F483778
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 270 | 1718 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300030963|Ga0265768_105053|Ga0265768_1050531 |
| Length | 189 |
| Sequence | MIPSDGGIARSVVGSAARSAEQMAVRRLNHAVLYVHGLDRTVDFYRTTLGFEVRLEIPGRAAFLRAPGSANDHDLGLFEIGTGRAPDRPAHPGLYHLAWEVGTLADLADARAKLAAAGALVGESDHRVSKSLYAKDPSGIEFEVLWRVPAEDWAAETADGDMILPLDLDAAIARWGQDQATGAAAGSPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 75 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 93 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 156 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.9 |
| Metatranscriptomes | 2.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 93.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265768_105053 | 3300030963 | Bacteria | 758 |
| 2 | Ga0070658_10115677 | 3300005327 | Bacteria | 2225 |
| 3 | Ga0070683_100046191 | 3300005329 | Bacteria | 4022 |
| 4 | Ga0070666_10321067 | 3300005335 | Bacteria | 1105 |
| 5 | Ga0070680_100917305 | 3300005336 | Bacteria | 756 |
| 6 | Ga0070682_100349255 | 3300005337 | Bacteria | 1102 |
| 7 | Ga0068868_100252694 | 3300005338 | Bacteria | 1484 |
| 8 | Ga0068868_100851766 | 3300005338 | Bacteria | 826 |
| 9 | Ga0070660_100029919 | 3300005339 | Bacteria | 4083 |
| 10 | Ga0070689_100061655 | 3300005340 | Bacteria | 2917 |
| 11 | Ga0070691_10012298 | 3300005341 | Bacteria | 3918 |
| 12 | Ga0070691_10067197 | 3300005341 | Bacteria | 1734 |
| 13 | Ga0070687_100026444 | 3300005343 | Bacteria | 2794 |
| 14 | Ga0070661_100031694 | 3300005344 | Bacteria | 3823 |
| 15 | Ga0070661_100986968 | 3300005344 | Bacteria | 698 |
| 16 | Ga0070688_100399629 | 3300005365 | Bacteria | 1017 |
| 17 | Ga0070659_100057640 | 3300005366 | Bacteria | 3063 |
| 18 | Ga0070709_10000127 | 3300005434 | Bacteria | 50350 |
| 19 | Ga0070709_10013588 | 3300005434 | Bacteria | 4582 |
| 20 | Ga0070709_10423202 | 3300005434 | Bacteria | 998 |
| 21 | Ga0070709_10465726 | 3300005434 | Bacteria | 954 |
| 22 | Ga0070709_10915592 | 3300005434 | Bacteria | 694 |
| 23 | Ga0070714_100000318 | 3300005435 | Bacteria | 36459 |
| 24 | Ga0070714_100000566 | 3300005435 | Bacteria | 26682 |
| 25 | Ga0070714_100000689 | 3300005435 | Bacteria | 23869 |
| 26 | Ga0070714_100002268 | 3300005435 | Bacteria | 14142 |
| 27 | Ga0070714_100264058 | 3300005435 | Bacteria | 1595 |
| 28 | Ga0070714_100899174 | 3300005435 | Bacteria | 860 |
| 29 | Ga0070714_101014004 | 3300005435 | Bacteria | 808 |
| 30 | Ga0070713_100002191 | 3300005436 | Bacteria | 12652 |
| 31 | Ga0070713_100002403 | 3300005436 | Bacteria | 12211 |
| 32 | Ga0070713_100037480 | 3300005436 | Bacteria | 3920 |
| 33 | Ga0070713_100092012 | 3300005436 | Bacteria | 2610 |
| 34 | Ga0070713_100111465 | 3300005436 | Bacteria | 2386 |
| 35 | Ga0070713_100151180 | 3300005436 | Bacteria | 2065 |
| 36 | Ga0070713_100389165 | 3300005436 | Bacteria | 1300 |
| 37 | Ga0070713_100955575 | 3300005436 | Bacteria | 825 |
| 38 | Ga0070710_10000177 | 3300005437 | Bacteria | 29266 |
| 39 | Ga0070710_10001432 | 3300005437 | Bacteria | 11267 |
| 40 | Ga0070710_10022781 | 3300005437 | Bacteria | 3282 |
| 41 | Ga0070710_10042888 | 3300005437 | Bacteria | 2503 |
| 42 | Ga0070710_10274564 | 3300005437 | Bacteria | 1091 |
| 43 | Ga0070710_10280696 | 3300005437 | Bacteria | 1081 |
| 44 | Ga0070701_10505582 | 3300005438 | Bacteria | 785 |
| 45 | Ga0070711_100000158 | 3300005439 | Bacteria | 36681 |
| 46 | Ga0070711_100003475 | 3300005439 | Bacteria | 9183 |
| 47 | Ga0070711_100121910 | 3300005439 | Bacteria | 1930 |
| 48 | Ga0070711_100137932 | 3300005439 | Bacteria | 1825 |
| 49 | Ga0070711_101487654 | 3300005439 | Bacteria | 590 |
| 50 | Ga0070705_100039731 | 3300005440 | Bacteria | 2671 |
| 51 | Ga0070694_100124287 | 3300005444 | Bacteria | 1855 |
| 52 | Ga0070708_100014131 | 3300005445 | Bacteria | 6563 |
| 53 | Ga0070708_100029185 | 3300005445 | Bacteria | 4755 |
| 54 | Ga0070708_100046036 | 3300005445 | Bacteria | 3847 |
| 55 | Ga0070708_100085571 | 3300005445 | Bacteria | 2862 |
| 56 | Ga0070708_100109248 | 3300005445 | Bacteria | 2540 |
| 57 | Ga0070708_100116285 | 3300005445 | Bacteria | 2462 |
| 58 | Ga0070708_100156662 | 3300005445 | Bacteria | 2121 |
| 59 | Ga0070708_100227048 | 3300005445 | Bacteria | 1752 |
| 60 | Ga0070708_100241795 | 3300005445 | Bacteria | 1695 |
| 61 | Ga0070708_100273305 | 3300005445 | Bacteria | 1590 |
| 62 | Ga0070708_100488058 | 3300005445 | Bacteria | 1162 |
| 63 | Ga0070663_100176013 | 3300005455 | Bacteria | 1657 |
| 64 | Ga0070662_100200609 | 3300005457 | Bacteria | 1583 |
| 65 | Ga0070681_10142805 | 3300005458 | Bacteria | 2323 |
| 66 | Ga0070681_11080798 | 3300005458 | Bacteria | 723 |
| 67 | Ga0068867_100501773 | 3300005459 | Bacteria | 1043 |
| 68 | Ga0070706_100002062 | 3300005467 | Bacteria | 20535 |
| 69 | Ga0070706_100003701 | 3300005467 | Bacteria | 14955 |
| 70 | Ga0070706_100006498 | 3300005467 | Bacteria | 11035 |
| 71 | Ga0070706_100007197 | 3300005467 | Bacteria | 10459 |
| 72 | Ga0070706_100015978 | 3300005467 | Bacteria | 6933 |
| 73 | Ga0070706_100024755 | 3300005467 | Bacteria | 5526 |
| 74 | Ga0070706_100028667 | 3300005467 | Bacteria | 5127 |
| 75 | Ga0070706_100061551 | 3300005467 | Bacteria | 3466 |
| 76 | Ga0070706_100092964 | 3300005467 | Bacteria | 2798 |
| 77 | Ga0070706_100151273 | 3300005467 | Bacteria | 2166 |
| 78 | Ga0070706_100151534 | 3300005467 | Bacteria | 2164 |
| 79 | Ga0070706_100276238 | 3300005467 | Bacteria | 1568 |
| 80 | Ga0070706_100638232 | 3300005467 | Bacteria | 989 |
| 81 | Ga0070707_100001992 | 3300005468 | Bacteria | 19545 |
| 82 | Ga0070707_100002252 | 3300005468 | Bacteria | 18404 |
| 83 | Ga0070707_100004968 | 3300005468 | Bacteria | 12460 |
| 84 | Ga0070707_100005544 | 3300005468 | Bacteria | 11792 |
| 85 | Ga0070707_100007290 | 3300005468 | Bacteria | 10269 |
| 86 | Ga0070707_100013838 | 3300005468 | Bacteria | 7555 |
| 87 | Ga0070707_100023182 | 3300005468 | Bacteria | 5872 |
| 88 | Ga0070707_100025462 | 3300005468 | Bacteria | 5613 |
| 89 | Ga0070707_100053299 | 3300005468 | Bacteria | 3878 |
| 90 | Ga0070707_100118012 | 3300005468 | Bacteria | 2575 |
| 91 | Ga0070707_100130794 | 3300005468 | Bacteria | 2441 |
| 92 | Ga0070707_100147526 | 3300005468 | Bacteria | 2289 |
| 93 | Ga0070707_100251380 | 3300005468 | Bacteria | 1720 |
| 94 | Ga0070707_100256143 | 3300005468 | Bacteria | 1703 |
| 95 | Ga0070707_100610766 | 3300005468 | Bacteria | 1053 |
| 96 | Ga0070707_100684032 | 3300005468 | Bacteria | 989 |
| 97 | Ga0070698_100000028 | 3300005471 | Bacteria | 98040 |
| 98 | Ga0070698_100001318 | 3300005471 | Bacteria | 27643 |
| 99 | Ga0070698_100004118 | 3300005471 | Bacteria | 15985 |
| 100 | Ga0070698_100017228 | 3300005471 | Bacteria | 7612 |
| 101 | Ga0070698_100048162 | 3300005471 | Bacteria | 4355 |
| 102 | Ga0070698_100052447 | 3300005471 | Bacteria | 4149 |
| 103 | Ga0070698_100064245 | 3300005471 | Bacteria | 3698 |
| 104 | Ga0070698_100072345 | 3300005471 | Bacteria | 3456 |
| 105 | Ga0070698_100085243 | 3300005471 | Bacteria | 3146 |
| 106 | Ga0070698_100131464 | 3300005471 | Bacteria | 2458 |
| 107 | Ga0070698_100450299 | 3300005471 | Bacteria | 1223 |
| 108 | Ga0070698_100537777 | 3300005471 | Bacteria | 1107 |
| 109 | Ga0070698_100707470 | 3300005471 | Bacteria | 950 |
| 110 | Ga0070698_101051495 | 3300005471 | Bacteria | 762 |
| 111 | Ga0070698_101108604 | 3300005471 | Bacteria | 740 |
| 112 | Ga0070699_100005167 | 3300005518 | Bacteria | 11480 |
| 113 | Ga0070699_100126974 | 3300005518 | Bacteria | 2246 |
| 114 | Ga0070699_100188209 | 3300005518 | Bacteria | 1833 |
| 115 | Ga0070699_100228496 | 3300005518 | Bacteria | 1659 |
| 116 | Ga0070679_100029643 | 3300005530 | Bacteria | 5398 |
| 117 | Ga0070697_100002042 | 3300005536 | Bacteria | 15467 |
| 118 | Ga0070697_100121430 | 3300005536 | Bacteria | 2186 |
| 119 | Ga0070697_100292246 | 3300005536 | Bacteria | 1400 |
| 120 | Ga0070697_100640465 | 3300005536 | Bacteria | 936 |
| 121 | Ga0068853_100181550 | 3300005539 | Bacteria | 1908 |
| 122 | Ga0070686_100067274 | 3300005544 | Bacteria | 2333 |
| 123 | Ga0070696_100070625 | 3300005546 | Bacteria | 2457 |
| 124 | Ga0070693_100029706 | 3300005547 | Bacteria | 2983 |
| 125 | Ga0068855_100593544 | 3300005563 | Bacteria | 1195 |
| 126 | Ga0068855_101016728 | 3300005563 | Unclassified | 870 |
| 127 | Ga0070664_100049942 | 3300005564 | Bacteria | 3538 |
| 128 | Ga0068857_100494255 | 3300005577 | Bacteria | 1147 |
| 129 | Ga0068857_101975898 | 3300005577 | Bacteria | 572 |
| 130 | Ga0068854_100058858 | 3300005578 | Bacteria | 2775 |
| 131 | Ga0068856_100039845 | 3300005614 | Bacteria | 4613 |
| 132 | Ga0068856_100185635 | 3300005614 | Bacteria | 2093 |
| 133 | Ga0068856_100271265 | 3300005614 | Bacteria | 1712 |
| 134 | Ga0070702_100058569 | 3300005615 | Bacteria | 2232 |
| 135 | Ga0068852_100219060 | 3300005616 | Bacteria | 1809 |
| 136 | Ga0068859_100030304 | 3300005617 | Bacteria | 5428 |
| 137 | Ga0068859_100282990 | 3300005617 | Bacteria | 1751 |
| 138 | Ga0068864_100085848 | 3300005618 | Bacteria | 2768 |
| 139 | Ga0068864_100097455 | 3300005618 | Bacteria | 2603 |
| 140 | Ga0068864_100351693 | 3300005618 | Bacteria | 1390 |
| 141 | Ga0068863_100143487 | 3300005841 | Bacteria | 2283 |
| 142 | Ga0068858_100065730 | 3300005842 | Bacteria | 3356 |
| 143 | Ga0068858_100120587 | 3300005842 | Bacteria | 2452 |
| 144 | Ga0081540_1000216 | 3300005983 | Bacteria | 61035 |
| 145 | Ga0081540_1000960 | 3300005983 | Bacteria | 26024 |
| 146 | Ga0070717_10003861 | 3300006028 | Bacteria | 10776 |
| 147 | Ga0070717_10004122 | 3300006028 | Bacteria | 10477 |
| 148 | Ga0070717_10008107 | 3300006028 | Bacteria | 7836 |
| 149 | Ga0070717_10009432 | 3300006028 | Bacteria | 7334 |
| 150 | Ga0070717_10022198 | 3300006028 | Bacteria | 5014 |
| 151 | Ga0070717_10075374 | 3300006028 | Bacteria | 2822 |
| 152 | Ga0070717_10098100 | 3300006028 | Bacteria | 2483 |
| 153 | Ga0070717_10132644 | 3300006028 | Bacteria | 2143 |
| 154 | Ga0070717_10159909 | 3300006028 | Bacteria | 1953 |
| 155 | Ga0070717_10521892 | 3300006028 | Bacteria | 1074 |
| 156 | Ga0070717_11030664 | 3300006028 | Bacteria | 749 |
| 157 | Ga0070715_10032738 | 3300006163 | Bacteria | 2120 |
| 158 | Ga0070715_10042596 | 3300006163 | Bacteria | 1909 |
