F483660

General Info

Members Datasets Scaffolds Average Seq Length
856 366 1712 130

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10114605|Ga0207688_101146054
Length 135
Sequence MGRMTDPALELNVLGGPLEPCGTDPVTGFYRDGSCTCGPARAHHLICVVATSEFLTHQRSVGNDLISPVPEFAFPGLHPGDRWCVVLERWLQSYDAGLAAPVVLAATNQRALDLVELDVLRQFAVDVPDDLSSLD

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
364 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
365 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
366 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.92
Nodule 0
Rhizoplane 7.48
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10114605 3300025901 Bacteria 1568
2 JGI24750J21931_1046690 3300002070 Bacteria 668
3 JGI24744J21845_10008718 3300002077 Bacteria 2084
4 JGI24034J26672_10013077 3300002239 Bacteria 1257
5 JGI24034J26672_10110439 3300002239 Bacteria 525
6 Ga0055540_1000057 3300003792 Bacteria 136356
7 Ga0055540_1000710 3300003792 Bacteria 22736
8 Ga0055540_1000951 3300003792 Bacteria 18813
9 Ga0070683_100069881 3300005329 Bacteria 3275
10 Ga0070690_100338043 3300005330 Bacteria 1090
11 Ga0070670_100689742 3300005331 Bacteria 918
12 Ga0068869_100105153 3300005334 Bacteria 2141
13 Ga0068869_100311234 3300005334 Bacteria 1275
14 Ga0070666_10014474 3300005335 Bacteria 5025
15 Ga0070682_100259708 3300005337 Bacteria 1256
16 Ga0068868_100058153 3300005338 Bacteria 3055
17 Ga0068868_100676456 3300005338 Bacteria 921
18 Ga0068868_101173492 3300005338 Bacteria 709
19 Ga0070660_100027313 3300005339 Bacteria 4258
20 Ga0070660_100207266 3300005339 Bacteria 1591
21 Ga0070689_100088316 3300005340 Bacteria 2440
22 Ga0070689_100329003 3300005340 Bacteria 1278
23 Ga0070689_101039393 3300005340 Bacteria 730
24 Ga0070691_10023955 3300005341 Bacteria 2836
25 Ga0070691_10437741 3300005341 Bacteria 744
26 Ga0070691_10771330 3300005341 Bacteria 583
27 Ga0070691_10987443 3300005341 Bacteria 525
28 Ga0070661_100259969 3300005344 Bacteria 1342
29 Ga0070661_101145486 3300005344 Bacteria 649
30 Ga0070692_10134992 3300005345 Bacteria 1391
31 Ga0070692_10370043 3300005345 Bacteria 896
32 Ga0070668_100027831 3300005347 Bacteria 4290
33 Ga0070668_100135230 3300005347 Bacteria 1982
34 Ga0070668_100153207 3300005347 Bacteria 1866
35 Ga0070668_100477745 3300005347 Bacteria 1076
36 Ga0070669_100808949 3300005353 Bacteria 797
37 Ga0070669_101708122 3300005353 Bacteria 549
38 Ga0070671_100015987 3300005355 Bacteria 6062
39 Ga0070671_100045113 3300005355 Bacteria 3664
40 Ga0070671_100732601 3300005355 Bacteria 859
41 Ga0070671_101059993 3300005355 Bacteria 711
42 Ga0070674_100050320 3300005356 Bacteria 2868
43 Ga0070674_100740904 3300005356 Bacteria 844
44 Ga0070673_100031871 3300005364 Bacteria 3961
45 Ga0070673_101147627 3300005364 Bacteria 727
46 Ga0070688_100217490 3300005365 Bacteria 1345
47 Ga0070659_100029195 3300005366 Bacteria 4261
48 Ga0070659_100093698 3300005366 Bacteria 2410
49 Ga0070667_100167429 3300005367 Bacteria 1939
50 Ga0070667_100274022 3300005367 Bacteria 1514
51 Ga0070703_10015534 3300005406 Bacteria 2179
52 Ga0070709_10035737 3300005434 Bacteria 3021
53 Ga0070709_10149086 3300005434 Bacteria 1615
54 Ga0070714_100041434 3300005435 Bacteria 3885
55 Ga0070714_100169325 3300005435 Bacteria 1981
56 Ga0070714_100420599 3300005435 Bacteria 1266
57 Ga0070714_101124904 3300005435 Bacteria 766
58 Ga0070713_100058301 3300005436 Bacteria 3220
59 Ga0070713_100092719 3300005436 Bacteria 2601
60 Ga0070713_100575187 3300005436 Bacteria 1068
61 Ga0070713_101445660 3300005436 Bacteria 667
62 Ga0070710_10003496 3300005437 Bacteria 7445
63 Ga0070710_10037726 3300005437 Bacteria 2651
64 Ga0070710_10057200 3300005437 Bacteria 2209
65 Ga0070701_10008680 3300005438 Bacteria 4410
66 Ga0070711_100014133 3300005439 Bacteria 5025
67 Ga0070711_100055425 3300005439 Bacteria 2739
68 Ga0070705_100079586 3300005440 Bacteria 2008
69 Ga0070700_100071747 3300005441 Bacteria 2212
70 Ga0070700_100649177 3300005441 Bacteria 833
71 Ga0070694_100059765 3300005444 Bacteria 2597
72 Ga0070694_100295424 3300005444 Bacteria 1240
73 Ga0070708_101142342 3300005445 Bacteria 729
74 Ga0070663_100025408 3300005455 Bacteria 3998
75 Ga0070663_100055994 3300005455 Bacteria 2824
76 Ga0070663_100073099 3300005455 Bacteria 2501
77 Ga0070663_100213699 3300005455 Bacteria 1511
78 Ga0070678_100005012 3300005456 Bacteria 7591
79 Ga0070662_100086718 3300005457 Bacteria 2342
80 Ga0070681_10040349 3300005458 Bacteria 4677
81 Ga0070681_10233284 3300005458 Bacteria 1754
82 Ga0070681_10868847 3300005458 Bacteria 820
83 Ga0068867_100238724 3300005459 Bacteria 1473
84 Ga0068867_101449347 3300005459 Bacteria 638
85 Ga0070685_10014290 3300005466 Bacteria 4202
86 Ga0070685_10202543 3300005466 Bacteria 1291
87 Ga0070685_10208521 3300005466 Bacteria 1274
88 Ga0070685_10876367 3300005466 Bacteria 667
89 Ga0070706_100009587 3300005467 Bacteria 9005
90 Ga0070707_100007797 3300005468 Bacteria 9944
91 Ga0070707_100105674 3300005468 Bacteria 2730
92 Ga0070698_100017226 3300005471 Bacteria 7612
93 Ga0070698_100663738 3300005471 Bacteria 984
94 Ga0070699_100374003 3300005518 Bacteria 1286
95 Ga0070684_100041900 3300005535 Bacteria 3950
96 Ga0070684_100108394 3300005535 Bacteria 2488
97 Ga0070697_100250680 3300005536 Bacteria 1514
98 Ga0070697_100496310 3300005536 Bacteria 1067
99 Ga0068853_100103584 3300005539 Bacteria 2519
100 Ga0068853_100136865 3300005539 Bacteria 2196
101 Ga0068853_100886575 3300005539 Bacteria 856
102 Ga0070672_100659724 3300005543 Bacteria 914
103 Ga0070686_100230315 3300005544 Bacteria 1344
104 Ga0070695_100001581 3300005545 Bacteria 12712
105 Ga0070696_100133525 3300005546 Bacteria 1808
106 Ga0070696_101176440 3300005546 Bacteria 647
107 Ga0070693_100103608 3300005547 Bacteria 1738
108 Ga0070693_100962209 3300005547 Bacteria 644
109 Ga0070665_100084793 3300005548 Bacteria 3173
110 Ga0070665_100295744 3300005548 Bacteria 1622
111 Ga0070665_100942566 3300005548 Bacteria 876
112 Ga0070704_100022142 3300005549 Bacteria 4132
113 Ga0070704_100067514 3300005549 Bacteria 2583
114 Ga0070704_100155095 3300005549 Bacteria 1805
115 Ga0068855_100029678 3300005563 Bacteria 6538
116 Ga0068855_100608249 3300005563 Bacteria 1178
117 Ga0068855_100893420 3300005563 Bacteria 939
118 Ga0068855_100918258 3300005563 Bacteria 924
119 Ga0070664_100078280 3300005564 Bacteria 2844
120 Ga0068857_101429364 3300005577 Bacteria 673
121 Ga0068854_100069849 3300005578 Bacteria 2566
122 Ga0068856_100076961 3300005614 Bacteria 3305
123 Ga0068856_100862104 3300005614 Bacteria 925
124 Ga0068856_100993908 3300005614 Bacteria 857
125 Ga0070702_100661069 3300005615 Bacteria 791
126 Ga0068852_100228262 3300005616 Bacteria 1774
127 Ga0068852_100478145 3300005616 Bacteria 1238
128 Ga0068859_100049473 3300005617 Bacteria 4221
129 Ga0068859_100376792 3300005617 Bacteria 1515
130 Ga0068859_100495641 3300005617 Bacteria 1317
131 Ga0068859_100542094 3300005617 Bacteria 1258
132 Ga0068859_101747810 3300005617 Bacteria 687
133 Ga0068864_100077719 3300005618 Bacteria 2903
134 Ga0068864_100217854 3300005618 Bacteria 1760
135 Ga0068866_10030885 3300005718 Bacteria 2576
136 Ga0068866_10768108 3300005718 Bacteria 667
137 Ga0068861_100017454 3300005719 Bacteria 5097
138 Ga0068861_100083286 3300005719 Bacteria 2509
139 Ga0068861_100639344 3300005719 Bacteria 981
140 Ga0068861_101171324 3300005719 Bacteria 742
141 Ga0068870_10639879 3300005840 Bacteria 727
142 Ga0068863_100094036 3300005841 Bacteria 2845
143 Ga0068863_100239520 3300005841 Bacteria 1751
144 Ga0068858_100164677 3300005842 Bacteria 2089
145 Ga0068858_100306664 3300005842 Bacteria 1515
146 Ga0068858_100342451 3300005842 Bacteria 1431
147 Ga0068858_100345110 3300005842 Bacteria 1425
148 Ga0068858_100622269 3300005842 Bacteria 1048
149 Ga0068860_100166752 3300005843 Bacteria 2126
150 Ga0068860_100827985 3300005843 Bacteria 940
151 Ga0068862_100198939 3300005844 Bacteria 1806
152 Ga0068862_100310837 3300005844 Bacteria 1452
