 3300009098 Bacteria 1478
202 Ga0105245_11238556 3300009098 Bacteria 794
203 Ga0105247_10022237 3300009101 Bacteria 3818
204 Ga0114129_10274852 3300009147 Bacteria 2253
205 Ga0114129_10571211 3300009147 Bacteria 1468
206 Ga0105243_10032414 3300009148 Bacteria 4037
207 Ga0105243_11381782 3300009148 Bacteria 724
208 Ga0105241_10051803 3300009174 Bacteria 3132
209 Ga0105241_11113588 3300009174 Bacteria 744
210 Ga0105242_10375128 3300009176 Bacteria 1321
211 Ga0105237_10837231 3300009545 Bacteria 927
212 Ga0105249_10077682 3300009553 Bacteria 3079
213 Ga0099796_10023530 3300010159 Bacteria 1924
214 Ga0157320_1000850 3300012481 Bacteria 1380
215 Ga0157341_1000456 3300012494 Bacteria 2067
216 Ga0157371_10026824 3300013102 Bacteria 4184
217 Ga0157370_10060734 3300013104 Bacteria 3588
218 Ga0157370_10299282 3300013104 Bacteria 1485
219 Ga0157369_11155758 3300013105 Bacteria 791
220 Ga0157374_10098756 3300013296 Bacteria 2796
221 Ga0157374_10437311 3300013296 Bacteria 1308
222 Ga0157378_10347221 3300013297 Bacteria 1449
223 Ga0163162_10565459 3300013306 Bacteria 1264
224 Ga0157372_10302117 3300013307 Bacteria 1862
225 Ga0157372_10648207 3300013307 Bacteria 1230
226 Ga0157372_10921636 3300013307 Bacteria 1013
227 Ga0157375_10067111 3300013308 Bacteria 3584
228 Ga0157375_10073819 3300013308 Bacteria 3431
229 Ga0163163_10009527 3300014325 Bacteria 8676
230 Ga0163163_10345919 3300014325 Bacteria 1543
231 Ga0157380_10375827 3300014326 Bacteria 1339
232 Ga0182008_10208313 3300014497 Bacteria 997
233 Ga0157377_10030606 3300014745 Bacteria 2917
234 Ga0157379_10009369 3300014968 Bacteria 8532
235 Ga0157379_10805146 3300014968 Bacteria 887
236 Ga0157376_10037222 3300014969 Bacteria 3947
237 Ga0157376_10070067 3300014969 Bacteria 2975
238 Ga0197907_10921524 3300020069 Bacteria 1653
239 Ga0206349_1072023 3300020075 Bacteria 906
240 Ga0206355_1690273 3300020076 Bacteria 968
241 Ga0206351_10298566 3300020077 Bacteria 650
242 Ga0206350_10877957 3300020080 Bacteria 828
243 Ga0206354_11457378 3300020081 Bacteria 752
244 Ga0206353_11539891 3300020082 Bacteria 925
245 Ga0206353_11593526 3300020082 Bacteria 1862
246 Ga0206353_11844072 3300020082 Bacteria 926
247 Ga0206353_11942878 3300020082 Bacteria 1008
248 Ga0213874_10029482 3300021377 Bacteria 1575
249 Ga0213874_10215634 3300021377 Bacteria 696
250 Ga0213874_10270273 3300021377 Bacteria 632
251 Ga0213876_10122247 3300021384 Bacteria 1383
252 Ga0213876_10363613 3300021384 Bacteria 770
253 Ga0213875_10001317 3300021388 Bacteria 16413
254 Ga0213875_10003914 3300021388 Bacteria 8327
255 Ga0213875_10018906 3300021388 Bacteria 3317
256 Ga0213875_10032302 3300021388 Bacteria 2474
257 Ga0213875_10049770 3300021388 Bacteria 1964
258 Ga0213875_10169187 3300021388 Bacteria 1026
259 Ga0224712_10036107 3300022467 Bacteria 1829
260 Ga0224712_10057094 3300022467 Bacteria 1541
261 Ga0224712_10117158 3300022467 Bacteria 1149
262 Ga0224712_10190020 3300022467 Bacteria 929
263 Ga0224572_1019308 3300024225 Bacteria 1310
264 Ga0207653_10011575 3300025885 Bacteria 2752
265 Ga0207692_10000088 3300025898 Bacteria 26975
266 Ga0207692_10010349 3300025898 Bacteria 3928
267 Ga0207692_10018761 3300025898 Bacteria 3111
268 Ga0207692_10086833 3300025898 Bacteria 1687
269 Ga0207692_10153381 3300025898 Bacteria 1321
270 Ga0207642_10121710 3300025899 Bacteria 1347
271 Ga0207688_10021100 3300025901 Bacteria 3557
272 Ga0207647_10192433 3300025904 Bacteria 1182
273 Ga0207685_10018343 3300025905 Bacteria 2283
274 Ga0207685_10044138 3300025905 Bacteria 1683
275 Ga0207685_10074321 3300025905 Bacteria 1387
276 Ga0207699_10000608 3300025906 Bacteria 17514
277 Ga0207699_10001553 3300025906 Bacteria 10877
278 Ga0207699_10008170 3300025906 Bacteria 5151
279 Ga0207699_10330973 3300025906 Bacteria 1071
280 Ga0207699_10423768 3300025906 Bacteria 951
281 Ga0207699_10518035 3300025906 Bacteria 862
282 Ga0207705_10747752 3300025909 Bacteria 760
283 Ga0207684_10000479 3300025910 Bacteria 51757
284 Ga0207684_10000798 3300025910 Bacteria 36416
285 Ga0207684_10023256 3300025910 Bacteria 5292
286 Ga0207684_10030469 3300025910 Bacteria 4591
287 Ga0207684_10034426 3300025910 Bacteria 4304
288 Ga0207684_10079128 3300025910 Bacteria 2796
289 Ga0207684_10088491 3300025910 Bacteria 2638
290 Ga0207684_10158744 3300025910 Bacteria 1947
291 Ga0207684_10171674 3300025910 Bacteria 1869
292 Ga0207684_10238222 3300025910 Bacteria 1570
293 Ga0207684_10296461 3300025910 Bacteria 1394
294 Ga0207684_10586056 3300025910 Bacteria 953
295 Ga0207684_10808410 3300025910 Bacteria 792
296 Ga0207654_10024927 3300025911 Bacteria 3221
297 Ga0207707_10811636 3300025912 Bacteria 779
298 Ga0207695_10119018 3300025913 Bacteria 2612
299 Ga0207693_10000436 3300025915 Bacteria 38097
300 Ga0207693_10009331 3300025915 Bacteria 8000
301 Ga0207693_10013696 3300025915 Bacteria 6533
302 Ga0207693_10022682 3300025915 Bacteria 4987
303 Ga0207693_10099467 3300025915 Bacteria 2280
304 Ga0207693_10099695 3300025915 Bacteria 2278
305 Ga0207693_11031191 3300025915 Bacteria 627
306 Ga0207663_10000615 3300025916 Bacteria 15819
307 Ga0207663_10006544 3300025916 Bacteria 5975
308 Ga0207663_10007709 3300025916 Bacteria 5601
309 Ga0207663_10045564 3300025916 Bacteria 2698
310 Ga0207663_10091058 3300025916 Bacteria 2024
311 Ga0207663_10174144 3300025916 Bacteria 1531
312 Ga0207663_10279184 3300025916 Bacteria 1240
313 Ga0207663_10615918 3300025916 Bacteria 854
314 Ga0207660_10344693 3300025917 Bacteria 1193
315 Ga0207662_10057778 3300025918 Bacteria 2320
316 Ga0207657_10009348 3300025919 Bacteria 9867
317 Ga0207652_10268387 3300025921 Bacteria 1539
318 Ga0207652_10425421 3300025921 Bacteria 1198
319 Ga0207646_10000193 3300025922 Bacteria 83049
320 Ga0207646_10000987 3300025922 Bacteria 36541
321 Ga0207646_10001795 3300025922 Bacteria 25949
322 Ga0207646_10009242 3300025922 Bacteria 9763
323 Ga0207646_10021993 3300025922 Bacteria 5883
324 Ga0207646_10046087 3300025922 Bacteria 3913
325 Ga0207646_10089975 3300025922 Bacteria 2748
326 Ga0207646_10100670 3300025922 Bacteria 2590
327 Ga0207646_10149150 3300025922 Bacteria 2108
328 Ga0207646_10523198 3300025922 Bacteria 1068
329 Ga0207646_10904055 3300025922 Bacteria 783
330 Ga0207694_11427832 3300025924 Bacteria 585
331 Ga0207659_10235298 3300025926 Bacteria 1479
332 Ga0207687_10211785 3300025927 Bacteria 1521
333 Ga0207687_11588107 3300025927 Bacteria 561
334 Ga0207700_10000029 3300025928 Bacteria 132615
335 Ga0207700_10010957 3300025928 Bacteria 5756
336 Ga0207700_10050230 3300025928 Bacteria 3107
337 Ga0207700_10092689 3300025928 Bacteria 2389
338 Ga0207700_10114026 3300025928 Bacteria 2180