| 159 | Ga0070715_10093759 | 3300006163 | Bacteria | 1387 |
| 160 | Ga0070715_10189375 | 3300006163 | Bacteria | 1037 |
| 161 | Ga0070715_10288025 | 3300006163 | Bacteria | 874 |
| 162 | Ga0070716_100001172 | 3300006173 | Bacteria | 11550 |
| 163 | Ga0070716_100003016 | 3300006173 | Bacteria | 7853 |
| 164 | Ga0070716_100049433 | 3300006173 | Bacteria | 2382 |
| 165 | Ga0070716_100283914 | 3300006173 | Bacteria | 1143 |
| 166 | Ga0070712_100001943 | 3300006175 | Bacteria | 12660 |
| 167 | Ga0070712_100006067 | 3300006175 | Bacteria | 7481 |
| 168 | Ga0070712_100008832 | 3300006175 | Bacteria | 6345 |
| 169 | Ga0070712_100012663 | 3300006175 | Bacteria | 5369 |
| 170 | Ga0070712_100041588 | 3300006175 | Bacteria | 3156 |
| 171 | Ga0070712_100148281 | 3300006175 | Bacteria | 1798 |
| 172 | Ga0070712_100374659 | 3300006175 | Bacteria | 1170 |
| 173 | Ga0097621_100154910 | 3300006237 | Bacteria | 1966 |
| 174 | Ga0097621_100171431 | 3300006237 | Bacteria | 1871 |
| 175 | Ga0097621_100348972 | 3300006237 | Bacteria | 1316 |
| 176 | Ga0068871_100138867 | 3300006358 | Bacteria | 2065 |
| 177 | Ga0068871_100874859 | 3300006358 | Bacteria | 832 |
| 178 | Ga0075428_100721512 | 3300006844 | Bacteria | 1061 |
| 179 | Ga0075433_10115068 | 3300006852 | Bacteria | 2386 |
| 180 | Ga0075433_10291091 | 3300006852 | Bacteria | 1446 |
| 181 | Ga0075433_10330213 | 3300006852 | Bacteria | 1349 |
| 182 | Ga0075434_100084234 | 3300006871 | Bacteria | 3178 |
| 183 | Ga0075434_100658828 | 3300006871 | Bacteria | 1065 |
| 184 | Ga0075434_101012586 | 3300006871 | Bacteria | 845 |
| 185 | Ga0075436_100010622 | 3300006914 | Bacteria | 6315 |
| 186 | Ga0075436_100044827 | 3300006914 | Bacteria | 3051 |
| 187 | Ga0097620_100030304 | 3300006931 | Bacteria | 5428 |
| 188 | Ga0097620_100282976 | 3300006931 | Bacteria | 1751 |
| 189 | Ga0075435_100002113 | 3300007076 | Bacteria | 13073 |
| 190 | Ga0075435_100078981 | 3300007076 | Bacteria | 2699 |
| 191 | Ga0075435_100102297 | 3300007076 | Bacteria | 2375 |
| 192 | Ga0075435_100102313 | 3300007076 | Bacteria | 2374 |
| 193 | Ga0075435_100102785 | 3300007076 | Bacteria | 2369 |
| 194 | Ga0075435_100306850 | 3300007076 | Bacteria | 1358 |
| 195 | Ga0099794_10059797 | 3300007265 | Bacteria | 1849 |
| 196 | Ga0099794_10087098 | 3300007265 | Bacteria | 1547 |
| 197 | Ga0105240_10342987 | 3300009093 | Bacteria | 1696 |
| 198 | Ga0105240_10585422 | 3300009093 | Bacteria | 1230 |
| 199 | Ga0111539_10138806 | 3300009094 | Bacteria | 2847 |
| 200 | Ga0105245_10014529 | 3300009098 | Bacteria | 6856 |
| 201 | Ga0105245_10342681 | 3300009098 | Bacteria | 1478 |
| 202 | Ga0105245_11238556 | 3300009098 | Bacteria | 794 |
| 203 | Ga0105247_10022237 | 3300009101 | Bacteria | 3818 |
| 204 | Ga0114129_10274852 | 3300009147 | Bacteria | 2253 |
| 205 | Ga0114129_10571211 | 3300009147 | Bacteria | 1468 |
| 206 | Ga0105243_10032414 | 3300009148 | Bacteria | 4037 |
| 207 | Ga0105243_11381782 | 3300009148 | Bacteria | 724 |
| 208 | Ga0105241_10051803 | 3300009174 | Bacteria | 3132 |
| 209 | Ga0105241_11113588 | 3300009174 | Bacteria | 744 |
| 210 | Ga0105242_10375128 | 3300009176 | Bacteria | 1321 |
| 211 | Ga0105237_10837231 | 3300009545 | Bacteria | 927 |
| 212 | Ga0105249_10077682 | 3300009553 | Bacteria | 3079 |
| 213 | Ga0099796_10023530 | 3300010159 | Bacteria | 1924 |
| 214 | Ga0157320_1000850 | 3300012481 | Bacteria | 1380 |
| 215 | Ga0157341_1000456 | 3300012494 | Bacteria | 2067 |
| 216 | Ga0157371_10026824 | 3300013102 | Bacteria | 4184 |
| 217 | Ga0157370_10060734 | 3300013104 | Bacteria | 3588 |
| 218 | Ga0157370_10299282 | 3300013104 | Bacteria | 1485 |
| 219 | Ga0157369_11155758 | 3300013105 | Bacteria | 791 |
| 220 | Ga0157374_10098756 | 3300013296 | Bacteria | 2796 |
| 221 | Ga0157374_10437311 | 3300013296 | Bacteria | 1308 |
| 222 | Ga0157378_10347221 | 3300013297 | Bacteria | 1449 |
| 223 | Ga0163162_10565459 | 3300013306 | Bacteria | 1264 |
| 224 | Ga0157372_10302117 | 3300013307 | Bacteria | 1862 |
| 225 | Ga0157372_10648207 | 3300013307 | Bacteria | 1230 |
| 226 | Ga0157372_10921636 | 3300013307 | Bacteria | 1013 |
| 227 | Ga0157375_10067111 | 3300013308 | Bacteria | 3584 |
| 228 | Ga0157375_10073819 | 3300013308 | Bacteria | 3431 |
| 229 | Ga0163163_10009527 | 3300014325 | Bacteria | 8676 |
| 230 | Ga0163163_10345919 | 3300014325 | Bacteria | 1543 |
| 231 | Ga0157380_10375827 | 3300014326 | Bacteria | 1339 |
| 232 | Ga0182008_10208313 | 3300014497 | Bacteria | 997 |
| 233 | Ga0157377_10030606 | 3300014745 | Bacteria | 2917 |
| 234 | Ga0157379_10009369 | 3300014968 | Bacteria | 8532 |
| 235 | Ga0157379_10805146 | 3300014968 | Bacteria | 887 |
| 236 | Ga0157376_10037222 | 3300014969 | Bacteria | 3947 |
| 237 | Ga0157376_10070067 | 3300014969 | Bacteria | 2975 |
| 238 | Ga0197907_10921524 | 3300020069 | Bacteria | 1653 |
| 239 | Ga0206349_1072023 | 3300020075 | Bacteria | 906 |
| 240 | Ga0206355_1690273 | 3300020076 | Bacteria | 968 |
| 241 | Ga0206351_10298566 | 3300020077 | Bacteria | 650 |
| 242 | Ga0206350_10877957 | 3300020080 | Bacteria | 828 |
| 243 | Ga0206354_11457378 | 3300020081 | Bacteria | 752 |
| 244 | Ga0206353_11539891 | 3300020082 | Bacteria | 925 |
| 245 | Ga0206353_11593526 | 3300020082 | Bacteria | 1862 |
| 246 | Ga0206353_11844072 | 3300020082 | Bacteria | 926 |
| 247 | Ga0206353_11942878 | 3300020082 | Bacteria | 1008 |
| 248 | Ga0213874_10029482 | 3300021377 | Bacteria | 1575 |
| 249 | Ga0213874_10215634 | 3300021377 | Bacteria | 696 |
| 250 | Ga0213874_10270273 | 3300021377 | Bacteria | 632 |
| 251 | Ga0213876_10122247 | 3300021384 | Bacteria | 1383 |
| 252 | Ga0213876_10363613 | 3300021384 | Bacteria | 770 |
| 253 | Ga0213875_10001317 | 3300021388 | Bacteria | 16413 |
| 254 | Ga0213875_10003914 | 3300021388 | Bacteria | 8327 |
| 255 | Ga0213875_10018906 | 3300021388 | Bacteria | 3317 |
| 256 | Ga0213875_10032302 | 3300021388 | Bacteria | 2474 |
| 257 | Ga0213875_10049770 | 3300021388 | Bacteria | 1964 |
| 258 | Ga0213875_10169187 | 3300021388 | Bacteria | 1026 |
| 259 | Ga0224712_10036107 | 3300022467 | Bacteria | 1829 |
| 260 | Ga0224712_10057094 | 3300022467 | Bacteria | 1541 |
| 261 | Ga0224712_10117158 | 3300022467 | Bacteria | 1149 |
| 262 | Ga0224712_10190020 | 3300022467 | Bacteria | 929 |
| 263 | Ga0224572_1019308 | 3300024225 | Bacteria | 1310 |
| 264 | Ga0207653_10011575 | 3300025885 | Bacteria | 2752 |
| 265 | Ga0207692_10000088 | 3300025898 | Bacteria | 26975 |
| 266 | Ga0207692_10010349 | 3300025898 | Bacteria | 3928 |
| 267 | Ga0207692_10018761 | 3300025898 | Bacteria | 3111 |
| 268 | Ga0207692_10086833 | 3300025898 | Bacteria | 1687 |
| 269 | Ga0207692_10153381 | 3300025898 | Bacteria | 1321 |
| 270 | Ga0207642_10121710 | 3300025899 | Bacteria | 1347 |
| 271 | Ga0207688_10021100 | 3300025901 | Bacteria | 3557 |
| 272 | Ga0207647_10192433 | 3300025904 | Bacteria | 1182 |
| 273 | Ga0207685_10018343 | 3300025905 | Bacteria | 2283 |
| 274 | Ga0207685_10044138 | 3300025905 | Bacteria | 1683 |
| 275 | Ga0207685_10074321 | 3300025905 | Bacteria | 1387 |
| 276 | Ga0207699_10000608 | 3300025906 | Bacteria | 17514 |
| 277 | Ga0207699_10001553 | 3300025906 | Bacteria | 10877 |
| 278 | Ga0207699_10008170 | 3300025906 | Bacteria | 5151 |
| 279 | Ga0207699_10330973 | 3300025906 | Bacteria | 1071 |
| 280 | Ga0207699_10423768 | 3300025906 | Bacteria | 951 |
| 281 | Ga0207699_10518035 | 3300025906 | Bacteria | 862 |
| 282 | Ga0207705_10747752 | 3300025909 | Bacteria | 760 |
| 283 | Ga0207684_10000479 | 3300025910 | Bacteria | 51757 |
| 284 | Ga0207684_10000798 | 3300025910 | Bacteria | 36416 |
| 285 | Ga0207684_10023256 | 3300025910 | Bacteria | 5292 |
| 286 | Ga0207684_10030469 | 3300025910 | Bacteria | 4591 |
| 287 | Ga0207684_10034426 | 3300025910 | Bacteria | 4304 |
| 288 | Ga0207684_10079128 | 3300025910 | Bacteria | 2796 |
| 289 | Ga0207684_10088491 | 3300025910 | Bacteria | 2638 |
| 290 | Ga0207684_10158744 | 3300025910 | Bacteria | 1947 |
| 291 | Ga0207684_10171674 | 3300025910 | Bacteria | 1869 |
| 292 | Ga0207684_10238222 | 3300025910 | Bacteria | 1570 |
| 293 | Ga0207684_10296461 | 3300025910 | Bacteria | 1394 |
| 294 | Ga0207684_10586056 | 3300025910 | Bacteria | 953 |
| 295 | Ga0207684_10808410 | 3300025910 | Bacteria | 792 |
| 296 | Ga0207654_10024927 | 3300025911 | Bacteria | 3221 |
| 297 | Ga0207707_10811636 | 3300025912 | Bacteria | 779 |
| 298 | Ga0207695_10119018 | 3300025913 | Bacteria | 2612 |
| 299 | Ga0207693_10000436 | 3300025915 | Bacteria | 38097 |
| 300 | Ga0207693_10009331 | 3300025915 | Bacteria | 8000 |
| 301 | Ga0207693_10013696 | 3300025915 | Bacteria | 6533 |
| 302 | Ga0207693_10022682 | 3300025915 | Bacteria | 4987 |
| 303 | Ga0207693_10099467 | 3300025915 | Bacteria | 2280 |
| 304 | Ga0207693_10099695 | 3300025915 | Bacteria | 2278 |
| 305 | Ga0207693_11031191 | 3300025915 | Bacteria | 627 |
| 306 | Ga0207663_10000615 | 3300025916 | Bacteria | 15819 |
| 307 | Ga0207663_10006544 | 3300025916 | Bacteria | 5975 |
| 308 | Ga0207663_10007709 | 3300025916 | Bacteria | 5601 |
| 309 | Ga0207663_10045564 | 3300025916 | Bacteria | 2698 |
| 310 | Ga0207663_10091058 | 3300025916 | Bacteria | 2024 |
| 311 | Ga0207663_10174144 | 3300025916 | Bacteria | 1531 |
| 312 | Ga0207663_10279184 | 3300025916 | Bacteria | 1240 |
| 313 | Ga0207663_10615918 | 3300025916 | Bacteria | 854 |
| 314 | Ga0207660_10344693 | 3300025917 | Bacteria | 1193 |
| 315 | Ga0207662_10057778 | 3300025918 | Bacteria | 2320 |
| 316 | Ga0207657_10009348 | 3300025919 | Bacteria | 9867 |
| 317 | Ga0207652_10268387 | 3300025921 | Bacteria | 1539 |
| 318 | Ga0207652_10425421 | 3300025921 | Bacteria | 1198 |
| 319 | Ga0207646_10000193 | 3300025922 | Bacteria | 83049 |
| 320 | Ga0207646_10000987 | 3300025922 | Bacteria | 36541 |
| 321 | Ga0207646_10001795 | 3300025922 | Bacteria | 25949 |
| 322 | Ga0207646_10009242 | 3300025922 | Bacteria | 9763 |
| 323 | Ga0207646_10021993 | 3300025922 | Bacteria | 5883 |
| 324 | Ga0207646_10046087 | 3300025922 | Bacteria | 3913 |
| 325 | Ga0207646_10089975 | 3300025922 | Bacteria | 2748 |
| 326 | Ga0207646_10100670 | 3300025922 | Bacteria | 2590 |
| 327 | Ga0207646_10149150 | 3300025922 | Bacteria | 2108 |
| 328 | Ga0207646_10523198 | 3300025922 | Bacteria | 1068 |
| 329 | Ga0207646_10904055 | 3300025922 | Bacteria | 783 |
| 330 | Ga0207694_11427832 | 3300025924 | Bacteria | 585 |