153 Ga0068862_100331074 3300005844 Bacteria 1408
154 Ga0068862_100496061 3300005844 Bacteria 1158
155 Ga0068862_101264928 3300005844 Bacteria 738
156 Ga0081455_10026424 3300005937 Bacteria 5339
157 Ga0081455_10251443 3300005937 Bacteria 1292
158 Ga0081538_10158524 3300005981 Bacteria 1010
159 Ga0081539_10014925 3300005985 Bacteria 5700
160 Ga0070717_10003028 3300006028 Bacteria 11974
161 Ga0070717_10107315 3300006028 Bacteria 2378
162 Ga0075365_10005619 3300006038 Bacteria 6786
163 Ga0075365_10009500 3300006038 Bacteria 5595
164 Ga0075365_10243610 3300006038 Bacteria 1263
165 Ga0075365_10358458 3300006038 Bacteria 1028
166 Ga0075368_10003351 3300006042 Bacteria 5337
167 Ga0075363_100008629 3300006048 Bacteria 4756
168 Ga0075363_100008757 3300006048 Bacteria 4729
169 Ga0075363_100027476 3300006048 Bacteria 2918
170 Ga0075363_100030350 3300006048 Bacteria 2798
171 Ga0075363_100134655 3300006048 Bacteria 1388
172 Ga0075363_100152831 3300006048 Bacteria 1304
173 Ga0075363_100245791 3300006048 Bacteria 1029
174 Ga0075364_10019553 3300006051 Bacteria 4250
175 Ga0075364_10032511 3300006051 Bacteria 3355
176 Ga0075364_10075677 3300006051 Bacteria 2221
177 Ga0075364_10338880 3300006051 Bacteria 1025
178 Ga0075364_10445287 3300006051 Bacteria 885
179 Ga0075364_10475917 3300006051 Bacteria 854
180 Ga0075432_10242536 3300006058 Bacteria 728
181 Ga0070715_10128709 3300006163 Bacteria 1216
182 Ga0070715_10144574 3300006163 Bacteria 1159
183 Ga0070715_10333036 3300006163 Bacteria 823
184 Ga0070716_100055138 3300006173 Bacteria 2273
185 Ga0070716_100267841 3300006173 Bacteria 1172
186 Ga0070716_101045158 3300006173 Bacteria 648
187 Ga0070712_100028964 3300006175 Bacteria 3709
188 Ga0070712_100332404 3300006175 Bacteria 1238
189 Ga0075362_10019967 3300006177 Bacteria 2795
190 Ga0075362_10034621 3300006177 Bacteria 2202
191 Ga0075362_10054358 3300006177 Bacteria 1799
192 Ga0075362_10155228 3300006177 Bacteria 1100
193 Ga0075367_10032313 3300006178 Bacteria 3010
194 Ga0075367_10171444 3300006178 Bacteria 1352
195 Ga0075367_10187617 3300006178 Bacteria 1290
196 Ga0075367_10231622 3300006178 Bacteria 1157
197 Ga0075367_10244013 3300006178 Bacteria 1126
198 Ga0075367_10315468 3300006178 Bacteria 985
199 Ga0075367_10464285 3300006178 Bacteria 803
200 Ga0075367_10520219 3300006178 Bacteria 755
201 Ga0075367_10542578 3300006178 Bacteria 738
202 Ga0075369_10004266 3300006186 Bacteria 5268
203 Ga0075369_10012184 3300006186 Bacteria 3395
204 Ga0075369_10014240 3300006186 Bacteria 3173
205 Ga0075369_10018636 3300006186 Bacteria 2828
206 Ga0075369_10054265 3300006186 Bacteria 1740
207 Ga0075369_10102196 3300006186 Bacteria 1287
208 Ga0075369_10104232 3300006186 Bacteria 1274
209 Ga0075369_10307480 3300006186 Bacteria 741
210 Ga0075369_10510953 3300006186 Bacteria 572
211 Ga0075366_10245729 3300006195 Bacteria 1091
212 Ga0097621_100238480 3300006237 Bacteria 1589
213 Ga0097621_100275412 3300006237 Bacteria 1480
214 Ga0097621_100370421 3300006237 Bacteria 1278
215 Ga0075370_10019687 3300006353 Bacteria 3678
216 Ga0075370_10109297 3300006353 Bacteria 1604
217 Ga0075370_10140617 3300006353 Bacteria 1411
218 Ga0075370_10160209 3300006353 Bacteria 1320
219 Ga0075370_10342249 3300006353 Bacteria 893
220 Ga0068871_100665338 3300006358 Bacteria 952
221 Ga0075430_100111180 3300006846 Bacteria 2284
222 Ga0075430_100249923 3300006846 Bacteria 1469
223 Ga0075430_100321513 3300006846 Bacteria 1279
224 Ga0075433_10078685 3300006852 Bacteria 2905
225 Ga0075434_101180991 3300006871 Bacteria 777
226 Ga0075434_102290876 3300006871 Bacteria 543
227 Ga0068865_100110943 3300006881 Bacteria 2024
228 Ga0068865_100208743 3300006881 Bacteria 1520
229 Ga0075436_100173910 3300006914 Bacteria 1520
230 Ga0097620_100049474 3300006931 Bacteria 4221
231 Ga0097620_100376800 3300006931 Bacteria 1515
232 Ga0097620_100495626 3300006931 Bacteria 1317
233 Ga0097620_100542206 3300006931 Bacteria 1258
234 Ga0097620_101747371 3300006931 Bacteria 687
235 Ga0075435_100013188 3300007076 Bacteria 6141
236 Ga0075435_101287315 3300007076 Bacteria 640
237 Ga0099794_10380513 3300007265 Bacteria 736
238 Ga0105251_10267010 3300009011 Bacteria 772
239 Ga0105250_10082813 3300009092 Bacteria 1301
240 Ga0105240_10079574 3300009093 Bacteria 4033
241 Ga0105240_10822163 3300009093 Bacteria 1005
242 Ga0111539_10123649 3300009094 Bacteria 3032
243 Ga0111539_10284799 3300009094 Bacteria 1923
244 Ga0111539_10916597 3300009094 Bacteria 1019
245 Ga0111539_11251012 3300009094 Bacteria 862
246 Ga0105245_10011525 3300009098 Bacteria 7699
247 Ga0105245_10123186 3300009098 Bacteria 2424
248 Ga0105245_10130446 3300009098 Bacteria 2357
249 Ga0105247_10018616 3300009101 Bacteria 4168
250 Ga0105247_10102356 3300009101 Bacteria 1832
251 Ga0105247_10650045 3300009101 Bacteria 788
252 Ga0114129_10271682 3300009147 Bacteria 2268
253 Ga0105243_10070732 3300009148 Bacteria 2818
254 Ga0105243_10098267 3300009148 Bacteria 2424
255 Ga0105243_10220054 3300009148 Bacteria 1678
256 Ga0105241_10067616 3300009174 Bacteria 2766
257 Ga0105241_11716648 3300009174 Bacteria 610
258 Ga0105242_10317092 3300009176 Bacteria 1429
259 Ga0105242_10467858 3300009176 Bacteria 1192
260 Ga0105242_11367903 3300009176 Bacteria 734
261 Ga0105242_11778294 3300009176 Bacteria 654
262 Ga0105248_10027042 3300009177 Bacteria 6383
263 Ga0105248_11050790 3300009177 Bacteria 920
264 Ga0105237_10281491 3300009545 Bacteria 1665
265 Ga0105237_10358355 3300009545 Bacteria 1463
266 Ga0105237_10657886 3300009545 Bacteria 1054
267 Ga0105238_10136510 3300009551 Bacteria 2430
268 Ga0105238_10600247 3300009551 Bacteria 1109
269 Ga0105249_10092851 3300009553 Bacteria 2826
270 Ga0105249_10555322 3300009553 Bacteria 1199
271 Ga0105249_11039399 3300009553 Bacteria 888
272 Ga0105249_12214319 3300009553 Bacteria 622
273 Ga0105249_12287328 3300009553 Bacteria 613
274 Ga0105249_12638064 3300009553 Bacteria 575
275 Ga0105239_10191692 3300010375 Bacteria 2288
276 Ga0105239_10300803 3300010375 Bacteria 1807
277 Ga0105239_11653147 3300010375 Bacteria 741
278 Ga0105239_12101666 3300010375 Bacteria 656
279 Ga0105246_10017216 3300011119 Bacteria 4592
280 Ga0105246_10149732 3300011119 Bacteria 1765
281 Ga0105246_11373977 3300011119 Bacteria 658
282 Ga0105246_12048750 3300011119 Bacteria 553
283 Ga0157373_10651193 3300013100 Bacteria 769
284 Ga0157371_10087531 3300013102 Bacteria 2206
285 Ga0157370_10071968 3300013104 Bacteria 3262
286 Ga0157369_10036662 3300013105 Bacteria 5372
287 Ga0157369_10328584 3300013105 Bacteria 1589
288 Ga0157369_10336191 3300013105 Bacteria 1569
289 Ga0157374_10031323 3300013296 Bacteria 4833
290 Ga0157374_10395739 3300013296 Bacteria 1378
291 Ga0157378_10058773 3300013297 Bacteria 3429
292 Ga0157378_10457479 3300013297 Bacteria 1268
293 Ga0163162_10045976 3300013306 Bacteria 4375
294 Ga0163162_10498525 3300013306 Bacteria 1348
295 Ga0163162_10700596 3300013306 Bacteria 1134
296 Ga0163162_10892064 3300013306 Bacteria 1003
297 Ga0157372_10075533 3300013307 Bacteria 3803
298 Ga0157372_10624236 3300013307 Bacteria 1256
299 Ga0157375_10040515 3300013308 Bacteria 4490
300 Ga0157375_10113023 3300013308 Bacteria 2816
301 Ga0157375_10116521 3300013308 Bacteria 2776
302 Ga0157375_10196797 3300013308 Bacteria 2171
303 Ga0157375_10306438 3300013308 Bacteria 1752
304 Ga0157375_11212809 3300013308 Bacteria 885
305 Ga0157375_11916680 3300013308 Bacteria 704
306 Ga0163163_10217308 3300014325 Bacteria 1960
307 Ga0163163_10284796 3300014325 Bacteria 1704
308 Ga0163163_10598523 3300014325 Bacteria 1166
309 Ga0163163_10640971 3300014325 Bacteria 1126
310 Ga0157380_10163258 3300014326 Bacteria 1938
311 Ga0157380_11483719 3300014326 Bacteria 731
312 Ga0157380_11814263 3300014326 Bacteria 669
313 Ga0157380_11895374 3300014326 Bacteria 656
314 Ga0157377_10010829 3300014745 Bacteria 4528
315 Ga0157377_10019077 3300014745 Bacteria 3578
316 Ga0157377_11214511 3300014745 Bacteria 584