339 Ga0207700_10115778 3300025928 Bacteria 2165
340 Ga0207700_10185144 3300025928 Bacteria 1746
341 Ga0207700_10264001 3300025928 Bacteria 1475
342 Ga0207700_10270120 3300025928 Bacteria 1459
343 Ga0207664_10000110 3300025929 Bacteria 72637
344 Ga0207664_10002802 3300025929 Bacteria 11579
345 Ga0207664_10004783 3300025929 Bacteria 9201
346 Ga0207664_10041698 3300025929 Bacteria 3577
347 Ga0207664_10092959 3300025929 Bacteria 2476
348 Ga0207664_10096587 3300025929 Bacteria 2432
349 Ga0207664_10121036 3300025929 Bacteria 2190
350 Ga0207664_10124191 3300025929 Bacteria 2165
351 Ga0207664_10295199 3300025929 Bacteria 1425
352 Ga0207664_10318716 3300025929 Bacteria 1371
353 Ga0207664_11114696 3300025929 Bacteria 705
354 Ga0207644_10169885 3300025931 Bacteria 1701
355 Ga0207706_10021844 3300025933 Bacteria 5744
356 Ga0207670_10180395 3300025936 Bacteria 1590
357 Ga0207665_10000144 3300025939 Bacteria 48077
358 Ga0207665_10000371 3300025939 Bacteria 31095
359 Ga0207665_10012857 3300025939 Bacteria 5505
360 Ga0207665_10046612 3300025939 Bacteria 2904
361 Ga0207665_10102307 3300025939 Bacteria 2002
362 Ga0207665_10170815 3300025939 Bacteria 1570
363 Ga0207665_10286005 3300025939 Bacteria 1228
364 Ga0207691_10153945 3300025940 Bacteria 2020
365 Ga0207711_10444844 3300025941 Bacteria 1206
366 Ga0207689_10008458 3300025942 Bacteria 8963
367 Ga0207661_10380764 3300025944 Bacteria 1277
368 Ga0207679_10216486 3300025945 Bacteria 1609
369 Ga0207679_10421957 3300025945 Bacteria 1177
370 Ga0207679_10815401 3300025945 Bacteria 851
371 Ga0207667_10287954 3300025949 Bacteria 1678
372 Ga0207667_10685135 3300025949 Bacteria 1028
373 Ga0207712_10639271 3300025961 Bacteria 924
374 Ga0207640_10105079 3300025981 Bacteria 1989
375 Ga0207677_10033217 3300026023 Bacteria 3326
376 Ga0207677_10067136 3300026023 Bacteria 2511
377 Ga0207677_10703732 3300026023 Bacteria 897
378 Ga0207639_11003546 3300026041 Bacteria 782
379 Ga0207678_10023957 3300026067 Bacteria 5337
380 Ga0207708_10084403 3300026075 Bacteria 2442
381 Ga0207702_10287239 3300026078 Bacteria 1557
382 Ga0207702_11405502 3300026078 Unclassified 692
383 Ga0207648_10593464 3300026089 Bacteria 1020
384 Ga0207648_11062861 3300026089 Bacteria 759
385 Ga0207676_10095761 3300026095 Bacteria 2448
386 Ga0207674_10047522 3300026116 Bacteria 4398
387 Ga0207674_10053348 3300026116 Bacteria 4122
388 Ga0207675_100015848 3300026118 Bacteria 7029
389 Ga0207683_10081725 3300026121 Bacteria 2868
390 Ga0207698_11737540 3300026142 Bacteria 639
391 Ga0268265_10046996 3300028380 Bacteria 3231
392 Ga0265336_10020488 3300028666 Bacteria 2121
393 Ga0265338_10008234 3300028800 Bacteria 12700
394 Ga0265338_10008494 3300028800 Bacteria 12457
395 Ga0265338_10021432 3300028800 Bacteria 6738
396 Ga0265766_1002005 3300030863 Bacteria 1093
397 Ga0373948_0137758 3300034817 Bacteria 602
398 Ga0373959_0005334 3300034820 Bacteria 2105
399 Ga0373959_0012553 3300034820 Bacteria 1515
400 Ga0373926_0001134 3300035083 Bacteria 7918
401 Ga0373926_0022191 3300035083 Bacteria 2202
402 Ga0373926_0213358 3300035083 Bacteria 744
403 Ga0373928_0002714 3300035084 Bacteria 3423
404 Ga0373928_0014128 3300035084 Bacteria 1611
405 Ga0373929_0003272 3300035085 Bacteria 2930
406 Ga0373934_0000108 3300035086 Bacteria 29499
407 Ga0373934_0020538 3300035086 Bacteria 2538
408 Ga0373934_0021345 3300035086 Bacteria 2493
409 Ga0373934_0035538 3300035086 Bacteria 1960
410 Ga0373934_0109152 3300035086 Bacteria 1121
411 Ga0373940_0006912 3300035088 Bacteria 2542
412 Ga0373944_0000289 3300035089 Bacteria 11174
413 Ga0373944_0020473 3300035089 Bacteria 1906
414 Ga0373944_0043043 3300035089 Bacteria 1402
415 Ga0373949_0020209 3300035090 Bacteria 1522
416 Ga0373951_0006227 3300035091 Bacteria 2733
417 Ga0373923_0000440 3300035111 Bacteria 9801
418 Ga0373923_0023245 3300035111 Bacteria 2437
419 Ga0373923_0040398 3300035111 Bacteria 1920
420 Ga0373923_0044162 3300035111 Bacteria 1846
421 Ga0373923_0217492 3300035111 Bacteria 887
422 Ga0373923_0421501 3300035111 Bacteria 644
423 Ga0373932_0025734 3300035112 Bacteria 1595
424 Ga0373932_0208589 3300035112 Bacteria 697
425 Ga0373936_0004054 3300035113 Bacteria 5519
426 Ga0373936_0006186 3300035113 Bacteria 4512
427 Ga0373936_0013551 3300035113 Bacteria 3112
428 Ga0373936_0093632 3300035113 Bacteria 1262
429 Ga0373936_0114683 3300035113 Bacteria 1146
430 Ga0373936_0204478 3300035113 Bacteria 872
431 Ga0373939_0020543 3300035114 Bacteria 1795
432 Ga0373941_0006307 3300035115 Bacteria 2849
433 Ga0373941_0019064 3300035115 Bacteria 1904
434 Ga0373945_0003403 3300035116 Bacteria 5002
435 Ga0373945_0019675 3300035116 Bacteria 2306
436 Ga0373945_0116666 3300035116 Bacteria 1058
437 Ga0373945_0203655 3300035116 Bacteria 822
438 Ga0373953_0000094 3300035117 Bacteria 21383
439 Ga0373953_0003722 3300035117 Bacteria 4786
440 Ga0373953_0014394 3300035117 Bacteria 2844
441 Ga0373953_0029168 3300035117 Bacteria 2132
442 Ga0373953_0087560 3300035117 Bacteria 1300
443 Ga0373953_0196437 3300035117 Bacteria 872
444 Ga0373953_0283446 3300035117 Unclassified 722
445 Ga0373954_0016687 3300035118 Bacteria 3290
446 Ga0373954_0017488 3300035118 Bacteria 3221
447 Ga0373954_0049604 3300035118 Bacteria 1968
448 Ga0373954_0098627 3300035118 Bacteria 1408
449 Ga0373954_0106472 3300035118 Bacteria 1355
450 Ga0373954_0171828 3300035118 Bacteria 1061
451 Ga0373956_0001194 3300035119 Bacteria 10735
452 Ga0373956_0023529 3300035119 Bacteria 2645
453 Ga0373956_0046033 3300035119 Bacteria 1947
454 Ga0373956_0150377 3300035119 Bacteria 1095
455 Ga0373956_0250119 3300035119 Bacteria 843
456 Ga0373956_0343764 3300035119 Unclassified 711
457 Ga0373957_0000166 3300035120 Bacteria 16937
458 Ga0373957_0017096 3300035120 Bacteria 2520
459 Ga0373957_0017140 3300035120 Bacteria 2517
460 Ga0373957_0107957 3300035120 Bacteria 1119
461 Ga0373957_0153974 3300035120 Bacteria 944
462 Ga0373960_0005964 3300035121 Bacteria 2840
463 Ga0373943_0010430 3300035170 Bacteria 4162
464 Ga0373943_0040749 3300035170 Bacteria 2243
465 Ga0373943_0370413 3300035170 Bacteria 823
466 Ga0373943_0457081 3300035170 Bacteria 742
467 Ga0373946_0000253 3300035171 Bacteria 16969
468 Ga0373946_0000665 3300035171 Bacteria 11525
469 Ga0373946_0034420 3300035171 Bacteria 2045
470 Ga0373946_0171485 3300035171 Bacteria 1024
471 Ga0373946_0390712 3300035171 Bacteria 701
472 Ga0373955_0000112 3300035172 Bacteria 32757
473 Ga0373955_0016168 3300035172 Bacteria 3668
474 Ga0373955_0073552 3300035172 Bacteria 1916
475 Ga0373955_0143500 3300035172 Bacteria 1401
476 Ga0373955_0434387 3300035172 Bacteria 799
477 Ga0373942_0013081 3300035207 Bacteria 1990
