F483582
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 335 | 1708 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10043682|Ga0157380_100436823 |
| Length | 211 |
| Sequence | MRSRRDDPTDRFLAIVRLASSFVSARRLSQAIAEGDGISLLVEIADDASARAAQEGGAEGLVVRARAFTAETDLPLLAYGLLPEDAAAGSADAVVLTTGDGDEALAGHVERCHELGIEVVVRVSDDDELARALDHVDPEILLLTAERADDEQAPLDRLLELLPDVPAGKLAIAELADASRQDVEELERAGVDAVLVAGDVETLVGDAVPDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.94 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.61 |
| Rhizosphere | 91.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157380_10043682 | 3300014326 | Bacteria | 3509 |
| 2 | ARcpr5yngRDRAFT_c003016 | 3300000043 | Bacteria | 1692 |
| 3 | ARSoilOldRDRAFT_c002270 | 3300000044 | Bacteria | 1709 |
| 4 | JGI24737J22298_10110495 | 3300001990 | Bacteria | 813 |
| 5 | JGI24743J22301_10016017 | 3300001991 | Bacteria | 1395 |
| 6 | JGI24745J21846_1018450 | 3300002073 | Bacteria | 814 |
| 7 | JGI25407J50210_10002831 | 3300003373 | Bacteria | 4129 |
| 8 | Ga0070658_10003860 | 3300005327 | Bacteria | 12288 |
| 9 | Ga0070658_10017085 | 3300005327 | Bacteria | 5806 |
| 10 | Ga0070676_10085673 | 3300005328 | Bacteria | 1920 |
| 11 | Ga0070676_10113857 | 3300005328 | Bacteria | 1688 |
| 12 | Ga0070683_100005500 | 3300005329 | Bacteria | 10580 |
| 13 | Ga0070683_100013071 | 3300005329 | Bacteria | 7229 |
| 14 | Ga0070683_100028810 | 3300005329 | Bacteria | 5023 |
| 15 | Ga0070683_100056692 | 3300005329 | Bacteria | 3638 |
| 16 | Ga0070683_100175093 | 3300005329 | Bacteria | 2037 |
| 17 | Ga0070683_100228870 | 3300005329 | Bacteria | 1767 |
| 18 | Ga0070690_100033153 | 3300005330 | Bacteria | 3231 |
| 19 | Ga0070670_100138844 | 3300005331 | Unclassified | 2101 |
| 20 | Ga0070677_10167423 | 3300005333 | Bacteria | 1036 |
| 21 | Ga0068869_100019781 | 3300005334 | Bacteria | 4607 |
| 22 | Ga0068869_100367051 | 3300005334 | Bacteria | 1177 |
| 23 | Ga0070666_10035169 | 3300005335 | Bacteria | 3322 |
| 24 | Ga0070666_10579347 | 3300005335 | Bacteria | 818 |
| 25 | Ga0070680_100005429 | 3300005336 | Bacteria | 9653 |
| 26 | Ga0070680_100005596 | 3300005336 | Bacteria | 9515 |
| 27 | Ga0070680_100068476 | 3300005336 | Bacteria | 2913 |
| 28 | Ga0070680_100261556 | 3300005336 | Bacteria | 1464 |
| 29 | Ga0070680_100323307 | 3300005336 | Bacteria | 1309 |
| 30 | Ga0070680_101091102 | 3300005336 | Unclassified | 690 |
| 31 | Ga0070682_100014991 | 3300005337 | Bacteria | 4486 |
| 32 | Ga0070682_100016847 | 3300005337 | Bacteria | 4253 |
| 33 | Ga0070682_100028418 | 3300005337 | Bacteria | 3363 |
| 34 | Ga0070682_100353653 | 3300005337 | Bacteria | 1096 |
| 35 | Ga0068868_100009600 | 3300005338 | Bacteria | 6977 |
| 36 | Ga0068868_100011610 | 3300005338 | Bacteria | 6416 |
| 37 | Ga0068868_100324671 | 3300005338 | Bacteria | 1312 |
| 38 | Ga0068868_100397673 | 3300005338 | Unclassified | 1188 |
| 39 | Ga0070660_100001315 | 3300005339 | Bacteria | 16915 |
| 40 | Ga0070660_100002583 | 3300005339 | Bacteria | 12422 |
| 41 | Ga0070660_100023901 | 3300005339 | Bacteria | 4532 |
| 42 | Ga0070660_100343975 | 3300005339 | Bacteria | 1227 |
| 43 | Ga0070660_100769621 | 3300005339 | Bacteria | 809 |
| 44 | Ga0070689_100011412 | 3300005340 | Bacteria | 6364 |
| 45 | Ga0070689_100313200 | 3300005340 | Bacteria | 1309 |
| 46 | Ga0070691_10353244 | 3300005341 | Bacteria | 817 |
| 47 | Ga0070687_100107052 | 3300005343 | Bacteria | 1576 |
| 48 | Ga0070687_100151767 | 3300005343 | Bacteria | 1360 |
| 49 | Ga0070661_100017891 | 3300005344 | Bacteria | 5032 |
| 50 | Ga0070661_100096145 | 3300005344 | Bacteria | 2197 |
| 51 | Ga0070661_100168675 | 3300005344 | Unclassified | 1661 |
| 52 | Ga0070692_10002701 | 3300005345 | Bacteria | 6953 |
| 53 | Ga0070692_10161843 | 3300005345 | Bacteria | 1283 |
| 54 | Ga0070668_100026101 | 3300005347 | Bacteria | 4431 |
| 55 | Ga0070668_100253848 | 3300005347 | Bacteria | 1460 |
| 56 | Ga0070669_100262428 | 3300005353 | Bacteria | 1379 |
| 57 | Ga0070669_100916669 | 3300005353 | Unclassified | 749 |
| 58 | Ga0070675_100505049 | 3300005354 | Bacteria | 1090 |
| 59 | Ga0070671_100085277 | 3300005355 | Bacteria | 2642 |
| 60 | Ga0070671_100130519 | 3300005355 | Bacteria | 2116 |
| 61 | Ga0070671_100272126 | 3300005355 | Unclassified | 1440 |
| 62 | Ga0070674_100006802 | 3300005356 | Bacteria | 6700 |
| 63 | Ga0070674_100029271 | 3300005356 | Bacteria | 3625 |
| 64 | Ga0070674_100287939 | 3300005356 | Bacteria | 1305 |
| 65 | Ga0070673_100041587 | 3300005364 | Bacteria | 3537 |
| 66 | Ga0070673_100109103 | 3300005364 | Bacteria | 2292 |
| 67 | Ga0070673_100262882 | 3300005364 | Bacteria | 1508 |
| 68 | Ga0070673_100330325 | 3300005364 | Bacteria | 1349 |
| 69 | Ga0070673_100477216 | 3300005364 | Bacteria | 1125 |
| 70 | Ga0070688_100045024 | 3300005365 | Bacteria | 2724 |
| 71 | Ga0070688_100354764 | 3300005365 | Bacteria | 1075 |
| 72 | Ga0070659_100002737 | 3300005366 | Bacteria | 12541 |
| 73 | Ga0070659_100002964 | 3300005366 | Bacteria | 12102 |
| 74 | Ga0070659_100009602 | 3300005366 | Bacteria | 7112 |
| 75 | Ga0070659_100020202 | 3300005366 | Bacteria | 5057 |
| 76 | Ga0070659_100134971 | 3300005366 | Bacteria | 2006 |
| 77 | Ga0070659_100290721 | 3300005366 | Bacteria | 1361 |
| 78 | Ga0070659_100425091 | 3300005366 | Bacteria | 1124 |
| 79 | Ga0070667_100139739 | 3300005367 | Bacteria | 2120 |
| 80 | Ga0070667_100179494 | 3300005367 | Bacteria | 1872 |
| 81 | Ga0070667_101272821 | 3300005367 | Bacteria | 689 |
| 82 | Ga0070703_10048501 | 3300005406 | Bacteria | 1349 |
| 83 | Ga0070703_10060629 | 3300005406 | Bacteria | 1237 |
| 84 | Ga0070709_10041649 | 3300005434 | Bacteria | 2831 |
| 85 | Ga0070714_100647947 | 3300005435 | Bacteria | 1017 |
| 86 | Ga0070714_100786704 | 3300005435 | Bacteria | 921 |
| 87 | Ga0070713_100176885 | 3300005436 | Bacteria | 1915 |
| 88 | Ga0070713_100980986 | 3300005436 | Bacteria | 815 |
| 89 | Ga0070710_10054835 | 3300005437 | Bacteria | 2250 |
| 90 | Ga0070710_10345681 | 3300005437 | Bacteria | 983 |
| 91 | Ga0070701_10024977 | 3300005438 | Bacteria | 2896 |
| 92 | Ga0070701_10044351 | 3300005438 | Bacteria | 2278 |
| 93 | Ga0070701_10155483 | 3300005438 | Bacteria | 1320 |
| 94 | Ga0070711_100002843 | 3300005439 | Bacteria | 9950 |
| 95 | Ga0070711_100184464 | 3300005439 | Bacteria | 1599 |
| 96 | Ga0070711_100226437 | 3300005439 | Bacteria | 1456 |
| 97 | Ga0070705_100003398 | 3300005440 | Bacteria | 7801 |
| 98 | Ga0070705_100313990 | 3300005440 | Bacteria | 1128 |
| 99 | Ga0070700_100003896 | 3300005441 | Bacteria | 7750 |
| 100 | Ga0070700_100087767 | 3300005441 | Bacteria | 2022 |
| 101 | Ga0070694_100082991 | 3300005444 | Bacteria | 2232 |
| 102 | Ga0070694_100340870 | 3300005444 | Bacteria | 1159 |
| 103 | Ga0070708_100025365 | 3300005445 | Bacteria | 5067 |
| 104 | Ga0070708_100279979 | 3300005445 | Bacteria | 1570 |
| 105 | Ga0070663_100043975 | 3300005455 | Bacteria | 3146 |
| 106 | Ga0070678_100001638 | 3300005456 | Bacteria | 11984 |
| 107 | Ga0070678_100017651 | 3300005456 | Bacteria | 4602 |
| 108 | Ga0070678_100192483 | 3300005456 | Bacteria | 1678 |
| 109 | Ga0070678_100194572 | 3300005456 | Bacteria | 1669 |
| 110 | Ga0070662_100053043 | 3300005457 | Bacteria | 2934 |
| 111 | Ga0070662_100085529 | 3300005457 | Bacteria | 2357 |
| 112 | Ga0070681_10002072 | 3300005458 | Bacteria | 18196 |
| 113 | Ga0070681_10041565 | 3300005458 | Bacteria | 4608 |
| 114 | Ga0070681_10043777 | 3300005458 | Bacteria | 4482 |
| 115 | Ga0070681_10206258 | 3300005458 | Bacteria | 1882 |
| 116 | Ga0070681_10323390 | 3300005458 | Bacteria | 1452 |
| 117 | Ga0068867_100035611 | 3300005459 | Bacteria | 3611 |
| 118 | Ga0068867_100183786 | 3300005459 | Bacteria | 1664 |
| 119 | Ga0068867_100511882 | 3300005459 | Bacteria | 1033 |
| 120 | Ga0070706_100002022 | 3300005467 | Bacteria | 20814 |
| 121 | Ga0070706_100020874 | 3300005467 | Bacteria | 6030 |
| 122 | Ga0070706_100268106 | 3300005467 | Bacteria | 1593 |
| 123 | Ga0070707_100000309 | 3300005468 | Bacteria | 47965 |
| 124 | Ga0070707_100675132 | 3300005468 | Bacteria | 996 |
| 125 | Ga0070698_100023695 | 3300005471 | Bacteria | 6413 |
| 126 | Ga0070698_100086756 | 3300005471 | Bacteria | 3116 |
| 127 | Ga0070698_100457577 | 3300005471 | Unclassified | 1212 |
| 128 | Ga0070699_100024421 | 3300005518 | Bacteria | 5208 |
| 129 | Ga0070699_100056700 | 3300005518 | Bacteria | 3393 |
| 130 | Ga0070699_100060871 | 3300005518 | Bacteria | 3272 |
| 131 | Ga0070679_100030303 | 3300005530 | Bacteria | 5342 |
| 132 | Ga0070679_100079548 | 3300005530 | Bacteria | 3267 |
| 133 | Ga0070679_100105121 | 3300005530 | Bacteria | 2810 |
| 134 | Ga0070679_100136892 | 3300005530 | Bacteria | 2430 |
| 135 | Ga0070684_100007151 | 3300005535 | Bacteria | 8672 |
| 136 | Ga0070684_100042718 | 3300005535 | Bacteria | 3914 |
| 137 | Ga0070684_100145973 | 3300005535 | Bacteria | 2141 |
| 138 | Ga0070684_100234945 | 3300005535 | Bacteria | 1674 |
| 139 | Ga0070697_100163620 | 3300005536 | Bacteria | 1880 |
| 140 | Ga0070697_100457068 | 3300005536 | Unclassified | 1113 |
| 141 | Ga0068853_100010118 | 3300005539 | Bacteria | 7620 |
| 142 | Ga0068853_100070632 | 3300005539 | Bacteria | 3040 |
| 143 | Ga0068853_100265913 | 3300005539 | Bacteria | 1578 |
| 144 | Ga0070672_100024776 | 3300005543 | Bacteria | 4440 |
| 145 | Ga0070672_100028255 | 3300005543 | Bacteria | 4193 |
| 146 | Ga0070672_100028456 | 3300005543 | Bacteria | 4180 |
| 147 | Ga0070686_100001231 | 3300005544 | Bacteria | 14556 |
| 148 | Ga0070686_100301473 | 3300005544 | Bacteria | 1188 |
| 149 | Ga0070696_100059351 | 3300005546 | Bacteria | 2673 |
| 150 | Ga0070696_100227139 | 3300005546 | Bacteria | 1403 |
| 151 | Ga0070693_100271248 | 3300005547 | Bacteria | 1133 |
| 152 | Ga0070693_100381132 | 3300005547 | Bacteria | 973 |
| 153 | Ga0070665_100012647 | 3300005548 | Bacteria | 8499 |
| 154 | Ga0070665_100120796 | 3300005548 | Bacteria | 2621 |