317 Ga0157379_10060407 3300014968 Bacteria 3389
318 Ga0157379_10082807 3300014968 Bacteria 2875
319 Ga0157379_10158602 3300014968 Bacteria 2042
320 Ga0157376_10112791 3300014969 Bacteria 2396
321 Ga0157376_10173207 3300014969 Bacteria 1967
322 Ga0157376_10267190 3300014969 Bacteria 1605
323 Ga0163161_10004462 3300017792 Bacteria 9749
324 Ga0163161_10112537 3300017792 Bacteria 2036
325 Ga0163161_10218240 3300017792 Bacteria 1476
326 Ga0163161_10524998 3300017792 Bacteria 967
327 Ga0163161_11383615 3300017792 Bacteria 614
328 Ga0213876_10002748 3300021384 Bacteria 10248
329 Ga0213876_10027772 3300021384 Bacteria 2984
330 Ga0213875_10009632 3300021388 Bacteria 4885
331 Ga0213875_10069219 3300021388 Bacteria 1648
332 Ga0209673_1014992 3300025273 Bacteria 2969
333 Ga0209673_1042378 3300025273 Bacteria 1281
334 Ga0209051_1000075 3300025303 Bacteria 205011
335 Ga0209051_1000466 3300025303 Bacteria 53034
336 Ga0209051_1004758 3300025303 Bacteria 8205
337 Ga0207653_10021898 3300025885 Bacteria 2029
338 Ga0207653_10051267 3300025885 Bacteria 1374
339 Ga0207692_10032751 3300025898 Bacteria 2500
340 Ga0207692_10138641 3300025898 Bacteria 1381
341 Ga0207692_10296673 3300025898 Bacteria 982
342 Ga0207642_10029820 3300025899 Bacteria 2264
343 Ga0207710_10098201 3300025900 Bacteria 1378
344 Ga0207710_10156514 3300025900 Bacteria 1108
345 Ga0207688_10001015 3300025901 Bacteria 14329
346 Ga0207688_10005416 3300025901 Bacteria 6937
347 Ga0207647_10038054 3300025904 Bacteria 3044
348 Ga0207685_10013908 3300025905 Bacteria 2503
349 Ga0207685_10069466 3300025905 Bacteria 1423
350 Ga0207699_10104325 3300025906 Bacteria 1805
351 Ga0207699_10310030 3300025906 Bacteria 1104
352 Ga0207645_10213471 3300025907 Bacteria 1271
353 Ga0207643_10095756 3300025908 Bacteria 1735
354 Ga0207643_10456143 3300025908 Bacteria 814
355 Ga0207643_10631487 3300025908 Bacteria 690
356 Ga0207705_10000882 3300025909 Bacteria 24528
357 Ga0207705_10567972 3300025909 Bacteria 882
358 Ga0207684_10003011 3300025910 Bacteria 16706
359 Ga0207707_10006566 3300025912 Bacteria 10150
360 Ga0207695_10120739 3300025913 Bacteria 2589
361 Ga0207671_10647225 3300025914 Bacteria 842
362 Ga0207693_10003643 3300025915 Bacteria 13157
363 Ga0207693_10003901 3300025915 Bacteria 12701
364 Ga0207693_10660532 3300025915 Bacteria 812
365 Ga0207663_10036006 3300025916 Bacteria 2974
366 Ga0207663_10064718 3300025916 Bacteria 2334
367 Ga0207663_10717404 3300025916 Bacteria 792
368 Ga0207657_10042965 3300025919 Bacteria 3985
369 Ga0207657_10431613 3300025919 Bacteria 1035
370 Ga0207652_10719944 3300025921 Bacteria 890
371 Ga0207646_10040912 3300025922 Bacteria 4167
372 Ga0207646_10060050 3300025922 Bacteria 3395
373 Ga0207681_10843242 3300025923 Bacteria 766
374 Ga0207694_10257785 3300025924 Bacteria 1428
375 Ga0207694_10547001 3300025924 Bacteria 971
376 Ga0207694_11020954 3300025924 Bacteria 700
377 Ga0207650_10149344 3300025925 Bacteria 1843
378 Ga0207650_11321193 3300025925 Bacteria 614
379 Ga0207659_11710983 3300025926 Bacteria 535
380 Ga0207687_10011238 3300025927 Bacteria 5847
381 Ga0207687_10068875 3300025927 Bacteria 2522
382 Ga0207687_10127652 3300025927 Bacteria 1912
383 Ga0207687_10138701 3300025927 Bacteria 1842
384 Ga0207700_10058922 3300025928 Bacteria 2903
385 Ga0207700_10204299 3300025928 Bacteria 1666
386 Ga0207700_10273952 3300025928 Bacteria 1449
387 Ga0207664_10126512 3300025929 Bacteria 2146
388 Ga0207664_10227668 3300025929 Bacteria 1619
389 Ga0207664_10251002 3300025929 Bacteria 1544
390 Ga0207664_10590938 3300025929 Bacteria 997
391 Ga0207664_10989118 3300025929 Bacteria 754
392 Ga0207644_10006749 3300025931 Bacteria 7479
393 Ga0207644_10646508 3300025931 Bacteria 880
394 Ga0207690_10866446 3300025932 Bacteria 748
395 Ga0207706_10033872 3300025933 Bacteria 4546
396 Ga0207706_10070750 3300025933 Bacteria 3068
397 Ga0207686_10025849 3300025934 Bacteria 3421
398 Ga0207686_10258141 3300025934 Bacteria 1276
399 Ga0207686_10450802 3300025934 Bacteria 990
400 Ga0207709_10118990 3300025935 Bacteria 1780
401 Ga0207709_10408348 3300025935 Bacteria 1040
402 Ga0207670_10354551 3300025936 Bacteria 1163
403 Ga0207670_10972195 3300025936 Bacteria 713
404 Ga0207669_10662685 3300025937 Bacteria 854
405 Ga0207704_10087985 3300025938 Bacteria 2031
406 Ga0207704_10166459 3300025938 Bacteria 1575
407 Ga0207704_10269733 3300025938 Bacteria 1288
408 Ga0207665_10001686 3300025939 Bacteria 14855
409 Ga0207665_10006167 3300025939 Bacteria 7959
410 Ga0207665_10383195 3300025939 Bacteria 1067
411 Ga0207691_10028339 3300025940 Bacteria 5245
412 Ga0207691_10138993 3300025940 Bacteria 2141
413 Ga0207689_10002967 3300025942 Bacteria 15656
414 Ga0207689_10082267 3300025942 Bacteria 2647
415 Ga0207661_10088274 3300025944 Bacteria 2577
416 Ga0207679_10339979 3300025945 Bacteria 1305
417 Ga0207667_10480260 3300025949 Bacteria 1262
418 Ga0207667_11379517 3300025949 Bacteria 679
419 Ga0207651_10189840 3300025960 Bacteria 1638
420 Ga0207651_11673366 3300025960 Bacteria 573
421 Ga0207712_10203715 3300025961 Bacteria 1571
422 Ga0207712_10218756 3300025961 Bacteria 1521
423 Ga0207712_10345390 3300025961 Bacteria 1235
424 Ga0207712_11379179 3300025961 Bacteria 631
425 Ga0207712_12058371 3300025961 Bacteria 511
426 Ga0207668_10060585 3300025972 Bacteria 2657
427 Ga0207668_10216168 3300025972 Bacteria 1536
428 Ga0207668_10800836 3300025972 Bacteria 834
429 Ga0207640_10057345 3300025981 Bacteria 2561
430 Ga0207640_10091443 3300025981 Bacteria 2108
431 Ga0207640_10221425 3300025981 Bacteria 1449
432 Ga0207658_10312782 3300025986 Bacteria 1357
433 Ga0207658_10425726 3300025986 Bacteria 1171
434 Ga0207658_10769480 3300025986 Bacteria 873
435 Ga0207658_11085516 3300025986 Bacteria 731
436 Ga0207677_10035531 3300026023 Bacteria 3238
437 Ga0207677_10391992 3300026023 Bacteria 1175
438 Ga0207677_11577565 3300026023 Bacteria 607
439 Ga0207677_11750934 3300026023 Bacteria 576
440 Ga0207703_10020553 3300026035 Bacteria 5164
441 Ga0207703_10140404 3300026035 Bacteria 2096
442 Ga0207703_10172881 3300026035 Bacteria 1901
443 Ga0207703_10295714 3300026035 Bacteria 1475
444 Ga0207639_10055585 3300026041 Bacteria 3030
445 Ga0207639_10108191 3300026041 Bacteria 2260
446 Ga0207639_10117639 3300026041 Bacteria 2178
447 Ga0207678_10001619 3300026067 Bacteria 20711
448 Ga0207678_11311455 3300026067 Bacteria 640
449 Ga0207708_10146771 3300026075 Bacteria 1854
450 Ga0207702_10071613 3300026078 Bacteria 2985
451 Ga0207702_10911971 3300026078 Bacteria 871
452 Ga0207641_10071087 3300026088 Bacteria 2992
453 Ga0207641_10130639 3300026088 Bacteria 2255
454 Ga0207641_10271248 3300026088 Bacteria 1592
455 Ga0207648_10021008 3300026089 Bacteria 5876
456 Ga0207676_10192151 3300026095 Bacteria 1797
457 Ga0207674_11383414 3300026116 Bacteria 673
458 Ga0207675_100009746 3300026118 Bacteria 8993
459 Ga0207675_100031985 3300026118 Bacteria 4902
460 Ga0207675_101016837 3300026118 Bacteria 847
461 Ga0207675_101951212 3300026118 Bacteria 605
462 Ga0207683_10016291 3300026121 Bacteria 6326
463 Ga0207683_10202392 3300026121 Bacteria 1805
464 Ga0207683_11861070 3300026121 Bacteria 551
465 Ga0209813_10044759 3300027866 Bacteria 1361
466 Ga0209813_10221756 3300027866 Bacteria 708
467 Ga0207428_10104749 3300027907 Bacteria 2182
468 Ga0207428_10151501 3300027907 Bacteria 1765
469 Ga0224573_1003159 3300028019 Bacteria 1217
470 Ga0268266_10457713 3300028379 Bacteria 1214
471 Ga0268265_10392769 3300028380 Bacteria 1280
472 Ga0268265_10466148 3300028380 Bacteria 1183
473 Ga0268265_12554435 3300028380 Bacteria 517
474 Ga0268264_10058126 3300028381 Bacteria 3237
475 Ga0268264_10771532 3300028381 Bacteria 959
476 Ga0268264_11885461 3300028381 Bacteria 607
477 Ga0265327_10001602 3300031251 Bacteria 27454
478 Ga0307413_10132620 3300031824 Bacteria 1708
479 Ga0307413_10462873 3300031824 Bacteria 1009
480 Ga0307410_10018179 3300031852 Bacteria 4243
481 Ga0307410_10099240 3300031852 Bacteria 2084