478 Ga0373924_0000211 3300035410 Bacteria 17761
479 Ga0373924_0002044 3300035410 Bacteria 6726
480 Ga0373924_0007597 3300035410 Bacteria 3917
481 Ga0373924_0036499 3300035410 Bacteria 1997
482 Ga0373924_0077318 3300035410 Bacteria 1411
483 Ga0373924_0300603 3300035410 Bacteria 713
484 Ga0373931_0025020 3300035691 Bacteria 3030
485 Ga0373931_0276157 3300035691 Bacteria 1030
486 Ga0373931_0575561 3300035691 Bacteria 734
487 Ga0373931_0688548 3300035691 Bacteria 674
488 Ga0373935_0000970 3300035692 Bacteria 15551
489 Ga0373935_0058068 3300035692 Bacteria 2470
490 Ga0373935_0069952 3300035692 Bacteria 2262
491 Ga0373935_0090302 3300035692 Bacteria 2005
492 Ga0373935_0095707 3300035692 Bacteria 1950
493 Ga0373935_0152168 3300035692 Bacteria 1571
494 Ga0373935_0191624 3300035692 Bacteria 1408
495 Ga0373935_0321116 3300035692 Bacteria 1099
496 Ga0373935_0327448 3300035692 Bacteria 1088
497 Ga0373927_0003427 3300035695 Bacteria 11371
498 Ga0373927_0008071 3300035695 Bacteria 7107
499 Ga0373927_0051612 3300035695 Bacteria 2659
500 Ga0373927_0085403 3300035695 Bacteria 2048
501 Ga0373927_0093124 3300035695 Bacteria 1957
502 Ga0373933_0000022 3300035724 Bacteria 94582
503 Ga0373933_0009952 3300035724 Bacteria 5204
504 Ga0373933_0010723 3300035724 Bacteria 5027
505 Ga0373933_0043371 3300035724 Bacteria 2661
506 Ga0373933_0070150 3300035724 Bacteria 2131
507 Ga0373933_0081382 3300035724 Bacteria 1986
508 Ga0373947_0000006 3300035725 Bacteria 223611
509 Ga0373947_0001275 3300035725 Bacteria 15526
510 Ga0373947_0045741 3300035725 Bacteria 2619
511 Ga0373947_0116824 3300035725 Bacteria 1692
512 Ga0373947_0379888 3300035725 Bacteria 951
513 Ga0373947_0528399 3300035725 Bacteria 802
514 Ga0373937_0000022 3300036401 Bacteria 127537
515 Ga0373937_0008926 3300036401 Bacteria 8704
516 Ga0373937_0088587 3300036401 Bacteria 2865
517 Ga0373937_0145162 3300036401 Bacteria 2221
518 Ga0373937_0206487 3300036401 Bacteria 1847
519 Ga0373937_0302222 3300036401 Bacteria 1512
520 Ga0373937_0362013 3300036401 Bacteria 1374
521 Ga0373937_0473550 3300036401 Bacteria 1189
522 Ga0373925_0006452 3300037068 Bacteria 8629
523 Ga0373925_0035770 3300037068 Bacteria 3666
524 Ga0373925_0056010 3300037068 Bacteria 2952
525 Ga0373925_0082951 3300037068 Bacteria 2440
526 Ga0373925_0145471 3300037068 Bacteria 1858
527 Ga0373925_0187850 3300037068 Bacteria 1638
528 Ga0373925_0373403 3300037068 Bacteria 1160
529 Ga0373925_0465282 3300037068 Bacteria 1036
530 Ga0436364_0022748 3300037853 Bacteria 2210
531 Ga0436364_0165105 3300037853 Bacteria 5758
532 Ga0436364_0287557 3300037853 Bacteria 2574
533 Ga0436364_0403534 3300037853 Bacteria 17431
534 Ga0436364_0813504 3300037853 Bacteria 1505
535 Ga0436364_1104976 3300037853 Bacteria 23337
536 Ga0436364_1260325 3300037853 Bacteria 730
537 Ga0436364_1433707 3300037853 Bacteria 1118
538 Ga0436364_1482361 3300037853 Bacteria 4786
539 Ga0436365_0833348 3300039437 Bacteria 1532
540 Ga0436365_1762478 3300039437 Bacteria 1097
541 Ga0436361_1213485 3300039447 Bacteria 917
542 Ga0436363_0137663 3300039450 Bacteria 963
543 Ga0436363_0257475 3300039450 Bacteria 580
544 Ga0436363_0836105 3300039450 Bacteria 756
545 Ga0436363_0902303 3300039450 Bacteria 3476
546 Ga0436363_0909159 3300039450 Bacteria 630
547 Ga0436363_1480634 3300039450 Bacteria 654
548 Ga0436362_0338528 3300039453 Bacteria 2813
549 Ga0436362_0368392 3300039453 Bacteria 679
550 Ga0436362_0372337 3300039453 Bacteria 586
551 Ga0436362_1015235 3300039453 Bacteria 923
552 Ga0466961_0363668 3300044693 Bacteria 880
553 Ga0466963_0052060 3300044694 Bacteria 2716
554 Ga0466963_0176417 3300044694 Bacteria 1491
555 Ga0466957_0462353 3300044842 Bacteria 876
556 Ga0466959_0124676 3300045049 Bacteria 1829
557 Ga0466959_0268297 3300045049 Bacteria 1174
558 Ga0466958_0387961 3300045836 Bacteria 901
559 Ga0466967_0014807 3300045976 Bacteria 6092
560 Ga0466967_0552920 3300045976 Bacteria 1133
561 Ga0495592_0000025 3300046454 Bacteria 136324
562 Ga0495592_0019709 3300046454 Bacteria 5130
563 Ga0495592_0026425 3300046454 Bacteria 4401
564 Ga0495592_0110047 3300046454 Bacteria 1950
565 Ga0495592_0345222 3300046454 Bacteria 956
566 Ga0495603_0005042 3300046455 Bacteria 7895
567 Ga0495603_0024547 3300046455 Bacteria 3646
568 Ga0495603_0189154 3300046455 Bacteria 1190
569 Ga0495629_0002510 3300046459 Bacteria 14082
570 Ga0495629_0061255 3300046459 Bacteria 2629
571 Ga0495629_0128252 3300046459 Bacteria 1767
572 Ga0495629_0160381 3300046459 Bacteria 1562
573 Ga0495641_0012813 3300046461 Bacteria 4655
574 Ga0495641_0046460 3300046461 Bacteria 1996
575 Ga0495641_0050822 3300046461 Bacteria 1894
576 Ga0495641_0286358 3300046461 Bacteria 742
577 Ga0495651_0000014 3300046462 Bacteria 136312
578 Ga0495651_0021944 3300046462 Bacteria 4965
579 Ga0495651_0023468 3300046462 Bacteria 4795
580 Ga0495651_0028505 3300046462 Bacteria 4350
581 Ga0495651_0042434 3300046462 Bacteria 3531
582 Ga0495651_0068436 3300046462 Bacteria 2706
583 Ga0495651_0789444 3300046462 Bacteria 586
584 Ga0495653_0014717 3300046463 Bacteria 6381
585 Ga0495653_0016957 3300046463 Bacteria 5924
586 Ga0495653_0034894 3300046463 Bacteria 3972
587 Ga0495653_0043271 3300046463 Bacteria 3502
588 Ga0495653_0046178 3300046463 Bacteria 3373
589 Ga0495653_0048688 3300046463 Bacteria 3270
590 Ga0495653_0078687 3300046463 Bacteria 2444
591 Ga0495653_0146406 3300046463 Bacteria 1654
592 Ga0495653_0624010 3300046463 Bacteria 660
593 Ga0495582_0002650 3300046473 Bacteria 9981
594 Ga0495582_0018083 3300046473 Bacteria 3855
595 Ga0495582_0045935 3300046473 Bacteria 2405
596 Ga0495582_0111332 3300046473 Bacteria 1538
597 Ga0495639_0018940 3300046475 Bacteria 3001
598 Ga0495639_0058975 3300046475 Bacteria 1756
599 Ga0495639_0236162 3300046475 Bacteria 901
600 Ga0495662_0000415 3300046476 Bacteria 19153
601 Ga0495662_0005659 3300046476 Bacteria 6247
602 Ga0495662_0020737 3300046476 Bacteria 3179
603 Ga0495662_0027014 3300046476 Bacteria 2773
604 Ga0495662_0048126 3300046476 Bacteria 2058
605 Ga0495662_0186174 3300046476 Bacteria 1023
606 Ga0495664_0008128 3300046477 Bacteria 5843
607 Ga0495664_0013731 3300046477 Bacteria 4591
608 Ga0495664_0083295 3300046477 Bacteria 1919
609 Ga0495664_0370480 3300046477 Bacteria 861
610 Ga0495664_0370683 3300046477 Bacteria 861
611 Ga0495594_0019264 3300046499 Bacteria 3625
612 Ga0495594_0047095 3300046499 Bacteria 2368
613 Ga0495608_0000190 3300046511 Bacteria 43597
614 Ga0495608_0026053 3300046511 Bacteria 3990
615 Ga0495608_0027392 3300046511 Bacteria 3877
616 Ga0495608_0028031 3300046511 Bacteria 3828
617 Ga0495608_0138993 3300046511 Bacteria 1551