| 155 | Ga0070704_100013430 | 3300005549 | Bacteria | 5083 |
| 156 | Ga0070704_100272632 | 3300005549 | Bacteria | 1399 |
| 157 | Ga0068855_100052278 | 3300005563 | Bacteria | 4810 |
| 158 | Ga0068855_100097753 | 3300005563 | Bacteria | 3382 |
| 159 | Ga0070664_100127367 | 3300005564 | Bacteria | 2234 |
| 160 | Ga0070664_100226649 | 3300005564 | Bacteria | 1674 |
| 161 | Ga0070664_100230194 | 3300005564 | Bacteria | 1661 |
| 162 | Ga0070664_100316798 | 3300005564 | Bacteria | 1412 |
| 163 | Ga0070664_100346972 | 3300005564 | Bacteria | 1349 |
| 164 | Ga0068857_100074663 | 3300005577 | Bacteria | 3022 |
| 165 | Ga0068857_100153514 | 3300005577 | Bacteria | 2087 |
| 166 | Ga0068857_100156007 | 3300005577 | Bacteria | 2070 |
| 167 | Ga0068854_100007680 | 3300005578 | Bacteria | 6894 |
| 168 | Ga0068854_100156461 | 3300005578 | Bacteria | 1761 |
| 169 | Ga0068856_100055931 | 3300005614 | Bacteria | 3893 |
| 170 | Ga0068856_100229336 | 3300005614 | Unclassified | 1872 |
| 171 | Ga0070702_100045806 | 3300005615 | Bacteria | 2476 |
| 172 | Ga0070702_100120266 | 3300005615 | Bacteria | 1643 |
| 173 | Ga0068852_100039567 | 3300005616 | Bacteria | 3970 |
| 174 | Ga0068852_100046060 | 3300005616 | Bacteria | 3714 |
| 175 | Ga0068852_100062990 | 3300005616 | Bacteria | 3227 |
| 176 | Ga0068859_100228762 | 3300005617 | Bacteria | 1947 |
| 177 | Ga0068864_100109778 | 3300005618 | Bacteria | 2456 |
| 178 | Ga0068866_10003011 | 3300005718 | Bacteria | 6957 |
| 179 | Ga0068866_10128321 | 3300005718 | Bacteria | 1438 |
| 180 | Ga0068866_10159339 | 3300005718 | Bacteria | 1314 |
| 181 | Ga0068861_100050371 | 3300005719 | Bacteria | 3158 |
| 182 | Ga0068861_100080755 | 3300005719 | Bacteria | 2544 |
| 183 | Ga0068851_10109164 | 3300005834 | Bacteria | 1475 |
| 184 | Ga0068870_10016555 | 3300005840 | Bacteria | 3526 |
| 185 | Ga0068858_100191683 | 3300005842 | Bacteria | 1931 |
| 186 | Ga0068860_100253619 | 3300005843 | Bacteria | 1714 |
| 187 | Ga0081455_10007754 | 3300005937 | Bacteria | 11257 |
| 188 | Ga0081455_10036392 | 3300005937 | Bacteria | 4383 |
| 189 | Ga0081455_10074667 | 3300005937 | Bacteria | 2800 |
| 190 | Ga0081455_10320565 | 3300005937 | Bacteria | 1104 |
| 191 | Ga0081538_10000168 | 3300005981 | Bacteria | 70181 |
| 192 | Ga0081538_10000809 | 3300005981 | Bacteria | 33947 |
| 193 | Ga0081538_10007796 | 3300005981 | Bacteria | 9196 |
| 194 | Ga0081538_10021988 | 3300005981 | Bacteria | 4635 |
| 195 | Ga0081538_10101634 | 3300005981 | Bacteria | 1446 |
| 196 | Ga0081539_10001549 | 3300005985 | Bacteria | 38322 |
| 197 | Ga0070717_10050481 | 3300006028 | Bacteria | 3419 |
| 198 | Ga0070717_10244355 | 3300006028 | Bacteria | 1584 |
| 199 | Ga0075432_10002049 | 3300006058 | Bacteria | 6703 |
| 200 | Ga0070712_100271000 | 3300006175 | Bacteria | 1364 |
| 201 | Ga0070712_100285024 | 3300006175 | Bacteria | 1332 |
| 202 | Ga0097621_100076206 | 3300006237 | Bacteria | 2782 |
| 203 | Ga0068871_100123832 | 3300006358 | Bacteria | 2186 |
| 204 | Ga0068871_100379302 | 3300006358 | Bacteria | 1256 |
| 205 | Ga0075428_100004576 | 3300006844 | Bacteria | 15296 |
| 206 | Ga0075428_100448325 | 3300006844 | Bacteria | 1382 |
| 207 | Ga0075428_101266990 | 3300006844 | Bacteria | 776 |
| 208 | Ga0075433_10079174 | 3300006852 | Bacteria | 2896 |
| 209 | Ga0075433_10145716 | 3300006852 | Bacteria | 2105 |
| 210 | Ga0075434_100091839 | 3300006871 | Bacteria | 3038 |
| 211 | Ga0068865_100000466 | 3300006881 | Bacteria | 22602 |
| 212 | Ga0068865_100080710 | 3300006881 | Bacteria | 2334 |
| 213 | Ga0068865_100114398 | 3300006881 | Bacteria | 1995 |
| 214 | Ga0075436_100736081 | 3300006914 | Bacteria | 732 |
| 215 | Ga0097620_100228754 | 3300006931 | Bacteria | 1947 |
| 216 | Ga0075435_100008386 | 3300007076 | Bacteria | 7413 |
| 217 | Ga0105240_10347801 | 3300009093 | Bacteria | 1682 |
| 218 | Ga0111539_10016526 | 3300009094 | Bacteria | 9148 |
| 219 | Ga0111539_10355949 | 3300009094 | Bacteria | 1704 |
| 220 | Ga0105245_10013757 | 3300009098 | Bacteria | 7046 |
| 221 | Ga0105245_10036154 | 3300009098 | Bacteria | 4386 |
| 222 | Ga0105245_10042951 | 3300009098 | Bacteria | 4033 |
| 223 | Ga0105245_10090240 | 3300009098 | Bacteria | 2818 |
| 224 | Ga0105245_10095547 | 3300009098 | Bacteria | 2742 |
| 225 | Ga0105245_10325214 | 3300009098 | Unclassified | 1516 |
| 226 | Ga0105245_10332033 | 3300009098 | Bacteria | 1501 |
| 227 | Ga0105245_10358451 | 3300009098 | Bacteria | 1447 |
| 228 | Ga0105245_10402121 | 3300009098 | Bacteria | 1369 |
| 229 | Ga0105247_10023817 | 3300009101 | Bacteria | 3690 |
| 230 | Ga0105247_10152184 | 3300009101 | Unclassified | 1525 |
| 231 | Ga0114129_10053849 | 3300009147 | Bacteria | 5643 |
| 232 | Ga0114129_10476598 | 3300009147 | Bacteria | 1633 |
| 233 | Ga0105243_10002349 | 3300009148 | Bacteria | 15832 |
| 234 | Ga0105243_10027690 | 3300009148 | Bacteria | 4345 |
| 235 | Ga0105243_10049951 | 3300009148 | Bacteria | 3302 |
| 236 | Ga0105243_10151002 | 3300009148 | Bacteria | 1993 |
| 237 | Ga0105243_10689175 | 3300009148 | Unclassified | 995 |
| 238 | Ga0105243_11448889 | 3300009148 | Bacteria | 709 |
| 239 | Ga0105241_10210254 | 3300009174 | Unclassified | 1630 |
| 240 | Ga0105241_10362195 | 3300009174 | Bacteria | 1262 |
| 241 | Ga0105242_10052483 | 3300009176 | Bacteria | 3327 |
| 242 | Ga0105242_10090258 | 3300009176 | Bacteria | 2577 |
| 243 | Ga0105248_10007928 | 3300009177 | Bacteria | 11673 |
| 244 | Ga0105248_10117003 | 3300009177 | Bacteria | 3006 |
| 245 | Ga0105248_10189211 | 3300009177 | Bacteria | 2319 |
| 246 | Ga0105248_10365768 | 3300009177 | Bacteria | 1624 |
| 247 | Ga0105238_10275804 | 3300009551 | Bacteria | 1662 |
| 248 | Ga0105238_10796605 | 3300009551 | Bacteria | 960 |
| 249 | Ga0105249_10010071 | 3300009553 | Bacteria | 8296 |
| 250 | Ga0105249_10150806 | 3300009553 | Bacteria | 2238 |
| 251 | Ga0105249_10594889 | 3300009553 | Unclassified | 1160 |
| 252 | Ga0105239_10026243 | 3300010375 | Bacteria | 6413 |
| 253 | Ga0105239_10026685 | 3300010375 | Bacteria | 6357 |
| 254 | Ga0105239_10062561 | 3300010375 | Bacteria | 4085 |
| 255 | Ga0105239_10077277 | 3300010375 | Bacteria | 3663 |
| 256 | Ga0105239_10126857 | 3300010375 | Bacteria | 2837 |
| 257 | Ga0105239_11189591 | 3300010375 | Bacteria | 878 |
| 258 | Ga0105246_10066322 | 3300011119 | Bacteria | 2527 |
| 259 | Ga0105246_10738936 | 3300011119 | Bacteria | 867 |
| 260 | Ga0157371_10026423 | 3300013102 | Bacteria | 4220 |
| 261 | Ga0157371_10184170 | 3300013102 | Bacteria | 1494 |
| 262 | Ga0157370_10063033 | 3300013104 | Bacteria | 3513 |
| 263 | Ga0157370_10754725 | 3300013104 | Bacteria | 886 |
| 264 | Ga0157369_10031930 | 3300013105 | Bacteria | 5794 |
| 265 | Ga0157369_10728224 | 3300013105 | Bacteria | 1021 |
| 266 | Ga0157374_10003026 | 3300013296 | Bacteria | 14087 |
| 267 | Ga0157374_10289777 | 3300013296 | Bacteria | 1618 |
| 268 | Ga0157374_10415575 | 3300013296 | Bacteria | 1343 |
| 269 | Ga0157374_11033523 | 3300013296 | Bacteria | 841 |
| 270 | Ga0157378_10018028 | 3300013297 | Bacteria | 6198 |
| 271 | Ga0157378_10213632 | 3300013297 | Bacteria | 1830 |
| 272 | Ga0163162_10103015 | 3300013306 | Bacteria | 2948 |
| 273 | Ga0163162_10253695 | 3300013306 | Bacteria | 1891 |
| 274 | Ga0163162_10479848 | 3300013306 | Bacteria | 1375 |
| 275 | Ga0157372_10045631 | 3300013307 | Bacteria | 4863 |
| 276 | Ga0157372_10294889 | 3300013307 | Bacteria | 1886 |
| 277 | Ga0157375_10014145 | 3300013308 | Bacteria | 7115 |
| 278 | Ga0157375_10210624 | 3300013308 | Bacteria | 2101 |
| 279 | Ga0157375_10561061 | 3300013308 | Bacteria | 1303 |
| 280 | Ga0157375_10943073 | 3300013308 | Unclassified | 1005 |
| 281 | Ga0157375_11103386 | 3300013308 | Unclassified | 929 |
| 282 | Ga0163163_10123737 | 3300014325 | Bacteria | 2622 |
| 283 | Ga0163163_10380103 | 3300014325 | Bacteria | 1470 |
| 284 | Ga0163163_10470387 | 3300014325 | Bacteria | 1318 |
| 285 | Ga0163163_11044295 | 3300014325 | Bacteria | 880 |
| 286 | Ga0157380_10012211 | 3300014326 | Bacteria | 6223 |
| 287 | Ga0157380_10343065 | 3300014326 | Bacteria | 1394 |
| 288 | Ga0157380_10358681 | 3300014326 | Bacteria | 1367 |
| 289 | Ga0157377_10008810 | 3300014745 | Bacteria | 4933 |
| 290 | Ga0157377_10012979 | 3300014745 | Bacteria | 4204 |
| 291 | Ga0157377_10020169 | 3300014745 | Bacteria | 3490 |
| 292 | Ga0157379_10039406 | 3300014968 | Bacteria | 4215 |
| 293 | Ga0157376_10002955 | 3300014969 | Bacteria | 11662 |
| 294 | Ga0157376_10110656 | 3300014969 | Bacteria | 2417 |
| 295 | Ga0157376_10391407 | 3300014969 | Bacteria | 1341 |
| 296 | Ga0206356_10014031 | 3300020070 | Bacteria | 918 |
| 297 | Ga0206356_11569972 | 3300020070 | Bacteria | 1726 |
| 298 | Ga0206354_10324474 | 3300020081 | Bacteria | 1790 |
| 299 | Ga0206354_10590986 | 3300020081 | Bacteria | 2353 |
| 300 | Ga0206353_11234956 | 3300020082 | Bacteria | 6417 |
| 301 | Ga0206353_11362018 | 3300020082 | Bacteria | 1148 |
| 302 | Ga0206353_11533416 | 3300020082 | Bacteria | 2946 |
| 303 | Ga0206353_11969906 | 3300020082 | Bacteria | 1468 |
| 304 | Ga0213876_10075292 | 3300021384 | Bacteria | 1783 |
| 305 | Ga0207682_10103703 | 3300025893 | Bacteria | 1246 |
| 306 | Ga0207692_10040353 | 3300025898 | Bacteria | 2303 |
| 307 | Ga0207692_10407330 | 3300025898 | Bacteria | 849 |
| 308 | Ga0207642_10013808 | 3300025899 | Bacteria | 2959 |
| 309 | Ga0207710_10027367 | 3300025900 | Bacteria | 2468 |
| 310 | Ga0207688_10018365 | 3300025901 | Bacteria | 3805 |
| 311 | Ga0207688_10019751 | 3300025901 | Bacteria | 3673 |
| 312 | Ga0207688_10052312 | 3300025901 | Bacteria | 2288 |
| 313 | Ga0207688_10139237 | 3300025901 | Bacteria | 1427 |
| 314 | Ga0207688_10224750 | 3300025901 | Bacteria | 1132 |
| 315 | Ga0207680_10035810 | 3300025903 | Bacteria | 2854 |
| 316 | Ga0207647_10158436 | 3300025904 | Unclassified | 1321 |
| 317 | Ga0207645_10240379 | 3300025907 | Bacteria | 1196 |
| 318 | Ga0207643_10019082 | 3300025908 | Bacteria | 3757 |
| 319 | Ga0207643_10070599 | 3300025908 | Bacteria | 2009 |