| 331 | Ga0207659_10235298 | 3300025926 | Bacteria | 1479 |
| 332 | Ga0207687_10211785 | 3300025927 | Bacteria | 1521 |
| 333 | Ga0207687_11588107 | 3300025927 | Bacteria | 561 |
| 334 | Ga0207700_10000029 | 3300025928 | Bacteria | 132615 |
| 335 | Ga0207700_10010957 | 3300025928 | Bacteria | 5756 |
| 336 | Ga0207700_10050230 | 3300025928 | Bacteria | 3107 |
| 337 | Ga0207700_10092689 | 3300025928 | Bacteria | 2389 |
| 338 | Ga0207700_10114026 | 3300025928 | Bacteria | 2180 |
| 339 | Ga0207700_10115778 | 3300025928 | Bacteria | 2165 |
| 340 | Ga0207700_10185144 | 3300025928 | Bacteria | 1746 |
| 341 | Ga0207700_10264001 | 3300025928 | Bacteria | 1475 |
| 342 | Ga0207700_10270120 | 3300025928 | Bacteria | 1459 |
| 343 | Ga0207664_10000110 | 3300025929 | Bacteria | 72637 |
| 344 | Ga0207664_10002802 | 3300025929 | Bacteria | 11579 |
| 345 | Ga0207664_10004783 | 3300025929 | Bacteria | 9201 |
| 346 | Ga0207664_10041698 | 3300025929 | Bacteria | 3577 |
| 347 | Ga0207664_10092959 | 3300025929 | Bacteria | 2476 |
| 348 | Ga0207664_10096587 | 3300025929 | Bacteria | 2432 |
| 349 | Ga0207664_10121036 | 3300025929 | Bacteria | 2190 |
| 350 | Ga0207664_10124191 | 3300025929 | Bacteria | 2165 |
| 351 | Ga0207664_10295199 | 3300025929 | Bacteria | 1425 |
| 352 | Ga0207664_10318716 | 3300025929 | Bacteria | 1371 |
| 353 | Ga0207664_11114696 | 3300025929 | Bacteria | 705 |
| 354 | Ga0207644_10169885 | 3300025931 | Bacteria | 1701 |
| 355 | Ga0207706_10021844 | 3300025933 | Bacteria | 5744 |
| 356 | Ga0207670_10180395 | 3300025936 | Bacteria | 1590 |
| 357 | Ga0207665_10000144 | 3300025939 | Bacteria | 48077 |
| 358 | Ga0207665_10000371 | 3300025939 | Bacteria | 31095 |
| 359 | Ga0207665_10012857 | 3300025939 | Bacteria | 5505 |
| 360 | Ga0207665_10046612 | 3300025939 | Bacteria | 2904 |
| 361 | Ga0207665_10102307 | 3300025939 | Bacteria | 2002 |
| 362 | Ga0207665_10170815 | 3300025939 | Bacteria | 1570 |
| 363 | Ga0207665_10286005 | 3300025939 | Bacteria | 1228 |
| 364 | Ga0207691_10153945 | 3300025940 | Bacteria | 2020 |
| 365 | Ga0207711_10444844 | 3300025941 | Bacteria | 1206 |
| 366 | Ga0207689_10008458 | 3300025942 | Bacteria | 8963 |
| 367 | Ga0207661_10380764 | 3300025944 | Bacteria | 1277 |
| 368 | Ga0207679_10216486 | 3300025945 | Bacteria | 1609 |
| 369 | Ga0207679_10421957 | 3300025945 | Bacteria | 1177 |
| 370 | Ga0207679_10815401 | 3300025945 | Bacteria | 851 |
| 371 | Ga0207667_10287954 | 3300025949 | Bacteria | 1678 |
| 372 | Ga0207667_10685135 | 3300025949 | Bacteria | 1028 |
| 373 | Ga0207712_10639271 | 3300025961 | Bacteria | 924 |
| 374 | Ga0207640_10105079 | 3300025981 | Bacteria | 1989 |
| 375 | Ga0207677_10033217 | 3300026023 | Bacteria | 3326 |
| 376 | Ga0207677_10067136 | 3300026023 | Bacteria | 2511 |
| 377 | Ga0207677_10703732 | 3300026023 | Bacteria | 897 |
| 378 | Ga0207639_11003546 | 3300026041 | Bacteria | 782 |
| 379 | Ga0207678_10023957 | 3300026067 | Bacteria | 5337 |
| 380 | Ga0207708_10084403 | 3300026075 | Bacteria | 2442 |
| 381 | Ga0207702_10287239 | 3300026078 | Bacteria | 1557 |
| 382 | Ga0207702_11405502 | 3300026078 | Unclassified | 692 |
| 383 | Ga0207648_10593464 | 3300026089 | Bacteria | 1020 |
| 384 | Ga0207648_11062861 | 3300026089 | Bacteria | 759 |
| 385 | Ga0207676_10095761 | 3300026095 | Bacteria | 2448 |
| 386 | Ga0207674_10047522 | 3300026116 | Bacteria | 4398 |
| 387 | Ga0207674_10053348 | 3300026116 | Bacteria | 4122 |
| 388 | Ga0207675_100015848 | 3300026118 | Bacteria | 7029 |
| 389 | Ga0207683_10081725 | 3300026121 | Bacteria | 2868 |
| 390 | Ga0207698_11737540 | 3300026142 | Bacteria | 639 |
| 391 | Ga0268265_10046996 | 3300028380 | Bacteria | 3231 |
| 392 | Ga0265336_10020488 | 3300028666 | Bacteria | 2121 |
| 393 | Ga0265338_10008234 | 3300028800 | Bacteria | 12700 |
| 394 | Ga0265338_10008494 | 3300028800 | Bacteria | 12457 |
| 395 | Ga0265338_10021432 | 3300028800 | Bacteria | 6738 |
| 396 | Ga0265766_1002005 | 3300030863 | Bacteria | 1093 |
| 397 | Ga0373948_0137758 | 3300034817 | Bacteria | 602 |
| 398 | Ga0373959_0005334 | 3300034820 | Bacteria | 2105 |
| 399 | Ga0373959_0012553 | 3300034820 | Bacteria | 1515 |
| 400 | Ga0373926_0001134 | 3300035083 | Bacteria | 7918 |
| 401 | Ga0373926_0022191 | 3300035083 | Bacteria | 2202 |
| 402 | Ga0373926_0213358 | 3300035083 | Bacteria | 744 |
| 403 | Ga0373928_0002714 | 3300035084 | Bacteria | 3423 |
| 404 | Ga0373928_0014128 | 3300035084 | Bacteria | 1611 |
| 405 | Ga0373929_0003272 | 3300035085 | Bacteria | 2930 |
| 406 | Ga0373934_0000108 | 3300035086 | Bacteria | 29499 |
| 407 | Ga0373934_0020538 | 3300035086 | Bacteria | 2538 |
| 408 | Ga0373934_0021345 | 3300035086 | Bacteria | 2493 |
| 409 | Ga0373934_0035538 | 3300035086 | Bacteria | 1960 |
| 410 | Ga0373934_0109152 | 3300035086 | Bacteria | 1121 |
| 411 | Ga0373940_0006912 | 3300035088 | Bacteria | 2542 |
| 412 | Ga0373944_0000289 | 3300035089 | Bacteria | 11174 |
| 413 | Ga0373944_0020473 | 3300035089 | Bacteria | 1906 |
| 414 | Ga0373944_0043043 | 3300035089 | Bacteria | 1402 |
| 415 | Ga0373949_0020209 | 3300035090 | Bacteria | 1522 |
| 416 | Ga0373951_0006227 | 3300035091 | Bacteria | 2733 |
| 417 | Ga0373923_0000440 | 3300035111 | Bacteria | 9801 |
| 418 | Ga0373923_0023245 | 3300035111 | Bacteria | 2437 |
| 419 | Ga0373923_0040398 | 3300035111 | Bacteria | 1920 |
| 420 | Ga0373923_0044162 | 3300035111 | Bacteria | 1846 |
| 421 | Ga0373923_0217492 | 3300035111 | Bacteria | 887 |
| 422 | Ga0373923_0421501 | 3300035111 | Bacteria | 644 |
| 423 | Ga0373932_0025734 | 3300035112 | Bacteria | 1595 |
| 424 | Ga0373932_0208589 | 3300035112 | Bacteria | 697 |
| 425 | Ga0373936_0004054 | 3300035113 | Bacteria | 5519 |
| 426 | Ga0373936_0006186 | 3300035113 | Bacteria | 4512 |
| 427 | Ga0373936_0013551 | 3300035113 | Bacteria | 3112 |
| 428 | Ga0373936_0093632 | 3300035113 | Bacteria | 1262 |
| 429 | Ga0373936_0114683 | 3300035113 | Bacteria | 1146 |
| 430 | Ga0373936_0204478 | 3300035113 | Bacteria | 872 |
| 431 | Ga0373939_0020543 | 3300035114 | Bacteria | 1795 |
| 432 | Ga0373941_0006307 | 3300035115 | Bacteria | 2849 |
| 433 | Ga0373941_0019064 | 3300035115 | Bacteria | 1904 |
| 434 | Ga0373945_0003403 | 3300035116 | Bacteria | 5002 |
| 435 | Ga0373945_0019675 | 3300035116 | Bacteria | 2306 |
| 436 | Ga0373945_0116666 | 3300035116 | Bacteria | 1058 |
| 437 | Ga0373945_0203655 | 3300035116 | Bacteria | 822 |
| 438 | Ga0373953_0000094 | 3300035117 | Bacteria | 21383 |
| 439 | Ga0373953_0003722 | 3300035117 | Bacteria | 4786 |
| 440 | Ga0373953_0014394 | 3300035117 | Bacteria | 2844 |
| 441 | Ga0373953_0029168 | 3300035117 | Bacteria | 2132 |
| 442 | Ga0373953_0087560 | 3300035117 | Bacteria | 1300 |
| 443 | Ga0373953_0196437 | 3300035117 | Bacteria | 872 |
| 444 | Ga0373953_0283446 | 3300035117 | Unclassified | 722 |
| 445 | Ga0373954_0016687 | 3300035118 | Bacteria | 3290 |
| 446 | Ga0373954_0017488 | 3300035118 | Bacteria | 3221 |
| 447 | Ga0373954_0049604 | 3300035118 | Bacteria | 1968 |
| 448 | Ga0373954_0098627 | 3300035118 | Bacteria | 1408 |
| 449 | Ga0373954_0106472 | 3300035118 | Bacteria | 1355 |
| 450 | Ga0373954_0171828 | 3300035118 | Bacteria | 1061 |
| 451 | Ga0373956_0001194 | 3300035119 | Bacteria | 10735 |
| 452 | Ga0373956_0023529 | 3300035119 | Bacteria | 2645 |
| 453 | Ga0373956_0046033 | 3300035119 | Bacteria | 1947 |
| 454 | Ga0373956_0150377 | 3300035119 | Bacteria | 1095 |
| 455 | Ga0373956_0250119 | 3300035119 | Bacteria | 843 |
| 456 | Ga0373956_0343764 | 3300035119 | Unclassified | 711 |
| 457 | Ga0373957_0000166 | 3300035120 | Bacteria | 16937 |
| 458 | Ga0373957_0017096 | 3300035120 | Bacteria | 2520 |
| 459 | Ga0373957_0017140 | 3300035120 | Bacteria | 2517 |
| 460 | Ga0373957_0107957 | 3300035120 | Bacteria | 1119 |
| 461 | Ga0373957_0153974 | 3300035120 | Bacteria | 944 |
| 462 | Ga0373960_0005964 | 3300035121 | Bacteria | 2840 |
| 463 | Ga0373943_0010430 | 3300035170 | Bacteria | 4162 |
| 464 | Ga0373943_0040749 | 3300035170 | Bacteria | 2243 |
| 465 | Ga0373943_0370413 | 3300035170 | Bacteria | 823 |
| 466 | Ga0373943_0457081 | 3300035170 | Bacteria | 742 |
| 467 | Ga0373946_0000253 | 3300035171 | Bacteria | 16969 |
| 468 | Ga0373946_0000665 | 3300035171 | Bacteria | 11525 |
| 469 | Ga0373946_0034420 | 3300035171 | Bacteria | 2045 |
| 470 | Ga0373946_0171485 | 3300035171 | Bacteria | 1024 |
| 471 | Ga0373946_0390712 | 3300035171 | Bacteria | 701 |
| 472 | Ga0373955_0000112 | 3300035172 | Bacteria | 32757 |
| 473 | Ga0373955_0016168 | 3300035172 | Bacteria | 3668 |
| 474 | Ga0373955_0073552 | 3300035172 | Bacteria | 1916 |
| 475 | Ga0373955_0143500 | 3300035172 | Bacteria | 1401 |
| 476 | Ga0373955_0434387 | 3300035172 | Bacteria | 799 |
| 477 | Ga0373942_0013081 | 3300035207 | Bacteria | 1990 |
| 478 | Ga0373924_0000211 | 3300035410 | Bacteria | 17761 |
| 479 | Ga0373924_0002044 | 3300035410 | Bacteria | 6726 |
| 480 | Ga0373924_0007597 | 3300035410 | Bacteria | 3917 |
| 481 | Ga0373924_0036499 | 3300035410 | Bacteria | 1997 |
| 482 | Ga0373924_0077318 | 3300035410 | Bacteria | 1411 |
| 483 | Ga0373924_0300603 | 3300035410 | Bacteria | 713 |
| 484 | Ga0373931_0025020 | 3300035691 | Bacteria | 3030 |
| 485 | Ga0373931_0276157 | 3300035691 | Bacteria | 1030 |
| 486 | Ga0373931_0575561 | 3300035691 | Bacteria | 734 |
| 487 | Ga0373931_0688548 | 3300035691 | Bacteria | 674 |
| 488 | Ga0373935_0000970 | 3300035692 | Bacteria | 15551 |
| 489 | Ga0373935_0058068 | 3300035692 | Bacteria | 2470 |
| 490 | Ga0373935_0069952 | 3300035692 | Bacteria | 2262 |
| 491 | Ga0373935_0090302 | 3300035692 | Bacteria | 2005 |
| 492 | Ga0373935_0095707 | 3300035692 | Bacteria | 1950 |
| 493 | Ga0373935_0152168 | 3300035692 | Bacteria | 1571 |
| 494 | Ga0373935_0191624 | 3300035692 | Bacteria | 1408 |
| 495 | Ga0373935_0321116 | 3300035692 | Bacteria | 1099 |
| 496 | Ga0373935_0327448 | 3300035692 | Bacteria | 1088 |
| 497 | Ga0373927_0003427 | 3300035695 | Bacteria | 11371 |
| 498 | Ga0373927_0008071 | 3300035695 | Bacteria | 7107 |
| 499 | Ga0373927_0051612 | 3300035695 | Bacteria | 2659 |
| 500 | Ga0373927_0085403 | 3300035695 | Bacteria | 2048 |
| 501 | Ga0373927_0093124 | 3300035695 | Bacteria | 1957 |
| 502 | Ga0373933_0000022 | 3300035724 | Bacteria | 94582 |
| 503 | Ga0373933_0009952 | 3300035724 | Bacteria | 5204 |