618 Ga0495608_0229821 3300046511 Bacteria 1161
619 Ga0495608_0262667 3300046511 Bacteria 1074
620 Ga0495608_0270416 3300046511 Bacteria 1057
621 Ga0495608_0312620 3300046511 Bacteria 971
622 Ga0495618_0033244 3300046514 Bacteria 3233
623 Ga0495618_0036751 3300046514 Bacteria 3074
624 Ga0495618_0058982 3300046514 Bacteria 2431
625 Ga0495618_0062188 3300046514 Bacteria 2368
626 Ga0495618_0069649 3300046514 Bacteria 2236
627 Ga0495618_0079625 3300046514 Bacteria 2090
628 Ga0495618_0116698 3300046514 Bacteria 1709
629 Ga0495618_0130493 3300046514 Bacteria 1608
630 Ga0495618_0296849 3300046514 Bacteria 1004
631 Ga0495618_0510701 3300046514 Bacteria 723
632 Ga0495628_0000346 3300046516 Bacteria 42250
633 Ga0495628_0034457 3300046516 Bacteria 4071
634 Ga0495628_0051400 3300046516 Bacteria 3258
635 Ga0495628_0057318 3300046516 Bacteria 3064
636 Ga0495628_0096929 3300046516 Bacteria 2278
637 Ga0495628_0148892 3300046516 Bacteria 1783
638 Ga0495628_0246247 3300046516 Bacteria 1336
639 Ga0495630_0015459 3300046517 Bacteria 5572
640 Ga0495630_0035134 3300046517 Bacteria 3745
641 Ga0495630_0055015 3300046517 Bacteria 2981
642 Ga0495630_0065777 3300046517 Bacteria 2724
643 Ga0495630_1306325 3300046517 Bacteria 547
644 Ga0495666_0004933 3300046526 Bacteria 6757
645 Ga0495666_0036493 3300046526 Bacteria 2394
646 Ga0495652_0010242 3300046529 Bacteria 8500
647 Ga0495652_0030510 3300046529 Bacteria 4727
648 Ga0495652_0031518 3300046529 Bacteria 4642
649 Ga0495652_0032332 3300046529 Bacteria 4576
650 Ga0495652_0038016 3300046529 Bacteria 4172
651 Ga0495652_0079199 3300046529 Bacteria 2717
652 Ga0495652_0148146 3300046529 Bacteria 1837
653 Ga0495652_0149262 3300046529 Bacteria 1828
654 Ga0495652_0223967 3300046529 Bacteria 1411
655 Ga0495652_0302171 3300046529 Bacteria 1163
656 Ga0495665_0000524 3300046531 Bacteria 19423
657 Ga0495665_0003902 3300046531 Bacteria 8070
658 Ga0495665_0012150 3300046531 Bacteria 4662
659 Ga0495665_0014274 3300046531 Bacteria 4285
660 Ga0495665_0424162 3300046531 Bacteria 673
661 Ga0495640_0019543 3300046533 Bacteria 4998
662 Ga0495640_0127799 3300046533 Bacteria 1647
663 Ga0495640_0133265 3300046533 Bacteria 1606
664 Ga0495640_0160262 3300046533 Bacteria 1442
665 Ga0495640_0214779 3300046533 Bacteria 1215
666 Ga0495640_0391904 3300046533 Bacteria 853
667 Ga0495586_0006410 3300046535 Bacteria 6286
668 Ga0495586_0031390 3300046535 Bacteria 2845
669 Ga0495587_0000029 3300046536 Bacteria 136321
670 Ga0495587_0006950 3300046536 Bacteria 7350
671 Ga0495587_0012669 3300046536 Bacteria 5303
672 Ga0495587_0037890 3300046536 Bacteria 2892
673 Ga0495587_0142002 3300046536 Bacteria 1370
674 Ga0495587_0144565 3300046536 Bacteria 1356
675 Ga0495645_0022525 3300046543 Bacteria 4558
676 Ga0495645_0031600 3300046543 Bacteria 3858
677 Ga0495645_0065440 3300046543 Bacteria 2629
678 Ga0495645_0168598 3300046543 Bacteria 1508
679 Ga0495645_0359905 3300046543 Bacteria 935
680 Ga0495645_0504041 3300046543 Bacteria 756
681 Ga0495667_0000036 3300046559 Bacteria 136146
682 Ga0495667_0001443 3300046559 Bacteria 15660
683 Ga0495667_0007912 3300046559 Bacteria 7207
684 Ga0495667_0011226 3300046559 Bacteria 6067
685 Ga0495667_0027589 3300046559 Bacteria 3824
686 Ga0495667_0031427 3300046559 Bacteria 3564
687 Ga0495667_0062785 3300046559 Bacteria 2433
688 Ga0495667_0125890 3300046559 Bacteria 1653
689 Ga0495667_0323559 3300046559 Bacteria 976
690 Ga0495634_0005049 3300046642 Bacteria 10190
691 Ga0495634_0011657 3300046642 Bacteria 6394
692 Ga0495634_0069302 3300046642 Bacteria 2327
693 Ga0495634_0145533 3300046642 Bacteria 1501
694 Ga0495635_0004586 3300046663 Bacteria 9583
695 Ga0495635_0008790 3300046663 Bacteria 7053
696 Ga0495635_0038965 3300046663 Bacteria 3290
697 Ga0495635_0060878 3300046663 Bacteria 2593
698 Ga0495635_0114341 3300046663 Bacteria 1842
699 Ga0495635_0209544 3300046663 Bacteria 1320
700 Ga0495635_0244086 3300046663 Bacteria 1211
701 Ga0495635_0299941 3300046663 Bacteria 1077
702 Ga0495588_0058930 3300046674 Bacteria 1985
703 Ga0495657_0000071 3300046675 Bacteria 92182
704 Ga0495657_0008636 3300046675 Bacteria 7776
705 Ga0495657_0038498 3300046675 Bacteria 3290
706 Ga0495657_0044277 3300046675 Bacteria 3028
707 Ga0495657_0044387 3300046675 Bacteria 3023
708 Ga0495657_0100342 3300046675 Bacteria 1845
709 Ga0495657_0210672 3300046675 Bacteria 1181
710 Ga0495657_0310114 3300046675 Bacteria 939
711 Ga0495599_0000094 3300046678 Bacteria 62648
712 Ga0495599_0010549 3300046678 Bacteria 5652
713 Ga0495599_0042454 3300046678 Bacteria 2853
714 Ga0495599_0058963 3300046678 Bacteria 2401
715 Ga0495599_0115031 3300046678 Bacteria 1674
716 Ga0495599_0116985 3300046678 Bacteria 1658
717 Ga0495599_0137792 3300046678 Bacteria 1514
718 Ga0495599_0270372 3300046678 Bacteria 1031
719 Ga0495599_0316810 3300046678 Bacteria 939
720 Ga0495623_0000113 3300046679 Bacteria 49223
721 Ga0495623_0029194 3300046679 Bacteria 3549
722 Ga0495623_0067661 3300046679 Bacteria 2229
723 Ga0495623_0073363 3300046679 Bacteria 2127
724 Ga0495623_0181232 3300046679 Bacteria 1223
725 Ga0495646_0008387 3300046680 Bacteria 6569
726 Ga0495646_0031995 3300046680 Bacteria 3275
727 Ga0495646_0045764 3300046680 Bacteria 2670
728 Ga0495646_0052418 3300046680 Bacteria 2464
729 Ga0495646_0194436 3300046680 Bacteria 1107
730 Ga0495646_0205946 3300046680 Bacteria 1069
731 Ga0495647_0389773 3300046681 Bacteria 638
732 Ga0495658_0003156 3300046683 Bacteria 8214
733 Ga0495658_0086281 3300046683 Bacteria 1851
734 Ga0495658_0178053 3300046683 Bacteria 1318
735 Ga0495613_0018727 3300046689 Bacteria 5163
736 Ga0495613_0067359 3300046689 Bacteria 2613
737 Ga0495613_0137841 3300046689 Bacteria 1745
738 Ga0495613_0196613 3300046689 Bacteria 1423
739 Ga0495613_0240966 3300046689 Bacteria 1264
740 Ga0495624_0003337 3300046690 Bacteria 11932
741 Ga0495624_0024311 3300046690 Bacteria 3987
742 Ga0495624_0026797 3300046690 Bacteria 3776
743 Ga0495600_0001986 3300046809 Bacteria 11495
744 Ga0495600_0008730 3300046809 Bacteria 6234
745 Ga0495600_0032324 3300046809 Bacteria 3394
746 Ga0495600_0074984 3300046809 Bacteria 2209
747 Ga0495600_0153438 3300046809 Bacteria 1490
748 Ga0495600_0177626 3300046809 Bacteria 1372
749 Ga0495600_0420422 3300046809 Unclassified 829
750 Ga0495581_0000903 3300047315 Bacteria 15917
751 Ga0495581_0051859 3300047315 Bacteria 2369
752 Ga0495581_0092484 3300047315 Bacteria 1756
753 Ga0495581_0115715 3300047315 Bacteria 1559
754 Ga0495581_0408805 3300047315 Bacteria 791
755 Ga0495604_0000044 3300047317 Bacteria 112937
756 Ga0495604_0015746 3300047317 Bacteria 6035
757 Ga0495604_0153870 3300047317 Bacteria 1631