| 320 | Ga0207643_10086664 | 3300025908 | Bacteria | 1820 |
| 321 | Ga0207705_10027995 | 3300025909 | Bacteria | 4018 |
| 322 | Ga0207705_10052485 | 3300025909 | Bacteria | 2935 |
| 323 | Ga0207705_10138270 | 3300025909 | Bacteria | 1817 |
| 324 | Ga0207684_10011047 | 3300025910 | Bacteria | 7910 |
| 325 | Ga0207684_10100186 | 3300025910 | Unclassified | 2475 |
| 326 | Ga0207684_10557055 | 3300025910 | Bacteria | 980 |
| 327 | Ga0207654_10213303 | 3300025911 | Bacteria | 1277 |
| 328 | Ga0207707_10055219 | 3300025912 | Bacteria | 3455 |
| 329 | Ga0207707_10074091 | 3300025912 | Bacteria | 2969 |
| 330 | Ga0207707_10094926 | 3300025912 | Bacteria | 2606 |
| 331 | Ga0207707_10212838 | 3300025912 | Bacteria | 1683 |
| 332 | Ga0207707_10326645 | 3300025912 | Unclassified | 1324 |
| 333 | Ga0207695_10150236 | 3300025913 | Bacteria | 2269 |
| 334 | Ga0207671_10291505 | 3300025914 | Bacteria | 1288 |
| 335 | Ga0207693_10001288 | 3300025915 | Bacteria | 22292 |
| 336 | Ga0207693_10201579 | 3300025915 | Bacteria | 1565 |
| 337 | Ga0207693_10521625 | 3300025915 | Bacteria | 927 |
| 338 | Ga0207663_10080370 | 3300025916 | Unclassified | 2131 |
| 339 | Ga0207663_10102230 | 3300025916 | Bacteria | 1928 |
| 340 | Ga0207663_10503095 | 3300025916 | Bacteria | 941 |
| 341 | Ga0207660_10064656 | 3300025917 | Bacteria | 2641 |
| 342 | Ga0207660_10120964 | 3300025917 | Bacteria | 1983 |
| 343 | Ga0207660_10215582 | 3300025917 | Bacteria | 1505 |
| 344 | Ga0207660_10306722 | 3300025917 | Bacteria | 1265 |
| 345 | Ga0207662_10130382 | 3300025918 | Unclassified | 1585 |
| 346 | Ga0207657_10000523 | 3300025919 | Bacteria | 40648 |
| 347 | Ga0207657_10005589 | 3300025919 | Bacteria | 13129 |
| 348 | Ga0207657_10015376 | 3300025919 | Bacteria | 7415 |
| 349 | Ga0207657_10016636 | 3300025919 | Bacteria | 7086 |
| 350 | Ga0207657_10088900 | 3300025919 | Bacteria | 2581 |
| 351 | Ga0207649_10020758 | 3300025920 | Bacteria | 3771 |
| 352 | Ga0207649_10032982 | 3300025920 | Bacteria | 3090 |
| 353 | Ga0207649_10352946 | 3300025920 | Bacteria | 1089 |
| 354 | Ga0207649_10705207 | 3300025920 | Bacteria | 783 |
| 355 | Ga0207652_10127180 | 3300025921 | Unclassified | 2270 |
| 356 | Ga0207652_10129300 | 3300025921 | Bacteria | 2252 |
| 357 | Ga0207652_10136729 | 3300025921 | Bacteria | 2189 |
| 358 | Ga0207652_10287587 | 3300025921 | Bacteria | 1483 |
| 359 | Ga0207652_10478830 | 3300025921 | Bacteria | 1121 |
| 360 | Ga0207652_10616532 | 3300025921 | Bacteria | 972 |
| 361 | Ga0207646_10001136 | 3300025922 | Bacteria | 33979 |
| 362 | Ga0207681_10142076 | 3300025923 | Bacteria | 1789 |
| 363 | Ga0207681_10613606 | 3300025923 | Bacteria | 900 |
| 364 | Ga0207694_10040157 | 3300025924 | Bacteria | 3602 |
| 365 | Ga0207659_10127920 | 3300025926 | Bacteria | 1956 |
| 366 | Ga0207659_10205540 | 3300025926 | Bacteria | 1575 |
| 367 | Ga0207687_10032931 | 3300025927 | Bacteria | 3513 |
| 368 | Ga0207687_10151295 | 3300025927 | Bacteria | 1771 |
| 369 | Ga0207687_10156569 | 3300025927 | Bacteria | 1744 |
| 370 | Ga0207687_10224165 | 3300025927 | Bacteria | 1482 |
| 371 | Ga0207687_10290988 | 3300025927 | Bacteria | 1313 |
| 372 | Ga0207687_10345438 | 3300025927 | Unclassified | 1211 |
| 373 | Ga0207700_10054986 | 3300025928 | Unclassified | 2990 |
| 374 | Ga0207700_11336139 | 3300025928 | Unclassified | 638 |
| 375 | Ga0207664_10643047 | 3300025929 | Unclassified | 953 |
| 376 | Ga0207644_10056484 | 3300025931 | Bacteria | 2833 |
| 377 | Ga0207644_10108279 | 3300025931 | Bacteria | 2098 |
| 378 | Ga0207644_10306545 | 3300025931 | Unclassified | 1281 |
| 379 | Ga0207690_10058607 | 3300025932 | Bacteria | 2605 |
| 380 | Ga0207690_10246329 | 3300025932 | Bacteria | 1378 |
| 381 | Ga0207690_10330977 | 3300025932 | Bacteria | 1200 |
| 382 | Ga0207690_10430648 | 3300025932 | Bacteria | 1057 |
| 383 | Ga0207706_10018464 | 3300025933 | Bacteria | 6274 |
| 384 | Ga0207706_10043279 | 3300025933 | Bacteria | 3991 |
| 385 | Ga0207706_10083849 | 3300025933 | Bacteria | 2802 |
| 386 | Ga0207686_10074768 | 3300025934 | Bacteria | 2191 |
| 387 | Ga0207686_10378154 | 3300025934 | Bacteria | 1073 |
| 388 | Ga0207686_10381775 | 3300025934 | Bacteria | 1069 |
| 389 | Ga0207709_10005071 | 3300025935 | Bacteria | 7519 |
| 390 | Ga0207670_10013115 | 3300025936 | Bacteria | 4876 |
| 391 | Ga0207670_10173329 | 3300025936 | Bacteria | 1619 |
| 392 | Ga0207670_10175715 | 3300025936 | Bacteria | 1609 |
| 393 | Ga0207669_10029842 | 3300025937 | Bacteria | 3021 |
| 394 | Ga0207669_10425606 | 3300025937 | Unclassified | 1046 |
| 395 | Ga0207704_10008306 | 3300025938 | Bacteria | 4955 |
| 396 | Ga0207704_10063208 | 3300025938 | Bacteria | 2306 |
| 397 | Ga0207665_10073388 | 3300025939 | Bacteria | 2340 |
| 398 | Ga0207691_10010759 | 3300025940 | Bacteria | 8782 |
| 399 | Ga0207691_10021817 | 3300025940 | Bacteria | 6044 |
| 400 | Ga0207691_10032862 | 3300025940 | Bacteria | 4834 |
| 401 | Ga0207691_10033303 | 3300025940 | Bacteria | 4797 |
| 402 | Ga0207711_10291101 | 3300025941 | Bacteria | 1505 |
| 403 | Ga0207689_10106844 | 3300025942 | Bacteria | 2300 |
| 404 | Ga0207689_10244216 | 3300025942 | Bacteria | 1484 |
| 405 | Ga0207689_10313730 | 3300025942 | Bacteria | 1301 |
| 406 | Ga0207661_10001401 | 3300025944 | Bacteria | 16231 |
| 407 | Ga0207661_10066621 | 3300025944 | Bacteria | 2926 |
| 408 | Ga0207661_10067324 | 3300025944 | Bacteria | 2912 |
| 409 | Ga0207661_10086399 | 3300025944 | Bacteria | 2603 |
| 410 | Ga0207661_10105034 | 3300025944 | Bacteria | 2379 |
| 411 | Ga0207661_10168786 | 3300025944 | Unclassified | 1904 |
| 412 | Ga0207661_10229299 | 3300025944 | Bacteria | 1644 |
| 413 | Ga0207661_10246029 | 3300025944 | Unclassified | 1588 |
| 414 | Ga0207679_10037316 | 3300025945 | Bacteria | 3453 |
| 415 | Ga0207679_10436415 | 3300025945 | Bacteria | 1159 |
| 416 | Ga0207667_10445091 | 3300025949 | Bacteria | 1317 |
| 417 | Ga0207667_10635158 | 3300025949 | Bacteria | 1074 |
| 418 | Ga0207667_10686554 | 3300025949 | Bacteria | 1027 |
| 419 | Ga0207667_10711012 | 3300025949 | Bacteria | 1007 |
| 420 | Ga0207651_10025655 | 3300025960 | Bacteria | 3667 |
| 421 | Ga0207651_10297970 | 3300025960 | Bacteria | 1340 |
| 422 | Ga0207712_10006602 | 3300025961 | Bacteria | 7320 |
| 423 | Ga0207712_11022737 | 3300025961 | Bacteria | 734 |
| 424 | Ga0207668_10050527 | 3300025972 | Bacteria | 2866 |
| 425 | Ga0207640_10151506 | 3300025981 | Bacteria | 1704 |
| 426 | Ga0207658_10197238 | 3300025986 | Bacteria | 1678 |
| 427 | Ga0207658_10480478 | 3300025986 | Unclassified | 1104 |
| 428 | Ga0207677_10058946 | 3300026023 | Unclassified | 2646 |
| 429 | Ga0207677_10471043 | 3300026023 | Bacteria | 1080 |
| 430 | Ga0207639_10035468 | 3300026041 | Bacteria | 3691 |
| 431 | Ga0207678_10063183 | 3300026067 | Bacteria | 3182 |
| 432 | Ga0207678_10212382 | 3300026067 | Bacteria | 1656 |
| 433 | Ga0207708_10000500 | 3300026075 | Bacteria | 30176 |
| 434 | Ga0207708_10044887 | 3300026075 | Bacteria | 3368 |
| 435 | Ga0207708_10077355 | 3300026075 | Bacteria | 2553 |
| 436 | Ga0207708_10112798 | 3300026075 | Bacteria | 2112 |
| 437 | Ga0207708_10868976 | 3300026075 | Bacteria | 779 |
| 438 | Ga0207702_10015464 | 3300026078 | Bacteria | 6320 |
| 439 | Ga0207702_10034026 | 3300026078 | Bacteria | 4258 |
| 440 | Ga0207702_11632166 | 3300026078 | Unclassified | 638 |
| 441 | Ga0207641_10076273 | 3300026088 | Bacteria | 2898 |
| 442 | Ga0207648_10014908 | 3300026089 | Bacteria | 7165 |
| 443 | Ga0207648_10078619 | 3300026089 | Bacteria | 2878 |
| 444 | Ga0207648_10179665 | 3300026089 | Bacteria | 1873 |
| 445 | Ga0207648_10492273 | 3300026089 | Bacteria | 1121 |
| 446 | Ga0207674_10025708 | 3300026116 | Bacteria | 6269 |
| 447 | Ga0207674_10142929 | 3300026116 | Bacteria | 2352 |
| 448 | Ga0207675_100010460 | 3300026118 | Bacteria | 8689 |
| 449 | Ga0207675_100166122 | 3300026118 | Bacteria | 2108 |
| 450 | Ga0207675_100312001 | 3300026118 | Bacteria | 1534 |
| 451 | Ga0207683_10001613 | 3300026121 | Bacteria | 20249 |
| 452 | Ga0207683_10016884 | 3300026121 | Bacteria | 6211 |
| 453 | Ga0207683_10036768 | 3300026121 | Bacteria | 4264 |
| 454 | Ga0207698_10025340 | 3300026142 | Bacteria | 4177 |
| 455 | Ga0207698_10367121 | 3300026142 | Bacteria | 1365 |
| 456 | Ga0207698_10390708 | 3300026142 | Bacteria | 1326 |
| 457 | Ga0207428_10000196 | 3300027907 | Bacteria | 84609 |
| 458 | Ga0207428_10021983 | 3300027907 | Bacteria | 5388 |
| 459 | Ga0268266_10010984 | 3300028379 | Bacteria | 7881 |
| 460 | Ga0268266_10113811 | 3300028379 | Bacteria | 2400 |
| 461 | Ga0268264_10385956 | 3300028381 | Bacteria | 1342 |
| 462 | Ga0265318_10079468 | 3300028577 | Bacteria | 1212 |
| 463 | Ga0265320_10232619 | 3300031240 | Bacteria | 819 |
| 464 | Ga0265327_10116318 | 3300031251 | Bacteria | 1272 |
| 465 | Ga0265316_10401806 | 3300031344 | Bacteria | 987 |
| 466 | Ga0265313_10084325 | 3300031595 | Bacteria | 1438 |
| 467 | Ga0265314_10112311 | 3300031711 | Bacteria | 1730 |
| 468 | Ga0307415_100191398 | 3300032126 | Bacteria | 1615 |
| 469 | Ga0373948_0009715 | 3300034817 | Bacteria | 1666 |
| 470 | Ga0373958_0011982 | 3300034819 | Bacteria | 1477 |
| 471 | Ga0373959_0028528 | 3300034820 | Bacteria | 1115 |
| 472 | Ga0373928_0021797 | 3300035084 | Unclassified | 1354 |
| 473 | Ga0373951_0073053 | 3300035091 | Bacteria | 877 |
| 474 | Ga0373941_0083250 | 3300035115 | Bacteria | 1084 |
| 475 | Ga0373956_0290365 | 3300035119 | Bacteria | 778 |
| 476 | Ga0373943_0001296 | 3300035170 | Bacteria | 11229 |
| 477 | Ga0373955_0089149 | 3300035172 | Unclassified | 1755 |
| 478 | Ga0373924_0050918 | 3300035410 | Unclassified | 1716 |
| 479 | Ga0373935_0147855 | 3300035692 | Bacteria | 1592 |
| 480 | Ga0373933_0869737 | 3300035724 | Bacteria | 593 |
| 481 | Ga0373947_0364898 | 3300035725 | Bacteria | 970 |
| 482 | Ga0373937_0074997 | 3300036401 | Bacteria | 3122 |
| 483 | Ga0395899_0009816 | 3300037312 | Bacteria | 7343 |