482 Ga0307410_10319230 3300031852 Bacteria 1232
483 Ga0307410_10907604 3300031852 Bacteria 755
484 Ga0307407_10209032 3300031903 Bacteria 1313
485 Ga0307407_10395204 3300031903 Bacteria 990
486 Ga0307407_10465516 3300031903 Bacteria 920
487 Ga0307412_10123439 3300031911 Bacteria 1869
488 Ga0307409_100130969 3300031995 Bacteria 2143
489 Ga0307409_100199169 3300031995 Bacteria 1790
490 Ga0307409_100243377 3300031995 Bacteria 1639
491 Ga0307409_101033071 3300031995 Bacteria 841
492 Ga0307409_101901421 3300031995 Bacteria 625
493 Ga0307409_102202197 3300031995 Bacteria 581
494 Ga0307409_102205218 3300031995 Bacteria 580
495 Ga0307416_100250550 3300032002 Bacteria 1723
496 Ga0307416_101160145 3300032002 Bacteria 878
497 Ga0307416_101444470 3300032002 Bacteria 794
498 Ga0307416_102439005 3300032002 Bacteria 622
499 Ga0307415_100351073 3300032126 Bacteria 1242
500 Ga0373948_0206759 3300034817 Bacteria 514
501 Ga0373958_0031466 3300034819 Bacteria 1043
502 Ga0373938_0100244 3300034957 Bacteria 727
503 Ga0373938_0142875 3300034957 Bacteria 632
504 Ga0373928_0015958 3300035084 Bacteria 1533
505 Ga0373929_0020830 3300035085 Bacteria 1325
506 Ga0373929_0117155 3300035085 Bacteria 687
507 Ga0373940_0024350 3300035088 Bacteria 1569
508 Ga0373949_0009851 3300035090 Bacteria 2091
509 Ga0373951_0021877 3300035091 Bacteria 1470
510 Ga0373932_0027964 3300035112 Bacteria 1547
511 Ga0373932_0188137 3300035112 Bacteria 728
512 Ga0373939_0015136 3300035114 Bacteria 2013
513 Ga0373941_0272189 3300035115 Bacteria 667
514 Ga0373960_0013123 3300035121 Bacteria 2072
515 Ga0373946_0390001 3300035171 Bacteria 702
516 Ga0373942_0020860 3300035207 Bacteria 1649
517 Ga0373961_0063060 3300035241 Bacteria 1130
518 Ga0373962_0032461 3300035242 Bacteria 1436
519 Ga0316574_0743597 3300035398 Bacteria 599
520 Ga0373931_0033341 3300035691 Bacteria 2668
521 Ga0373931_0082406 3300035691 Bacteria 1778
522 Ga0373931_0329621 3300035691 Bacteria 950
523 Ga0373927_0086100 3300035695 Bacteria 2040
524 Ga0395898_0319516 3300037466 Bacteria 1481
525 Ga0436364_0136088 3300037853 Bacteria 17933
526 Ga0436364_0203662 3300037853 Bacteria 6669
527 Ga0436364_0220105 3300037853 Bacteria 2263
528 Ga0436364_0564415 3300037853 Bacteria 887
529 Ga0436364_1341515 3300037853 Bacteria 6365
530 Ga0395901_0193097 3300038443 Bacteria 2135
531 Ga0395901_1532099 3300038443 Bacteria 622
532 Ga0436365_0456050 3300039437 Bacteria 1789
533 Ga0436365_1049793 3300039437 Unclassified 1416
534 Ga0436365_1054830 3300039437 Bacteria 5333
535 Ga0436365_1454613 3300039437 Bacteria 26721
536 Ga0436363_1568153 3300039450 Bacteria 645
537 Ga0436362_0184727 3300039453 Bacteria 1010
538 Ga0436362_0606133 3300039453 Bacteria 2219
539 Ga0439436_0044663 3300041404 Bacteria 1262
540 Ga0439436_0092224 3300041404 Bacteria 844
541 Ga0439439_0057377 3300041406 Bacteria 1029
542 Ga0439466_0039547 3300041411 Bacteria 1580
543 Ga0439465_0004011 3300041413 Bacteria 4799
544 Ga0439465_0085663 3300041413 Bacteria 1073
545 Ga0451791_0658588 3300041451 Bacteria 1824
546 Ga0451793_1281738 3300041452 Bacteria 1008
547 Ga0451793_1692933 3300041452 Bacteria 1228
548 Ga0451795_0426143 3300041456 Bacteria 1106
549 Ga0451802_1479392 3300041460 Bacteria 670
550 Ga0451806_212474 3300041462 Bacteria 925
551 Ga0451807_2065124 3300041486 Bacteria 957
552 Ga0451833_1305560 3300041491 Bacteria 1106
553 Ga0451843_0152064 3300041509 Bacteria 638
554 Ga0451853_0305186 3300041512 Bacteria 763
555 Ga0439445_0004114 3300042004 Bacteria 3285
556 Ga0439452_079713 3300042010 Bacteria 714
557 Ga0439462_0034955 3300042015 Bacteria 1335
558 Ga0439463_082137 3300042016 Bacteria 829
559 Ga0439434_0003530 3300042435 Bacteria 4568
560 Ga0439434_0206651 3300042435 Bacteria 663
561 Ga0466969_0041458 3300044656 Bacteria 2303
562 Ga0466972_0023833 3300044658 Bacteria 3041
563 Ga0466972_0047757 3300044658 Bacteria 2069
564 Ga0466965_0054704 3300044683 Bacteria 1985
565 Ga0466965_0065653 3300044683 Bacteria 1818
566 Ga0466966_0141913 3300044684 Bacteria 1467
567 Ga0466966_0644045 3300044684 Bacteria 638
568 Ga0466961_0014853 3300044693 Bacteria 5003
569 Ga0466961_0454618 3300044693 Bacteria 775
570 Ga0466963_0069425 3300044694 Bacteria 2368
571 Ga0466963_0076835 3300044694 Bacteria 2255
572 Ga0466964_0089980 3300044706 Bacteria 1334
573 Ga0466971_0069018 3300044719 Bacteria 1603
574 Ga0466968_0064233 3300044735 Bacteria 1587
575 Ga0466968_0107272 3300044735 Bacteria 1253
576 Ga0466968_0202878 3300044735 Bacteria 929
577 Ga0466970_0313691 3300044765 Bacteria 886
578 Ga0466970_0330033 3300044765 Bacteria 863
579 Ga0466970_0602062 3300044765 Bacteria 637
580 Ga0466957_0153000 3300044842 Bacteria 1493
581 Ga0466957_0322917 3300044842 Bacteria 1042
582 Ga0466960_0000870 3300044901 Bacteria 10670
583 Ga0466960_0184643 3300044901 Bacteria 1132
584 Ga0466960_0324043 3300044901 Bacteria 873
585 Ga0466959_0088673 3300045049 Bacteria 2224
586 Ga0466959_0598101 3300045049 Bacteria 742
587 Ga0466958_0002298 3300045836 Bacteria 9532
588 Ga0466958_0018386 3300045836 Bacteria 4056
589 Ga0466958_0194765 3300045836 Bacteria 1289
590 Ga0466958_1094197 3300045836 Bacteria 520
591 Ga0466967_0146847 3300045976 Bacteria 2200
592 Ga0466967_0187181 3300045976 Bacteria 1955
593 Ga0466967_1939965 3300045976 Bacteria 586
594 Ga0466967_2477444 3300045976 Bacteria 514
595 Ga0495603_0311767 3300046455 Bacteria 904
596 Ga0495629_0010758 3300046459 Bacteria 6656
597 Ga0495641_0028600 3300046461 Bacteria 2696
598 Ga0495641_0205132 3300046461 Bacteria 884
599 Ga0495582_0064349 3300046473 Bacteria 2025
600 Ga0495584_0154879 3300046491 Bacteria 1164
601 Ga0495594_0461057 3300046499 Bacteria 722
602 Ga0495608_0865063 3300046511 Bacteria 531
603 Ga0495620_0342764 3300046515 Bacteria 567
604 Ga0495630_0354376 3300046517 Bacteria 1123
605 Ga0495640_0033995 3300046533 Bacteria 3620
606 Ga0495640_0369052 3300046533 Bacteria 884
607 Ga0495597_0265398 3300046542 Bacteria 672
608 Ga0495667_0487809 3300046559 Bacteria 772
609 Ga0495656_0354314 3300046615 Bacteria 761
610 Ga0495656_0521380 3300046615 Bacteria 632
611 Ga0495611_0500480 3300046648 Bacteria 552
612 Ga0495625_0339748 3300046660 Bacteria 952
613 Ga0495647_0311438 3300046681 Bacteria 711
614 Ga0495658_0146905 3300046683 Bacteria 1446
615 Ga0495658_0778077 3300046683 Bacteria 613
616 Ga0495613_0295996 3300046689 Bacteria 1121
617 Ga0495624_0277602 3300046690 Bacteria 1012
618 Ga0495660_0527084 3300046810 Bacteria 502
619 Ga0495581_0015805 3300047315 Bacteria 4383
620 Ga0495674_0020932 3300047319 Bacteria 6055
621 Ga0495672_0004714 3300047320 Bacteria 11028
622 Ga0495676_0053604 3300047321 Bacteria 3213
623 Ga0495686_0003209 3300047472 Bacteria 14397
624 Ga0495686_0128212 3300047472 Bacteria 1507
625 Ga0495593_0014564 3300047673 Bacteria 4469
626 Ga0496100_0066355 3300048903 Bacteria 2393
627 Ga0496100_0214763 3300048903 Bacteria 1409
628 Ga0496100_0245078 3300048903 Bacteria 1324
629 Ga0496100_0642372 3300048903 Bacteria 826
630 Ga0496100_0777288 3300048903 Bacteria 750
631 Ga0496101_0069232 3300048904 Bacteria 2581
632 Ga0496101_0182729 3300048904 Bacteria 1615
633 Ga0496101_0613556 3300048904 Bacteria 860
634 Ga0496102_0038178 3300048905 Bacteria 4333
635 Ga0496102_0046277 3300048905 Bacteria 3951
636 Ga0496102_0195559 3300048905 Bacteria 1906
637 Ga0496102_0632892 3300048905 Bacteria 993
638 Ga0496102_0648191 3300048905 Bacteria 979
639 Ga0496103_0046029 3300048906 Bacteria 2693
640 Ga0496103_0080359 3300048906 Bacteria 2050
641 Ga0496103_0083362 3300048906 Bacteria 2013
642 Ga0496103_0981817 3300048906 Bacteria 526
643 Ga0496104_0030264 3300048907 Bacteria 5029
644 Ga0496104_0475862 3300048907 Bacteria 1160
645 Ga0496104_0721397 3300048907 Bacteria 904
646 Ga0496105_0374894 3300048908 Bacteria 1133
647 Ga0496106_0062268 3300048909 Bacteria 2832
648 Ga0496106_0205166 3300048909 Bacteria 1569
649 Ga0496106_1264245 3300048909 Bacteria 574
650 Ga0496106_1341452 3300048909 Bacteria 554