758 Ga0495604_0248216 3300047317 Bacteria 1214
759 Ga0495604_0499174 3300047317 Bacteria 790
760 Ga0495604_0729922 3300047317 Bacteria 627
761 Ga0495674_0000044 3300047319 Bacteria 84651
762 Ga0495674_0057081 3300047319 Bacteria 3417
763 Ga0495674_0267428 3300047319 Bacteria 1404
764 Ga0495674_0268119 3300047319 Bacteria 1401
765 Ga0495674_0453327 3300047319 Bacteria 1030
766 Ga0495674_0515277 3300047319 Bacteria 955
767 Ga0495676_0008527 3300047321 Bacteria 9393
768 Ga0495676_0058852 3300047321 Bacteria 3021
769 Ga0495676_0131456 3300047321 Bacteria 1806
770 Ga0495676_0351362 3300047321 Bacteria 985
771 Ga0495680_0000219 3300047322 Bacteria 62686
772 Ga0495680_0017665 3300047322 Bacteria 6078
773 Ga0495680_0024774 3300047322 Bacteria 4972
774 Ga0495680_0043101 3300047322 Bacteria 3575
775 Ga0495680_0074258 3300047322 Bacteria 2582
776 Ga0495680_0159531 3300047322 Bacteria 1638
777 Ga0495675_0002157 3300047444 Bacteria 11734
778 Ga0495675_0002458 3300047444 Bacteria 11082
779 Ga0495675_0004181 3300047444 Bacteria 8733
780 Ga0495675_0029798 3300047444 Bacteria 3481
781 Ga0495675_0040598 3300047444 Bacteria 2965
782 Ga0495675_0072339 3300047444 Bacteria 2175
783 Ga0495684_0000962 3300047471 Bacteria 23465
784 Ga0495684_0017761 3300047471 Bacteria 5479
785 Ga0495684_0064779 3300047471 Bacteria 2777
786 Ga0495684_0098357 3300047471 Bacteria 2212
787 Ga0495593_0005556 3300047673 Bacteria 7448
788 Ga0495593_0013529 3300047673 Bacteria 4652
789 Ga0495593_0032474 3300047673 Bacteria 2845
790 Ga0495593_0063625 3300047673 Bacteria 1926
791 Ga0495593_0090808 3300047673 Bacteria 1573
792 Ga0495602_0000480 3300048088 Bacteria 36967
793 Ga0495602_0033666 3300048088 Bacteria 4803
794 Ga0495602_0051492 3300048088 Bacteria 3666
795 Ga0495602_0104978 3300048088 Bacteria 2310
796 Ga0495602_0111495 3300048088 Bacteria 2221
797 Ga0495602_0130961 3300048088 Bacteria 2000
798 Ga0495602_0248377 3300048088 Bacteria 1327
799 Ga0495602_0279468 3300048088 Bacteria 1230
800 Ga0495602_0361202 3300048088 Bacteria 1045
801 Ga0495602_0700402 3300048088 Bacteria 687
802 Ga0495614_0005646 3300048089 Bacteria 5641
803 Ga0495614_0046486 3300048089 Bacteria 1861
804 Ga0495614_0236617 3300048089 Bacteria 833
805 Ga0496101_0081580 3300048904 Bacteria 2392
806 Ga0496102_0271430 3300048905 Bacteria 1599
807 Ga0496103_0112067 3300048906 Bacteria 1733
808 Ga0496104_0008559 3300048907 Bacteria 9098
809 Ga0496104_0226081 3300048907 Bacteria 1783
810 Ga0496105_0010843 3300048908 Bacteria 7175
811 Ga0496105_0039664 3300048908 Bacteria 3882
812 Ga0496105_0543062 3300048908 Bacteria 908
813 Ga0496106_0084617 3300048909 Bacteria 2440
814 Ga0496108_0211820 3300048911 Bacteria 1682
815 Ga0496108_0232166 3300048911 Bacteria 1604
816 Ga0496108_0286318 3300048911 Bacteria 1434
817 Ga0496109_0072290 3300048912 Bacteria 3168
818 Ga0496109_0309743 3300048912 Bacteria 1489
819 Ga0496110_0008342 3300048913 Bacteria 8335
820 Ga0496110_0074600 3300048913 Bacteria 3013
821 Ga0496111_0010415 3300048914 Bacteria 6239
822 Ga0496111_0089111 3300048914 Bacteria 2259
823 Ga0496112_0580649 3300048915 Bacteria 1053
824 Ga0496113_0116354 3300048916 Bacteria 2086
825 Ga0496113_1097658 3300048916 Bacteria 624
826 Ga0496114_0433192 3300048917 Bacteria 1165
827 Ga0496115_0734967 3300048918 Bacteria 773
828 Ga0496126_0129579 3300048929 Bacteria 2181
829 Ga0501042_0021172 3300049578 Bacteria 4528
830 Ga0501047_0079622 3300049581 Bacteria 3150
831 nmdc:mga05p37_17739_c1 3300050507 Bacteria 8590
832 nmdc:mga05p37_405395_c1 3300050507 Bacteria 1591
833 nmdc:mga08y16_519657_c1 3300050511 Bacteria 1207
834 nmdc:mga0n895_112648_c1 3300050512 Bacteria 2737
835 nmdc:mga0rr50_159719_c1 3300050513 Bacteria 1829
836 nmdc:mga0rr50_203890_c1 3300050513 Bacteria 1627
837 nmdc:mga0rr50_297027_c1 3300050513 Bacteria 1351
838 nmdc:mga08x19_110520_c1 3300050514 Bacteria 1833
839 nmdc:mga08x19_471501_c1 3300050514 Bacteria 884
840 nmdc:mga0a205_150886_c1 3300050515 Bacteria 2224
841 nmdc:mga0a205_307715_c1 3300050515 Bacteria 1457
842 nmdc:mga0a205_495943_c1 3300050515 Bacteria 1078
843 Ga0495601_0002241 3300053077 Bacteria 10897
844 Ga0495601_0009107 3300053077 Bacteria 5862
845 Ga0495601_0031020 3300053077 Bacteria 3321
846 Ga0495601_0167548 3300053077 Bacteria 1435
847 Ga0495601_0212785 3300053077 Bacteria 1263
848 Ga0495601_0425782 3300053077 Bacteria 859
849 Ga0495612_0017697 3300053078 Bacteria 2853
850 Ga0495612_0082055 3300053078 Bacteria 1355
851 Ga0495595_0002659 3300053084 Bacteria 7012
852 Ga0495595_0007985 3300053084 Bacteria 4334
853 Ga0495595_0038448 3300053084 Bacteria 2180
854 Ga0495619_0005114 3300053085 Bacteria 8324
855 Ga0495619_0018796 3300053085 Bacteria 4387
856 Ga0495619_0065485 3300053085 Bacteria 2424
857 Ga0495619_0205040 3300053085 Bacteria 1365
858 Ga0587083_0040764 3300059505 Bacteria 971
859 Ga0587114_026681 3300059655 Bacteria 856
860 Ga0265768_105053
861 Ga0070658_10115677
862 Ga0070683_100046191
863 Ga0070666_10321067
864 Ga0070680_100917305
865 Ga0070682_100349255
866 Ga0068868_100252694
867 Ga0068868_100851766
868 Ga0070660_100029919
869 Ga0070689_100061655
870 Ga0070691_10012298
871 Ga0070691_10067197
872 Ga0070687_100026444
873 Ga0070661_100031694
874 Ga0070661_100986968
875 Ga0070688_100399629
876 Ga0070659_100057640
877 Ga0070709_10000127
878 Ga0070709_10013588
879 Ga0070709_10423202
880 Ga0070709_10465726
881 Ga0070709_10915592
882 Ga0070714_100000318
883 Ga0070714_100000566
884 Ga0070714_100000689
885 Ga0070714_100002268
886 Ga0070714_100264058
887 Ga0070714_100899174
888 Ga0070714_101014004
889 Ga0070713_100002191
890 Ga0070713_100002403
891 Ga0070713_100037480
892 Ga0070713_100092012
893 Ga0070713_100111465
894 Ga0070713_100151180
895 Ga0070713_100389165
896 Ga0070713_100955575
897 Ga0070710_10000177
898 Ga0070710_10001432
899 Ga0070710_10022781
900 Ga0070710_10042888
901 Ga0070710_10274564
902 Ga0070710_10280696
903 Ga0070701_10505582
904 Ga0070711_100000158
905 Ga0070711_100003475
906 Ga0070711_100121910
907 Ga0070711_100137932
908 Ga0070711_101487654
909 Ga0070705_100039731
910 Ga0070694_100124287
911 Ga0070708_100014131
912 Ga0070708_100029185
913 Ga0070708_100046036
914 Ga0070708_100085571
915 Ga0070708_100109248
916 Ga0070708_100116285
917 Ga0070708_100156662
918 Ga0070708_100227048
919 Ga0070708_100241795
920 Ga0070708_100273305
921 Ga0070708_100488058
922 Ga0070663_100176013
923 Ga0070662_100200609
924 Ga0070681_10142805
925 Ga0070681_11080798
926 Ga0068867_100501773
927 Ga0070706_100002062
928 Ga0070706_100003701
929 Ga0070706_100006498
930 Ga0070706_100007197
931 Ga0070706_100015978