| 484 | Ga0395899_0082798 | 3300037312 | Bacteria | 2333 |
| 485 | Ga0395899_0101592 | 3300037312 | Bacteria | 2075 |
| 486 | Ga0395899_0426283 | 3300037312 | Bacteria | 873 |
| 487 | Ga0395900_0008989 | 3300037418 | Bacteria | 10243 |
| 488 | Ga0395900_0009327 | 3300037418 | Bacteria | 10061 |
| 489 | Ga0395900_0080154 | 3300037418 | Bacteria | 3355 |
| 490 | Ga0395900_0444849 | 3300037418 | Bacteria | 1253 |
| 491 | Ga0395900_0822696 | 3300037418 | Bacteria | 856 |
| 492 | Ga0395898_0003791 | 3300037466 | Bacteria | 16731 |
| 493 | Ga0395898_0014525 | 3300037466 | Bacteria | 8087 |
| 494 | Ga0395898_0015638 | 3300037466 | Bacteria | 7777 |
| 495 | Ga0395898_0022314 | 3300037466 | Bacteria | 6411 |
| 496 | Ga0395898_0082952 | 3300037466 | Bacteria | 3089 |
| 497 | Ga0395898_0412683 | 3300037466 | Bacteria | 1287 |
| 498 | Ga0395905_0003409 | 3300037471 | Bacteria | 17006 |
| 499 | Ga0395905_0006296 | 3300037471 | Bacteria | 11970 |
| 500 | Ga0395905_0006822 | 3300037471 | Bacteria | 11428 |
| 501 | Ga0395905_0026362 | 3300037471 | Bacteria | 5480 |
| 502 | Ga0436364_1449480 | 3300037853 | Bacteria | 1651 |
| 503 | Ga0395901_0011556 | 3300038443 | Bacteria | 8947 |
| 504 | Ga0395901_0025903 | 3300038443 | Bacteria | 6023 |
| 505 | Ga0395901_0106174 | 3300038443 | Bacteria | 2947 |
| 506 | Ga0395901_0119949 | 3300038443 | Bacteria | 2763 |
| 507 | Ga0395901_0270339 | 3300038443 | Bacteria | 1768 |
| 508 | Ga0395901_0817196 | 3300038443 | Unclassified | 920 |
| 509 | Ga0395901_1405319 | 3300038443 | Unclassified | 656 |
| 510 | Ga0436365_0041413 | 3300039437 | Bacteria | 2451 |
| 511 | Ga0436365_0622750 | 3300039437 | Bacteria | 1138 |
| 512 | Ga0436360_0023640 | 3300039438 | Bacteria | 3097 |
| 513 | Ga0436362_0536614 | 3300039453 | Bacteria | 3978 |
| 514 | Ga0451802_1281792 | 3300041460 | Bacteria | 1233 |
| 515 | Ga0451853_1098251 | 3300041512 | Bacteria | 747 |
| 516 | Ga0450920_020137 | 3300042122 | Bacteria | 1284 |
| 517 | Ga0466961_0055233 | 3300044693 | Bacteria | 2532 |
| 518 | Ga0466961_0309065 | 3300044693 | Bacteria | 965 |
| 519 | Ga0466961_0360993 | 3300044693 | Bacteria | 884 |
| 520 | Ga0466963_0144727 | 3300044694 | Bacteria | 1648 |
| 521 | Ga0466963_0180125 | 3300044694 | Bacteria | 1475 |
| 522 | Ga0466964_0007673 | 3300044706 | Bacteria | 4038 |
| 523 | Ga0466964_0061653 | 3300044706 | Bacteria | 1562 |
| 524 | Ga0466960_0313260 | 3300044901 | Bacteria | 887 |
| 525 | Ga0466959_0112155 | 3300045049 | Unclassified | 1945 |
| 526 | Ga0466967_0021144 | 3300045976 | Bacteria | 5276 |
| 527 | Ga0466967_0021553 | 3300045976 | Bacteria | 5239 |
| 528 | Ga0466967_0131646 | 3300045976 | Bacteria | 2322 |
| 529 | Ga0466967_0270229 | 3300045976 | Bacteria | 1629 |
| 530 | Ga0466967_0297441 | 3300045976 | Bacteria | 1552 |
| 531 | Ga0495603_0028431 | 3300046455 | Bacteria | 3372 |
| 532 | Ga0495603_0194685 | 3300046455 | Bacteria | 1172 |
| 533 | Ga0495651_0061199 | 3300046462 | Unclassified | 2881 |
| 534 | Ga0495651_0081308 | 3300046462 | Bacteria | 2446 |
| 535 | Ga0495651_0318795 | 3300046462 | Bacteria | 1037 |
| 536 | Ga0495653_0033495 | 3300046463 | Bacteria | 4070 |
| 537 | Ga0495653_0327220 | 3300046463 | Bacteria | 992 |
| 538 | Ga0495582_0035028 | 3300046473 | Bacteria | 2760 |
| 539 | Ga0495664_0051746 | 3300046477 | Bacteria | 2439 |
| 540 | Ga0495664_0169133 | 3300046477 | Unclassified | 1326 |
| 541 | Ga0495584_0057269 | 3300046491 | Bacteria | 1961 |
| 542 | Ga0495596_0025190 | 3300046500 | Bacteria | 2406 |
| 543 | Ga0495607_0105222 | 3300046501 | Bacteria | 1505 |
| 544 | Ga0495608_0033691 | 3300046511 | Bacteria | 3459 |
| 545 | Ga0495618_0167055 | 3300046514 | Unclassified | 1401 |
| 546 | Ga0495630_0209916 | 3300046517 | Unclassified | 1486 |
| 547 | Ga0495630_0350133 | 3300046517 | Unclassified | 1130 |
| 548 | Ga0495630_0498402 | 3300046517 | Bacteria | 934 |
| 549 | Ga0495631_0079342 | 3300046518 | Bacteria | 1417 |
| 550 | Ga0495637_0066581 | 3300046520 | Bacteria | 1464 |
| 551 | Ga0495666_0124780 | 3300046526 | Bacteria | 1204 |
| 552 | Ga0495642_0093054 | 3300046528 | Bacteria | 1277 |
| 553 | Ga0495652_0053055 | 3300046529 | Bacteria | 3457 |
| 554 | Ga0495652_0066470 | 3300046529 | Bacteria | 3025 |
| 555 | Ga0495640_0074061 | 3300046533 | Unclassified | 2278 |
| 556 | Ga0495586_0080663 | 3300046535 | Archaea | 1787 |
| 557 | Ga0495586_0307427 | 3300046535 | Bacteria | 909 |
| 558 | Ga0495587_0045827 | 3300046536 | Unclassified | 2597 |
| 559 | Ga0495609_0110647 | 3300046538 | Bacteria | 1186 |
| 560 | Ga0495645_0066783 | 3300046543 | Bacteria | 2598 |
| 561 | Ga0495667_0033239 | 3300046559 | Bacteria | 3452 |
| 562 | Ga0495667_0124111 | 3300046559 | Bacteria | 1667 |
| 563 | Ga0495668_0299366 | 3300046616 | Bacteria | 882 |
| 564 | Ga0495634_0312354 | 3300046642 | Bacteria | 948 |
| 565 | Ga0495635_0191253 | 3300046663 | Bacteria | 1389 |
| 566 | Ga0495659_0153011 | 3300046664 | Bacteria | 927 |
| 567 | Ga0495657_0059925 | 3300046675 | Unclassified | 2523 |
| 568 | Ga0495657_0060856 | 3300046675 | Unclassified | 2500 |
| 569 | Ga0495599_0130167 | 3300046678 | Unclassified | 1563 |
| 570 | Ga0495599_0433147 | 3300046678 | Bacteria | 780 |
| 571 | Ga0495623_0070015 | 3300046679 | Unclassified | 2185 |
| 572 | Ga0495623_0087910 | 3300046679 | Bacteria | 1914 |
| 573 | Ga0495646_0054872 | 3300046680 | Unclassified | 2395 |
| 574 | Ga0495647_0014517 | 3300046681 | Bacteria | 2746 |
| 575 | Ga0495658_0011401 | 3300046683 | Bacteria | 4470 |
| 576 | Ga0495658_0335756 | 3300046683 | Bacteria | 959 |
| 577 | Ga0495669_0255347 | 3300046684 | Bacteria | 842 |
| 578 | Ga0495613_0217565 | 3300046689 | Unclassified | 1342 |
| 579 | Ga0495670_0035531 | 3300046691 | Bacteria | 2484 |
| 580 | Ga0495671_0356017 | 3300046692 | Bacteria | 702 |
| 581 | Ga0495589_0029789 | 3300046794 | Bacteria | 2752 |
| 582 | Ga0495600_0005255 | 3300046809 | Bacteria | 7792 |
| 583 | Ga0495581_0000251 | 3300047315 | Bacteria | 25737 |
| 584 | Ga0495581_0057053 | 3300047315 | Bacteria | 2254 |
| 585 | Ga0495581_0150775 | 3300047315 | Bacteria | 1358 |
| 586 | Ga0495604_0138636 | 3300047317 | Unclassified | 1740 |
| 587 | Ga0495604_0451603 | 3300047317 | Bacteria | 840 |
| 588 | Ga0495674_0065108 | 3300047319 | Bacteria | 3167 |
| 589 | Ga0495674_0188704 | 3300047319 | Unclassified | 1714 |
| 590 | Ga0495674_0190334 | 3300047319 | Unclassified | 1705 |
| 591 | Ga0495676_0068673 | 3300047321 | Bacteria | 2737 |
| 592 | Ga0495676_0300655 | 3300047321 | Bacteria | 1082 |
| 593 | Ga0495680_0045633 | 3300047322 | Bacteria | 3460 |
| 594 | Ga0495680_0301091 | 3300047322 | Unclassified | 1126 |
| 595 | Ga0495680_0597313 | 3300047322 | Bacteria | 739 |
| 596 | Ga0495675_0009568 | 3300047444 | Bacteria | 6037 |
| 597 | Ga0495677_0033049 | 3300047445 | Bacteria | 1885 |
| 598 | Ga0495685_032783 | 3300047447 | Bacteria | 1785 |
| 599 | Ga0495684_0082230 | 3300047471 | Bacteria | 2444 |
| 600 | Ga0495602_0017149 | 3300048088 | Bacteria | 7264 |
| 601 | Ga0495602_0382812 | 3300048088 | Unclassified | 1007 |
| 602 | Ga0495614_0100141 | 3300048089 | Unclassified | 1266 |
| 603 | Ga0496100_0030782 | 3300048903 | Bacteria | 3331 |
| 604 | Ga0496100_0094671 | 3300048903 | Bacteria | 2046 |
| 605 | Ga0496100_0123896 | 3300048903 | Bacteria | 1812 |
| 606 | Ga0496101_0001226 | 3300048904 | Bacteria | 15362 |
| 607 | Ga0496101_0036395 | 3300048904 | Bacteria | 3486 |
| 608 | Ga0496101_0203865 | 3300048904 | Bacteria | 1530 |
| 609 | Ga0496101_0248566 | 3300048904 | Bacteria | 1385 |
| 610 | Ga0496101_0303049 | 3300048904 | Bacteria | 1252 |
| 611 | Ga0496101_0367634 | 3300048904 | Bacteria | 1131 |
| 612 | Ga0496102_0047331 | 3300048905 | Bacteria | 3907 |
| 613 | Ga0496103_0008487 | 3300048906 | Bacteria | 6104 |
| 614 | Ga0496103_0246825 | 3300048906 | Bacteria | 1149 |
| 615 | Ga0496104_0007576 | 3300048907 | Bacteria | 9607 |
| 616 | Ga0496104_0070134 | 3300048907 | Bacteria | 3332 |
| 617 | Ga0496104_0090814 | 3300048907 | Bacteria | 2919 |
| 618 | Ga0496104_0143068 | 3300048907 | Bacteria | 2298 |
| 619 | Ga0496104_0234725 | 3300048907 | Bacteria | 1746 |
| 620 | Ga0496104_0261919 | 3300048907 | Bacteria | 1642 |
| 621 | Ga0496104_0272992 | 3300048907 | Unclassified | 1604 |
| 622 | Ga0496104_0346143 | 3300048907 | Bacteria | 1399 |
| 623 | Ga0496104_0884555 | 3300048907 | Bacteria | 798 |
| 624 | Ga0496105_0026019 | 3300048908 | Bacteria | 4769 |
| 625 | Ga0496105_0417848 | 3300048908 | Bacteria | 1062 |
| 626 | Ga0496106_0026378 | 3300048909 | Bacteria | 4326 |
| 627 | Ga0496106_0250739 | 3300048909 | Bacteria | 1415 |
| 628 | Ga0496106_0250823 | 3300048909 | Bacteria | 1415 |
| 629 | Ga0496106_0310877 | 3300048909 | Unclassified | 1264 |
| 630 | Ga0496106_0556450 | 3300048909 | Bacteria | 920 |
| 631 | Ga0496107_0016044 | 3300048910 | Bacteria | 5256 |
| 632 | Ga0496107_0170422 | 3300048910 | Bacteria | 1615 |
| 633 | Ga0496108_0007773 | 3300048911 | Bacteria | 8685 |
| 634 | Ga0496108_0029381 | 3300048911 | Bacteria | 4551 |
| 635 | Ga0496108_0048818 | 3300048911 | Bacteria | 3540 |
| 636 | Ga0496109_0000789 | 3300048912 | Bacteria | 26350 |
| 637 | Ga0496109_0012783 | 3300048912 | Bacteria | 7258 |
| 638 | Ga0496109_0122754 | 3300048912 | Bacteria | 2420 |
| 639 | Ga0496109_0225341 | 3300048912 | Bacteria | 1763 |
| 640 | Ga0496109_0761624 | 3300048912 | Bacteria | 906 |
| 641 | Ga0496110_0034058 | 3300048913 | Bacteria | 4409 |
| 642 | Ga0496110_0123174 | 3300048913 | Bacteria | 2338 |
| 643 | Ga0496110_0135219 | 3300048913 | Bacteria | 2227 |
| 644 | Ga0496110_0267107 | 3300048913 | Bacteria | 1557 |
| 645 | Ga0496110_0493721 | 3300048913 | Unclassified | 1115 |
| 646 | Ga0496110_0827303 | 3300048913 | Unclassified | 831 |
| 647 | Ga0496111_0000612 | 3300048914 | Bacteria | 18851 |
| 648 | Ga0496111_0002932 | 3300048914 | Bacteria | 10433 |
| 649 | Ga0496111_0040987 | 3300048914 | Bacteria | 3322 |