651 Ga0496107_0419787 3300048910 Bacteria 994
652 Ga0496107_1097385 3300048910 Bacteria 575
653 Ga0496108_0017889 3300048911 Bacteria 5798
654 Ga0496108_0021043 3300048911 Bacteria 5360
655 Ga0496108_0032783 3300048911 Bacteria 4314
656 Ga0496108_0180275 3300048911 Bacteria 1829
657 Ga0496108_0820802 3300048911 Bacteria 801
658 Ga0496108_0878851 3300048911 Bacteria 770
659 Ga0496109_0008333 3300048912 Bacteria 8802
660 Ga0496109_0047406 3300048912 Bacteria 3907
661 Ga0496109_0116458 3300048912 Bacteria 2487
662 Ga0496109_0119606 3300048912 Bacteria 2453
663 Ga0496109_0387675 3300048912 Bacteria 1320
664 Ga0496109_0495904 3300048912 Bacteria 1153
665 Ga0496109_1780152 3300048912 Bacteria 549
666 Ga0496110_0016634 3300048913 Bacteria 6143
667 Ga0496110_0063575 3300048913 Bacteria 3261
668 Ga0496110_0107349 3300048913 Bacteria 2506
669 Ga0496110_0212885 3300048913 Bacteria 1757
670 Ga0496111_0142146 3300048914 Bacteria 1778
671 Ga0496111_0248290 3300048914 Bacteria 1321
672 Ga0496112_0033322 3300048915 Bacteria 5007
673 Ga0496112_0065402 3300048915 Bacteria 3588
674 Ga0496113_0010523 3300048916 Bacteria 6118
675 Ga0496113_0074117 3300048916 Bacteria 2595
676 Ga0496113_0241763 3300048916 Bacteria 1440
677 Ga0496113_0689528 3300048916 Bacteria 816
678 Ga0496114_0093266 3300048917 Bacteria 2559
679 Ga0496114_0131437 3300048917 Bacteria 2162
680 Ga0496114_0244297 3300048917 Bacteria 1579
681 Ga0496115_0051634 3300048918 Bacteria 3296
682 Ga0496115_0113966 3300048918 Bacteria 2222
683 Ga0496124_0247008 3300048927 Bacteria 1323
684 Ga0496124_0677064 3300048927 Bacteria 658
685 Ga0496126_0558507 3300048929 Bacteria 907
686 Ga0501032_0011156 3300049569 Bacteria 6457
687 Ga0501032_0055595 3300049569 Unclassified 2663
688 Ga0501033_0024957 3300049570 Bacteria 4505
689 Ga0501033_0340554 3300049570 Unclassified 1051
690 Ga0501034_0416538 3300049571 Bacteria 1265
691 Ga0501036_0114619 3300049572 Bacteria 2277
692 Ga0501036_0334094 3300049572 Bacteria 1266
693 Ga0501036_0470175 3300049572 Bacteria 1047
694 Ga0501037_0152463 3300049573 Unclassified 1651
695 Ga0501037_0213725 3300049573 Bacteria 1359
696 Ga0501038_0030399 3300049574 Bacteria 4781
697 Ga0501038_0412265 3300049574 Bacteria 1044
698 Ga0501038_0625916 3300049574 Bacteria 812
699 Ga0501038_0675490 3300049574 Unclassified 776
700 Ga0501039_0003877 3300049575 Bacteria 11224
701 Ga0501039_0080171 3300049575 Bacteria 2540
702 Ga0501039_0199783 3300049575 Bacteria 1572
703 Ga0501040_0051381 3300049576 Bacteria 2819
704 Ga0501040_0322734 3300049576 Bacteria 1104
705 Ga0501040_0886427 3300049576 Bacteria 646
706 Ga0501040_0893549 3300049576 Bacteria 643
707 Ga0501041_0055841 3300049577 Bacteria 2411
708 Ga0501041_0231730 3300049577 Unclassified 1160
709 Ga0501041_0253011 3300049577 Bacteria 1107
710 Ga0501042_0004699 3300049578 Bacteria 8716
711 Ga0501043_0042813 3300049579 Bacteria 3559
712 Ga0501046_0002786 3300049580 Bacteria 16268
713 Ga0501046_0263377 3300049580 Bacteria 1266
714 Ga0501046_0295373 3300049580 Bacteria 1184
715 Ga0501046_0675958 3300049580 Bacteria 729
716 Ga0501047_0009880 3300049581 Bacteria 9019
717 Ga0501048_0020040 3300049582 Bacteria 4905
718 Ga0501048_0049283 3300049582 Bacteria 3002
719 Ga0501048_0115213 3300049582 Bacteria 1899
720 Ga0501067_0424847 3300049583 Bacteria 742
721 Ga0501068_0006530 3300049584 Bacteria 6435
722 Ga0501068_0022885 3300049584 Bacteria 3658
723 Ga0501068_0274464 3300049584 Bacteria 1077
724 Ga0501068_0527202 3300049584 Bacteria 767
725 Ga0501068_0578651 3300049584 Bacteria 731
726 Ga0501068_0618531 3300049584 Bacteria 706
727 Ga0501069_0021436 3300049585 Bacteria 3507
728 Ga0501069_0209032 3300049585 Bacteria 1132
729 Ga0501069_0567822 3300049585 Bacteria 679
730 Ga0501069_0743701 3300049585 Bacteria 593
731 Ga0501070_0246556 3300049586 Bacteria 1462
732 Ga0501071_0004766 3300049587 Bacteria 8634
733 Ga0501071_0006695 3300049587 Bacteria 7490
734 Ga0501071_0475130 3300049587 Bacteria 958
735 Ga0501071_0551731 3300049587 Unclassified 885
736 Ga0501072_0002058 3300049588 Bacteria 14955
737 Ga0501072_0010557 3300049588 Bacteria 7031
738 Ga0501072_0056885 3300049588 Bacteria 3081
739 Ga0501072_0171787 3300049588 Bacteria 1730
740 Ga0501073_0062107 3300049589 Unclassified 2606
741 Ga0501074_0009527 3300049590 Bacteria 7054
742 Ga0501074_0121727 3300049590 Bacteria 1866
743 Ga0501074_0867532 3300049590 Bacteria 635
744 Ga0501074_0988289 3300049590 Bacteria 592
745 Ga0501075_0013170 3300049591 Bacteria 5897
746 Ga0501075_0015145 3300049591 Bacteria 5530
747 Ga0501075_0043298 3300049591 Bacteria 3376
748 Ga0501075_0058659 3300049591 Bacteria 2899
749 Ga0501076_0055748 3300049592 Bacteria 3134
750 Ga0501076_0352562 3300049592 Bacteria 1208
751 Ga0501076_0542434 3300049592 Unclassified 959
752 Ga0501076_0569099 3300049592 Bacteria 934
753 Ga0501076_0680541 3300049592 Bacteria 849
754 Ga0501076_0910825 3300049592 Bacteria 725
755 Ga0501077_0049970 3300049593 Bacteria 2658
756 Ga0501077_0062270 3300049593 Bacteria 2367
757 Ga0501077_0106076 3300049593 Bacteria 1781
758 Ga0501079_0012469 3300049741 Bacteria 6488
759 Ga0501079_0043246 3300049741 Unclassified 3477
760 Ga0501079_0056350 3300049741 Bacteria 3033
761 Ga0501079_0258393 3300049741 Bacteria 1361
762 Ga0501080_0014950 3300049742 Bacteria 7146
763 Ga0501080_0842149 3300049742 Bacteria 802
764 Ga0501081_0011559 3300049743 Bacteria 5776
765 Ga0501081_0145415 3300049743 Bacteria 1701
766 Ga0501081_0210631 3300049743 Bacteria 1411
767 Ga0501081_0288490 3300049743 Bacteria 1202
768 Ga0501081_0758097 3300049743 Bacteria 730
769 Ga0501083_0208262 3300049744 Unclassified 1275
770 Ga0501083_0267812 3300049744 Bacteria 1111
771 Ga0501035_0000685 3300049822 Bacteria 37052
772 Ga0501035_0046524 3300049822 Bacteria 3903
773 Ga0501035_0421074 3300049822 Bacteria 1109
774 Ga0501044_0003313 3300049823 Bacteria 18143
775 Ga0501044_0374381 3300049823 Unclassified 1340
776 Ga0501045_0018333 3300049824 Bacteria 4978
777 Ga0501045_0168724 3300049824 Unclassified 1630
778 Ga0501045_0226076 3300049824 Bacteria 1393
779 Ga0501045_0281220 3300049824 Bacteria 1239
780 Ga0501045_0586489 3300049824 Bacteria 826
781 nmdc:mga03683_142555_c1 3300050489 Bacteria 1078
782 nmdc:mga03683_22585_c1 3300050489 Bacteria 1969
783 nmdc:mga03683_63653_c1 3300050489 Bacteria 1564
784 nmdc:mga03683_92333_c1 3300050489 Bacteria 1321
785 nmdc:mga03n38_11046_c1 3300050490 Bacteria 3349
786 nmdc:mga03n38_126541_c1 3300050490 Bacteria 1262
787 nmdc:mga03n38_240230_c1 3300050490 Bacteria 953
788 nmdc:mga03n38_424145_c1 3300050490 Bacteria 736
789 nmdc:mga03n38_842663_c1 3300050490 Bacteria 536
790 nmdc:mga00v17_172414_c1 3300050491 Bacteria 1395
791 nmdc:mga00v17_214366_c1 3300050491 Bacteria 1246
792 nmdc:mga00v17_23598_c1 3300050491 Bacteria 3559
793 nmdc:mga00v17_286655_c1 3300050491 Bacteria 1069
794 nmdc:mga00v17_36389_c1 3300050491 Bacteria 2933
795 nmdc:mga00v17_412054_c1 3300050491 Bacteria 878
796 nmdc:mga00v17_447363_c1 3300050491 Bacteria 839
797 nmdc:mga00v17_447947_c1 3300050491 Bacteria 838
798 nmdc:mga00v17_8990_c1 3300050491 Bacteria 5391
799 nmdc:mga0yw44_299035_c1 3300050492 Bacteria 1078
800 nmdc:mga0yw44_346704_c1 3300050492 Bacteria 999
801 nmdc:mga0yw44_4116_c1 3300050492 Bacteria 6597
802 nmdc:mga0yw44_50646_c1 3300050492 Bacteria 2512
803 nmdc:mga0k408_53443_c1 3300050493 Bacteria 2341
804 nmdc:mga06z11_105627_c1 3300050494 Bacteria 1552
805 nmdc:mga06z11_190888_c1 3300050494 Bacteria 1186
806 nmdc:mga06z11_207577_c1 3300050494 Bacteria 1140
807 nmdc:mga06z11_212613_c1 3300050494 Bacteria 1127
808 nmdc:mga06z11_226894_c1 3300050494 Bacteria 1093
809 nmdc:mga06z11_383905_c1 3300050494 Bacteria 844
810 nmdc:mga06z11_584687_c1 3300050494 Bacteria 679
811 nmdc:mga06z11_853085_c1 3300050494 Bacteria 555
812 nmdc:mga04h51_53623_c1 3300050495 Bacteria 1361
813 nmdc:mga07m45_104697_c1 3300050496 Bacteria 1627