932 Ga0070706_100024755
933 Ga0070706_100028667
934 Ga0070706_100061551
935 Ga0070706_100092964
936 Ga0070706_100151273
937 Ga0070706_100151534
938 Ga0070706_100276238
939 Ga0070706_100638232
940 Ga0070707_100001992
941 Ga0070707_100002252
942 Ga0070707_100004968
943 Ga0070707_100005544
944 Ga0070707_100007290
945 Ga0070707_100013838
946 Ga0070707_100023182
947 Ga0070707_100025462
948 Ga0070707_100053299
949 Ga0070707_100118012
950 Ga0070707_100130794
951 Ga0070707_100147526
952 Ga0070707_100251380
953 Ga0070707_100256143
954 Ga0070707_100610766
955 Ga0070707_100684032
956 Ga0070698_100000028
957 Ga0070698_100001318
958 Ga0070698_100004118
959 Ga0070698_100017228
960 Ga0070698_100048162
961 Ga0070698_100052447
962 Ga0070698_100064245
963 Ga0070698_100072345
964 Ga0070698_100085243
965 Ga0070698_100131464
966 Ga0070698_100450299
967 Ga0070698_100537777
968 Ga0070698_100707470
969 Ga0070698_101051495
970 Ga0070698_101108604
971 Ga0070699_100005167
972 Ga0070699_100126974
973 Ga0070699_100188209
974 Ga0070699_100228496
975 Ga0070679_100029643
976 Ga0070697_100002042
977 Ga0070697_100121430
978 Ga0070697_100292246
979 Ga0070697_100640465
980 Ga0068853_100181550
981 Ga0070686_100067274
982 Ga0070696_100070625
983 Ga0070693_100029706
984 Ga0068855_100593544
985 Ga0068855_101016728
986 Ga0070664_100049942
987 Ga0068857_100494255
988 Ga0068857_101975898
989 Ga0068854_100058858
990 Ga0068856_100039845
991 Ga0068856_100185635
992 Ga0068856_100271265
993 Ga0070702_100058569
994 Ga0068852_100219060
995 Ga0068859_100030304
996 Ga0068859_100282990
997 Ga0068864_100085848
998 Ga0068864_100097455
999 Ga0068864_100351693
1000 Ga0068863_100143487
1001 Ga0068858_100065730
1002 Ga0068858_100120587
1003 Ga0081540_1000216
1004 Ga0081540_1000960
1005 Ga0070717_10003861
1006 Ga0070717_10004122
1007 Ga0070717_10008107
1008 Ga0070717_10009432
1009 Ga0070717_10022198
1010 Ga0070717_10075374
1011 Ga0070717_10098100
1012 Ga0070717_10132644
1013 Ga0070717_10159909
1014 Ga0070717_10521892
1015 Ga0070717_11030664
1016 Ga0070715_10032738
1017 Ga0070715_10042596
1018 Ga0070715_10093759
1019 Ga0070715_10189375
1020 Ga0070715_10288025
1021 Ga0070716_100001172
1022 Ga0070716_100003016
1023 Ga0070716_100049433
1024 Ga0070716_100283914
1025 Ga0070712_100001943
1026 Ga0070712_100006067
1027 Ga0070712_100008832
1028 Ga0070712_100012663
1029 Ga0070712_100041588
1030 Ga0070712_100148281
1031 Ga0070712_100374659
1032 Ga0097621_100154910
1033 Ga0097621_100171431
1034 Ga0097621_100348972
1035 Ga0068871_100138867
1036 Ga0068871_100874859
1037 Ga0075428_100721512
1038 Ga0075433_10115068
1039 Ga0075433_10291091
1040 Ga0075433_10330213
1041 Ga0075434_100084234
1042 Ga0075434_100658828
1043 Ga0075434_101012586
1044 Ga0075436_100010622
1045 Ga0075436_100044827
1046 Ga0097620_100030304
1047 Ga0097620_100282976
1048 Ga0075435_100002113
1049 Ga0075435_100078981
1050 Ga0075435_100102297
1051 Ga0075435_100102313
1052 Ga0075435_100102785
1053 Ga0075435_100306850
1054 Ga0099794_10059797
1055 Ga0099794_10087098
1056 Ga0105240_10342987
1057 Ga0105240_10585422
1058 Ga0111539_10138806
1059 Ga0105245_10014529
1060 Ga0105245_10342681
1061 Ga0105245_11238556
1062 Ga0105247_10022237
1063 Ga0114129_10274852
1064 Ga0114129_10571211
1065 Ga0105243_10032414
1066 Ga0105243_11381782
1067 Ga0105241_10051803
1068 Ga0105241_11113588
1069 Ga0105242_10375128
1070 Ga0105237_10837231
1071 Ga0105249_10077682
1072 Ga0099796_10023530
1073 Ga0157320_1000850
1074 Ga0157341_1000456
1075 Ga0157371_10026824
1076 Ga0157370_10060734
1077 Ga0157370_10299282
1078 Ga0157369_11155758
1079 Ga0157374_10098756
1080 Ga0157374_10437311
1081 Ga0157378_10347221
1082 Ga0163162_10565459
1083 Ga0157372_10302117
1084 Ga0157372_10648207
1085 Ga0157372_10921636
1086 Ga0157375_10067111
1087 Ga0157375_10073819
1088 Ga0163163_10009527
1089 Ga0163163_10345919
1090 Ga0157380_10375827
1091 Ga0182008_10208313
1092 Ga0157377_10030606
1093 Ga0157379_10009369
1094 Ga0157379_10805146
1095 Ga0157376_10037222
1096 Ga0157376_10070067
1097 Ga0197907_10921524
1098 Ga0206349_1072023
1099 Ga0206355_1690273
1100 Ga0206351_10298566
1101 Ga0206350_10877957
1102 Ga0206354_11457378
1103 Ga0206353_11539891
1104 Ga0206353_11593526
1105 Ga0206353_11844072
1106 Ga0206353_11942878
1107 Ga0213874_10029482
1108 Ga0213874_10215634
1109 Ga0213874_10270273
1110 Ga0213876_10122247
1111 Ga0213876_10363613
1112 Ga0213875_10001317
1113 Ga0213875_10003914
1114 Ga0213875_10018906
1115 Ga0213875_10032302
1116 Ga0213875_10049770
1117 Ga0213875_10169187
1118 Ga0224712_10036107
1119 Ga0224712_10057094
1120 Ga0224712_10117158
1121 Ga0224712_10190020
1122 Ga0224572_1019308
1123 Ga0207653_10011575
1124 Ga0207692_10000088
1125 Ga0207692_10010349
1126 Ga0207692_10018761
1127 Ga0207692_10086833
1128 Ga0207692_10153381
1129 Ga0207642_10121710
1130 Ga0207688_10021100
1131 Ga0207647_10192433
1132 Ga0207685_10018343
1133 Ga0207685_10044138
1134 Ga0207685_10074321
1135 Ga0207699_10000608
1136 Ga0207699_10001553
1137 Ga0207699_10008170
1138 Ga0207699_10330973
1139 Ga0207699_10423768
1140 Ga0207699_10518035
1141 Ga0207705_10747752
1142 Ga0207684_10000479
1143 Ga0207684_10000798
1144 Ga0207684_10023256
1145 Ga0207684_10030469
1146 Ga0207684_10034426
1147 Ga0207684_10079128
1148 Ga0207684_10088491
1149 Ga0207684_10158744
1150 Ga0207684_10171674
1151 Ga0207684_10238222
1152 Ga0207684_10296461
1153 Ga0207684_10586056
1154 Ga0207684_10808410
1155 Ga0207654_10024927
1156 Ga0207707_10811636
1157 Ga0207695_10119018
1158 Ga0207693_10000436
1159 Ga0207693_10009331
1160 Ga0207693_10013696
1161 Ga0207693_10022682
1162 Ga0207693_10099467
1163 Ga0207693_10099695
1164 Ga0207693_11031191
1165 Ga0207663_10000615
1166 Ga0207663_10006544
1167 Ga0207663_10007709
1168 Ga0207663_10045564
1169 Ga0207663_10091058
1170 Ga0207663_10174144
1171 Ga0207663_10279184
1172 Ga0207663_10615918
1173 Ga0207660_10344693
1174 Ga0207662_10057778
1175 Ga0207657_10009348
1176 Ga0207652_10268387
1177 Ga0207652_10425421
1178 Ga0207646_10000193
1179 Ga0207646_10000987
1180 Ga0207646_10001795
1181 Ga0207646_10009242
1182 Ga0207646_10021993
1183 Ga0207646_10046087
1184 Ga0207646_10089975
1185 Ga0207646_10100670
1186 Ga0207646_10149150
1187 Ga0207646_10523198
1188 Ga0207646_10904055
1189 Ga0207694_11427832
1190 Ga0207659_10235298
1191 Ga0207687_10211785
1192 Ga0207687_11588107
1193 Ga0207700_10000029
1194 Ga0207700_10010957
1195 Ga0207700_10050230
1196 Ga0207700_10092689
1197 Ga0207700_10114026
1198 Ga0207700_10115778
1199 Ga0207700_10185144
1200 Ga0207700_10264001
1201 Ga0207700_10270120
1202 Ga0207664_10000110
1203 Ga0207664_10002802
1204 Ga0207664_10004783