| 650 | Ga0496111_0077560 | 3300048914 | Bacteria | 2422 |
| 651 | Ga0496112_0031169 | 3300048915 | Bacteria | 5168 |
| 652 | Ga0496112_0456904 | 3300048915 | Bacteria | 1215 |
| 653 | Ga0496112_0704274 | 3300048915 | Bacteria | 938 |
| 654 | Ga0496113_0066791 | 3300048916 | Bacteria | 2725 |
| 655 | Ga0496113_0169965 | 3300048916 | Bacteria | 1726 |
| 656 | Ga0496113_0240898 | 3300048916 | Unclassified | 1443 |
| 657 | Ga0496114_0044189 | 3300048917 | Bacteria | 3695 |
| 658 | Ga0496114_0088252 | 3300048917 | Bacteria | 2631 |
| 659 | Ga0496114_0159758 | 3300048917 | Bacteria | 1959 |
| 660 | Ga0496114_0161889 | 3300048917 | Bacteria | 1946 |
| 661 | Ga0496114_1038478 | 3300048917 | Bacteria | 703 |
| 662 | Ga0496115_0000431 | 3300048918 | Bacteria | 33991 |
| 663 | Ga0496115_0034658 | 3300048918 | Bacteria | 3989 |
| 664 | Ga0496115_0053832 | 3300048918 | Bacteria | 3231 |
| 665 | Ga0496115_0056803 | 3300048918 | Bacteria | 3146 |
| 666 | Ga0496115_0092140 | 3300048918 | Unclassified | 2477 |
| 667 | Ga0501031_0003039 | 3300049568 | Bacteria | 10723 |
| 668 | Ga0501031_0008840 | 3300049568 | Bacteria | 6549 |
| 669 | Ga0501031_0017518 | 3300049568 | Bacteria | 4656 |
| 670 | Ga0501031_0069323 | 3300049568 | Bacteria | 2296 |
| 671 | Ga0501031_0164492 | 3300049568 | Unclassified | 1450 |
| 672 | Ga0501031_0366214 | 3300049568 | Bacteria | 933 |
| 673 | Ga0501031_0544640 | 3300049568 | Bacteria | 748 |
| 674 | Ga0501032_0025692 | 3300049569 | Bacteria | 4059 |
| 675 | Ga0501032_0069448 | 3300049569 | Bacteria | 2351 |
| 676 | Ga0501032_0074724 | 3300049569 | Bacteria | 2258 |
| 677 | Ga0501032_0091001 | 3300049569 | Bacteria | 2025 |
| 678 | Ga0501032_0229282 | 3300049569 | Bacteria | 1208 |
| 679 | Ga0501032_0276410 | 3300049569 | Bacteria | 1088 |
| 680 | Ga0501033_0089648 | 3300049570 | Bacteria | 2249 |
| 681 | Ga0501033_0208686 | 3300049570 | Unclassified | 1393 |
| 682 | Ga0501033_0226575 | 3300049570 | Bacteria | 1329 |
| 683 | Ga0501034_0299273 | 3300049571 | Bacteria | 1546 |
| 684 | Ga0501034_0591322 | 3300049571 | Bacteria | 1016 |
| 685 | Ga0501036_0102932 | 3300049572 | Bacteria | 2415 |
| 686 | Ga0501036_0398702 | 3300049572 | Unclassified | 1148 |
| 687 | Ga0501037_0006544 | 3300049573 | Bacteria | 8526 |
| 688 | Ga0501037_0009223 | 3300049573 | Bacteria | 7233 |
| 689 | Ga0501038_0083674 | 3300049574 | Unclassified | 2686 |
| 690 | Ga0501038_0101880 | 3300049574 | Bacteria | 2390 |
| 691 | Ga0501038_0127136 | 3300049574 | Bacteria | 2096 |
| 692 | Ga0501039_0008012 | 3300049575 | Bacteria | 8049 |
| 693 | Ga0501039_0022023 | 3300049575 | Bacteria | 4890 |
| 694 | Ga0501039_0035030 | 3300049575 | Bacteria | 3874 |
| 695 | Ga0501039_0313469 | 3300049575 | Unclassified | 1233 |
| 696 | Ga0501040_0003363 | 3300049576 | Bacteria | 10328 |
| 697 | Ga0501040_0019635 | 3300049576 | Bacteria | 4497 |
| 698 | Ga0501040_0065275 | 3300049576 | Bacteria | 2507 |
| 699 | Ga0501040_0109453 | 3300049576 | Bacteria | 1932 |
| 700 | Ga0501040_0112384 | 3300049576 | Bacteria | 1905 |
| 701 | Ga0501040_0152022 | 3300049576 | Bacteria | 1633 |
| 702 | Ga0501040_0157994 | 3300049576 | Bacteria | 1602 |
| 703 | Ga0501040_0239878 | 3300049576 | Unclassified | 1292 |
| 704 | Ga0501040_0332506 | 3300049576 | Bacteria | 1087 |
| 705 | Ga0501041_0003225 | 3300049577 | Bacteria | 9374 |
| 706 | Ga0501041_0011119 | 3300049577 | Bacteria | 5314 |
| 707 | Ga0501041_0090082 | 3300049577 | Bacteria | 1894 |
| 708 | Ga0501041_0163324 | 3300049577 | Unclassified | 1393 |
| 709 | Ga0501041_0192293 | 3300049577 | Bacteria | 1278 |
| 710 | Ga0501041_0293706 | 3300049577 | Bacteria | 1024 |
| 711 | Ga0501041_0305468 | 3300049577 | Bacteria | 1003 |
| 712 | Ga0501042_0005449 | 3300049578 | Bacteria | 8197 |
| 713 | Ga0501042_0067107 | 3300049578 | Bacteria | 2564 |
| 714 | Ga0501042_0119736 | 3300049578 | Bacteria | 1895 |
| 715 | Ga0501042_0492159 | 3300049578 | Bacteria | 890 |
| 716 | Ga0501042_0503182 | 3300049578 | Unclassified | 880 |
| 717 | Ga0501042_0869896 | 3300049578 | Unclassified | 656 |
| 718 | Ga0501043_0008180 | 3300049579 | Bacteria | 8247 |
| 719 | Ga0501043_0117519 | 3300049579 | Bacteria | 2086 |
| 720 | Ga0501043_0256995 | 3300049579 | Unclassified | 1344 |
| 721 | Ga0501043_0890408 | 3300049579 | Bacteria | 639 |
| 722 | Ga0501046_0006570 | 3300049580 | Bacteria | 10277 |
| 723 | Ga0501046_0009150 | 3300049580 | Bacteria | 8579 |
| 724 | Ga0501046_0048546 | 3300049580 | Bacteria | 3361 |
| 725 | Ga0501046_0155022 | 3300049580 | Unclassified | 1726 |
| 726 | Ga0501046_0278829 | 3300049580 | Bacteria | 1225 |
| 727 | Ga0501046_0341765 | 3300049580 | Bacteria | 1088 |
| 728 | Ga0501047_0052732 | 3300049581 | Bacteria | 3932 |
| 729 | Ga0501047_0196113 | 3300049581 | Bacteria | 1881 |
| 730 | Ga0501047_0485683 | 3300049581 | Bacteria | 1063 |
| 731 | Ga0501048_0040635 | 3300049582 | Bacteria | 3332 |
| 732 | Ga0501048_0139773 | 3300049582 | Bacteria | 1712 |
| 733 | Ga0501048_0153120 | 3300049582 | Unclassified | 1631 |
| 734 | Ga0501048_0166094 | 3300049582 | Bacteria | 1563 |
| 735 | Ga0501048_0343113 | 3300049582 | Bacteria | 1065 |
| 736 | Ga0501067_0004242 | 3300049583 | Bacteria | 7906 |
| 737 | Ga0501067_0359497 | 3300049583 | Bacteria | 812 |
| 738 | Ga0501068_0047138 | 3300049584 | Bacteria | 2599 |
| 739 | Ga0501068_0127147 | 3300049584 | Unclassified | 1592 |
| 740 | Ga0501069_0040352 | 3300049585 | Bacteria | 2579 |
| 741 | Ga0501070_0006895 | 3300049586 | Bacteria | 9666 |
| 742 | Ga0501070_0015087 | 3300049586 | Bacteria | 6504 |
| 743 | Ga0501070_0164840 | 3300049586 | Bacteria | 1826 |
| 744 | Ga0501070_0188650 | 3300049586 | Bacteria | 1695 |
| 745 | Ga0501071_0006032 | 3300049587 | Bacteria | 7847 |
| 746 | Ga0501071_0018922 | 3300049587 | Bacteria | 4777 |
| 747 | Ga0501071_0037935 | 3300049587 | Bacteria | 3442 |
| 748 | Ga0501071_0042219 | 3300049587 | Bacteria | 3266 |
| 749 | Ga0501071_0291279 | 3300049587 | Bacteria | 1236 |
| 750 | Ga0501072_0005187 | 3300049588 | Bacteria | 9910 |
| 751 | Ga0501072_0011226 | 3300049588 | Bacteria | 6838 |
| 752 | Ga0501072_0085744 | 3300049588 | Bacteria | 2498 |
| 753 | Ga0501072_0140901 | 3300049588 | Bacteria | 1922 |
| 754 | Ga0501072_0164661 | 3300049588 | Unclassified | 1769 |
| 755 | Ga0501072_0212761 | 3300049588 | Bacteria | 1540 |
| 756 | Ga0501072_0267075 | 3300049588 | Bacteria | 1361 |
| 757 | Ga0501072_0377282 | 3300049588 | Bacteria | 1125 |
| 758 | Ga0501073_0041868 | 3300049589 | Bacteria | 3235 |
| 759 | Ga0501073_0329488 | 3300049589 | Unclassified | 1054 |
| 760 | Ga0501073_0477215 | 3300049589 | Unclassified | 862 |
| 761 | Ga0501074_0032865 | 3300049590 | Bacteria | 3759 |
| 762 | Ga0501074_0033101 | 3300049590 | Bacteria | 3746 |
| 763 | Ga0501074_0194069 | 3300049590 | Bacteria | 1447 |
| 764 | Ga0501074_0579673 | 3300049590 | Bacteria | 794 |
| 765 | Ga0501074_0841602 | 3300049590 | Bacteria | 646 |
| 766 | Ga0501075_0016209 | 3300049591 | Bacteria | 5364 |
| 767 | Ga0501075_0023728 | 3300049591 | Bacteria | 4492 |
| 768 | Ga0501075_0037864 | 3300049591 | Bacteria | 3605 |
| 769 | Ga0501075_0219937 | 3300049591 | Bacteria | 1449 |
| 770 | Ga0501075_0260580 | 3300049591 | Bacteria | 1321 |
| 771 | Ga0501076_0004275 | 3300049592 | Bacteria | 10115 |
| 772 | Ga0501076_0019995 | 3300049592 | Bacteria | 5122 |
| 773 | Ga0501076_0028979 | 3300049592 | Bacteria | 4302 |
| 774 | Ga0501076_0040751 | 3300049592 | Bacteria | 3650 |
| 775 | Ga0501076_0092508 | 3300049592 | Bacteria | 2433 |
| 776 | Ga0501076_0107007 | 3300049592 | Bacteria | 2258 |
| 777 | Ga0501076_0112711 | 3300049592 | Bacteria | 2200 |
| 778 | Ga0501076_0843137 | 3300049592 | Unclassified | 756 |
| 779 | Ga0501077_0002154 | 3300049593 | Bacteria | 11898 |
| 780 | Ga0501077_0010446 | 3300049593 | Bacteria | 5778 |
| 781 | Ga0501077_0016445 | 3300049593 | Bacteria | 4661 |
| 782 | Ga0501077_0074513 | 3300049593 | Unclassified | 2150 |
| 783 | Ga0501077_0121659 | 3300049593 | Bacteria | 1654 |
| 784 | Ga0501077_0148535 | 3300049593 | Bacteria | 1487 |
| 785 | Ga0501077_0161526 | 3300049593 | Bacteria | 1422 |
| 786 | Ga0501077_0174519 | 3300049593 | Bacteria | 1365 |
| 787 | Ga0501077_0454675 | 3300049593 | Bacteria | 820 |
| 788 | Ga0501079_0007610 | 3300049741 | Bacteria | 8204 |
| 789 | Ga0501079_0009161 | 3300049741 | Bacteria | 7494 |
| 790 | Ga0501079_0040277 | 3300049741 | Bacteria | 3604 |
| 791 | Ga0501079_0089397 | 3300049741 | Unclassified | 2385 |
| 792 | Ga0501079_0208267 | 3300049741 | Bacteria | 1527 |
| 793 | Ga0501080_0003423 | 3300049742 | Bacteria | 13998 |
| 794 | Ga0501080_0012225 | 3300049742 | Bacteria | 7867 |
| 795 | Ga0501080_0072390 | 3300049742 | Bacteria | 3207 |
| 796 | Ga0501080_0097991 | 3300049742 | Bacteria | 2721 |
| 797 | Ga0501080_0099711 | 3300049742 | Bacteria | 2695 |
| 798 | Ga0501080_0124978 | 3300049742 | Bacteria | 2383 |
| 799 | Ga0501080_0718029 | 3300049742 | Unclassified | 881 |
| 800 | Ga0501081_0029903 | 3300049743 | Bacteria | 3683 |
| 801 | Ga0501081_0042737 | 3300049743 | Bacteria | 3106 |
| 802 | Ga0501081_0523614 | 3300049743 | Bacteria | 884 |
| 803 | Ga0501081_0881537 | 3300049743 | Bacteria | 674 |
| 804 | Ga0501083_0002005 | 3300049744 | Bacteria | 14008 |
| 805 | Ga0501083_0513297 | 3300049744 | Bacteria | 780 |
| 806 | Ga0501035_0008282 | 3300049822 | Bacteria | 9686 |
| 807 | Ga0501035_0157756 | 3300049822 | Bacteria | 1966 |
| 808 | Ga0501035_0172802 | 3300049822 | Bacteria | 1866 |
| 809 | Ga0501035_0342029 | 3300049822 | Bacteria | 1253 |
| 810 | Ga0501044_0066228 | 3300049823 | Bacteria | 3684 |
| 811 | Ga0501044_0157020 | 3300049823 | Bacteria | 2254 |
| 812 | Ga0501045_0004901 | 3300049824 | Bacteria | 9271 |
| 813 | Ga0501045_0006558 | 3300049824 | Bacteria | 8067 |
| 814 | Ga0501045_0019180 | 3300049824 | Bacteria | 4872 |
| 815 | Ga0501045_0055734 | 3300049824 | Bacteria | 2890 |
| 816 | Ga0501045_0369500 | 3300049824 | Bacteria | 1067 |