| 504 | Ga0373933_0010723 | 3300035724 | Bacteria | 5027 |
| 505 | Ga0373933_0043371 | 3300035724 | Bacteria | 2661 |
| 506 | Ga0373933_0070150 | 3300035724 | Bacteria | 2131 |
| 507 | Ga0373933_0081382 | 3300035724 | Bacteria | 1986 |
| 508 | Ga0373947_0000006 | 3300035725 | Bacteria | 223611 |
| 509 | Ga0373947_0001275 | 3300035725 | Bacteria | 15526 |
| 510 | Ga0373947_0045741 | 3300035725 | Bacteria | 2619 |
| 511 | Ga0373947_0116824 | 3300035725 | Bacteria | 1692 |
| 512 | Ga0373947_0379888 | 3300035725 | Bacteria | 951 |
| 513 | Ga0373947_0528399 | 3300035725 | Bacteria | 802 |
| 514 | Ga0373937_0000022 | 3300036401 | Bacteria | 127537 |
| 515 | Ga0373937_0008926 | 3300036401 | Bacteria | 8704 |
| 516 | Ga0373937_0088587 | 3300036401 | Bacteria | 2865 |
| 517 | Ga0373937_0145162 | 3300036401 | Bacteria | 2221 |
| 518 | Ga0373937_0206487 | 3300036401 | Bacteria | 1847 |
| 519 | Ga0373937_0302222 | 3300036401 | Bacteria | 1512 |
| 520 | Ga0373937_0362013 | 3300036401 | Bacteria | 1374 |
| 521 | Ga0373937_0473550 | 3300036401 | Bacteria | 1189 |
| 522 | Ga0373925_0006452 | 3300037068 | Bacteria | 8629 |
| 523 | Ga0373925_0035770 | 3300037068 | Bacteria | 3666 |
| 524 | Ga0373925_0056010 | 3300037068 | Bacteria | 2952 |
| 525 | Ga0373925_0082951 | 3300037068 | Bacteria | 2440 |
| 526 | Ga0373925_0145471 | 3300037068 | Bacteria | 1858 |
| 527 | Ga0373925_0187850 | 3300037068 | Bacteria | 1638 |
| 528 | Ga0373925_0373403 | 3300037068 | Bacteria | 1160 |
| 529 | Ga0373925_0465282 | 3300037068 | Bacteria | 1036 |
| 530 | Ga0436364_0022748 | 3300037853 | Bacteria | 2210 |
| 531 | Ga0436364_0165105 | 3300037853 | Bacteria | 5758 |
| 532 | Ga0436364_0287557 | 3300037853 | Bacteria | 2574 |
| 533 | Ga0436364_0403534 | 3300037853 | Bacteria | 17431 |
| 534 | Ga0436364_0813504 | 3300037853 | Bacteria | 1505 |
| 535 | Ga0436364_1104976 | 3300037853 | Bacteria | 23337 |
| 536 | Ga0436364_1260325 | 3300037853 | Bacteria | 730 |
| 537 | Ga0436364_1433707 | 3300037853 | Bacteria | 1118 |
| 538 | Ga0436364_1482361 | 3300037853 | Bacteria | 4786 |
| 539 | Ga0436365_0833348 | 3300039437 | Bacteria | 1532 |
| 540 | Ga0436365_1762478 | 3300039437 | Bacteria | 1097 |
| 541 | Ga0436361_1213485 | 3300039447 | Bacteria | 917 |
| 542 | Ga0436363_0137663 | 3300039450 | Bacteria | 963 |
| 543 | Ga0436363_0257475 | 3300039450 | Bacteria | 580 |
| 544 | Ga0436363_0836105 | 3300039450 | Bacteria | 756 |
| 545 | Ga0436363_0902303 | 3300039450 | Bacteria | 3476 |
| 546 | Ga0436363_0909159 | 3300039450 | Bacteria | 630 |
| 547 | Ga0436363_1480634 | 3300039450 | Bacteria | 654 |
| 548 | Ga0436362_0338528 | 3300039453 | Bacteria | 2813 |
| 549 | Ga0436362_0368392 | 3300039453 | Bacteria | 679 |
| 550 | Ga0436362_0372337 | 3300039453 | Bacteria | 586 |
| 551 | Ga0436362_1015235 | 3300039453 | Bacteria | 923 |
| 552 | Ga0466961_0363668 | 3300044693 | Bacteria | 880 |
| 553 | Ga0466963_0052060 | 3300044694 | Bacteria | 2716 |
| 554 | Ga0466963_0176417 | 3300044694 | Bacteria | 1491 |
| 555 | Ga0466957_0462353 | 3300044842 | Bacteria | 876 |
| 556 | Ga0466959_0124676 | 3300045049 | Bacteria | 1829 |
| 557 | Ga0466959_0268297 | 3300045049 | Bacteria | 1174 |
| 558 | Ga0466958_0387961 | 3300045836 | Bacteria | 901 |
| 559 | Ga0466967_0014807 | 3300045976 | Bacteria | 6092 |
| 560 | Ga0466967_0552920 | 3300045976 | Bacteria | 1133 |
| 561 | Ga0495592_0000025 | 3300046454 | Bacteria | 136324 |
| 562 | Ga0495592_0019709 | 3300046454 | Bacteria | 5130 |
| 563 | Ga0495592_0026425 | 3300046454 | Bacteria | 4401 |
| 564 | Ga0495592_0110047 | 3300046454 | Bacteria | 1950 |
| 565 | Ga0495592_0345222 | 3300046454 | Bacteria | 956 |
| 566 | Ga0495603_0005042 | 3300046455 | Bacteria | 7895 |
| 567 | Ga0495603_0024547 | 3300046455 | Bacteria | 3646 |
| 568 | Ga0495603_0189154 | 3300046455 | Bacteria | 1190 |
| 569 | Ga0495629_0002510 | 3300046459 | Bacteria | 14082 |
| 570 | Ga0495629_0061255 | 3300046459 | Bacteria | 2629 |
| 571 | Ga0495629_0128252 | 3300046459 | Bacteria | 1767 |
| 572 | Ga0495629_0160381 | 3300046459 | Bacteria | 1562 |
| 573 | Ga0495641_0012813 | 3300046461 | Bacteria | 4655 |
| 574 | Ga0495641_0046460 | 3300046461 | Bacteria | 1996 |
| 575 | Ga0495641_0050822 | 3300046461 | Bacteria | 1894 |
| 576 | Ga0495641_0286358 | 3300046461 | Bacteria | 742 |
| 577 | Ga0495651_0000014 | 3300046462 | Bacteria | 136312 |
| 578 | Ga0495651_0021944 | 3300046462 | Bacteria | 4965 |
| 579 | Ga0495651_0023468 | 3300046462 | Bacteria | 4795 |
| 580 | Ga0495651_0028505 | 3300046462 | Bacteria | 4350 |
| 581 | Ga0495651_0042434 | 3300046462 | Bacteria | 3531 |
| 582 | Ga0495651_0068436 | 3300046462 | Bacteria | 2706 |
| 583 | Ga0495651_0789444 | 3300046462 | Bacteria | 586 |
| 584 | Ga0495653_0014717 | 3300046463 | Bacteria | 6381 |
| 585 | Ga0495653_0016957 | 3300046463 | Bacteria | 5924 |
| 586 | Ga0495653_0034894 | 3300046463 | Bacteria | 3972 |
| 587 | Ga0495653_0043271 | 3300046463 | Bacteria | 3502 |
| 588 | Ga0495653_0046178 | 3300046463 | Bacteria | 3373 |
| 589 | Ga0495653_0048688 | 3300046463 | Bacteria | 3270 |
| 590 | Ga0495653_0078687 | 3300046463 | Bacteria | 2444 |
| 591 | Ga0495653_0146406 | 3300046463 | Bacteria | 1654 |
| 592 | Ga0495653_0624010 | 3300046463 | Bacteria | 660 |
| 593 | Ga0495582_0002650 | 3300046473 | Bacteria | 9981 |
| 594 | Ga0495582_0018083 | 3300046473 | Bacteria | 3855 |
| 595 | Ga0495582_0045935 | 3300046473 | Bacteria | 2405 |
| 596 | Ga0495582_0111332 | 3300046473 | Bacteria | 1538 |
| 597 | Ga0495639_0018940 | 3300046475 | Bacteria | 3001 |
| 598 | Ga0495639_0058975 | 3300046475 | Bacteria | 1756 |
| 599 | Ga0495639_0236162 | 3300046475 | Bacteria | 901 |
| 600 | Ga0495662_0000415 | 3300046476 | Bacteria | 19153 |
| 601 | Ga0495662_0005659 | 3300046476 | Bacteria | 6247 |
| 602 | Ga0495662_0020737 | 3300046476 | Bacteria | 3179 |
| 603 | Ga0495662_0027014 | 3300046476 | Bacteria | 2773 |
| 604 | Ga0495662_0048126 | 3300046476 | Bacteria | 2058 |
| 605 | Ga0495662_0186174 | 3300046476 | Bacteria | 1023 |
| 606 | Ga0495664_0008128 | 3300046477 | Bacteria | 5843 |
| 607 | Ga0495664_0013731 | 3300046477 | Bacteria | 4591 |
| 608 | Ga0495664_0083295 | 3300046477 | Bacteria | 1919 |
| 609 | Ga0495664_0370480 | 3300046477 | Bacteria | 861 |
| 610 | Ga0495664_0370683 | 3300046477 | Bacteria | 861 |
| 611 | Ga0495594_0019264 | 3300046499 | Bacteria | 3625 |
| 612 | Ga0495594_0047095 | 3300046499 | Bacteria | 2368 |
| 613 | Ga0495608_0000190 | 3300046511 | Bacteria | 43597 |
| 614 | Ga0495608_0026053 | 3300046511 | Bacteria | 3990 |
| 615 | Ga0495608_0027392 | 3300046511 | Bacteria | 3877 |
| 616 | Ga0495608_0028031 | 3300046511 | Bacteria | 3828 |
| 617 | Ga0495608_0138993 | 3300046511 | Bacteria | 1551 |
| 618 | Ga0495608_0229821 | 3300046511 | Bacteria | 1161 |
| 619 | Ga0495608_0262667 | 3300046511 | Bacteria | 1074 |
| 620 | Ga0495608_0270416 | 3300046511 | Bacteria | 1057 |
| 621 | Ga0495608_0312620 | 3300046511 | Bacteria | 971 |
| 622 | Ga0495618_0033244 | 3300046514 | Bacteria | 3233 |
| 623 | Ga0495618_0036751 | 3300046514 | Bacteria | 3074 |
| 624 | Ga0495618_0058982 | 3300046514 | Bacteria | 2431 |
| 625 | Ga0495618_0062188 | 3300046514 | Bacteria | 2368 |
| 626 | Ga0495618_0069649 | 3300046514 | Bacteria | 2236 |
| 627 | Ga0495618_0079625 | 3300046514 | Bacteria | 2090 |
| 628 | Ga0495618_0116698 | 3300046514 | Bacteria | 1709 |
| 629 | Ga0495618_0130493 | 3300046514 | Bacteria | 1608 |
| 630 | Ga0495618_0296849 | 3300046514 | Bacteria | 1004 |
| 631 | Ga0495618_0510701 | 3300046514 | Bacteria | 723 |
| 632 | Ga0495628_0000346 | 3300046516 | Bacteria | 42250 |
| 633 | Ga0495628_0034457 | 3300046516 | Bacteria | 4071 |
| 634 | Ga0495628_0051400 | 3300046516 | Bacteria | 3258 |
| 635 | Ga0495628_0057318 | 3300046516 | Bacteria | 3064 |
| 636 | Ga0495628_0096929 | 3300046516 | Bacteria | 2278 |
| 637 | Ga0495628_0148892 | 3300046516 | Bacteria | 1783 |
| 638 | Ga0495628_0246247 | 3300046516 | Bacteria | 1336 |
| 639 | Ga0495630_0015459 | 3300046517 | Bacteria | 5572 |
| 640 | Ga0495630_0035134 | 3300046517 | Bacteria | 3745 |
| 641 | Ga0495630_0055015 | 3300046517 | Bacteria | 2981 |
| 642 | Ga0495630_0065777 | 3300046517 | Bacteria | 2724 |
| 643 | Ga0495630_1306325 | 3300046517 | Bacteria | 547 |
| 644 | Ga0495666_0004933 | 3300046526 | Bacteria | 6757 |
| 645 | Ga0495666_0036493 | 3300046526 | Bacteria | 2394 |
| 646 | Ga0495652_0010242 | 3300046529 | Bacteria | 8500 |
| 647 | Ga0495652_0030510 | 3300046529 | Bacteria | 4727 |
| 648 | Ga0495652_0031518 | 3300046529 | Bacteria | 4642 |
| 649 | Ga0495652_0032332 | 3300046529 | Bacteria | 4576 |
| 650 | Ga0495652_0038016 | 3300046529 | Bacteria | 4172 |
| 651 | Ga0495652_0079199 | 3300046529 | Bacteria | 2717 |
| 652 | Ga0495652_0148146 | 3300046529 | Bacteria | 1837 |
| 653 | Ga0495652_0149262 | 3300046529 | Bacteria | 1828 |
| 654 | Ga0495652_0223967 | 3300046529 | Bacteria | 1411 |
| 655 | Ga0495652_0302171 | 3300046529 | Bacteria | 1163 |
| 656 | Ga0495665_0000524 | 3300046531 | Bacteria | 19423 |
| 657 | Ga0495665_0003902 | 3300046531 | Bacteria | 8070 |
| 658 | Ga0495665_0012150 | 3300046531 | Bacteria | 4662 |
| 659 | Ga0495665_0014274 | 3300046531 | Bacteria | 4285 |
| 660 | Ga0495665_0424162 | 3300046531 | Bacteria | 673 |
| 661 | Ga0495640_0019543 | 3300046533 | Bacteria | 4998 |
| 662 | Ga0495640_0127799 | 3300046533 | Bacteria | 1647 |
| 663 | Ga0495640_0133265 | 3300046533 | Bacteria | 1606 |
| 664 | Ga0495640_0160262 | 3300046533 | Bacteria | 1442 |
| 665 | Ga0495640_0214779 | 3300046533 | Bacteria | 1215 |
| 666 | Ga0495640_0391904 | 3300046533 | Bacteria | 853 |
| 667 | Ga0495586_0006410 | 3300046535 | Bacteria | 6286 |
| 668 | Ga0495586_0031390 | 3300046535 | Bacteria | 2845 |
| 669 | Ga0495587_0000029 | 3300046536 | Bacteria | 136321 |
| 670 | Ga0495587_0006950 | 3300046536 | Bacteria | 7350 |
| 671 | Ga0495587_0012669 | 3300046536 | Bacteria | 5303 |
| 672 | Ga0495587_0037890 | 3300046536 | Bacteria | 2892 |
| 673 | Ga0495587_0142002 | 3300046536 | Bacteria | 1370 |
| 674 | Ga0495587_0144565 | 3300046536 | Bacteria | 1356 |
| 675 | Ga0495645_0022525 | 3300046543 | Bacteria | 4558 |
| 676 | Ga0495645_0031600 | 3300046543 | Bacteria | 3858 |
| 677 | Ga0495645_0065440 | 3300046543 | Bacteria | 2629 |