1205 Ga0207664_10041698
1206 Ga0207664_10092959
1207 Ga0207664_10096587
1208 Ga0207664_10121036
1209 Ga0207664_10124191
1210 Ga0207664_10295199
1211 Ga0207664_10318716
1212 Ga0207664_11114696
1213 Ga0207644_10169885
1214 Ga0207706_10021844
1215 Ga0207670_10180395
1216 Ga0207665_10000144
1217 Ga0207665_10000371
1218 Ga0207665_10012857
1219 Ga0207665_10046612
1220 Ga0207665_10102307
1221 Ga0207665_10170815
1222 Ga0207665_10286005
1223 Ga0207691_10153945
1224 Ga0207711_10444844
1225 Ga0207689_10008458
1226 Ga0207661_10380764
1227 Ga0207679_10216486
1228 Ga0207679_10421957
1229 Ga0207679_10815401
1230 Ga0207667_10287954
1231 Ga0207667_10685135
1232 Ga0207712_10639271
1233 Ga0207640_10105079
1234 Ga0207677_10033217
1235 Ga0207677_10067136
1236 Ga0207677_10703732
1237 Ga0207639_11003546
1238 Ga0207678_10023957
1239 Ga0207708_10084403
1240 Ga0207702_10287239
1241 Ga0207702_11405502
1242 Ga0207648_10593464
1243 Ga0207648_11062861
1244 Ga0207676_10095761
1245 Ga0207674_10047522
1246 Ga0207674_10053348
1247 Ga0207675_100015848
1248 Ga0207683_10081725
1249 Ga0207698_11737540
1250 Ga0268265_10046996
1251 Ga0265336_10020488
1252 Ga0265338_10008234
1253 Ga0265338_10008494
1254 Ga0265338_10021432
1255 Ga0265766_1002005
1256 Ga0373948_0137758
1257 Ga0373959_0005334
1258 Ga0373959_0012553
1259 Ga0373926_0001134
1260 Ga0373926_0022191
1261 Ga0373926_0213358
1262 Ga0373928_0002714
1263 Ga0373928_0014128
1264 Ga0373929_0003272
1265 Ga0373934_0000108
1266 Ga0373934_0020538
1267 Ga0373934_0021345
1268 Ga0373934_0035538
1269 Ga0373934_0109152
1270 Ga0373940_0006912
1271 Ga0373944_0000289
1272 Ga0373944_0020473
1273 Ga0373944_0043043
1274 Ga0373949_0020209
1275 Ga0373951_0006227
1276 Ga0373923_0000440
1277 Ga0373923_0023245
1278 Ga0373923_0040398
1279 Ga0373923_0044162
1280 Ga0373923_0217492
1281 Ga0373923_0421501
1282 Ga0373932_0025734
1283 Ga0373932_0208589
1284 Ga0373936_0004054
1285 Ga0373936_0006186
1286 Ga0373936_0013551
1287 Ga0373936_0093632
1288 Ga0373936_0114683
1289 Ga0373936_0204478
1290 Ga0373939_0020543
1291 Ga0373941_0006307
1292 Ga0373941_0019064
1293 Ga0373945_0003403
1294 Ga0373945_0019675
1295 Ga0373945_0116666
1296 Ga0373945_0203655
1297 Ga0373953_0000094
1298 Ga0373953_0003722
1299 Ga0373953_0014394
1300 Ga0373953_0029168
1301 Ga0373953_0087560
1302 Ga0373953_0196437
1303 Ga0373953_0283446
1304 Ga0373954_0016687
1305 Ga0373954_0017488
1306 Ga0373954_0049604
1307 Ga0373954_0098627
1308 Ga0373954_0106472
1309 Ga0373954_0171828
1310 Ga0373956_0001194
1311 Ga0373956_0023529
1312 Ga0373956_0046033
1313 Ga0373956_0150377
1314 Ga0373956_0250119
1315 Ga0373956_0343764
1316 Ga0373957_0000166
1317 Ga0373957_0017096
1318 Ga0373957_0017140
1319 Ga0373957_0107957
1320 Ga0373957_0153974
1321 Ga0373960_0005964
1322 Ga0373943_0010430
1323 Ga0373943_0040749
1324 Ga0373943_0370413
1325 Ga0373943_0457081
1326 Ga0373946_0000253
1327 Ga0373946_0000665
1328 Ga0373946_0034420
1329 Ga0373946_0171485
1330 Ga0373946_0390712
1331 Ga0373955_0000112
1332 Ga0373955_0016168
1333 Ga0373955_0073552
1334 Ga0373955_0143500
1335 Ga0373955_0434387
1336 Ga0373942_0013081
1337 Ga0373924_0000211
1338 Ga0373924_0002044
1339 Ga0373924_0007597
1340 Ga0373924_0036499
1341 Ga0373924_0077318
1342 Ga0373924_0300603
1343 Ga0373931_0025020
1344 Ga0373931_0276157
1345 Ga0373931_0575561
1346 Ga0373931_0688548
1347 Ga0373935_0000970
1348 Ga0373935_0058068
1349 Ga0373935_0069952
1350 Ga0373935_0090302
1351 Ga0373935_0095707
1352 Ga0373935_0152168
1353 Ga0373935_0191624
1354 Ga0373935_0321116
1355 Ga0373935_0327448
1356 Ga0373927_0003427
1357 Ga0373927_0008071
1358 Ga0373927_0051612
1359 Ga0373927_0085403
1360 Ga0373927_0093124
1361 Ga0373933_0000022
1362 Ga0373933_0009952
1363 Ga0373933_0010723
1364 Ga0373933_0043371
1365 Ga0373933_0070150
1366 Ga0373933_0081382
1367 Ga0373947_0000006
1368 Ga0373947_0001275
1369 Ga0373947_0045741
1370 Ga0373947_0116824
1371 Ga0373947_0379888
1372 Ga0373947_0528399
1373 Ga0373937_0000022
1374 Ga0373937_0008926
1375 Ga0373937_0088587
1376 Ga0373937_0145162
1377 Ga0373937_0206487
1378 Ga0373937_0302222
1379 Ga0373937_0362013
1380 Ga0373937_0473550
1381 Ga0373925_0006452
1382 Ga0373925_0035770
1383 Ga0373925_0056010
1384 Ga0373925_0082951
1385 Ga0373925_0145471
1386 Ga0373925_0187850
1387 Ga0373925_0373403
1388 Ga0373925_0465282
1389 Ga0436364_0022748
1390 Ga0436364_0165105
1391 Ga0436364_0287557
1392 Ga0436364_0403534
1393 Ga0436364_0813504
1394 Ga0436364_1104976
1395 Ga0436364_1260325
1396 Ga0436364_1433707
1397 Ga0436364_1482361
1398 Ga0436365_0833348
1399 Ga0436365_1762478
1400 Ga0436361_1213485
1401 Ga0436363_0137663
1402 Ga0436363_0257475
1403 Ga0436363_0836105
1404 Ga0436363_0902303
1405 Ga0436363_0909159
1406 Ga0436363_1480634
1407 Ga0436362_0338528
1408 Ga0436362_0368392
1409 Ga0436362_0372337
1410 Ga0436362_1015235
1411 Ga0466961_0363668
1412 Ga0466963_0052060
1413 Ga0466963_0176417
1414 Ga0466957_0462353
1415 Ga0466959_0124676
1416 Ga0466959_0268297
1417 Ga0466958_0387961
1418 Ga0466967_0014807
1419 Ga0466967_0552920
1420 Ga0495592_0000025
1421 Ga0495592_0019709
1422 Ga0495592_0026425
1423 Ga0495592_0110047
1424 Ga0495592_0345222
1425 Ga0495603_0005042
1426 Ga0495603_0024547
1427 Ga0495603_0189154
1428 Ga0495629_0002510
1429 Ga0495629_0061255
1430 Ga0495629_0128252
1431 Ga0495629_0160381
1432 Ga0495641_0012813
1433 Ga0495641_0046460
1434 Ga0495641_0050822
1435 Ga0495641_0286358
1436 Ga0495651_0000014
1437 Ga0495651_0021944
1438 Ga0495651_0023468
1439 Ga0495651_0028505
1440 Ga0495651_0042434
1441 Ga0495651_0068436
1442 Ga0495651_0789444
1443 Ga0495653_0014717
1444 Ga0495653_0016957
1445 Ga0495653_0034894
1446 Ga0495653_0043271
1447 Ga0495653_0046178
1448 Ga0495653_0048688
1449 Ga0495653_0078687
1450 Ga0495653_0146406
1451 Ga0495653_0624010
1452 Ga0495582_0002650
1453 Ga0495582_0018083
1454 Ga0495582_0045935
1455 Ga0495582_0111332
1456 Ga0495639_0018940
1457 Ga0495639_0058975
1458 Ga0495639_0236162
1459 Ga0495662_0000415
1460 Ga0495662_0005659
1461 Ga0495662_0020737
1462 Ga0495662_0027014
1463 Ga0495662_0048126
1464 Ga0495662_0186174
1465 Ga0495664_0008128
1466 Ga0495664_0013731
1467 Ga0495664_0083295
1468 Ga0495664_0370480
1469 Ga0495664_0370683
1470 Ga0495594_0019264
1471 Ga0495594_0047095
1472 Ga0495608_0000190
1473 Ga0495608_0026053
1474 Ga0495608_0027392
1475 Ga0495608_0028031
1476 Ga0495608_0138993
1477 Ga0495608_0229821
1478 Ga0495608_0262667
1479 Ga0495608_0270416
1480 Ga0495608_0312620
1481 Ga0495618_0033244
1482 Ga0495618_0036751
1483 Ga0495618_0058982
1484 Ga0495618_0062188
1485 Ga0495618_0069649
1486 Ga0495618_0079625
1487 Ga0495618_0116698
1488 Ga0495618_0130493