| 817 | Ga0501045_0388321 | 3300049824 | Bacteria | 1039 |
| 818 | nmdc:mga05p37_265057_c1 | 3300050507 | Bacteria | 2054 |
| 819 | nmdc:mga05p37_53035_c1 | 3300050507 | Bacteria | 4988 |
| 820 | nmdc:mga06r32_676437_c1 | 3300050510 | Bacteria | 999 |
| 821 | nmdc:mga08y16_223255_c1 | 3300050511 | Bacteria | 1950 |
| 822 | nmdc:mga08y16_68175_c1 | 3300050511 | Bacteria | 3710 |
| 823 | nmdc:mga0n895_72801_c1 | 3300050512 | Bacteria | 3410 |
| 824 | nmdc:mga0rr50_14698_c1 | 3300050513 | Bacteria | 5145 |
| 825 | nmdc:mga08x19_403084_c1 | 3300050514 | Bacteria | 959 |
| 826 | nmdc:mga0a205_10739_c2 | 3300050515 | Bacteria | 5984 |
| 827 | nmdc:mga0a205_156121_c2 | 3300050515 | Unclassified | 968 |
| 828 | Ga0495601_0011007 | 3300053077 | Bacteria | 5405 |
| 829 | Ga0495601_0121847 | 3300053077 | Bacteria | 1694 |
| 830 | Ga0495595_0124648 | 3300053084 | Unclassified | 1256 |
| 831 | Ga0495595_0173780 | 3300053084 | Bacteria | 1067 |
| 832 | Ga0495619_0074585 | 3300053085 | Bacteria | 2275 |
| 833 | Ga0495619_0240060 | 3300053085 | Bacteria | 1256 |
| 834 | Ga0495619_0368104 | 3300053085 | Unclassified | 994 |
| 835 | Ga0501084_0005148 | 3300054114 | Bacteria | 10700 |
| 836 | Ga0501084_0049704 | 3300054114 | Bacteria | 3509 |
| 837 | Ga0501084_0076061 | 3300054114 | Bacteria | 2813 |
| 838 | Ga0501084_0077657 | 3300054114 | Bacteria | 2783 |
| 839 | Ga0501084_0216472 | 3300054114 | Unclassified | 1616 |
| 840 | Ga0501084_0358928 | 3300054114 | Bacteria | 1231 |
| 841 | Ga0501084_0525702 | 3300054114 | Unclassified | 1000 |
| 842 | Ga0501084_0801650 | 3300054114 | Bacteria | 793 |
| 843 | Ga0501082_0003519 | 3300060353 | Bacteria | 13680 |
| 844 | Ga0501082_0032986 | 3300060353 | Bacteria | 4465 |
| 845 | Ga0501082_0080222 | 3300060353 | Bacteria | 2815 |
| 846 | Ga0501082_0081108 | 3300060353 | Bacteria | 2800 |
| 847 | Ga0501082_0151370 | 3300060353 | Unclassified | 2015 |
| 848 | Ga0501082_0215469 | 3300060353 | Bacteria | 1670 |
| 849 | Ga0501082_0487396 | 3300060353 | Unclassified | 1077 |
| 850 | Ga0530510_0012617 | 3300061734 | Bacteria | 5940 |
| 851 | Ga0530510_0013743 | 3300061734 | Bacteria | 5698 |
| 852 | Ga0530510_0055123 | 3300061734 | Bacteria | 2872 |
| 853 | Ga0530510_0068009 | 3300061734 | Bacteria | 2585 |
| 854 | Ga0530510_0370288 | 3300061734 | Unclassified | 1077 |
| 855 | Ga0157380_10043682 | |||
| 856 | ARcpr5yngRDRAFT_c003016 | |||
| 857 | ARSoilOldRDRAFT_c002270 | |||
| 858 | JGI24737J22298_10110495 | |||
| 859 | JGI24743J22301_10016017 | |||
| 860 | JGI24745J21846_1018450 | |||
| 861 | JGI25407J50210_10002831 | |||
| 862 | Ga0070658_10003860 | |||
| 863 | Ga0070658_10017085 | |||
| 864 | Ga0070676_10085673 | |||
| 865 | Ga0070676_10113857 | |||
| 866 | Ga0070683_100005500 | |||
| 867 | Ga0070683_100013071 | |||
| 868 | Ga0070683_100028810 | |||
| 869 | Ga0070683_100056692 | |||
| 870 | Ga0070683_100175093 | |||
| 871 | Ga0070683_100228870 | |||
| 872 | Ga0070690_100033153 | |||
| 873 | Ga0070670_100138844 | |||
| 874 | Ga0070677_10167423 | |||
| 875 | Ga0068869_100019781 | |||
| 876 | Ga0068869_100367051 | |||
| 877 | Ga0070666_10035169 | |||
| 878 | Ga0070666_10579347 | |||
| 879 | Ga0070680_100005429 | |||
| 880 | Ga0070680_100005596 | |||
| 881 | Ga0070680_100068476 | |||
| 882 | Ga0070680_100261556 | |||
| 883 | Ga0070680_100323307 | |||
| 884 | Ga0070680_101091102 | |||
| 885 | Ga0070682_100014991 | |||
| 886 | Ga0070682_100016847 | |||
| 887 | Ga0070682_100028418 | |||
| 888 | Ga0070682_100353653 | |||
| 889 | Ga0068868_100009600 | |||
| 890 | Ga0068868_100011610 | |||
| 891 | Ga0068868_100324671 | |||
| 892 | Ga0068868_100397673 | |||
| 893 | Ga0070660_100001315 | |||
| 894 | Ga0070660_100002583 | |||
| 895 | Ga0070660_100023901 | |||
| 896 | Ga0070660_100343975 | |||
| 897 | Ga0070660_100769621 | |||
| 898 | Ga0070689_100011412 | |||
| 899 | Ga0070689_100313200 | |||
| 900 | Ga0070691_10353244 | |||
| 901 | Ga0070687_100107052 | |||
| 902 | Ga0070687_100151767 | |||
| 903 | Ga0070661_100017891 | |||
| 904 | Ga0070661_100096145 | |||
| 905 | Ga0070661_100168675 | |||
| 906 | Ga0070692_10002701 | |||
| 907 | Ga0070692_10161843 | |||
| 908 | Ga0070668_100026101 | |||
| 909 | Ga0070668_100253848 | |||
| 910 | Ga0070669_100262428 | |||
| 911 | Ga0070669_100916669 | |||
| 912 | Ga0070675_100505049 | |||
| 913 | Ga0070671_100085277 | |||
| 914 | Ga0070671_100130519 | |||
| 915 | Ga0070671_100272126 | |||
| 916 | Ga0070674_100006802 | |||
| 917 | Ga0070674_100029271 | |||
| 918 | Ga0070674_100287939 | |||
| 919 | Ga0070673_100041587 | |||
| 920 | Ga0070673_100109103 | |||
| 921 | Ga0070673_100262882 | |||
| 922 | Ga0070673_100330325 | |||
| 923 | Ga0070673_100477216 | |||
| 924 | Ga0070688_100045024 | |||
| 925 | Ga0070688_100354764 | |||
| 926 | Ga0070659_100002737 | |||
| 927 | Ga0070659_100002964 | |||
| 928 | Ga0070659_100009602 | |||
| 929 | Ga0070659_100020202 | |||
| 930 | Ga0070659_100134971 | |||
| 931 | Ga0070659_100290721 | |||
| 932 | Ga0070659_100425091 | |||
| 933 | Ga0070667_100139739 | |||
| 934 | Ga0070667_100179494 | |||
| 935 | Ga0070667_101272821 | |||
| 936 | Ga0070703_10048501 | |||
| 937 | Ga0070703_10060629 | |||
| 938 | Ga0070709_10041649 | |||
| 939 | Ga0070714_100647947 | |||
| 940 | Ga0070714_100786704 | |||
| 941 | Ga0070713_100176885 | |||
| 942 | Ga0070713_100980986 | |||
| 943 | Ga0070710_10054835 | |||
| 944 | Ga0070710_10345681 | |||
| 945 | Ga0070701_10024977 | |||
| 946 | Ga0070701_10044351 | |||
| 947 | Ga0070701_10155483 | |||
| 948 | Ga0070711_100002843 | |||
| 949 | Ga0070711_100184464 | |||
| 950 | Ga0070711_100226437 | |||
| 951 | Ga0070705_100003398 | |||
| 952 | Ga0070705_100313990 | |||
| 953 | Ga0070700_100003896 | |||
| 954 | Ga0070700_100087767 | |||
| 955 | Ga0070694_100082991 | |||
| 956 | Ga0070694_100340870 | |||
| 957 | Ga0070708_100025365 | |||
| 958 | Ga0070708_100279979 | |||
| 959 | Ga0070663_100043975 | |||
| 960 | Ga0070678_100001638 | |||
| 961 | Ga0070678_100017651 | |||
| 962 | Ga0070678_100192483 | |||
| 963 | Ga0070678_100194572 | |||
| 964 | Ga0070662_100053043 | |||
| 965 | Ga0070662_100085529 | |||
| 966 | Ga0070681_10002072 | |||
| 967 | Ga0070681_10041565 | |||
| 968 | Ga0070681_10043777 | |||
| 969 | Ga0070681_10206258 | |||
| 970 | Ga0070681_10323390 | |||
| 971 | Ga0068867_100035611 | |||
| 972 | Ga0068867_100183786 | |||
| 973 | Ga0068867_100511882 | |||
| 974 | Ga0070706_100002022 | |||
| 975 | Ga0070706_100020874 | |||
| 976 | Ga0070706_100268106 | |||
| 977 | Ga0070707_100000309 | |||
| 978 | Ga0070707_100675132 | |||
| 979 | Ga0070698_100023695 | |||
| 980 | Ga0070698_100086756 | |||
| 981 | Ga0070698_100457577 | |||
| 982 | Ga0070699_100024421 | |||
| 983 | Ga0070699_100056700 | |||
| 984 | Ga0070699_100060871 | |||
| 985 | Ga0070679_100030303 | |||
| 986 | Ga0070679_100079548 | |||
| 987 | Ga0070679_100105121 | |||
| 988 | Ga0070679_100136892 | |||
| 989 | Ga0070684_100007151 | |||
| 990 | Ga0070684_100042718 | |||
| 991 | Ga0070684_100145973 | |||
| 992 | Ga0070684_100234945 | |||
| 993 | Ga0070697_100163620 | |||
| 994 | Ga0070697_100457068 | |||
| 995 | Ga0068853_100010118 | |||
| 996 | Ga0068853_100070632 | |||
| 997 | Ga0068853_100265913 | |||
| 998 | Ga0070672_100024776 | |||
| 999 | Ga0070672_100028255 | |||
| 1000 | Ga0070672_100028456 | |||
| 1001 | Ga0070686_100001231 | |||
| 1002 | Ga0070686_100301473 | |||
| 1003 | Ga0070696_100059351 | |||
| 1004 | Ga0070696_100227139 | |||
| 1005 | Ga0070693_100271248 | |||
| 1006 | Ga0070693_100381132 | |||
| 1007 | Ga0070665_100012647 | |||
| 1008 | Ga0070665_100120796 | |||
| 1009 | Ga0070704_100013430 | |||
| 1010 | Ga0070704_100272632 | |||
| 1011 | Ga0068855_100052278 | |||
| 1012 | Ga0068855_100097753 | |||
| 1013 | Ga0070664_100127367 | |||
| 1014 | Ga0070664_100226649 | |||
| 1015 | Ga0070664_100230194 | |||
| 1016 | Ga0070664_100316798 | |||
| 1017 | Ga0070664_100346972 | |||
| 1018 | Ga0068857_100074663 | |||
| 1019 | Ga0068857_100153514 | |||
| 1020 | Ga0068857_100156007 | |||
| 1021 | Ga0068854_100007680 | |||
| 1022 | Ga0068854_100156461 | |||
| 1023 | Ga0068856_100055931 | |||
| 1024 | Ga0068856_100229336 | |||
| 1025 | Ga0070702_100045806 | |||
| 1026 | Ga0070702_100120266 | |||
| 1027 | Ga0068852_100039567 | |||
| 1028 | Ga0068852_100046060 | |||
| 1029 | Ga0068852_100062990 | |||
| 1030 | Ga0068859_100228762 | |||
| 1031 | Ga0068864_100109778 | |||
| 1032 | Ga0068866_10003011 | |||
| 1033 | Ga0068866_10128321 | |||
| 1034 | Ga0068866_10159339 | |||
| 1035 | Ga0068861_100050371 | |||
| 1036 | Ga0068861_100080755 | |||
| 1037 | Ga0068851_10109164 | |||
| 1038 | Ga0068870_10016555 | |||
| 1039 | Ga0068858_100191683 | |||
| 1040 | Ga0068860_100253619 | |||
| 1041 | Ga0081455_10007754 | |||
| 1042 | Ga0081455_10036392 | |||
| 1043 | Ga0081455_10074667 | |||
| 1044 | Ga0081455_10320565 | |||
| 1045 | Ga0081538_10000168 | |||
| 1046 | Ga0081538_10000809 | |||
| 1047 | Ga0081538_10007796 | |||
| 1048 | Ga0081538_10021988 | |||
| 1049 | Ga0081538_10101634 | |||
| 1050 | Ga0081539_10001549 | |||
| 1051 | Ga0070717_10050481 | |||
| 1052 | Ga0070717_10244355 | |||
| 1053 | Ga0075432_10002049 | |||
| 1054 | Ga0070712_100271000 | |||
| 1055 | Ga0070712_100285024 | |||
| 1056 | Ga0097621_100076206 | |||
| 1057 | Ga0068871_100123832 | |||
| 1058 | Ga0068871_100379302 | |||
| 1059 | Ga0075428_100004576 | |||
| 1060 | Ga0075428_100448325 | |||
| 1061 | Ga0075428_101266990 | |||
| 1062 | Ga0075433_10079174 | |||
| 1063 | Ga0075433_10145716 | |||
| 1064 | Ga0075434_100091839 | |||
| 1065 | Ga0068865_100000466 | |||
| 1066 | Ga0068865_100080710 | |||
| 1067 | Ga0068865_100114398 | |||
| 1068 | Ga0075436_100736081 | |||
| 1069 | Ga0097620_100228754 | |||
| 1070 | Ga0075435_100008386 | |||
| 1071 | Ga0105240_10347801 | |||
| 1072 | Ga0111539_10016526 | |||
| 1073 | Ga0111539_10355949 | |||
| 1074 | Ga0105245_10013757 | |||
| 1075 | Ga0105245_10036154 | |||
| 1076 | Ga0105245_10042951 | |||