814 nmdc:mga07m45_205708_c1 3300050496 Bacteria 1145
815 nmdc:mga07m45_21738_c1 3300050496 Bacteria 3496
816 nmdc:mga07m45_250689_c1 3300050496 Bacteria 1030
817 nmdc:mga07m45_320577_c1 3300050496 Bacteria 901
818 nmdc:mga07m45_6789_c1 3300050496 Bacteria 5814
819 nmdc:mga0qj67_102858_c1 3300050509 Bacteria 2304
820 nmdc:mga0qj67_316432_c1 3300050509 Bacteria 1264
821 nmdc:mga08y16_342583_c1 3300050511 Bacteria 1536
822 nmdc:mga08y16_86846_c1 3300050511 Bacteria 3259
823 nmdc:mga0n895_1799014_c1 3300050512 Bacteria 573
824 nmdc:mga0n895_91173_c1 3300050512 Bacteria 3050
825 nmdc:mga0rr50_167275_c1 3300050513 Bacteria 1789
826 nmdc:mga08x19_442964_c1 3300050514 Bacteria 914
827 nmdc:mga0a205_25239_c1 3300050515 Bacteria 5661
828 nmdc:mga0sz30_16844_c1 3300050516 Bacteria 2907
829 nmdc:mga0sz30_195640_c1 3300050516 Bacteria 897
830 nmdc:mga0sz30_242453_c1 3300050516 Bacteria 802
831 nmdc:mga0sz30_305243_c1 3300050516 Bacteria 710
832 nmdc:mga0sz30_420867_c1 3300050516 Bacteria 599
833 nmdc:mga0sz30_57762_c1 3300050516 Bacteria 1654
834 nmdc:mga0sz30_6647_c1 3300050516 Bacteria 4307
835 Ga0495601_0565503 3300053077 Bacteria 731
836 Ga0495601_0955092 3300053077 Bacteria 540
837 Ga0495655_0217067 3300053083 Bacteria 631
838 Ga0495619_0435418 3300053085 Bacteria 904
839 Ga0500643_055551 3300053087 Bacteria 1121
840 Ga0501084_0046604 3300054114 Bacteria 3632
841 Ga0501082_0000537 3300060353 Bacteria 33718
842 Ga0501082_0135156 3300060353 Bacteria 2139
843 Ga0501082_0168124 3300060353 Bacteria 1906
844 Ga0501082_0476069 3300060353 Bacteria 1091
845 Ga0466962_0004130 3300061719 Bacteria 6958
846 Ga0466962_0053955 3300061719 Bacteria 1921
847 Ga0530510_0004142 3300061734 Bacteria 10013
848 Ga0530510_0013545 3300061734 Bacteria 5736
849 Ga0530510_0023906 3300061734 Bacteria 4358
850 Ga0530510_0643794 3300061734 Bacteria 807
851 Ga0530510_0683456 3300061734 Bacteria 782
852 Ga0530510_1584852 3300061734 Bacteria 503
853 2644486186 2643221687 Bacteria 6500351
854 2738667448 2738541264 Bacteria 5935393
855 2739146518 2738541356 Bacteria 5935017
856 2902840469 2902837492 Bacteria 6697721
857 Ga0207688_10114605
858 JGI24750J21931_1046690
859 JGI24744J21845_10008718
860 JGI24034J26672_10013077
861 JGI24034J26672_10110439
862 Ga0055540_1000057
863 Ga0055540_1000710
864 Ga0055540_1000951
865 Ga0070683_100069881
866 Ga0070690_100338043
867 Ga0070670_100689742
868 Ga0068869_100105153
869 Ga0068869_100311234
870 Ga0070666_10014474
871 Ga0070682_100259708
872 Ga0068868_100058153
873 Ga0068868_100676456
874 Ga0068868_101173492
875 Ga0070660_100027313
876 Ga0070660_100207266
877 Ga0070689_100088316
878 Ga0070689_100329003
879 Ga0070689_101039393
880 Ga0070691_10023955
881 Ga0070691_10437741
882 Ga0070691_10771330
883 Ga0070691_10987443
884 Ga0070661_100259969
885 Ga0070661_101145486
886 Ga0070692_10134992
887 Ga0070692_10370043
888 Ga0070668_100027831
889 Ga0070668_100135230
890 Ga0070668_100153207
891 Ga0070668_100477745
892 Ga0070669_100808949
893 Ga0070669_101708122
894 Ga0070671_100015987
895 Ga0070671_100045113
896 Ga0070671_100732601
897 Ga0070671_101059993
898 Ga0070674_100050320
899 Ga0070674_100740904
900 Ga0070673_100031871
901 Ga0070673_101147627
902 Ga0070688_100217490
903 Ga0070659_100029195
904 Ga0070659_100093698
905 Ga0070667_100167429
906 Ga0070667_100274022
907 Ga0070703_10015534
908 Ga0070709_10035737
909 Ga0070709_10149086
910 Ga0070714_100041434
911 Ga0070714_100169325
912 Ga0070714_100420599
913 Ga0070714_101124904
914 Ga0070713_100058301
915 Ga0070713_100092719
916 Ga0070713_100575187
917 Ga0070713_101445660
918 Ga0070710_10003496
919 Ga0070710_10037726
920 Ga0070710_10057200
921 Ga0070701_10008680
922 Ga0070711_100014133
923 Ga0070711_100055425
924 Ga0070705_100079586
925 Ga0070700_100071747
926 Ga0070700_100649177
927 Ga0070694_100059765
928 Ga0070694_100295424
929 Ga0070708_101142342
930 Ga0070663_100025408
931 Ga0070663_100055994
932 Ga0070663_100073099
933 Ga0070663_100213699
934 Ga0070678_100005012
935 Ga0070662_100086718
936 Ga0070681_10040349
937 Ga0070681_10233284
938 Ga0070681_10868847
939 Ga0068867_100238724
940 Ga0068867_101449347
941 Ga0070685_10014290
942 Ga0070685_10202543
943 Ga0070685_10208521
944 Ga0070685_10876367
945 Ga0070706_100009587
946 Ga0070707_100007797
947 Ga0070707_100105674
948 Ga0070698_100017226
949 Ga0070698_100663738
950 Ga0070699_100374003
951 Ga0070684_100041900
952 Ga0070684_100108394
953 Ga0070697_100250680
954 Ga0070697_100496310
955 Ga0068853_100103584
956 Ga0068853_100136865
957 Ga0068853_100886575
958 Ga0070672_100659724
959 Ga0070686_100230315
960 Ga0070695_100001581
961 Ga0070696_100133525
962 Ga0070696_101176440
963 Ga0070693_100103608
964 Ga0070693_100962209
965 Ga0070665_100084793
966 Ga0070665_100295744
967 Ga0070665_100942566
968 Ga0070704_100022142
969 Ga0070704_100067514
970 Ga0070704_100155095
971 Ga0068855_100029678
972 Ga0068855_100608249
973 Ga0068855_100893420
974 Ga0068855_100918258
975 Ga0070664_100078280
976 Ga0068857_101429364
977 Ga0068854_100069849
978 Ga0068856_100076961
979 Ga0068856_100862104
980 Ga0068856_100993908
981 Ga0070702_100661069
982 Ga0068852_100228262
983 Ga0068852_100478145
984 Ga0068859_100049473
985 Ga0068859_100376792
986 Ga0068859_100495641
987 Ga0068859_100542094
988 Ga0068859_101747810
989 Ga0068864_100077719
990 Ga0068864_100217854
991 Ga0068866_10030885
992 Ga0068866_10768108
993 Ga0068861_100017454
994 Ga0068861_100083286
995 Ga0068861_100639344
996 Ga0068861_101171324
997 Ga0068870_10639879
998 Ga0068863_100094036
999 Ga0068863_100239520
1000 Ga0068858_100164677
1001 Ga0068858_100306664
1002 Ga0068858_100342451
1003 Ga0068858_100345110
1004 Ga0068858_100622269
1005 Ga0068860_100166752
1006 Ga0068860_100827985
1007 Ga0068862_100198939
1008 Ga0068862_100310837
1009 Ga0068862_100331074
1010 Ga0068862_100496061
1011 Ga0068862_101264928
1012 Ga0081455_10026424
1013 Ga0081455_10251443
1014 Ga0081538_10158524
1015 Ga0081539_10014925
1016 Ga0070717_10003028
1017 Ga0070717_10107315
1018 Ga0075365_10005619
1019 Ga0075365_10009500
1020 Ga0075365_10243610
1021 Ga0075365_10358458
1022 Ga0075368_10003351
1023 Ga0075363_100008629
1024 Ga0075363_100008757
1025 Ga0075363_100027476
1026 Ga0075363_100030350
1027 Ga0075363_100134655
1028 Ga0075363_100152831
1029 Ga0075363_100245791
1030 Ga0075364_10019553
1031 Ga0075364_10032511
1032 Ga0075364_10075677
1033 Ga0075364_10338880
1034 Ga0075364_10445287
1035 Ga0075364_10475917
1036 Ga0075432_10242536
1037 Ga0070715_10128709
1038 Ga0070715_10144574
1039 Ga0070715_10333036
1040 Ga0070716_100055138
1041 Ga0070716_100267841
1042 Ga0070716_101045158
1043 Ga0070712_100028964
1044 Ga0070712_100332404
1045 Ga0075362_10019967
1046 Ga0075362_10034621
1047 Ga0075362_10054358
1048 Ga0075362_10155228
1049 Ga0075367_10032313
1050 Ga0075367_10171444
1051 Ga0075367_10187617
1052 Ga0075367_10231622
1053 Ga0075367_10244013
1054 Ga0075367_10315468
1055 Ga0075367_10464285
1056 Ga0075367_10520219
1057 Ga0075367_10542578
1058 Ga0075369_10004266
1059 Ga0075369_10012184
1060 Ga0075369_10014240
1061 Ga0075369_10018636
1062 Ga0075369_10054265
1063 Ga0075369_10102196
1064 Ga0075369_10104232
1065 Ga0075369_10307480
1066 Ga0075369_10510953
1067 Ga0075366_10245729
1068 Ga0097621_100238480
1069 Ga0097621_100275412
1070 Ga0097621_100370421
1071 Ga0075370_10019687
1072 Ga0075370_10109297
1073 Ga0075370_10140617
1074 Ga0075370_10160209
1075 Ga0075370_10342249
1076 Ga0068871_100665338
1077 Ga0075430_100111180
1078 Ga0075430_100249923
1079 Ga0075430_100321513
1080 Ga0075433_10078685
1081 Ga0075434_101180991
1082 Ga0075434_102290876
1083 Ga0068865_100110943
1084 Ga0068865_100208743
1085 Ga0075436_100173910
1086 Ga0097620_100049474
1087 Ga0097620_100376800
1088 Ga0097620_100495626
1089 Ga0097620_100542206
1090 Ga0097620_101747371
1091 Ga0075435_100013188
1092 Ga0075435_101287315
1093 Ga0099794_10380513
1094 Ga0105251_10267010
1095 Ga0105250_10082813
1096 Ga0105240_10079574