1489 Ga0495618_0296849
1490 Ga0495618_0510701
1491 Ga0495628_0000346
1492 Ga0495628_0034457
1493 Ga0495628_0051400
1494 Ga0495628_0057318
1495 Ga0495628_0096929
1496 Ga0495628_0148892
1497 Ga0495628_0246247
1498 Ga0495630_0015459
1499 Ga0495630_0035134
1500 Ga0495630_0055015
1501 Ga0495630_0065777
1502 Ga0495630_1306325
1503 Ga0495666_0004933
1504 Ga0495666_0036493
1505 Ga0495652_0010242
1506 Ga0495652_0030510
1507 Ga0495652_0031518
1508 Ga0495652_0032332
1509 Ga0495652_0038016
1510 Ga0495652_0079199
1511 Ga0495652_0148146
1512 Ga0495652_0149262
1513 Ga0495652_0223967
1514 Ga0495652_0302171
1515 Ga0495665_0000524
1516 Ga0495665_0003902
1517 Ga0495665_0012150
1518 Ga0495665_0014274
1519 Ga0495665_0424162
1520 Ga0495640_0019543
1521 Ga0495640_0127799
1522 Ga0495640_0133265
1523 Ga0495640_0160262
1524 Ga0495640_0214779
1525 Ga0495640_0391904
1526 Ga0495586_0006410
1527 Ga0495586_0031390
1528 Ga0495587_0000029
1529 Ga0495587_0006950
1530 Ga0495587_0012669
1531 Ga0495587_0037890
1532 Ga0495587_0142002
1533 Ga0495587_0144565
1534 Ga0495645_0022525
1535 Ga0495645_0031600
1536 Ga0495645_0065440
1537 Ga0495645_0168598
1538 Ga0495645_0359905
1539 Ga0495645_0504041
1540 Ga0495667_0000036
1541 Ga0495667_0001443
1542 Ga0495667_0007912
1543 Ga0495667_0011226
1544 Ga0495667_0027589
1545 Ga0495667_0031427
1546 Ga0495667_0062785
1547 Ga0495667_0125890
1548 Ga0495667_0323559
1549 Ga0495634_0005049
1550 Ga0495634_0011657
1551 Ga0495634_0069302
1552 Ga0495634_0145533
1553 Ga0495635_0004586
1554 Ga0495635_0008790
1555 Ga0495635_0038965
1556 Ga0495635_0060878
1557 Ga0495635_0114341
1558 Ga0495635_0209544
1559 Ga0495635_0244086
1560 Ga0495635_0299941
1561 Ga0495588_0058930
1562 Ga0495657_0000071
1563 Ga0495657_0008636
1564 Ga0495657_0038498
1565 Ga0495657_0044277
1566 Ga0495657_0044387
1567 Ga0495657_0100342
1568 Ga0495657_0210672
1569 Ga0495657_0310114
1570 Ga0495599_0000094
1571 Ga0495599_0010549
1572 Ga0495599_0042454
1573 Ga0495599_0058963
1574 Ga0495599_0115031
1575 Ga0495599_0116985
1576 Ga0495599_0137792
1577 Ga0495599_0270372
1578 Ga0495599_0316810
1579 Ga0495623_0000113
1580 Ga0495623_0029194
1581 Ga0495623_0067661
1582 Ga0495623_0073363
1583 Ga0495623_0181232
1584 Ga0495646_0008387
1585 Ga0495646_0031995
1586 Ga0495646_0045764
1587 Ga0495646_0052418
1588 Ga0495646_0194436
1589 Ga0495646_0205946
1590 Ga0495647_0389773
1591 Ga0495658_0003156
1592 Ga0495658_0086281
1593 Ga0495658_0178053
1594 Ga0495613_0018727
1595 Ga0495613_0067359
1596 Ga0495613_0137841
1597 Ga0495613_0196613
1598 Ga0495613_0240966
1599 Ga0495624_0003337
1600 Ga0495624_0024311
1601 Ga0495624_0026797
1602 Ga0495600_0001986
1603 Ga0495600_0008730
1604 Ga0495600_0032324
1605 Ga0495600_0074984
1606 Ga0495600_0153438
1607 Ga0495600_0177626
1608 Ga0495600_0420422
1609 Ga0495581_0000903
1610 Ga0495581_0051859
1611 Ga0495581_0092484
1612 Ga0495581_0115715
1613 Ga0495581_0408805
1614 Ga0495604_0000044
1615 Ga0495604_0015746
1616 Ga0495604_0153870
1617 Ga0495604_0248216
1618 Ga0495604_0499174
1619 Ga0495604_0729922
1620 Ga0495674_0000044
1621 Ga0495674_0057081
1622 Ga0495674_0267428
1623 Ga0495674_0268119
1624 Ga0495674_0453327
1625 Ga0495674_0515277
1626 Ga0495676_0008527
1627 Ga0495676_0058852
1628 Ga0495676_0131456
1629 Ga0495676_0351362
1630 Ga0495680_0000219
1631 Ga0495680_0017665
1632 Ga0495680_0024774
1633 Ga0495680_0043101
1634 Ga0495680_0074258
1635 Ga0495680_0159531
1636 Ga0495675_0002157
1637 Ga0495675_0002458
1638 Ga0495675_0004181
1639 Ga0495675_0029798
1640 Ga0495675_0040598
1641 Ga0495675_0072339
1642 Ga0495684_0000962
1643 Ga0495684_0017761
1644 Ga0495684_0064779
1645 Ga0495684_0098357
1646 Ga0495593_0005556
1647 Ga0495593_0013529
1648 Ga0495593_0032474
1649 Ga0495593_0063625
1650 Ga0495593_0090808
1651 Ga0495602_0000480
1652 Ga0495602_0033666
1653 Ga0495602_0051492
1654 Ga0495602_0104978
1655 Ga0495602_0111495
1656 Ga0495602_0130961
1657 Ga0495602_0248377
1658 Ga0495602_0279468
1659 Ga0495602_0361202
1660 Ga0495602_0700402
1661 Ga0495614_0005646
1662 Ga0495614_0046486
1663 Ga0495614_0236617
1664 Ga0496101_0081580
1665 Ga0496102_0271430
1666 Ga0496103_0112067
1667 Ga0496104_0008559
1668 Ga0496104_0226081
1669 Ga0496105_0010843
1670 Ga0496105_0039664
1671 Ga0496105_0543062
1672 Ga0496106_0084617
1673 Ga0496108_0211820
1674 Ga0496108_0232166
1675 Ga0496108_0286318
1676 Ga0496109_0072290
1677 Ga0496109_0309743
1678 Ga0496110_0008342
1679 Ga0496110_0074600
1680 Ga0496111_0010415
1681 Ga0496111_0089111
1682 Ga0496112_0580649
1683 Ga0496113_0116354
1684 Ga0496113_1097658
1685 Ga0496114_0433192
1686 Ga0496115_0734967
1687 Ga0496126_0129579
1688 Ga0501042_0021172
1689 Ga0501047_0079622
1690 nmdc:mga05p37_17739_c1
1691 nmdc:mga05p37_405395_c1
1692 nmdc:mga08y16_519657_c1
1693 nmdc:mga0n895_112648_c1
1694 nmdc:mga0rr50_159719_c1
1695 nmdc:mga0rr50_203890_c1
1696 nmdc:mga0rr50_297027_c1
1697 nmdc:mga08x19_110520_c1
1698 nmdc:mga08x19_471501_c1
1699 nmdc:mga0a205_150886_c1
1700 nmdc:mga0a205_307715_c1
1701 nmdc:mga0a205_495943_c1
1702 Ga0495601_0002241
1703 Ga0495601_0009107
1704 Ga0495601_0031020
1705 Ga0495601_0167548
1706 Ga0495601_0212785
1707 Ga0495601_0425782
1708 Ga0495612_0017697
1709 Ga0495612_0082055
1710 Ga0495595_0002659
1711 Ga0495595_0007985
1712 Ga0495595_0038448
1713 Ga0495619_0005114
1714 Ga0495619_0018796
1715 Ga0495619_0065485
1716 Ga0495619_0205040
1717 Ga0587083_0040764
1718 Ga0587114_026681

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

144

0.81

PF18029

Glyoxalase_6

Glyoxalase-like domain

30

145

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.7882 5 123
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.7814 4 123
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7745 3 123
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.764 3 125
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.764 4 123
ID Description Score Start End Superfamily
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8497 6 129 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8338 4 131 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8159 4 131 3.10.180.10
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8028 97 123 2.40.50.140
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.801 9 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1P8YE59-F1-model_v4 Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein 0.9206 71 166 GO:0051213
AF-A0A7Y2A344-F1-model_v4 VOC family protein 0.9173 79 160
AF-A0A7Y2A344-F1-model_v4 VOC family protein 0.9064 79 160
AF-A0A536CZM3-F1-model_v4 VOC family protein 0.8939 11 152
AF-A0A3L7XDZ1-F1-model_v4 VOC family protein 0.8841 22 157

Map