| 1077 | Ga0105245_10090240 | |||
| 1078 | Ga0105245_10095547 | |||
| 1079 | Ga0105245_10325214 | |||
| 1080 | Ga0105245_10332033 | |||
| 1081 | Ga0105245_10358451 | |||
| 1082 | Ga0105245_10402121 | |||
| 1083 | Ga0105247_10023817 | |||
| 1084 | Ga0105247_10152184 | |||
| 1085 | Ga0114129_10053849 | |||
| 1086 | Ga0114129_10476598 | |||
| 1087 | Ga0105243_10002349 | |||
| 1088 | Ga0105243_10027690 | |||
| 1089 | Ga0105243_10049951 | |||
| 1090 | Ga0105243_10151002 | |||
| 1091 | Ga0105243_10689175 | |||
| 1092 | Ga0105243_11448889 | |||
| 1093 | Ga0105241_10210254 | |||
| 1094 | Ga0105241_10362195 | |||
| 1095 | Ga0105242_10052483 | |||
| 1096 | Ga0105242_10090258 | |||
| 1097 | Ga0105248_10007928 | |||
| 1098 | Ga0105248_10117003 | |||
| 1099 | Ga0105248_10189211 | |||
| 1100 | Ga0105248_10365768 | |||
| 1101 | Ga0105238_10275804 | |||
| 1102 | Ga0105238_10796605 | |||
| 1103 | Ga0105249_10010071 | |||
| 1104 | Ga0105249_10150806 | |||
| 1105 | Ga0105249_10594889 | |||
| 1106 | Ga0105239_10026243 | |||
| 1107 | Ga0105239_10026685 | |||
| 1108 | Ga0105239_10062561 | |||
| 1109 | Ga0105239_10077277 | |||
| 1110 | Ga0105239_10126857 | |||
| 1111 | Ga0105239_11189591 | |||
| 1112 | Ga0105246_10066322 | |||
| 1113 | Ga0105246_10738936 | |||
| 1114 | Ga0157371_10026423 | |||
| 1115 | Ga0157371_10184170 | |||
| 1116 | Ga0157370_10063033 | |||
| 1117 | Ga0157370_10754725 | |||
| 1118 | Ga0157369_10031930 | |||
| 1119 | Ga0157369_10728224 | |||
| 1120 | Ga0157374_10003026 | |||
| 1121 | Ga0157374_10289777 | |||
| 1122 | Ga0157374_10415575 | |||
| 1123 | Ga0157374_11033523 | |||
| 1124 | Ga0157378_10018028 | |||
| 1125 | Ga0157378_10213632 | |||
| 1126 | Ga0163162_10103015 | |||
| 1127 | Ga0163162_10253695 | |||
| 1128 | Ga0163162_10479848 | |||
| 1129 | Ga0157372_10045631 | |||
| 1130 | Ga0157372_10294889 | |||
| 1131 | Ga0157375_10014145 | |||
| 1132 | Ga0157375_10210624 | |||
| 1133 | Ga0157375_10561061 | |||
| 1134 | Ga0157375_10943073 | |||
| 1135 | Ga0157375_11103386 | |||
| 1136 | Ga0163163_10123737 | |||
| 1137 | Ga0163163_10380103 | |||
| 1138 | Ga0163163_10470387 | |||
| 1139 | Ga0163163_11044295 | |||
| 1140 | Ga0157380_10012211 | |||
| 1141 | Ga0157380_10343065 | |||
| 1142 | Ga0157380_10358681 | |||
| 1143 | Ga0157377_10008810 | |||
| 1144 | Ga0157377_10012979 | |||
| 1145 | Ga0157377_10020169 | |||
| 1146 | Ga0157379_10039406 | |||
| 1147 | Ga0157376_10002955 | |||
| 1148 | Ga0157376_10110656 | |||
| 1149 | Ga0157376_10391407 | |||
| 1150 | Ga0206356_10014031 | |||
| 1151 | Ga0206356_11569972 | |||
| 1152 | Ga0206354_10324474 | |||
| 1153 | Ga0206354_10590986 | |||
| 1154 | Ga0206353_11234956 | |||
| 1155 | Ga0206353_11362018 | |||
| 1156 | Ga0206353_11533416 | |||
| 1157 | Ga0206353_11969906 | |||
| 1158 | Ga0213876_10075292 | |||
| 1159 | Ga0207682_10103703 | |||
| 1160 | Ga0207692_10040353 | |||
| 1161 | Ga0207692_10407330 | |||
| 1162 | Ga0207642_10013808 | |||
| 1163 | Ga0207710_10027367 | |||
| 1164 | Ga0207688_10018365 | |||
| 1165 | Ga0207688_10019751 | |||
| 1166 | Ga0207688_10052312 | |||
| 1167 | Ga0207688_10139237 | |||
| 1168 | Ga0207688_10224750 | |||
| 1169 | Ga0207680_10035810 | |||
| 1170 | Ga0207647_10158436 | |||
| 1171 | Ga0207645_10240379 | |||
| 1172 | Ga0207643_10019082 | |||
| 1173 | Ga0207643_10070599 | |||
| 1174 | Ga0207643_10086664 | |||
| 1175 | Ga0207705_10027995 | |||
| 1176 | Ga0207705_10052485 | |||
| 1177 | Ga0207705_10138270 | |||
| 1178 | Ga0207684_10011047 | |||
| 1179 | Ga0207684_10100186 | |||
| 1180 | Ga0207684_10557055 | |||
| 1181 | Ga0207654_10213303 | |||
| 1182 | Ga0207707_10055219 | |||
| 1183 | Ga0207707_10074091 | |||
| 1184 | Ga0207707_10094926 | |||
| 1185 | Ga0207707_10212838 | |||
| 1186 | Ga0207707_10326645 | |||
| 1187 | Ga0207695_10150236 | |||
| 1188 | Ga0207671_10291505 | |||
| 1189 | Ga0207693_10001288 | |||
| 1190 | Ga0207693_10201579 | |||
| 1191 | Ga0207693_10521625 | |||
| 1192 | Ga0207663_10080370 | |||
| 1193 | Ga0207663_10102230 | |||
| 1194 | Ga0207663_10503095 | |||
| 1195 | Ga0207660_10064656 | |||
| 1196 | Ga0207660_10120964 | |||
| 1197 | Ga0207660_10215582 | |||
| 1198 | Ga0207660_10306722 | |||
| 1199 | Ga0207662_10130382 | |||
| 1200 | Ga0207657_10000523 | |||
| 1201 | Ga0207657_10005589 | |||
| 1202 | Ga0207657_10015376 | |||
| 1203 | Ga0207657_10016636 | |||
| 1204 | Ga0207657_10088900 | |||
| 1205 | Ga0207649_10020758 | |||
| 1206 | Ga0207649_10032982 | |||
| 1207 | Ga0207649_10352946 | |||
| 1208 | Ga0207649_10705207 | |||
| 1209 | Ga0207652_10127180 | |||
| 1210 | Ga0207652_10129300 | |||
| 1211 | Ga0207652_10136729 | |||
| 1212 | Ga0207652_10287587 | |||
| 1213 | Ga0207652_10478830 | |||
| 1214 | Ga0207652_10616532 | |||
| 1215 | Ga0207646_10001136 | |||
| 1216 | Ga0207681_10142076 | |||
| 1217 | Ga0207681_10613606 | |||
| 1218 | Ga0207694_10040157 | |||
| 1219 | Ga0207659_10127920 | |||
| 1220 | Ga0207659_10205540 | |||
| 1221 | Ga0207687_10032931 | |||
| 1222 | Ga0207687_10151295 | |||
| 1223 | Ga0207687_10156569 | |||
| 1224 | Ga0207687_10224165 | |||
| 1225 | Ga0207687_10290988 | |||
| 1226 | Ga0207687_10345438 | |||
| 1227 | Ga0207700_10054986 | |||
| 1228 | Ga0207700_11336139 | |||
| 1229 | Ga0207664_10643047 | |||
| 1230 | Ga0207644_10056484 | |||
| 1231 | Ga0207644_10108279 | |||
| 1232 | Ga0207644_10306545 | |||
| 1233 | Ga0207690_10058607 | |||
| 1234 | Ga0207690_10246329 | |||
| 1235 | Ga0207690_10330977 | |||
| 1236 | Ga0207690_10430648 | |||
| 1237 | Ga0207706_10018464 | |||
| 1238 | Ga0207706_10043279 | |||
| 1239 | Ga0207706_10083849 | |||
| 1240 | Ga0207686_10074768 | |||
| 1241 | Ga0207686_10378154 | |||
| 1242 | Ga0207686_10381775 | |||
| 1243 | Ga0207709_10005071 | |||
| 1244 | Ga0207670_10013115 | |||
| 1245 | Ga0207670_10173329 | |||
| 1246 | Ga0207670_10175715 | |||
| 1247 | Ga0207669_10029842 | |||
| 1248 | Ga0207669_10425606 | |||
| 1249 | Ga0207704_10008306 | |||
| 1250 | Ga0207704_10063208 | |||
| 1251 | Ga0207665_10073388 | |||
| 1252 | Ga0207691_10010759 | |||
| 1253 | Ga0207691_10021817 | |||
| 1254 | Ga0207691_10032862 | |||
| 1255 | Ga0207691_10033303 | |||
| 1256 | Ga0207711_10291101 | |||
| 1257 | Ga0207689_10106844 | |||
| 1258 | Ga0207689_10244216 | |||
| 1259 | Ga0207689_10313730 | |||
| 1260 | Ga0207661_10001401 | |||
| 1261 | Ga0207661_10066621 | |||
| 1262 | Ga0207661_10067324 | |||
| 1263 | Ga0207661_10086399 | |||
| 1264 | Ga0207661_10105034 | |||
| 1265 | Ga0207661_10168786 | |||
| 1266 | Ga0207661_10229299 | |||
| 1267 | Ga0207661_10246029 | |||
| 1268 | Ga0207679_10037316 | |||
| 1269 | Ga0207679_10436415 | |||
| 1270 | Ga0207667_10445091 | |||
| 1271 | Ga0207667_10635158 | |||
| 1272 | Ga0207667_10686554 | |||
| 1273 | Ga0207667_10711012 | |||
| 1274 | Ga0207651_10025655 | |||
| 1275 | Ga0207651_10297970 | |||
| 1276 | Ga0207712_10006602 | |||
| 1277 | Ga0207712_11022737 | |||
| 1278 | Ga0207668_10050527 | |||
| 1279 | Ga0207640_10151506 | |||
| 1280 | Ga0207658_10197238 | |||
| 1281 | Ga0207658_10480478 | |||
| 1282 | Ga0207677_10058946 | |||
| 1283 | Ga0207677_10471043 | |||
| 1284 | Ga0207639_10035468 | |||
| 1285 | Ga0207678_10063183 | |||
| 1286 | Ga0207678_10212382 | |||
| 1287 | Ga0207708_10000500 | |||
| 1288 | Ga0207708_10044887 | |||
| 1289 | Ga0207708_10077355 | |||
| 1290 | Ga0207708_10112798 | |||
| 1291 | Ga0207708_10868976 | |||
| 1292 | Ga0207702_10015464 | |||
| 1293 | Ga0207702_10034026 | |||
| 1294 | Ga0207702_11632166 | |||
| 1295 | Ga0207641_10076273 | |||
| 1296 | Ga0207648_10014908 | |||
| 1297 | Ga0207648_10078619 | |||
| 1298 | Ga0207648_10179665 | |||
| 1299 | Ga0207648_10492273 | |||
| 1300 | Ga0207674_10025708 | |||
| 1301 | Ga0207674_10142929 | |||
| 1302 | Ga0207675_100010460 | |||
| 1303 | Ga0207675_100166122 | |||
| 1304 | Ga0207675_100312001 | |||
| 1305 | Ga0207683_10001613 | |||
| 1306 | Ga0207683_10016884 | |||
| 1307 | Ga0207683_10036768 | |||
| 1308 | Ga0207698_10025340 | |||
| 1309 | Ga0207698_10367121 | |||
| 1310 | Ga0207698_10390708 | |||
| 1311 | Ga0207428_10000196 | |||
| 1312 | Ga0207428_10021983 | |||
| 1313 | Ga0268266_10010984 | |||
| 1314 | Ga0268266_10113811 | |||
| 1315 | Ga0268264_10385956 | |||
| 1316 | Ga0265318_10079468 | |||
| 1317 | Ga0265320_10232619 | |||
| 1318 | Ga0265327_10116318 | |||
| 1319 | Ga0265316_10401806 | |||
| 1320 | Ga0265313_10084325 | |||
| 1321 | Ga0265314_10112311 | |||
| 1322 | Ga0307415_100191398 | |||
| 1323 | Ga0373948_0009715 | |||
| 1324 | Ga0373958_0011982 | |||
| 1325 | Ga0373959_0028528 | |||
| 1326 | Ga0373928_0021797 | |||
| 1327 | Ga0373951_0073053 | |||
| 1328 | Ga0373941_0083250 | |||
| 1329 | Ga0373956_0290365 | |||
| 1330 | Ga0373943_0001296 | |||
| 1331 | Ga0373955_0089149 | |||
| 1332 | Ga0373924_0050918 | |||
| 1333 | Ga0373935_0147855 | |||
| 1334 | Ga0373933_0869737 | |||
| 1335 | Ga0373947_0364898 | |||
| 1336 | Ga0373937_0074997 | |||
| 1337 | Ga0395899_0009816 | |||
| 1338 | Ga0395899_0082798 | |||
| 1339 | Ga0395899_0101592 | |||
| 1340 | Ga0395899_0426283 | |||
| 1341 | Ga0395900_0008989 | |||
| 1342 | Ga0395900_0009327 | |||
| 1343 | Ga0395900_0080154 | |||
| 1344 | Ga0395900_0444849 | |||
| 1345 | Ga0395900_0822696 | |||
| 1346 | Ga0395898_0003791 | |||
| 1347 | Ga0395898_0014525 | |||
| 1348 | Ga0395898_0015638 | |||
| 1349 | Ga0395898_0022314 | |||
| 1350 | Ga0395898_0082952 | |||
| 1351 | Ga0395898_0412683 | |||
| 1352 | Ga0395905_0003409 | |||
| 1353 | Ga0395905_0006296 | |||
| 1354 | Ga0395905_0006822 | |||
| 1355 | Ga0395905_0026362 | |||
| 1356 | Ga0436364_1449480 | |||
| 1357 | Ga0395901_0011556 | |||
| 1358 | Ga0395901_0025903 | |||
| 1359 | Ga0395901_0106174 | |||
| 1360 | Ga0395901_0119949 | |||
| 1361 | Ga0395901_0270339 | |||
| 1362 | Ga0395901_0817196 | |||
| 1363 | Ga0395901_1405319 | |||
| 1364 | Ga0436365_0041413 | |||
| 1365 | Ga0436365_0622750 | |||
| 1366 | Ga0436360_0023640 | |||
| 1367 | Ga0436362_0536614 | |||
| 1368 | Ga0451802_1281792 | |||
| 1369 | Ga0451853_1098251 | |||