| 678 | Ga0495645_0168598 | 3300046543 | Bacteria | 1508 |
| 679 | Ga0495645_0359905 | 3300046543 | Bacteria | 935 |
| 680 | Ga0495645_0504041 | 3300046543 | Bacteria | 756 |
| 681 | Ga0495667_0000036 | 3300046559 | Bacteria | 136146 |
| 682 | Ga0495667_0001443 | 3300046559 | Bacteria | 15660 |
| 683 | Ga0495667_0007912 | 3300046559 | Bacteria | 7207 |
| 684 | Ga0495667_0011226 | 3300046559 | Bacteria | 6067 |
| 685 | Ga0495667_0027589 | 3300046559 | Bacteria | 3824 |
| 686 | Ga0495667_0031427 | 3300046559 | Bacteria | 3564 |
| 687 | Ga0495667_0062785 | 3300046559 | Bacteria | 2433 |
| 688 | Ga0495667_0125890 | 3300046559 | Bacteria | 1653 |
| 689 | Ga0495667_0323559 | 3300046559 | Bacteria | 976 |
| 690 | Ga0495634_0005049 | 3300046642 | Bacteria | 10190 |
| 691 | Ga0495634_0011657 | 3300046642 | Bacteria | 6394 |
| 692 | Ga0495634_0069302 | 3300046642 | Bacteria | 2327 |
| 693 | Ga0495634_0145533 | 3300046642 | Bacteria | 1501 |
| 694 | Ga0495635_0004586 | 3300046663 | Bacteria | 9583 |
| 695 | Ga0495635_0008790 | 3300046663 | Bacteria | 7053 |
| 696 | Ga0495635_0038965 | 3300046663 | Bacteria | 3290 |
| 697 | Ga0495635_0060878 | 3300046663 | Bacteria | 2593 |
| 698 | Ga0495635_0114341 | 3300046663 | Bacteria | 1842 |
| 699 | Ga0495635_0209544 | 3300046663 | Bacteria | 1320 |
| 700 | Ga0495635_0244086 | 3300046663 | Bacteria | 1211 |
| 701 | Ga0495635_0299941 | 3300046663 | Bacteria | 1077 |
| 702 | Ga0495588_0058930 | 3300046674 | Bacteria | 1985 |
| 703 | Ga0495657_0000071 | 3300046675 | Bacteria | 92182 |
| 704 | Ga0495657_0008636 | 3300046675 | Bacteria | 7776 |
| 705 | Ga0495657_0038498 | 3300046675 | Bacteria | 3290 |
| 706 | Ga0495657_0044277 | 3300046675 | Bacteria | 3028 |
| 707 | Ga0495657_0044387 | 3300046675 | Bacteria | 3023 |
| 708 | Ga0495657_0100342 | 3300046675 | Bacteria | 1845 |
| 709 | Ga0495657_0210672 | 3300046675 | Bacteria | 1181 |
| 710 | Ga0495657_0310114 | 3300046675 | Bacteria | 939 |
| 711 | Ga0495599_0000094 | 3300046678 | Bacteria | 62648 |
| 712 | Ga0495599_0010549 | 3300046678 | Bacteria | 5652 |
| 713 | Ga0495599_0042454 | 3300046678 | Bacteria | 2853 |
| 714 | Ga0495599_0058963 | 3300046678 | Bacteria | 2401 |
| 715 | Ga0495599_0115031 | 3300046678 | Bacteria | 1674 |
| 716 | Ga0495599_0116985 | 3300046678 | Bacteria | 1658 |
| 717 | Ga0495599_0137792 | 3300046678 | Bacteria | 1514 |
| 718 | Ga0495599_0270372 | 3300046678 | Bacteria | 1031 |
| 719 | Ga0495599_0316810 | 3300046678 | Bacteria | 939 |
| 720 | Ga0495623_0000113 | 3300046679 | Bacteria | 49223 |
| 721 | Ga0495623_0029194 | 3300046679 | Bacteria | 3549 |
| 722 | Ga0495623_0067661 | 3300046679 | Bacteria | 2229 |
| 723 | Ga0495623_0073363 | 3300046679 | Bacteria | 2127 |
| 724 | Ga0495623_0181232 | 3300046679 | Bacteria | 1223 |
| 725 | Ga0495646_0008387 | 3300046680 | Bacteria | 6569 |
| 726 | Ga0495646_0031995 | 3300046680 | Bacteria | 3275 |
| 727 | Ga0495646_0045764 | 3300046680 | Bacteria | 2670 |
| 728 | Ga0495646_0052418 | 3300046680 | Bacteria | 2464 |
| 729 | Ga0495646_0194436 | 3300046680 | Bacteria | 1107 |
| 730 | Ga0495646_0205946 | 3300046680 | Bacteria | 1069 |
| 731 | Ga0495647_0389773 | 3300046681 | Bacteria | 638 |
| 732 | Ga0495658_0003156 | 3300046683 | Bacteria | 8214 |
| 733 | Ga0495658_0086281 | 3300046683 | Bacteria | 1851 |
| 734 | Ga0495658_0178053 | 3300046683 | Bacteria | 1318 |
| 735 | Ga0495613_0018727 | 3300046689 | Bacteria | 5163 |
| 736 | Ga0495613_0067359 | 3300046689 | Bacteria | 2613 |
| 737 | Ga0495613_0137841 | 3300046689 | Bacteria | 1745 |
| 738 | Ga0495613_0196613 | 3300046689 | Bacteria | 1423 |
| 739 | Ga0495613_0240966 | 3300046689 | Bacteria | 1264 |
| 740 | Ga0495624_0003337 | 3300046690 | Bacteria | 11932 |
| 741 | Ga0495624_0024311 | 3300046690 | Bacteria | 3987 |
| 742 | Ga0495624_0026797 | 3300046690 | Bacteria | 3776 |
| 743 | Ga0495600_0001986 | 3300046809 | Bacteria | 11495 |
| 744 | Ga0495600_0008730 | 3300046809 | Bacteria | 6234 |
| 745 | Ga0495600_0032324 | 3300046809 | Bacteria | 3394 |
| 746 | Ga0495600_0074984 | 3300046809 | Bacteria | 2209 |
| 747 | Ga0495600_0153438 | 3300046809 | Bacteria | 1490 |
| 748 | Ga0495600_0177626 | 3300046809 | Bacteria | 1372 |
| 749 | Ga0495600_0420422 | 3300046809 | Unclassified | 829 |
| 750 | Ga0495581_0000903 | 3300047315 | Bacteria | 15917 |
| 751 | Ga0495581_0051859 | 3300047315 | Bacteria | 2369 |
| 752 | Ga0495581_0092484 | 3300047315 | Bacteria | 1756 |
| 753 | Ga0495581_0115715 | 3300047315 | Bacteria | 1559 |
| 754 | Ga0495581_0408805 | 3300047315 | Bacteria | 791 |
| 755 | Ga0495604_0000044 | 3300047317 | Bacteria | 112937 |
| 756 | Ga0495604_0015746 | 3300047317 | Bacteria | 6035 |
| 757 | Ga0495604_0153870 | 3300047317 | Bacteria | 1631 |
| 758 | Ga0495604_0248216 | 3300047317 | Bacteria | 1214 |
| 759 | Ga0495604_0499174 | 3300047317 | Bacteria | 790 |
| 760 | Ga0495604_0729922 | 3300047317 | Bacteria | 627 |
| 761 | Ga0495674_0000044 | 3300047319 | Bacteria | 84651 |
| 762 | Ga0495674_0057081 | 3300047319 | Bacteria | 3417 |
| 763 | Ga0495674_0267428 | 3300047319 | Bacteria | 1404 |
| 764 | Ga0495674_0268119 | 3300047319 | Bacteria | 1401 |
| 765 | Ga0495674_0453327 | 3300047319 | Bacteria | 1030 |
| 766 | Ga0495674_0515277 | 3300047319 | Bacteria | 955 |
| 767 | Ga0495676_0008527 | 3300047321 | Bacteria | 9393 |
| 768 | Ga0495676_0058852 | 3300047321 | Bacteria | 3021 |
| 769 | Ga0495676_0131456 | 3300047321 | Bacteria | 1806 |
| 770 | Ga0495676_0351362 | 3300047321 | Bacteria | 985 |
| 771 | Ga0495680_0000219 | 3300047322 | Bacteria | 62686 |
| 772 | Ga0495680_0017665 | 3300047322 | Bacteria | 6078 |
| 773 | Ga0495680_0024774 | 3300047322 | Bacteria | 4972 |
| 774 | Ga0495680_0043101 | 3300047322 | Bacteria | 3575 |
| 775 | Ga0495680_0074258 | 3300047322 | Bacteria | 2582 |
| 776 | Ga0495680_0159531 | 3300047322 | Bacteria | 1638 |
| 777 | Ga0495675_0002157 | 3300047444 | Bacteria | 11734 |
| 778 | Ga0495675_0002458 | 3300047444 | Bacteria | 11082 |
| 779 | Ga0495675_0004181 | 3300047444 | Bacteria | 8733 |
| 780 | Ga0495675_0029798 | 3300047444 | Bacteria | 3481 |
| 781 | Ga0495675_0040598 | 3300047444 | Bacteria | 2965 |
| 782 | Ga0495675_0072339 | 3300047444 | Bacteria | 2175 |
| 783 | Ga0495684_0000962 | 3300047471 | Bacteria | 23465 |
| 784 | Ga0495684_0017761 | 3300047471 | Bacteria | 5479 |
| 785 | Ga0495684_0064779 | 3300047471 | Bacteria | 2777 |
| 786 | Ga0495684_0098357 | 3300047471 | Bacteria | 2212 |
| 787 | Ga0495593_0005556 | 3300047673 | Bacteria | 7448 |
| 788 | Ga0495593_0013529 | 3300047673 | Bacteria | 4652 |
| 789 | Ga0495593_0032474 | 3300047673 | Bacteria | 2845 |
| 790 | Ga0495593_0063625 | 3300047673 | Bacteria | 1926 |
| 791 | Ga0495593_0090808 | 3300047673 | Bacteria | 1573 |
| 792 | Ga0495602_0000480 | 3300048088 | Bacteria | 36967 |
| 793 | Ga0495602_0033666 | 3300048088 | Bacteria | 4803 |
| 794 | Ga0495602_0051492 | 3300048088 | Bacteria | 3666 |
| 795 | Ga0495602_0104978 | 3300048088 | Bacteria | 2310 |
| 796 | Ga0495602_0111495 | 3300048088 | Bacteria | 2221 |
| 797 | Ga0495602_0130961 | 3300048088 | Bacteria | 2000 |
| 798 | Ga0495602_0248377 | 3300048088 | Bacteria | 1327 |
| 799 | Ga0495602_0279468 | 3300048088 | Bacteria | 1230 |
| 800 | Ga0495602_0361202 | 3300048088 | Bacteria | 1045 |
| 801 | Ga0495602_0700402 | 3300048088 | Bacteria | 687 |
| 802 | Ga0495614_0005646 | 3300048089 | Bacteria | 5641 |
| 803 | Ga0495614_0046486 | 3300048089 | Bacteria | 1861 |
| 804 | Ga0495614_0236617 | 3300048089 | Bacteria | 833 |
| 805 | Ga0496101_0081580 | 3300048904 | Bacteria | 2392 |
| 806 | Ga0496102_0271430 | 3300048905 | Bacteria | 1599 |
| 807 | Ga0496103_0112067 | 3300048906 | Bacteria | 1733 |
| 808 | Ga0496104_0008559 | 3300048907 | Bacteria | 9098 |
| 809 | Ga0496104_0226081 | 3300048907 | Bacteria | 1783 |
| 810 | Ga0496105_0010843 | 3300048908 | Bacteria | 7175 |
| 811 | Ga0496105_0039664 | 3300048908 | Bacteria | 3882 |
| 812 | Ga0496105_0543062 | 3300048908 | Bacteria | 908 |
| 813 | Ga0496106_0084617 | 3300048909 | Bacteria | 2440 |
| 814 | Ga0496108_0211820 | 3300048911 | Bacteria | 1682 |
| 815 | Ga0496108_0232166 | 3300048911 | Bacteria | 1604 |
| 816 | Ga0496108_0286318 | 3300048911 | Bacteria | 1434 |
| 817 | Ga0496109_0072290 | 3300048912 | Bacteria | 3168 |
| 818 | Ga0496109_0309743 | 3300048912 | Bacteria | 1489 |
| 819 | Ga0496110_0008342 | 3300048913 | Bacteria | 8335 |
| 820 | Ga0496110_0074600 | 3300048913 | Bacteria | 3013 |
| 821 | Ga0496111_0010415 | 3300048914 | Bacteria | 6239 |
| 822 | Ga0496111_0089111 | 3300048914 | Bacteria | 2259 |
| 823 | Ga0496112_0580649 | 3300048915 | Bacteria | 1053 |
| 824 | Ga0496113_0116354 | 3300048916 | Bacteria | 2086 |
| 825 | Ga0496113_1097658 | 3300048916 | Bacteria | 624 |
| 826 | Ga0496114_0433192 | 3300048917 | Bacteria | 1165 |
| 827 | Ga0496115_0734967 | 3300048918 | Bacteria | 773 |
| 828 | Ga0496126_0129579 | 3300048929 | Bacteria | 2181 |
| 829 | Ga0501042_0021172 | 3300049578 | Bacteria | 4528 |
| 830 | Ga0501047_0079622 | 3300049581 | Bacteria | 3150 |
| 831 | nmdc:mga05p37_17739_c1 | 3300050507 | Bacteria | 8590 |
| 832 | nmdc:mga05p37_405395_c1 | 3300050507 | Bacteria | 1591 |
| 833 | nmdc:mga08y16_519657_c1 | 3300050511 | Bacteria | 1207 |
| 834 | nmdc:mga0n895_112648_c1 | 3300050512 | Bacteria | 2737 |
| 835 | nmdc:mga0rr50_159719_c1 | 3300050513 | Bacteria | 1829 |
| 836 | nmdc:mga0rr50_203890_c1 | 3300050513 | Bacteria | 1627 |
| 837 | nmdc:mga0rr50_297027_c1 | 3300050513 | Bacteria | 1351 |
| 838 | nmdc:mga08x19_110520_c1 | 3300050514 | Bacteria | 1833 |
| 839 | nmdc:mga08x19_471501_c1 | 3300050514 | Bacteria | 884 |
| 840 | nmdc:mga0a205_150886_c1 | 3300050515 | Bacteria | 2224 |
| 841 | nmdc:mga0a205_307715_c1 | 3300050515 | Bacteria | 1457 |
| 842 | nmdc:mga0a205_495943_c1 | 3300050515 | Bacteria | 1078 |
| 843 | Ga0495601_0002241 | 3300053077 | Bacteria | 10897 |
| 844 | Ga0495601_0009107 | 3300053077 | Bacteria | 5862 |
| 845 | Ga0495601_0031020 | 3300053077 | Bacteria | 3321 |
| 846 | Ga0495601_0167548 | 3300053077 | Bacteria | 1435 |
| 847 | Ga0495601_0212785 | 3300053077 | Bacteria | 1263 |
| 848 | Ga0495601_0425782 | 3300053077 | Bacteria | 859 |
| 849 | Ga0495612_0017697 | 3300053078 | Bacteria | 2853 |
| 850 | Ga0495612_0082055 | 3300053078 | Bacteria | 1355 |