1097 Ga0105240_10822163
1098 Ga0111539_10123649
1099 Ga0111539_10284799
1100 Ga0111539_10916597
1101 Ga0111539_11251012
1102 Ga0105245_10011525
1103 Ga0105245_10123186
1104 Ga0105245_10130446
1105 Ga0105247_10018616
1106 Ga0105247_10102356
1107 Ga0105247_10650045
1108 Ga0114129_10271682
1109 Ga0105243_10070732
1110 Ga0105243_10098267
1111 Ga0105243_10220054
1112 Ga0105241_10067616
1113 Ga0105241_11716648
1114 Ga0105242_10317092
1115 Ga0105242_10467858
1116 Ga0105242_11367903
1117 Ga0105242_11778294
1118 Ga0105248_10027042
1119 Ga0105248_11050790
1120 Ga0105237_10281491
1121 Ga0105237_10358355
1122 Ga0105237_10657886
1123 Ga0105238_10136510
1124 Ga0105238_10600247
1125 Ga0105249_10092851
1126 Ga0105249_10555322
1127 Ga0105249_11039399
1128 Ga0105249_12214319
1129 Ga0105249_12287328
1130 Ga0105249_12638064
1131 Ga0105239_10191692
1132 Ga0105239_10300803
1133 Ga0105239_11653147
1134 Ga0105239_12101666
1135 Ga0105246_10017216
1136 Ga0105246_10149732
1137 Ga0105246_11373977
1138 Ga0105246_12048750
1139 Ga0157373_10651193
1140 Ga0157371_10087531
1141 Ga0157370_10071968
1142 Ga0157369_10036662
1143 Ga0157369_10328584
1144 Ga0157369_10336191
1145 Ga0157374_10031323
1146 Ga0157374_10395739
1147 Ga0157378_10058773
1148 Ga0157378_10457479
1149 Ga0163162_10045976
1150 Ga0163162_10498525
1151 Ga0163162_10700596
1152 Ga0163162_10892064
1153 Ga0157372_10075533
1154 Ga0157372_10624236
1155 Ga0157375_10040515
1156 Ga0157375_10113023
1157 Ga0157375_10116521
1158 Ga0157375_10196797
1159 Ga0157375_10306438
1160 Ga0157375_11212809
1161 Ga0157375_11916680
1162 Ga0163163_10217308
1163 Ga0163163_10284796
1164 Ga0163163_10598523
1165 Ga0163163_10640971
1166 Ga0157380_10163258
1167 Ga0157380_11483719
1168 Ga0157380_11814263
1169 Ga0157380_11895374
1170 Ga0157377_10010829
1171 Ga0157377_10019077
1172 Ga0157377_11214511
1173 Ga0157379_10060407
1174 Ga0157379_10082807
1175 Ga0157379_10158602
1176 Ga0157376_10112791
1177 Ga0157376_10173207
1178 Ga0157376_10267190
1179 Ga0163161_10004462
1180 Ga0163161_10112537
1181 Ga0163161_10218240
1182 Ga0163161_10524998
1183 Ga0163161_11383615
1184 Ga0213876_10002748
1185 Ga0213876_10027772
1186 Ga0213875_10009632
1187 Ga0213875_10069219
1188 Ga0209673_1014992
1189 Ga0209673_1042378
1190 Ga0209051_1000075
1191 Ga0209051_1000466
1192 Ga0209051_1004758
1193 Ga0207653_10021898
1194 Ga0207653_10051267
1195 Ga0207692_10032751
1196 Ga0207692_10138641
1197 Ga0207692_10296673
1198 Ga0207642_10029820
1199 Ga0207710_10098201
1200 Ga0207710_10156514
1201 Ga0207688_10001015
1202 Ga0207688_10005416
1203 Ga0207647_10038054
1204 Ga0207685_10013908
1205 Ga0207685_10069466
1206 Ga0207699_10104325
1207 Ga0207699_10310030
1208 Ga0207645_10213471
1209 Ga0207643_10095756
1210 Ga0207643_10456143
1211 Ga0207643_10631487
1212 Ga0207705_10000882
1213 Ga0207705_10567972
1214 Ga0207684_10003011
1215 Ga0207707_10006566
1216 Ga0207695_10120739
1217 Ga0207671_10647225
1218 Ga0207693_10003643
1219 Ga0207693_10003901
1220 Ga0207693_10660532
1221 Ga0207663_10036006
1222 Ga0207663_10064718
1223 Ga0207663_10717404
1224 Ga0207657_10042965
1225 Ga0207657_10431613
1226 Ga0207652_10719944
1227 Ga0207646_10040912
1228 Ga0207646_10060050
1229 Ga0207681_10843242
1230 Ga0207694_10257785
1231 Ga0207694_10547001
1232 Ga0207694_11020954
1233 Ga0207650_10149344
1234 Ga0207650_11321193
1235 Ga0207659_11710983
1236 Ga0207687_10011238
1237 Ga0207687_10068875
1238 Ga0207687_10127652
1239 Ga0207687_10138701
1240 Ga0207700_10058922
1241 Ga0207700_10204299
1242 Ga0207700_10273952
1243 Ga0207664_10126512
1244 Ga0207664_10227668
1245 Ga0207664_10251002
1246 Ga0207664_10590938
1247 Ga0207664_10989118
1248 Ga0207644_10006749
1249 Ga0207644_10646508
1250 Ga0207690_10866446
1251 Ga0207706_10033872
1252 Ga0207706_10070750
1253 Ga0207686_10025849
1254 Ga0207686_10258141
1255 Ga0207686_10450802
1256 Ga0207709_10118990
1257 Ga0207709_10408348
1258 Ga0207670_10354551
1259 Ga0207670_10972195
1260 Ga0207669_10662685
1261 Ga0207704_10087985
1262 Ga0207704_10166459
1263 Ga0207704_10269733
1264 Ga0207665_10001686
1265 Ga0207665_10006167
1266 Ga0207665_10383195
1267 Ga0207691_10028339
1268 Ga0207691_10138993
1269 Ga0207689_10002967
1270 Ga0207689_10082267
1271 Ga0207661_10088274
1272 Ga0207679_10339979
1273 Ga0207667_10480260
1274 Ga0207667_11379517
1275 Ga0207651_10189840
1276 Ga0207651_11673366
1277 Ga0207712_10203715
1278 Ga0207712_10218756
1279 Ga0207712_10345390
1280 Ga0207712_11379179
1281 Ga0207712_12058371
1282 Ga0207668_10060585
1283 Ga0207668_10216168
1284 Ga0207668_10800836
1285 Ga0207640_10057345
1286 Ga0207640_10091443
1287 Ga0207640_10221425
1288 Ga0207658_10312782
1289 Ga0207658_10425726
1290 Ga0207658_10769480
1291 Ga0207658_11085516
1292 Ga0207677_10035531
1293 Ga0207677_10391992
1294 Ga0207677_11577565
1295 Ga0207677_11750934
1296 Ga0207703_10020553
1297 Ga0207703_10140404
1298 Ga0207703_10172881
1299 Ga0207703_10295714
1300 Ga0207639_10055585
1301 Ga0207639_10108191
1302 Ga0207639_10117639
1303 Ga0207678_10001619
1304 Ga0207678_11311455
1305 Ga0207708_10146771
1306 Ga0207702_10071613
1307 Ga0207702_10911971
1308 Ga0207641_10071087
1309 Ga0207641_10130639
1310 Ga0207641_10271248
1311 Ga0207648_10021008
1312 Ga0207676_10192151
1313 Ga0207674_11383414
1314 Ga0207675_100009746
1315 Ga0207675_100031985
1316 Ga0207675_101016837
1317 Ga0207675_101951212
1318 Ga0207683_10016291
1319 Ga0207683_10202392
1320 Ga0207683_11861070
1321 Ga0209813_10044759
1322 Ga0209813_10221756
1323 Ga0207428_10104749
1324 Ga0207428_10151501
1325 Ga0224573_1003159
1326 Ga0268266_10457713
1327 Ga0268265_10392769
1328 Ga0268265_10466148
1329 Ga0268265_12554435
1330 Ga0268264_10058126
1331 Ga0268264_10771532
1332 Ga0268264_11885461
1333 Ga0265327_10001602
1334 Ga0307413_10132620
1335 Ga0307413_10462873
1336 Ga0307410_10018179
1337 Ga0307410_10099240
1338 Ga0307410_10319230
1339 Ga0307410_10907604
1340 Ga0307407_10209032
1341 Ga0307407_10395204
1342 Ga0307407_10465516
1343 Ga0307412_10123439
1344 Ga0307409_100130969
1345 Ga0307409_100199169
1346 Ga0307409_100243377
1347 Ga0307409_101033071
1348 Ga0307409_101901421
1349 Ga0307409_102202197
1350 Ga0307409_102205218
1351 Ga0307416_100250550
1352 Ga0307416_101160145
1353 Ga0307416_101444470
1354 Ga0307416_102439005
1355 Ga0307415_100351073
1356 Ga0373948_0206759
1357 Ga0373958_0031466
1358 Ga0373938_0100244
1359 Ga0373938_0142875
1360 Ga0373928_0015958
1361 Ga0373929_0020830
1362 Ga0373929_0117155
1363 Ga0373940_0024350
1364 Ga0373949_0009851
1365 Ga0373951_0021877
1366 Ga0373932_0027964
1367 Ga0373932_0188137
1368 Ga0373939_0015136
1369 Ga0373941_0272189
1370 Ga0373960_0013123
1371 Ga0373946_0390001
1372 Ga0373942_0020860
1373 Ga0373961_0063060
1374 Ga0373962_0032461
1375 Ga0316574_0743597
1376 Ga0373931_0033341
1377 Ga0373931_0082406
1378 Ga0373931_0329621
1379 Ga0373927_0086100
1380 Ga0395898_0319516
1381 Ga0436364_0136088
1382 Ga0436364_0203662
1383 Ga0436364_0220105
1384 Ga0436364_0564415
1385 Ga0436364_1341515
1386 Ga0395901_0193097
1387 Ga0395901_1532099
1388 Ga0436365_0456050
1389 Ga0436365_1049793
1390 Ga0436365_1054830
1391 Ga0436365_1454613
1392 Ga0436363_1568153
1393 Ga0436362_0184727
1394 Ga0436362_0606133
1395 Ga0439436_0044663
1396 Ga0439436_0092224
1397 Ga0439439_0057377
1398 Ga0439466_0039547
1399 Ga0439465_0004011
1400 Ga0439465_0085663
1401 Ga0451791_0658588
1402 Ga0451793_1281738
1403 Ga0451793_1692933
1404 Ga0451795_0426143
1405 Ga0451802_1479392
1406 Ga0451806_212474
1407 Ga0451807_2065124
1408 Ga0451833_1305560
1409 Ga0451843_0152064
1410 Ga0451853_0305186
1411 Ga0439445_0004114
1412 Ga0439452_079713
1413 Ga0439462_0034955
1414 Ga0439463_082137
1415 Ga0439434_0003530
1416 Ga0439434_0206651
1417 Ga0466969_0041458
1418 Ga0466972_0023833
1419 Ga0466972_0047757
1420 Ga0466965_0054704
1421 Ga0466965_0065653
1422 Ga0466966_0141913
1423 Ga0466966_0644045
1424 Ga0466961_0014853
1425 Ga0466961_0454618
1426 Ga0466963_0069425
1427 Ga0466963_0076835
1428 Ga0466964_0089980