| 851 | Ga0495595_0002659 | 3300053084 | Bacteria | 7012 |
| 852 | Ga0495595_0007985 | 3300053084 | Bacteria | 4334 |
| 853 | Ga0495595_0038448 | 3300053084 | Bacteria | 2180 |
| 854 | Ga0495619_0005114 | 3300053085 | Bacteria | 8324 |
| 855 | Ga0495619_0018796 | 3300053085 | Bacteria | 4387 |
| 856 | Ga0495619_0065485 | 3300053085 | Bacteria | 2424 |
| 857 | Ga0495619_0205040 | 3300053085 | Bacteria | 1365 |
| 858 | Ga0587083_0040764 | 3300059505 | Bacteria | 971 |
| 859 | Ga0587114_026681 | 3300059655 | Bacteria | 856 |
| 860 | Ga0265768_105053 | |||
| 861 | Ga0070658_10115677 | |||
| 862 | Ga0070683_100046191 | |||
| 863 | Ga0070666_10321067 | |||
| 864 | Ga0070680_100917305 | |||
| 865 | Ga0070682_100349255 | |||
| 866 | Ga0068868_100252694 | |||
| 867 | Ga0068868_100851766 | |||
| 868 | Ga0070660_100029919 | |||
| 869 | Ga0070689_100061655 | |||
| 870 | Ga0070691_10012298 | |||
| 871 | Ga0070691_10067197 | |||
| 872 | Ga0070687_100026444 | |||
| 873 | Ga0070661_100031694 | |||
| 874 | Ga0070661_100986968 | |||
| 875 | Ga0070688_100399629 | |||
| 876 | Ga0070659_100057640 | |||
| 877 | Ga0070709_10000127 | |||
| 878 | Ga0070709_10013588 | |||
| 879 | Ga0070709_10423202 | |||
| 880 | Ga0070709_10465726 | |||
| 881 | Ga0070709_10915592 | |||
| 882 | Ga0070714_100000318 | |||
| 883 | Ga0070714_100000566 | |||
| 884 | Ga0070714_100000689 | |||
| 885 | Ga0070714_100002268 | |||
| 886 | Ga0070714_100264058 | |||
| 887 | Ga0070714_100899174 | |||
| 888 | Ga0070714_101014004 | |||
| 889 | Ga0070713_100002191 | |||
| 890 | Ga0070713_100002403 | |||
| 891 | Ga0070713_100037480 | |||
| 892 | Ga0070713_100092012 | |||
| 893 | Ga0070713_100111465 | |||
| 894 | Ga0070713_100151180 | |||
| 895 | Ga0070713_100389165 | |||
| 896 | Ga0070713_100955575 | |||
| 897 | Ga0070710_10000177 | |||
| 898 | Ga0070710_10001432 | |||
| 899 | Ga0070710_10022781 | |||
| 900 | Ga0070710_10042888 | |||
| 901 | Ga0070710_10274564 | |||
| 902 | Ga0070710_10280696 | |||
| 903 | Ga0070701_10505582 | |||
| 904 | Ga0070711_100000158 | |||
| 905 | Ga0070711_100003475 | |||
| 906 | Ga0070711_100121910 | |||
| 907 | Ga0070711_100137932 | |||
| 908 | Ga0070711_101487654 | |||
| 909 | Ga0070705_100039731 | |||
| 910 | Ga0070694_100124287 | |||
| 911 | Ga0070708_100014131 | |||
| 912 | Ga0070708_100029185 | |||
| 913 | Ga0070708_100046036 | |||
| 914 | Ga0070708_100085571 | |||
| 915 | Ga0070708_100109248 | |||
| 916 | Ga0070708_100116285 | |||
| 917 | Ga0070708_100156662 | |||
| 918 | Ga0070708_100227048 | |||
| 919 | Ga0070708_100241795 | |||
| 920 | Ga0070708_100273305 | |||
| 921 | Ga0070708_100488058 | |||
| 922 | Ga0070663_100176013 | |||
| 923 | Ga0070662_100200609 | |||
| 924 | Ga0070681_10142805 | |||
| 925 | Ga0070681_11080798 | |||
| 926 | Ga0068867_100501773 | |||
| 927 | Ga0070706_100002062 | |||
| 928 | Ga0070706_100003701 | |||
| 929 | Ga0070706_100006498 | |||
| 930 | Ga0070706_100007197 | |||
| 931 | Ga0070706_100015978 | |||
| 932 | Ga0070706_100024755 | |||
| 933 | Ga0070706_100028667 | |||
| 934 | Ga0070706_100061551 | |||
| 935 | Ga0070706_100092964 | |||
| 936 | Ga0070706_100151273 | |||
| 937 | Ga0070706_100151534 | |||
| 938 | Ga0070706_100276238 | |||
| 939 | Ga0070706_100638232 | |||
| 940 | Ga0070707_100001992 | |||
| 941 | Ga0070707_100002252 | |||
| 942 | Ga0070707_100004968 | |||
| 943 | Ga0070707_100005544 | |||
| 944 | Ga0070707_100007290 | |||
| 945 | Ga0070707_100013838 | |||
| 946 | Ga0070707_100023182 | |||
| 947 | Ga0070707_100025462 | |||
| 948 | Ga0070707_100053299 | |||
| 949 | Ga0070707_100118012 | |||
| 950 | Ga0070707_100130794 | |||
| 951 | Ga0070707_100147526 | |||
| 952 | Ga0070707_100251380 | |||
| 953 | Ga0070707_100256143 | |||
| 954 | Ga0070707_100610766 | |||
| 955 | Ga0070707_100684032 | |||
| 956 | Ga0070698_100000028 | |||
| 957 | Ga0070698_100001318 | |||
| 958 | Ga0070698_100004118 | |||
| 959 | Ga0070698_100017228 | |||
| 960 | Ga0070698_100048162 | |||
| 961 | Ga0070698_100052447 | |||
| 962 | Ga0070698_100064245 | |||
| 963 | Ga0070698_100072345 | |||
| 964 | Ga0070698_100085243 | |||
| 965 | Ga0070698_100131464 | |||
| 966 | Ga0070698_100450299 | |||
| 967 | Ga0070698_100537777 | |||
| 968 | Ga0070698_100707470 | |||
| 969 | Ga0070698_101051495 | |||
| 970 | Ga0070698_101108604 | |||
| 971 | Ga0070699_100005167 | |||
| 972 | Ga0070699_100126974 | |||
| 973 | Ga0070699_100188209 | |||
| 974 | Ga0070699_100228496 | |||
| 975 | Ga0070679_100029643 | |||
| 976 | Ga0070697_100002042 | |||
| 977 | Ga0070697_100121430 | |||
| 978 | Ga0070697_100292246 | |||
| 979 | Ga0070697_100640465 | |||
| 980 | Ga0068853_100181550 | |||
| 981 | Ga0070686_100067274 | |||
| 982 | Ga0070696_100070625 | |||
| 983 | Ga0070693_100029706 | |||
| 984 | Ga0068855_100593544 | |||
| 985 | Ga0068855_101016728 | |||
| 986 | Ga0070664_100049942 | |||
| 987 | Ga0068857_100494255 | |||
| 988 | Ga0068857_101975898 | |||
| 989 | Ga0068854_100058858 | |||
| 990 | Ga0068856_100039845 | |||
| 991 | Ga0068856_100185635 | |||
| 992 | Ga0068856_100271265 | |||
| 993 | Ga0070702_100058569 | |||
| 994 | Ga0068852_100219060 | |||
| 995 | Ga0068859_100030304 | |||
| 996 | Ga0068859_100282990 | |||
| 997 | Ga0068864_100085848 | |||
| 998 | Ga0068864_100097455 | |||
| 999 | Ga0068864_100351693 | |||
| 1000 | Ga0068863_100143487 | |||
| 1001 | Ga0068858_100065730 | |||
| 1002 | Ga0068858_100120587 | |||
| 1003 | Ga0081540_1000216 | |||
| 1004 | Ga0081540_1000960 | |||
| 1005 | Ga0070717_10003861 | |||
| 1006 | Ga0070717_10004122 | |||
| 1007 | Ga0070717_10008107 | |||
| 1008 | Ga0070717_10009432 | |||
| 1009 | Ga0070717_10022198 | |||
| 1010 | Ga0070717_10075374 | |||
| 1011 | Ga0070717_10098100 | |||
| 1012 | Ga0070717_10132644 | |||
| 1013 | Ga0070717_10159909 | |||
| 1014 | Ga0070717_10521892 | |||
| 1015 | Ga0070717_11030664 | |||
| 1016 | Ga0070715_10032738 | |||
| 1017 | Ga0070715_10042596 | |||
| 1018 | Ga0070715_10093759 | |||
| 1019 | Ga0070715_10189375 | |||
| 1020 | Ga0070715_10288025 | |||
| 1021 | Ga0070716_100001172 | |||
| 1022 | Ga0070716_100003016 | |||
| 1023 | Ga0070716_100049433 | |||
| 1024 | Ga0070716_100283914 | |||
| 1025 | Ga0070712_100001943 | |||
| 1026 | Ga0070712_100006067 | |||
| 1027 | Ga0070712_100008832 | |||
| 1028 | Ga0070712_100012663 | |||
| 1029 | Ga0070712_100041588 | |||
| 1030 | Ga0070712_100148281 | |||
| 1031 | Ga0070712_100374659 | |||
| 1032 | Ga0097621_100154910 | |||
| 1033 | Ga0097621_100171431 | |||
| 1034 | Ga0097621_100348972 | |||
| 1035 | Ga0068871_100138867 | |||
| 1036 | Ga0068871_100874859 | |||
| 1037 | Ga0075428_100721512 | |||
| 1038 | Ga0075433_10115068 | |||
| 1039 | Ga0075433_10291091 | |||
| 1040 | Ga0075433_10330213 | |||
| 1041 | Ga0075434_100084234 | |||
| 1042 | Ga0075434_100658828 | |||
| 1043 | Ga0075434_101012586 | |||
| 1044 | Ga0075436_100010622 | |||
| 1045 | Ga0075436_100044827 | |||
| 1046 | Ga0097620_100030304 | |||
| 1047 | Ga0097620_100282976 | |||
| 1048 | Ga0075435_100002113 | |||
| 1049 | Ga0075435_100078981 | |||
| 1050 | Ga0075435_100102297 | |||
| 1051 | Ga0075435_100102313 | |||
| 1052 | Ga0075435_100102785 | |||
| 1053 | Ga0075435_100306850 | |||
| 1054 | Ga0099794_10059797 | |||
| 1055 | Ga0099794_10087098 | |||
| 1056 | Ga0105240_10342987 | |||
| 1057 | Ga0105240_10585422 | |||
| 1058 | Ga0111539_10138806 | |||
| 1059 | Ga0105245_10014529 | |||
| 1060 | Ga0105245_10342681 | |||
| 1061 | Ga0105245_11238556 | |||
| 1062 | Ga0105247_10022237 | |||
| 1063 | Ga0114129_10274852 | |||
| 1064 | Ga0114129_10571211 | |||
| 1065 | Ga0105243_10032414 | |||
| 1066 | Ga0105243_11381782 | |||
| 1067 | Ga0105241_10051803 | |||
| 1068 | Ga0105241_11113588 | |||
| 1069 | Ga0105242_10375128 | |||
| 1070 | Ga0105237_10837231 | |||
| 1071 | Ga0105249_10077682 | |||
| 1072 | Ga0099796_10023530 | |||
| 1073 | Ga0157320_1000850 | |||
| 1074 | Ga0157341_1000456 | |||
| 1075 | Ga0157371_10026824 | |||
| 1076 | Ga0157370_10060734 | |||
| 1077 | Ga0157370_10299282 | |||
| 1078 | Ga0157369_11155758 | |||
| 1079 | Ga0157374_10098756 | |||
| 1080 | Ga0157374_10437311 | |||
| 1081 | Ga0157378_10347221 | |||
| 1082 | Ga0163162_10565459 | |||
| 1083 | Ga0157372_10302117 | |||
| 1084 | Ga0157372_10648207 | |||
| 1085 | Ga0157372_10921636 | |||
| 1086 | Ga0157375_10067111 | |||
| 1087 | Ga0157375_10073819 | |||
| 1088 | Ga0163163_10009527 | |||
| 1089 | Ga0163163_10345919 | |||
| 1090 | Ga0157380_10375827 | |||
| 1091 | Ga0182008_10208313 | |||
| 1092 | Ga0157377_10030606 | |||
| 1093 | Ga0157379_10009369 | |||
| 1094 | Ga0157379_10805146 | |||
| 1095 | Ga0157376_10037222 | |||
| 1096 | Ga0157376_10070067 | |||
| 1097 | Ga0197907_10921524 | |||
| 1098 | Ga0206349_1072023 | |||
| 1099 | Ga0206355_1690273 | |||
| 1100 | Ga0206351_10298566 | |||
| 1101 | Ga0206350_10877957 | |||
| 1102 | Ga0206354_11457378 | |||
| 1103 | Ga0206353_11539891 | |||
| 1104 | Ga0206353_11593526 | |||
| 1105 | Ga0206353_11844072 | |||
| 1106 | Ga0206353_11942878 | |||
| 1107 | Ga0213874_10029482 | |||
| 1108 | Ga0213874_10215634 | |||
| 1109 | Ga0213874_10270273 | |||
| 1110 | Ga0213876_10122247 | |||
| 1111 | Ga0213876_10363613 | |||
| 1112 | Ga0213875_10001317 | |||
| 1113 | Ga0213875_10003914 | |||
| 1114 | Ga0213875_10018906 | |||
| 1115 | Ga0213875_10032302 | |||
| 1116 | Ga0213875_10049770 | |||
| 1117 | Ga0213875_10169187 | |||
| 1118 | Ga0224712_10036107 | |||
| 1119 | Ga0224712_10057094 | |||
| 1120 | Ga0224712_10117158 | |||
| 1121 | Ga0224712_10190020 | |||
| 1122 | Ga0224572_1019308 | |||
| 1123 | Ga0207653_10011575 | |||
| 1124 | Ga0207692_10000088 | |||
| 1125 | Ga0207692_10010349 | |||
| 1126 | Ga0207692_10018761 | |||
| 1127 | Ga0207692_10086833 | |||
| 1128 | Ga0207692_10153381 | |||
| 1129 | Ga0207642_10121710 | |||
| 1130 | Ga0207688_10021100 | |||
| 1131 | Ga0207647_10192433 | |||
| 1132 | Ga0207685_10018343 | |||
| 1133 | Ga0207685_10044138 | |||
| 1134 | Ga0207685_10074321 | |||
| 1135 | Ga0207699_10000608 | |||
| 1136 | Ga0207699_10001553 | |||
| 1137 | Ga0207699_10008170 | |||
| 1138 | Ga0207699_10330973 | |||
| 1139 | Ga0207699_10423768 | |||
| 1140 | Ga0207699_10518035 | |||
| 1141 | Ga0207705_10747752 | |||
| 1142 | Ga0207684_10000479 | |||
| 1143 | Ga0207684_10000798 | |||
| 1144 | Ga0207684_10023256 | |||
| 1145 | Ga0207684_10030469 | |||
| 1146 | Ga0207684_10034426 | |||
| 1147 | Ga0207684_10079128 | |||
| 1148 | Ga0207684_10088491 | |||
| 1149 | Ga0207684_10158744 | |||
| 1150 | Ga0207684_10171674 | |||
| 1151 | Ga0207684_10238222 | |||
| 1152 | Ga0207684_10296461 | |||
| 1153 | Ga0207684_10586056 | |||
| 1154 | Ga0207684_10808410 | |||
| 1155 | Ga0207654_10024927 | |||
| 1156 | Ga0207707_10811636 | |||
| 1157 | Ga0207695_10119018 | |||
| 1158 | Ga0207693_10000436 | |||
| 1159 | Ga0207693_10009331 | |||
| 1160 | Ga0207693_10013696 | |||
| 1161 | Ga0207693_10022682 | |||
| 1162 | Ga0207693_10099467 | |||
| 1163 | Ga0207693_10099695 | |||
| 1164 | Ga0207693_11031191 | |||
| 1165 | Ga0207663_10000615 | |||
| 1166 | Ga0207663_10006544 | |||
| 1167 | Ga0207663_10007709 | |||
| 1168 | Ga0207663_10045564 | |||
| 1169 | Ga0207663_10091058 | |||
| 1170 | Ga0207663_10174144 | |||
| 1171 | Ga0207663_10279184 | |||
| 1172 | Ga0207663_10615918 | |||
| 1173 | Ga0207660_10344693 | |||
| 1174 | Ga0207662_10057778 | |||
| 1175 | Ga0207657_10009348 | |||
| 1176 | Ga0207652_10268387 | |||
| 1177 | Ga0207652_10425421 | |||
| 1178 | Ga0207646_10000193 | |||
| 1179 | Ga0207646_10000987 | |||
| 1180 | Ga0207646_10001795 | |||
| 1181 | Ga0207646_10009242 | |||
| 1182 | Ga0207646_10021993 | |||
| 1183 | Ga0207646_10046087 | |||
| 1184 | Ga0207646_10089975 | |||
| 1185 | Ga0207646_10100670 | |||
| 1186 | Ga0207646_10149150 | |||
| 1187 | Ga0207646_10523198 | |||
| 1188 | Ga0207646_10904055 | |||
| 1189 | Ga0207694_11427832 | |||
| 1190 | Ga0207659_10235298 | |||
| 1191 | Ga0207687_10211785 | |||
| 1192 | Ga0207687_11588107 | |||
| 1193 | Ga0207700_10000029 | |||
| 1194 | Ga0207700_10010957 | |||
| 1195 | Ga0207700_10050230 | |||
| 1196 | Ga0207700_10092689 | |||
| 1197 | Ga0207700_10114026 | |||
| 1198 | Ga0207700_10115778 | |||
| 1199 | Ga0207700_10185144 | |||
| 1200 | Ga0207700_10264001 | |||
| 1201 | Ga0207700_10270120 | |||
| 1202 | Ga0207664_10000110 | |||
| 1203 | Ga0207664_10002802 | |||
| 1204 | Ga0207664_10004783 | |||
| 1205 | Ga0207664_10041698 | |||
| 1206 | Ga0207664_10092959 | |||
| 1207 | Ga0207664_10096587 | |||
| 1208 | Ga0207664_10121036 | |||
| 1209 | Ga0207664_10124191 | |||
| 1210 | Ga0207664_10295199 | |||
| 1211 | Ga0207664_10318716 | |||
| 1212 | Ga0207664_11114696 | |||
| 1213 | Ga0207644_10169885 | |||
| 1214 | Ga0207706_10021844 | |||
| 1215 | Ga0207670_10180395 | |||
| 1216 | Ga0207665_10000144 | |||
| 1217 | Ga0207665_10000371 | |||
| 1218 | Ga0207665_10012857 | |||
| 1219 | Ga0207665_10046612 | |||
| 1220 | Ga0207665_10102307 | |||
| 1221 | Ga0207665_10170815 | |||
| 1222 | Ga0207665_10286005 | |||
| 1223 | Ga0207691_10153945 | |||
| 1224 | Ga0207711_10444844 | |||
| 1225 | Ga0207689_10008458 | |||
| 1226 | Ga0207661_10380764 | |||
| 1227 | Ga0207679_10216486 | |||
| 1228 | Ga0207679_10421957 | |||
| 1229 | Ga0207679_10815401 | |||
| 1230 | Ga0207667_10287954 | |||
| 1231 | Ga0207667_10685135 | |||
| 1232 | Ga0207712_10639271 | |||
| 1233 | Ga0207640_10105079 | |||
| 1234 | Ga0207677_10033217 | |||
| 1235 | Ga0207677_10067136 | |||
| 1236 | Ga0207677_10703732 | |||
| 1237 | Ga0207639_11003546 | |||
| 1238 | Ga0207678_10023957 | |||
| 1239 | Ga0207708_10084403 | |||
| 1240 | Ga0207702_10287239 | |||
| 1241 | Ga0207702_11405502 | |||
| 1242 | Ga0207648_10593464 | |||
| 1243 | Ga0207648_11062861 | |||
| 1244 | Ga0207676_10095761 | |||
| 1245 | Ga0207674_10047522 | |||
| 1246 | Ga0207674_10053348 | |||
| 1247 | Ga0207675_100015848 | |||
| 1248 | Ga0207683_10081725 | |||
| 1249 | Ga0207698_11737540 | |||
| 1250 | Ga0268265_10046996 | |||
| 1251 | Ga0265336_10020488 | |||
| 1252 | Ga0265338_10008234 | |||
| 1253 | Ga0265338_10008494 | |||
| 1254 | Ga0265338_10021432 | |||
| 1255 | Ga0265766_1002005 | |||
| 1256 | Ga0373948_0137758 | |||
| 1257 | Ga0373959_0005334 | |||
| 1258 | Ga0373959_0012553 | |||
| 1259 | Ga0373926_0001134 | |||
| 1260 | Ga0373926_0022191 | |||
| 1261 | Ga0373926_0213358 | |||
| 1262 | Ga0373928_0002714 | |||
| 1263 | Ga0373928_0014128 | |||
| 1264 | Ga0373929_0003272 | |||
| 1265 | Ga0373934_0000108 | |||
| 1266 | Ga0373934_0020538 | |||
| 1267 | Ga0373934_0021345 | |||
| 1268 | Ga0373934_0035538 | |||
| 1269 | Ga0373934_0109152 | |||
| 1270 | Ga0373940_0006912 | |||
| 1271 | Ga0373944_0000289 | |||
| 1272 | Ga0373944_0020473 | |||
| 1273 | Ga0373944_0043043 | |||
| 1274 | Ga0373949_0020209 | |||
| 1275 | Ga0373951_0006227 | |||
| 1276 | Ga0373923_0000440 | |||
| 1277 | Ga0373923_0023245 | |||
| 1278 | Ga0373923_0040398 | |||
| 1279 | Ga0373923_0044162 | |||
| 1280 | Ga0373923_0217492 | |||
| 1281 | Ga0373923_0421501 | |||
| 1282 | Ga0373932_0025734 | |||
| 1283 | Ga0373932_0208589 | |||
| 1284 | Ga0373936_0004054 | |||
| 1285 | Ga0373936_0006186 | |||
| 1286 | Ga0373936_0013551 | |||
| 1287 | Ga0373936_0093632 | |||
| 1288 | Ga0373936_0114683 | |||
| 1289 | Ga0373936_0204478 | |||
| 1290 | Ga0373939_0020543 | |||
| 1291 | Ga0373941_0006307 | |||
| 1292 | Ga0373941_0019064 | |||
| 1293 | Ga0373945_0003403 | |||
| 1294 | Ga0373945_0019675 | |||
| 1295 | Ga0373945_0116666 | |||
| 1296 | Ga0373945_0203655 | |||
| 1297 | Ga0373953_0000094 | |||
| 1298 | Ga0373953_0003722 | |||
| 1299 | Ga0373953_0014394 | |||
| 1300 | Ga0373953_0029168 | |||
| 1301 | Ga0373953_0087560 | |||
| 1302 | Ga0373953_0196437 | |||
| 1303 | Ga0373953_0283446 | |||
| 1304 | Ga0373954_0016687 | |||
| 1305 | Ga0373954_0017488 | |||
| 1306 | Ga0373954_0049604 | |||
| 1307 | Ga0373954_0098627 | |||
| 1308 | Ga0373954_0106472 | |||
| 1309 | Ga0373954_0171828 | |||
| 1310 | Ga0373956_0001194 | |||
| 1311 | Ga0373956_0023529 | |||
| 1312 | Ga0373956_0046033 | |||
| 1313 | Ga0373956_0150377 | |||
| 1314 | Ga0373956_0250119 | |||
| 1315 | Ga0373956_0343764 | |||
| 1316 | Ga0373957_0000166 | |||
| 1317 | Ga0373957_0017096 | |||
| 1318 | Ga0373957_0017140 | |||
| 1319 | Ga0373957_0107957 | |||
| 1320 | Ga0373957_0153974 | |||
| 1321 | Ga0373960_0005964 | |||
| 1322 | Ga0373943_0010430 | |||
| 1323 | Ga0373943_0040749 | |||
| 1324 | Ga0373943_0370413 | |||
| 1325 | Ga0373943_0457081 | |||
| 1326 | Ga0373946_0000253 | |||
| 1327 | Ga0373946_0000665 | |||
| 1328 | Ga0373946_0034420 | |||
| 1329 | Ga0373946_0171485 | |||
| 1330 | Ga0373946_0390712 | |||
| 1331 | Ga0373955_0000112 | |||
| 1332 | Ga0373955_0016168 | |||
| 1333 | Ga0373955_0073552 | |||
| 1334 | Ga0373955_0143500 | |||
| 1335 | Ga0373955_0434387 | |||
| 1336 | Ga0373942_0013081 | |||
| 1337 | Ga0373924_0000211 | |||
| 1338 | Ga0373924_0002044 | |||
| 1339 | Ga0373924_0007597 | |||
| 1340 | Ga0373924_0036499 | |||
| 1341 | Ga0373924_0077318 | |||
| 1342 | Ga0373924_0300603 | |||
| 1343 | Ga0373931_0025020 | |||
| 1344 | Ga0373931_0276157 | |||
| 1345 | Ga0373931_0575561 | |||
| 1346 | Ga0373931_0688548 | |||
| 1347 | Ga0373935_0000970 | |||
| 1348 | Ga0373935_0058068 | |||
| 1349 | Ga0373935_0069952 | |||
| 1350 | Ga0373935_0090302 | |||
| 1351 | Ga0373935_0095707 | |||
| 1352 | Ga0373935_0152168 | |||
| 1353 | Ga0373935_0191624 | |||
| 1354 | Ga0373935_0321116 | |||
| 1355 | Ga0373935_0327448 | |||
| 1356 | Ga0373927_0003427 | |||
| 1357 | Ga0373927_0008071 | |||
| 1358 | Ga0373927_0051612 | |||
| 1359 | Ga0373927_0085403 | |||
| 1360 | Ga0373927_0093124 | |||
| 1361 | Ga0373933_0000022 | |||
| 1362 | Ga0373933_0009952 | |||
| 1363 | Ga0373933_0010723 | |||
| 1364 | Ga0373933_0043371 | |||
| 1365 | Ga0373933_0070150 | |||
| 1366 | Ga0373933_0081382 | |||
| 1367 | Ga0373947_0000006 | |||
| 1368 | Ga0373947_0001275 | |||
| 1369 | Ga0373947_0045741 | |||
| 1370 | Ga0373947_0116824 | |||
| 1371 | Ga0373947_0379888 | |||
| 1372 | Ga0373947_0528399 | |||
| 1373 | Ga0373937_0000022 | |||
| 1374 | Ga0373937_0008926 | |||
| 1375 | Ga0373937_0088587 | |||
| 1376 | Ga0373937_0145162 | |||
| 1377 | Ga0373937_0206487 | |||
| 1378 | Ga0373937_0302222 | |||
| 1379 | Ga0373937_0362013 | |||
| 1380 | Ga0373937_0473550 | |||
| 1381 | Ga0373925_0006452 | |||
| 1382 | Ga0373925_0035770 | |||
| 1383 | Ga0373925_0056010 | |||
| 1384 | Ga0373925_0082951 | |||
| 1385 | Ga0373925_0145471 | |||
| 1386 | Ga0373925_0187850 | |||
| 1387 | Ga0373925_0373403 | |||
| 1388 | Ga0373925_0465282 | |||
| 1389 | Ga0436364_0022748 | |||
| 1390 | Ga0436364_0165105 | |||
| 1391 | Ga0436364_0287557 | |||
| 1392 | Ga0436364_0403534 | |||
| 1393 | Ga0436364_0813504 | |||
| 1394 | Ga0436364_1104976 | |||
| 1395 | Ga0436364_1260325 | |||
| 1396 | Ga0436364_1433707 | |||
| 1397 | Ga0436364_1482361 | |||
| 1398 | Ga0436365_0833348 | |||
| 1399 | Ga0436365_1762478 | |||
| 1400 | Ga0436361_1213485 | |||
| 1401 | Ga0436363_0137663 | |||
| 1402 | Ga0436363_0257475 | |||
| 1403 | Ga0436363_0836105 | |||
| 1404 | Ga0436363_0902303 | |||
| 1405 | Ga0436363_0909159 | |||
| 1406 | Ga0436363_1480634 | |||
| 1407 | Ga0436362_0338528 | |||
| 1408 | Ga0436362_0368392 | |||
| 1409 | Ga0436362_0372337 | |||
| 1410 | Ga0436362_1015235 | |||
| 1411 | Ga0466961_0363668 | |||
| 1412 | Ga0466963_0052060 | |||
| 1413 | Ga0466963_0176417 | |||
| 1414 | Ga0466957_0462353 | |||
| 1415 | Ga0466959_0124676 | |||
| 1416 | Ga0466959_0268297 | |||
| 1417 | Ga0466958_0387961 | |||
| 1418 | Ga0466967_0014807 | |||
| 1419 | Ga0466967_0552920 | |||
| 1420 | Ga0495592_0000025 | |||
| 1421 | Ga0495592_0019709 | |||
| 1422 | Ga0495592_0026425 | |||
| 1423 | Ga0495592_0110047 | |||
| 1424 | Ga0495592_0345222 | |||
| 1425 | Ga0495603_0005042 | |||
| 1426 | Ga0495603_0024547 | |||
| 1427 | Ga0495603_0189154 | |||
| 1428 | Ga0495629_0002510 | |||
| 1429 | Ga0495629_0061255 | |||
| 1430 | Ga0495629_0128252 | |||
| 1431 | Ga0495629_0160381 | |||
| 1432 | Ga0495641_0012813 | |||
| 1433 | Ga0495641_0046460 | |||
| 1434 | Ga0495641_0050822 | |||
| 1435 | Ga0495641_0286358 | |||
| 1436 | Ga0495651_0000014 | |||
| 1437 | Ga0495651_0021944 | |||
| 1438 | Ga0495651_0023468 | |||
| 1439 | Ga0495651_0028505 | |||
| 1440 | Ga0495651_0042434 | |||
| 1441 | Ga0495651_0068436 | |||
| 1442 | Ga0495651_0789444 | |||
| 1443 | Ga0495653_0014717 | |||
| 1444 | Ga0495653_0016957 | |||
| 1445 | Ga0495653_0034894 | |||
| 1446 | Ga0495653_0043271 | |||
| 1447 | Ga0495653_0046178 | |||
| 1448 | Ga0495653_0048688 | |||
| 1449 | Ga0495653_0078687 | |||
| 1450 | Ga0495653_0146406 | |||
| 1451 | Ga0495653_0624010 | |||
| 1452 | Ga0495582_0002650 | |||
| 1453 | Ga0495582_0018083 | |||