1429 Ga0466971_0069018
1430 Ga0466968_0064233
1431 Ga0466968_0107272
1432 Ga0466968_0202878
1433 Ga0466970_0313691
1434 Ga0466970_0330033
1435 Ga0466970_0602062
1436 Ga0466957_0153000
1437 Ga0466957_0322917
1438 Ga0466960_0000870
1439 Ga0466960_0184643
1440 Ga0466960_0324043
1441 Ga0466959_0088673
1442 Ga0466959_0598101
1443 Ga0466958_0002298
1444 Ga0466958_0018386
1445 Ga0466958_0194765
1446 Ga0466958_1094197
1447 Ga0466967_0146847
1448 Ga0466967_0187181
1449 Ga0466967_1939965
1450 Ga0466967_2477444
1451 Ga0495603_0311767
1452 Ga0495629_0010758
1453 Ga0495641_0028600
1454 Ga0495641_0205132
1455 Ga0495582_0064349
1456 Ga0495584_0154879
1457 Ga0495594_0461057
1458 Ga0495608_0865063
1459 Ga0495620_0342764
1460 Ga0495630_0354376
1461 Ga0495640_0033995
1462 Ga0495640_0369052
1463 Ga0495597_0265398
1464 Ga0495667_0487809
1465 Ga0495656_0354314
1466 Ga0495656_0521380
1467 Ga0495611_0500480
1468 Ga0495625_0339748
1469 Ga0495647_0311438
1470 Ga0495658_0146905
1471 Ga0495658_0778077
1472 Ga0495613_0295996
1473 Ga0495624_0277602
1474 Ga0495660_0527084
1475 Ga0495581_0015805
1476 Ga0495674_0020932
1477 Ga0495672_0004714
1478 Ga0495676_0053604
1479 Ga0495686_0003209
1480 Ga0495686_0128212
1481 Ga0495593_0014564
1482 Ga0496100_0066355
1483 Ga0496100_0214763
1484 Ga0496100_0245078
1485 Ga0496100_0642372
1486 Ga0496100_0777288
1487 Ga0496101_0069232
1488 Ga0496101_0182729
1489 Ga0496101_0613556
1490 Ga0496102_0038178
1491 Ga0496102_0046277
1492 Ga0496102_0195559
1493 Ga0496102_0632892
1494 Ga0496102_0648191
1495 Ga0496103_0046029
1496 Ga0496103_0080359
1497 Ga0496103_0083362
1498 Ga0496103_0981817
1499 Ga0496104_0030264
1500 Ga0496104_0475862
1501 Ga0496104_0721397
1502 Ga0496105_0374894
1503 Ga0496106_0062268
1504 Ga0496106_0205166
1505 Ga0496106_1264245
1506 Ga0496106_1341452
1507 Ga0496107_0419787
1508 Ga0496107_1097385
1509 Ga0496108_0017889
1510 Ga0496108_0021043
1511 Ga0496108_0032783
1512 Ga0496108_0180275
1513 Ga0496108_0820802
1514 Ga0496108_0878851
1515 Ga0496109_0008333
1516 Ga0496109_0047406
1517 Ga0496109_0116458
1518 Ga0496109_0119606
1519 Ga0496109_0387675
1520 Ga0496109_0495904
1521 Ga0496109_1780152
1522 Ga0496110_0016634
1523 Ga0496110_0063575
1524 Ga0496110_0107349
1525 Ga0496110_0212885
1526 Ga0496111_0142146
1527 Ga0496111_0248290
1528 Ga0496112_0033322
1529 Ga0496112_0065402
1530 Ga0496113_0010523
1531 Ga0496113_0074117
1532 Ga0496113_0241763
1533 Ga0496113_0689528
1534 Ga0496114_0093266
1535 Ga0496114_0131437
1536 Ga0496114_0244297
1537 Ga0496115_0051634
1538 Ga0496115_0113966
1539 Ga0496124_0247008
1540 Ga0496124_0677064
1541 Ga0496126_0558507
1542 Ga0501032_0011156
1543 Ga0501032_0055595
1544 Ga0501033_0024957
1545 Ga0501033_0340554
1546 Ga0501034_0416538
1547 Ga0501036_0114619
1548 Ga0501036_0334094
1549 Ga0501036_0470175
1550 Ga0501037_0152463
1551 Ga0501037_0213725
1552 Ga0501038_0030399
1553 Ga0501038_0412265
1554 Ga0501038_0625916
1555 Ga0501038_0675490
1556 Ga0501039_0003877
1557 Ga0501039_0080171
1558 Ga0501039_0199783
1559 Ga0501040_0051381
1560 Ga0501040_0322734
1561 Ga0501040_0886427
1562 Ga0501040_0893549
1563 Ga0501041_0055841
1564 Ga0501041_0231730
1565 Ga0501041_0253011
1566 Ga0501042_0004699
1567 Ga0501043_0042813
1568 Ga0501046_0002786
1569 Ga0501046_0263377
1570 Ga0501046_0295373
1571 Ga0501046_0675958
1572 Ga0501047_0009880
1573 Ga0501048_0020040
1574 Ga0501048_0049283
1575 Ga0501048_0115213
1576 Ga0501067_0424847
1577 Ga0501068_0006530
1578 Ga0501068_0022885
1579 Ga0501068_0274464
1580 Ga0501068_0527202
1581 Ga0501068_0578651
1582 Ga0501068_0618531
1583 Ga0501069_0021436
1584 Ga0501069_0209032
1585 Ga0501069_0567822
1586 Ga0501069_0743701
1587 Ga0501070_0246556
1588 Ga0501071_0004766
1589 Ga0501071_0006695
1590 Ga0501071_0475130
1591 Ga0501071_0551731
1592 Ga0501072_0002058
1593 Ga0501072_0010557
1594 Ga0501072_0056885
1595 Ga0501072_0171787
1596 Ga0501073_0062107
1597 Ga0501074_0009527
1598 Ga0501074_0121727
1599 Ga0501074_0867532
1600 Ga0501074_0988289
1601 Ga0501075_0013170
1602 Ga0501075_0015145
1603 Ga0501075_0043298
1604 Ga0501075_0058659
1605 Ga0501076_0055748
1606 Ga0501076_0352562
1607 Ga0501076_0542434
1608 Ga0501076_0569099
1609 Ga0501076_0680541
1610 Ga0501076_0910825
1611 Ga0501077_0049970
1612 Ga0501077_0062270
1613 Ga0501077_0106076
1614 Ga0501079_0012469
1615 Ga0501079_0043246
1616 Ga0501079_0056350
1617 Ga0501079_0258393
1618 Ga0501080_0014950
1619 Ga0501080_0842149
1620 Ga0501081_0011559
1621 Ga0501081_0145415
1622 Ga0501081_0210631
1623 Ga0501081_0288490
1624 Ga0501081_0758097
1625 Ga0501083_0208262
1626 Ga0501083_0267812
1627 Ga0501035_0000685
1628 Ga0501035_0046524
1629 Ga0501035_0421074
1630 Ga0501044_0003313
1631 Ga0501044_0374381
1632 Ga0501045_0018333
1633 Ga0501045_0168724
1634 Ga0501045_0226076
1635 Ga0501045_0281220
1636 Ga0501045_0586489
1637 nmdc:mga03683_142555_c1
1638 nmdc:mga03683_22585_c1
1639 nmdc:mga03683_63653_c1
1640 nmdc:mga03683_92333_c1
1641 nmdc:mga03n38_11046_c1
1642 nmdc:mga03n38_126541_c1
1643 nmdc:mga03n38_240230_c1
1644 nmdc:mga03n38_424145_c1
1645 nmdc:mga03n38_842663_c1
1646 nmdc:mga00v17_172414_c1
1647 nmdc:mga00v17_214366_c1
1648 nmdc:mga00v17_23598_c1
1649 nmdc:mga00v17_286655_c1
1650 nmdc:mga00v17_36389_c1
1651 nmdc:mga00v17_412054_c1
1652 nmdc:mga00v17_447363_c1
1653 nmdc:mga00v17_447947_c1
1654 nmdc:mga00v17_8990_c1
1655 nmdc:mga0yw44_299035_c1
1656 nmdc:mga0yw44_346704_c1
1657 nmdc:mga0yw44_4116_c1
1658 nmdc:mga0yw44_50646_c1
1659 nmdc:mga0k408_53443_c1
1660 nmdc:mga06z11_105627_c1
1661 nmdc:mga06z11_190888_c1
1662 nmdc:mga06z11_207577_c1
1663 nmdc:mga06z11_212613_c1
1664 nmdc:mga06z11_226894_c1
1665 nmdc:mga06z11_383905_c1
1666 nmdc:mga06z11_584687_c1
1667 nmdc:mga06z11_853085_c1
1668 nmdc:mga04h51_53623_c1
1669 nmdc:mga07m45_104697_c1
1670 nmdc:mga07m45_205708_c1
1671 nmdc:mga07m45_21738_c1
1672 nmdc:mga07m45_250689_c1
1673 nmdc:mga07m45_320577_c1
1674 nmdc:mga07m45_6789_c1
1675 nmdc:mga0qj67_102858_c1
1676 nmdc:mga0qj67_316432_c1
1677 nmdc:mga08y16_342583_c1
1678 nmdc:mga08y16_86846_c1
1679 nmdc:mga0n895_1799014_c1
1680 nmdc:mga0n895_91173_c1
1681 nmdc:mga0rr50_167275_c1
1682 nmdc:mga08x19_442964_c1
1683 nmdc:mga0a205_25239_c1
1684 nmdc:mga0sz30_16844_c1
1685 nmdc:mga0sz30_195640_c1
1686 nmdc:mga0sz30_242453_c1
1687 nmdc:mga0sz30_305243_c1
1688 nmdc:mga0sz30_420867_c1
1689 nmdc:mga0sz30_57762_c1
1690 nmdc:mga0sz30_6647_c1
1691 Ga0495601_0565503
1692 Ga0495601_0955092
1693 Ga0495655_0217067
1694 Ga0495619_0435418
1695 Ga0500643_055551
1696 Ga0501084_0046604
1697 Ga0501082_0000537
1698 Ga0501082_0135156
1699 Ga0501082_0168124
1700 Ga0501082_0476069
1701 Ga0466962_0004130
1702 Ga0466962_0053955
1703 Ga0530510_0004142
1704 Ga0530510_0013545
1705 Ga0530510_0023906
1706 Ga0530510_0643794
1707 Ga0530510_0683456
1708 Ga0530510_1584852
1709 2644486186
1710 2738667448
1711 2739146518
1712 2902840469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

11

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8853 4 120
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8713 4 120
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7772 1 120
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7712 1 120
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.5148 5 122
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.879 4 120 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8645 4 120 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7972 5 120 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7782 5 120 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.67 47 120 1.10.1660.80
ID Description Score Start End GO Terms
AF-Q0FK62-F1-model_v4 DUF2237 domain-containing protein 1.004 46 119
AF-A0A353DFF3-F1-model_v4 DUF2237 domain-containing protein 1.002 48 119
AF-A0A1Z8KNJ8-F1-model_v4 Uncharacterized protein 0.9966 81 120
AF-A0A0S1YR09-F1-model_v4 deleted 0.9952 70 120
AF-A0A383B302-F1-model_v4 DUF2237 domain-containing protein 0.9943 44 112

Map