| 1454 | Ga0495582_0045935 | |||
| 1455 | Ga0495582_0111332 | |||
| 1456 | Ga0495639_0018940 | |||
| 1457 | Ga0495639_0058975 | |||
| 1458 | Ga0495639_0236162 | |||
| 1459 | Ga0495662_0000415 | |||
| 1460 | Ga0495662_0005659 | |||
| 1461 | Ga0495662_0020737 | |||
| 1462 | Ga0495662_0027014 | |||
| 1463 | Ga0495662_0048126 | |||
| 1464 | Ga0495662_0186174 | |||
| 1465 | Ga0495664_0008128 | |||
| 1466 | Ga0495664_0013731 | |||
| 1467 | Ga0495664_0083295 | |||
| 1468 | Ga0495664_0370480 | |||
| 1469 | Ga0495664_0370683 | |||
| 1470 | Ga0495594_0019264 | |||
| 1471 | Ga0495594_0047095 | |||
| 1472 | Ga0495608_0000190 | |||
| 1473 | Ga0495608_0026053 | |||
| 1474 | Ga0495608_0027392 | |||
| 1475 | Ga0495608_0028031 | |||
| 1476 | Ga0495608_0138993 | |||
| 1477 | Ga0495608_0229821 | |||
| 1478 | Ga0495608_0262667 | |||
| 1479 | Ga0495608_0270416 | |||
| 1480 | Ga0495608_0312620 | |||
| 1481 | Ga0495618_0033244 | |||
| 1482 | Ga0495618_0036751 | |||
| 1483 | Ga0495618_0058982 | |||
| 1484 | Ga0495618_0062188 | |||
| 1485 | Ga0495618_0069649 | |||
| 1486 | Ga0495618_0079625 | |||
| 1487 | Ga0495618_0116698 | |||
| 1488 | Ga0495618_0130493 | |||
| 1489 | Ga0495618_0296849 | |||
| 1490 | Ga0495618_0510701 | |||
| 1491 | Ga0495628_0000346 | |||
| 1492 | Ga0495628_0034457 | |||
| 1493 | Ga0495628_0051400 | |||
| 1494 | Ga0495628_0057318 | |||
| 1495 | Ga0495628_0096929 | |||
| 1496 | Ga0495628_0148892 | |||
| 1497 | Ga0495628_0246247 | |||
| 1498 | Ga0495630_0015459 | |||
| 1499 | Ga0495630_0035134 | |||
| 1500 | Ga0495630_0055015 | |||
| 1501 | Ga0495630_0065777 | |||
| 1502 | Ga0495630_1306325 | |||
| 1503 | Ga0495666_0004933 | |||
| 1504 | Ga0495666_0036493 | |||
| 1505 | Ga0495652_0010242 | |||
| 1506 | Ga0495652_0030510 | |||
| 1507 | Ga0495652_0031518 | |||
| 1508 | Ga0495652_0032332 | |||
| 1509 | Ga0495652_0038016 | |||
| 1510 | Ga0495652_0079199 | |||
| 1511 | Ga0495652_0148146 | |||
| 1512 | Ga0495652_0149262 | |||
| 1513 | Ga0495652_0223967 | |||
| 1514 | Ga0495652_0302171 | |||
| 1515 | Ga0495665_0000524 | |||
| 1516 | Ga0495665_0003902 | |||
| 1517 | Ga0495665_0012150 | |||
| 1518 | Ga0495665_0014274 | |||
| 1519 | Ga0495665_0424162 | |||
| 1520 | Ga0495640_0019543 | |||
| 1521 | Ga0495640_0127799 | |||
| 1522 | Ga0495640_0133265 | |||
| 1523 | Ga0495640_0160262 | |||
| 1524 | Ga0495640_0214779 | |||
| 1525 | Ga0495640_0391904 | |||
| 1526 | Ga0495586_0006410 | |||
| 1527 | Ga0495586_0031390 | |||
| 1528 | Ga0495587_0000029 | |||
| 1529 | Ga0495587_0006950 | |||
| 1530 | Ga0495587_0012669 | |||
| 1531 | Ga0495587_0037890 | |||
| 1532 | Ga0495587_0142002 | |||
| 1533 | Ga0495587_0144565 | |||
| 1534 | Ga0495645_0022525 | |||
| 1535 | Ga0495645_0031600 | |||
| 1536 | Ga0495645_0065440 | |||
| 1537 | Ga0495645_0168598 | |||
| 1538 | Ga0495645_0359905 | |||
| 1539 | Ga0495645_0504041 | |||
| 1540 | Ga0495667_0000036 | |||
| 1541 | Ga0495667_0001443 | |||
| 1542 | Ga0495667_0007912 | |||
| 1543 | Ga0495667_0011226 | |||
| 1544 | Ga0495667_0027589 | |||
| 1545 | Ga0495667_0031427 | |||
| 1546 | Ga0495667_0062785 | |||
| 1547 | Ga0495667_0125890 | |||
| 1548 | Ga0495667_0323559 | |||
| 1549 | Ga0495634_0005049 | |||
| 1550 | Ga0495634_0011657 | |||
| 1551 | Ga0495634_0069302 | |||
| 1552 | Ga0495634_0145533 | |||
| 1553 | Ga0495635_0004586 | |||
| 1554 | Ga0495635_0008790 | |||
| 1555 | Ga0495635_0038965 | |||
| 1556 | Ga0495635_0060878 | |||
| 1557 | Ga0495635_0114341 | |||
| 1558 | Ga0495635_0209544 | |||
| 1559 | Ga0495635_0244086 | |||
| 1560 | Ga0495635_0299941 | |||
| 1561 | Ga0495588_0058930 | |||
| 1562 | Ga0495657_0000071 | |||
| 1563 | Ga0495657_0008636 | |||
| 1564 | Ga0495657_0038498 | |||
| 1565 | Ga0495657_0044277 | |||
| 1566 | Ga0495657_0044387 | |||
| 1567 | Ga0495657_0100342 | |||
| 1568 | Ga0495657_0210672 | |||
| 1569 | Ga0495657_0310114 | |||
| 1570 | Ga0495599_0000094 | |||
| 1571 | Ga0495599_0010549 | |||
| 1572 | Ga0495599_0042454 | |||
| 1573 | Ga0495599_0058963 | |||
| 1574 | Ga0495599_0115031 | |||
| 1575 | Ga0495599_0116985 | |||
| 1576 | Ga0495599_0137792 | |||
| 1577 | Ga0495599_0270372 | |||
| 1578 | Ga0495599_0316810 | |||
| 1579 | Ga0495623_0000113 | |||
| 1580 | Ga0495623_0029194 | |||
| 1581 | Ga0495623_0067661 | |||
| 1582 | Ga0495623_0073363 | |||
| 1583 | Ga0495623_0181232 | |||
| 1584 | Ga0495646_0008387 | |||
| 1585 | Ga0495646_0031995 | |||
| 1586 | Ga0495646_0045764 | |||
| 1587 | Ga0495646_0052418 | |||
| 1588 | Ga0495646_0194436 | |||
| 1589 | Ga0495646_0205946 | |||
| 1590 | Ga0495647_0389773 | |||
| 1591 | Ga0495658_0003156 | |||
| 1592 | Ga0495658_0086281 | |||
| 1593 | Ga0495658_0178053 | |||
| 1594 | Ga0495613_0018727 | |||
| 1595 | Ga0495613_0067359 | |||
| 1596 | Ga0495613_0137841 | |||
| 1597 | Ga0495613_0196613 | |||
| 1598 | Ga0495613_0240966 | |||
| 1599 | Ga0495624_0003337 | |||
| 1600 | Ga0495624_0024311 | |||
| 1601 | Ga0495624_0026797 | |||
| 1602 | Ga0495600_0001986 | |||
| 1603 | Ga0495600_0008730 | |||
| 1604 | Ga0495600_0032324 | |||
| 1605 | Ga0495600_0074984 | |||
| 1606 | Ga0495600_0153438 | |||
| 1607 | Ga0495600_0177626 | |||
| 1608 | Ga0495600_0420422 | |||
| 1609 | Ga0495581_0000903 | |||
| 1610 | Ga0495581_0051859 | |||
| 1611 | Ga0495581_0092484 | |||
| 1612 | Ga0495581_0115715 | |||
| 1613 | Ga0495581_0408805 | |||
| 1614 | Ga0495604_0000044 | |||
| 1615 | Ga0495604_0015746 | |||
| 1616 | Ga0495604_0153870 | |||
| 1617 | Ga0495604_0248216 | |||
| 1618 | Ga0495604_0499174 | |||
| 1619 | Ga0495604_0729922 | |||
| 1620 | Ga0495674_0000044 | |||
| 1621 | Ga0495674_0057081 | |||
| 1622 | Ga0495674_0267428 | |||
| 1623 | Ga0495674_0268119 | |||
| 1624 | Ga0495674_0453327 | |||
| 1625 | Ga0495674_0515277 | |||
| 1626 | Ga0495676_0008527 | |||
| 1627 | Ga0495676_0058852 | |||
| 1628 | Ga0495676_0131456 | |||
| 1629 | Ga0495676_0351362 | |||
| 1630 | Ga0495680_0000219 | |||
| 1631 | Ga0495680_0017665 | |||
| 1632 | Ga0495680_0024774 | |||
| 1633 | Ga0495680_0043101 | |||
| 1634 | Ga0495680_0074258 | |||
| 1635 | Ga0495680_0159531 | |||
| 1636 | Ga0495675_0002157 | |||
| 1637 | Ga0495675_0002458 | |||
| 1638 | Ga0495675_0004181 | |||
| 1639 | Ga0495675_0029798 | |||
| 1640 | Ga0495675_0040598 | |||
| 1641 | Ga0495675_0072339 | |||
| 1642 | Ga0495684_0000962 | |||
| 1643 | Ga0495684_0017761 | |||
| 1644 | Ga0495684_0064779 | |||
| 1645 | Ga0495684_0098357 | |||
| 1646 | Ga0495593_0005556 | |||
| 1647 | Ga0495593_0013529 | |||
| 1648 | Ga0495593_0032474 | |||
| 1649 | Ga0495593_0063625 | |||
| 1650 | Ga0495593_0090808 | |||
| 1651 | Ga0495602_0000480 | |||
| 1652 | Ga0495602_0033666 | |||
| 1653 | Ga0495602_0051492 | |||
| 1654 | Ga0495602_0104978 | |||
| 1655 | Ga0495602_0111495 | |||
| 1656 | Ga0495602_0130961 | |||
| 1657 | Ga0495602_0248377 | |||
| 1658 | Ga0495602_0279468 | |||
| 1659 | Ga0495602_0361202 | |||
| 1660 | Ga0495602_0700402 | |||
| 1661 | Ga0495614_0005646 | |||
| 1662 | Ga0495614_0046486 | |||
| 1663 | Ga0495614_0236617 | |||
| 1664 | Ga0496101_0081580 | |||
| 1665 | Ga0496102_0271430 | |||
| 1666 | Ga0496103_0112067 | |||
| 1667 | Ga0496104_0008559 | |||
| 1668 | Ga0496104_0226081 | |||
| 1669 | Ga0496105_0010843 | |||
| 1670 | Ga0496105_0039664 | |||
| 1671 | Ga0496105_0543062 | |||
| 1672 | Ga0496106_0084617 | |||
| 1673 | Ga0496108_0211820 | |||
| 1674 | Ga0496108_0232166 | |||
| 1675 | Ga0496108_0286318 | |||
| 1676 | Ga0496109_0072290 | |||
| 1677 | Ga0496109_0309743 | |||
| 1678 | Ga0496110_0008342 | |||
| 1679 | Ga0496110_0074600 | |||
| 1680 | Ga0496111_0010415 | |||
| 1681 | Ga0496111_0089111 | |||
| 1682 | Ga0496112_0580649 | |||
| 1683 | Ga0496113_0116354 | |||
| 1684 | Ga0496113_1097658 | |||
| 1685 | Ga0496114_0433192 | |||
| 1686 | Ga0496115_0734967 | |||
| 1687 | Ga0496126_0129579 | |||
| 1688 | Ga0501042_0021172 | |||
| 1689 | Ga0501047_0079622 | |||
| 1690 | nmdc:mga05p37_17739_c1 | |||
| 1691 | nmdc:mga05p37_405395_c1 | |||
| 1692 | nmdc:mga08y16_519657_c1 | |||
| 1693 | nmdc:mga0n895_112648_c1 | |||
| 1694 | nmdc:mga0rr50_159719_c1 | |||
| 1695 | nmdc:mga0rr50_203890_c1 | |||
| 1696 | nmdc:mga0rr50_297027_c1 | |||
| 1697 | nmdc:mga08x19_110520_c1 | |||
| 1698 | nmdc:mga08x19_471501_c1 | |||
| 1699 | nmdc:mga0a205_150886_c1 | |||
| 1700 | nmdc:mga0a205_307715_c1 | |||
| 1701 | nmdc:mga0a205_495943_c1 | |||
| 1702 | Ga0495601_0002241 | |||
| 1703 | Ga0495601_0009107 | |||
| 1704 | Ga0495601_0031020 | |||
| 1705 | Ga0495601_0167548 | |||
| 1706 | Ga0495601_0212785 | |||
| 1707 | Ga0495601_0425782 | |||
| 1708 | Ga0495612_0017697 | |||
| 1709 | Ga0495612_0082055 | |||
| 1710 | Ga0495595_0002659 | |||
| 1711 | Ga0495595_0007985 | |||
| 1712 | Ga0495595_0038448 | |||
| 1713 | Ga0495619_0005114 | |||
| 1714 | Ga0495619_0018796 | |||
| 1715 | Ga0495619_0065485 | |||
| 1716 | Ga0495619_0205040 | |||
| 1717 | Ga0587083_0040764 | |||
| 1718 | Ga0587114_026681 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xqa-assembly1.cif.gz_A | structure of a possible glyoxalase from bacillus cereus | 0.7882 | 5 | 123 |
| 2zw7-assembly1.cif.gz_B | crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a | 0.7814 | 4 | 123 |
| 2p7k-assembly1.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) | 0.7745 | 3 | 123 |
| 2rk0-assembly1.cif.gz_B | crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec | 0.764 | 3 | 125 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.764 | 4 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ81_10_141_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8497 | 6 | 129 | 3.10.180.10 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8338 | 4 | 131 | 3.10.180.10 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8159 | 4 | 131 | 3.10.180.10 |
| af_Q2G2A7_273_342_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8028 | 97 | 123 | 2.40.50.140 |
| af_Q5VMX8_15_124_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.801 | 9 | 126 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8YE59-F1-model_v4 | Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein | 0.9206 | 71 | 166 |
GO:0051213
|
| AF-A0A7Y2A344-F1-model_v4 | VOC family protein | 0.9173 | 79 | 160 |
|
| AF-A0A7Y2A344-F1-model_v4 | VOC family protein | 0.9064 | 79 | 160 |
|
| AF-A0A536CZM3-F1-model_v4 | VOC family protein | 0.8939 | 11 | 152 |
|
| AF-A0A3L7XDZ1-F1-model_v4 | VOC family protein | 0.8841 | 22 | 157 |
|