| 1370 | Ga0450920_020137 | |||
| 1371 | Ga0466961_0055233 | |||
| 1372 | Ga0466961_0309065 | |||
| 1373 | Ga0466961_0360993 | |||
| 1374 | Ga0466963_0144727 | |||
| 1375 | Ga0466963_0180125 | |||
| 1376 | Ga0466964_0007673 | |||
| 1377 | Ga0466964_0061653 | |||
| 1378 | Ga0466960_0313260 | |||
| 1379 | Ga0466959_0112155 | |||
| 1380 | Ga0466967_0021144 | |||
| 1381 | Ga0466967_0021553 | |||
| 1382 | Ga0466967_0131646 | |||
| 1383 | Ga0466967_0270229 | |||
| 1384 | Ga0466967_0297441 | |||
| 1385 | Ga0495603_0028431 | |||
| 1386 | Ga0495603_0194685 | |||
| 1387 | Ga0495651_0061199 | |||
| 1388 | Ga0495651_0081308 | |||
| 1389 | Ga0495651_0318795 | |||
| 1390 | Ga0495653_0033495 | |||
| 1391 | Ga0495653_0327220 | |||
| 1392 | Ga0495582_0035028 | |||
| 1393 | Ga0495664_0051746 | |||
| 1394 | Ga0495664_0169133 | |||
| 1395 | Ga0495584_0057269 | |||
| 1396 | Ga0495596_0025190 | |||
| 1397 | Ga0495607_0105222 | |||
| 1398 | Ga0495608_0033691 | |||
| 1399 | Ga0495618_0167055 | |||
| 1400 | Ga0495630_0209916 | |||
| 1401 | Ga0495630_0350133 | |||
| 1402 | Ga0495630_0498402 | |||
| 1403 | Ga0495631_0079342 | |||
| 1404 | Ga0495637_0066581 | |||
| 1405 | Ga0495666_0124780 | |||
| 1406 | Ga0495642_0093054 | |||
| 1407 | Ga0495652_0053055 | |||
| 1408 | Ga0495652_0066470 | |||
| 1409 | Ga0495640_0074061 | |||
| 1410 | Ga0495586_0080663 | |||
| 1411 | Ga0495586_0307427 | |||
| 1412 | Ga0495587_0045827 | |||
| 1413 | Ga0495609_0110647 | |||
| 1414 | Ga0495645_0066783 | |||
| 1415 | Ga0495667_0033239 | |||
| 1416 | Ga0495667_0124111 | |||
| 1417 | Ga0495668_0299366 | |||
| 1418 | Ga0495634_0312354 | |||
| 1419 | Ga0495635_0191253 | |||
| 1420 | Ga0495659_0153011 | |||
| 1421 | Ga0495657_0059925 | |||
| 1422 | Ga0495657_0060856 | |||
| 1423 | Ga0495599_0130167 | |||
| 1424 | Ga0495599_0433147 | |||
| 1425 | Ga0495623_0070015 | |||
| 1426 | Ga0495623_0087910 | |||
| 1427 | Ga0495646_0054872 | |||
| 1428 | Ga0495647_0014517 | |||
| 1429 | Ga0495658_0011401 | |||
| 1430 | Ga0495658_0335756 | |||
| 1431 | Ga0495669_0255347 | |||
| 1432 | Ga0495613_0217565 | |||
| 1433 | Ga0495670_0035531 | |||
| 1434 | Ga0495671_0356017 | |||
| 1435 | Ga0495589_0029789 | |||
| 1436 | Ga0495600_0005255 | |||
| 1437 | Ga0495581_0000251 | |||
| 1438 | Ga0495581_0057053 | |||
| 1439 | Ga0495581_0150775 | |||
| 1440 | Ga0495604_0138636 | |||
| 1441 | Ga0495604_0451603 | |||
| 1442 | Ga0495674_0065108 | |||
| 1443 | Ga0495674_0188704 | |||
| 1444 | Ga0495674_0190334 | |||
| 1445 | Ga0495676_0068673 | |||
| 1446 | Ga0495676_0300655 | |||
| 1447 | Ga0495680_0045633 | |||
| 1448 | Ga0495680_0301091 | |||
| 1449 | Ga0495680_0597313 | |||
| 1450 | Ga0495675_0009568 | |||
| 1451 | Ga0495677_0033049 | |||
| 1452 | Ga0495685_032783 | |||
| 1453 | Ga0495684_0082230 | |||
| 1454 | Ga0495602_0017149 | |||
| 1455 | Ga0495602_0382812 | |||
| 1456 | Ga0495614_0100141 | |||
| 1457 | Ga0496100_0030782 | |||
| 1458 | Ga0496100_0094671 | |||
| 1459 | Ga0496100_0123896 | |||
| 1460 | Ga0496101_0001226 | |||
| 1461 | Ga0496101_0036395 | |||
| 1462 | Ga0496101_0203865 | |||
| 1463 | Ga0496101_0248566 | |||
| 1464 | Ga0496101_0303049 | |||
| 1465 | Ga0496101_0367634 | |||
| 1466 | Ga0496102_0047331 | |||
| 1467 | Ga0496103_0008487 | |||
| 1468 | Ga0496103_0246825 | |||
| 1469 | Ga0496104_0007576 | |||
| 1470 | Ga0496104_0070134 | |||
| 1471 | Ga0496104_0090814 | |||
| 1472 | Ga0496104_0143068 | |||
| 1473 | Ga0496104_0234725 | |||
| 1474 | Ga0496104_0261919 | |||
| 1475 | Ga0496104_0272992 | |||
| 1476 | Ga0496104_0346143 | |||
| 1477 | Ga0496104_0884555 | |||
| 1478 | Ga0496105_0026019 | |||
| 1479 | Ga0496105_0417848 | |||
| 1480 | Ga0496106_0026378 | |||
| 1481 | Ga0496106_0250739 | |||
| 1482 | Ga0496106_0250823 | |||
| 1483 | Ga0496106_0310877 | |||
| 1484 | Ga0496106_0556450 | |||
| 1485 | Ga0496107_0016044 | |||
| 1486 | Ga0496107_0170422 | |||
| 1487 | Ga0496108_0007773 | |||
| 1488 | Ga0496108_0029381 | |||
| 1489 | Ga0496108_0048818 | |||
| 1490 | Ga0496109_0000789 | |||
| 1491 | Ga0496109_0012783 | |||
| 1492 | Ga0496109_0122754 | |||
| 1493 | Ga0496109_0225341 | |||
| 1494 | Ga0496109_0761624 | |||
| 1495 | Ga0496110_0034058 | |||
| 1496 | Ga0496110_0123174 | |||
| 1497 | Ga0496110_0135219 | |||
| 1498 | Ga0496110_0267107 | |||
| 1499 | Ga0496110_0493721 | |||
| 1500 | Ga0496110_0827303 | |||
| 1501 | Ga0496111_0000612 | |||
| 1502 | Ga0496111_0002932 | |||
| 1503 | Ga0496111_0040987 | |||
| 1504 | Ga0496111_0077560 | |||
| 1505 | Ga0496112_0031169 | |||
| 1506 | Ga0496112_0456904 | |||
| 1507 | Ga0496112_0704274 | |||
| 1508 | Ga0496113_0066791 | |||
| 1509 | Ga0496113_0169965 | |||
| 1510 | Ga0496113_0240898 | |||
| 1511 | Ga0496114_0044189 | |||
| 1512 | Ga0496114_0088252 | |||
| 1513 | Ga0496114_0159758 | |||
| 1514 | Ga0496114_0161889 | |||
| 1515 | Ga0496114_1038478 | |||
| 1516 | Ga0496115_0000431 | |||
| 1517 | Ga0496115_0034658 | |||
| 1518 | Ga0496115_0053832 | |||
| 1519 | Ga0496115_0056803 | |||
| 1520 | Ga0496115_0092140 | |||
| 1521 | Ga0501031_0003039 | |||
| 1522 | Ga0501031_0008840 | |||
| 1523 | Ga0501031_0017518 | |||
| 1524 | Ga0501031_0069323 | |||
| 1525 | Ga0501031_0164492 | |||
| 1526 | Ga0501031_0366214 | |||
| 1527 | Ga0501031_0544640 | |||
| 1528 | Ga0501032_0025692 | |||
| 1529 | Ga0501032_0069448 | |||
| 1530 | Ga0501032_0074724 | |||
| 1531 | Ga0501032_0091001 | |||
| 1532 | Ga0501032_0229282 | |||
| 1533 | Ga0501032_0276410 | |||
| 1534 | Ga0501033_0089648 | |||
| 1535 | Ga0501033_0208686 | |||
| 1536 | Ga0501033_0226575 | |||
| 1537 | Ga0501034_0299273 | |||
| 1538 | Ga0501034_0591322 | |||
| 1539 | Ga0501036_0102932 | |||
| 1540 | Ga0501036_0398702 | |||
| 1541 | Ga0501037_0006544 | |||
| 1542 | Ga0501037_0009223 | |||
| 1543 | Ga0501038_0083674 | |||
| 1544 | Ga0501038_0101880 | |||
| 1545 | Ga0501038_0127136 | |||
| 1546 | Ga0501039_0008012 | |||
| 1547 | Ga0501039_0022023 | |||
| 1548 | Ga0501039_0035030 | |||
| 1549 | Ga0501039_0313469 | |||
| 1550 | Ga0501040_0003363 | |||
| 1551 | Ga0501040_0019635 | |||
| 1552 | Ga0501040_0065275 | |||
| 1553 | Ga0501040_0109453 | |||
| 1554 | Ga0501040_0112384 | |||
| 1555 | Ga0501040_0152022 | |||
| 1556 | Ga0501040_0157994 | |||
| 1557 | Ga0501040_0239878 | |||
| 1558 | Ga0501040_0332506 | |||
| 1559 | Ga0501041_0003225 | |||
| 1560 | Ga0501041_0011119 | |||
| 1561 | Ga0501041_0090082 | |||
| 1562 | Ga0501041_0163324 | |||
| 1563 | Ga0501041_0192293 | |||
| 1564 | Ga0501041_0293706 | |||
| 1565 | Ga0501041_0305468 | |||
| 1566 | Ga0501042_0005449 | |||
| 1567 | Ga0501042_0067107 | |||
| 1568 | Ga0501042_0119736 | |||
| 1569 | Ga0501042_0492159 | |||
| 1570 | Ga0501042_0503182 | |||
| 1571 | Ga0501042_0869896 | |||
| 1572 | Ga0501043_0008180 | |||
| 1573 | Ga0501043_0117519 | |||
| 1574 | Ga0501043_0256995 | |||
| 1575 | Ga0501043_0890408 | |||
| 1576 | Ga0501046_0006570 | |||
| 1577 | Ga0501046_0009150 | |||
| 1578 | Ga0501046_0048546 | |||
| 1579 | Ga0501046_0155022 | |||
| 1580 | Ga0501046_0278829 | |||
| 1581 | Ga0501046_0341765 | |||
| 1582 | Ga0501047_0052732 | |||
| 1583 | Ga0501047_0196113 | |||
| 1584 | Ga0501047_0485683 | |||
| 1585 | Ga0501048_0040635 | |||
| 1586 | Ga0501048_0139773 | |||
| 1587 | Ga0501048_0153120 | |||
| 1588 | Ga0501048_0166094 | |||
| 1589 | Ga0501048_0343113 | |||
| 1590 | Ga0501067_0004242 | |||
| 1591 | Ga0501067_0359497 | |||
| 1592 | Ga0501068_0047138 | |||
| 1593 | Ga0501068_0127147 | |||
| 1594 | Ga0501069_0040352 | |||
| 1595 | Ga0501070_0006895 | |||
| 1596 | Ga0501070_0015087 | |||
| 1597 | Ga0501070_0164840 | |||
| 1598 | Ga0501070_0188650 | |||
| 1599 | Ga0501071_0006032 | |||
| 1600 | Ga0501071_0018922 | |||
| 1601 | Ga0501071_0037935 | |||
| 1602 | Ga0501071_0042219 | |||
| 1603 | Ga0501071_0291279 | |||
| 1604 | Ga0501072_0005187 | |||
| 1605 | Ga0501072_0011226 | |||
| 1606 | Ga0501072_0085744 | |||
| 1607 | Ga0501072_0140901 | |||
| 1608 | Ga0501072_0164661 | |||
| 1609 | Ga0501072_0212761 | |||
| 1610 | Ga0501072_0267075 | |||
| 1611 | Ga0501072_0377282 | |||
| 1612 | Ga0501073_0041868 | |||
| 1613 | Ga0501073_0329488 | |||
| 1614 | Ga0501073_0477215 | |||
| 1615 | Ga0501074_0032865 | |||
| 1616 | Ga0501074_0033101 | |||
| 1617 | Ga0501074_0194069 | |||
| 1618 | Ga0501074_0579673 | |||
| 1619 | Ga0501074_0841602 | |||
| 1620 | Ga0501075_0016209 | |||
| 1621 | Ga0501075_0023728 | |||
| 1622 | Ga0501075_0037864 | |||
| 1623 | Ga0501075_0219937 | |||
| 1624 | Ga0501075_0260580 | |||
| 1625 | Ga0501076_0004275 | |||
| 1626 | Ga0501076_0019995 | |||
| 1627 | Ga0501076_0028979 | |||
| 1628 | Ga0501076_0040751 | |||
| 1629 | Ga0501076_0092508 | |||
| 1630 | Ga0501076_0107007 | |||
| 1631 | Ga0501076_0112711 | |||
| 1632 | Ga0501076_0843137 | |||
| 1633 | Ga0501077_0002154 | |||
| 1634 | Ga0501077_0010446 | |||
| 1635 | Ga0501077_0016445 | |||
| 1636 | Ga0501077_0074513 | |||
| 1637 | Ga0501077_0121659 | |||
| 1638 | Ga0501077_0148535 | |||
| 1639 | Ga0501077_0161526 | |||
| 1640 | Ga0501077_0174519 | |||
| 1641 | Ga0501077_0454675 | |||
| 1642 | Ga0501079_0007610 | |||
| 1643 | Ga0501079_0009161 | |||
| 1644 | Ga0501079_0040277 | |||
| 1645 | Ga0501079_0089397 | |||
| 1646 | Ga0501079_0208267 | |||
| 1647 | Ga0501080_0003423 | |||
| 1648 | Ga0501080_0012225 | |||
| 1649 | Ga0501080_0072390 | |||
| 1650 | Ga0501080_0097991 | |||
| 1651 | Ga0501080_0099711 | |||
| 1652 | Ga0501080_0124978 | |||
| 1653 | Ga0501080_0718029 | |||
| 1654 | Ga0501081_0029903 | |||
| 1655 | Ga0501081_0042737 | |||
| 1656 | Ga0501081_0523614 | |||
| 1657 | Ga0501081_0881537 | |||
| 1658 | Ga0501083_0002005 | |||
| 1659 | Ga0501083_0513297 | |||
| 1660 | Ga0501035_0008282 | |||
| 1661 | Ga0501035_0157756 | |||
| 1662 | Ga0501035_0172802 | |||
| 1663 | Ga0501035_0342029 | |||
| 1664 | Ga0501044_0066228 | |||
| 1665 | Ga0501044_0157020 | |||
| 1666 | Ga0501045_0004901 | |||
| 1667 | Ga0501045_0006558 | |||
| 1668 | Ga0501045_0019180 | |||
| 1669 | Ga0501045_0055734 | |||
| 1670 | Ga0501045_0369500 | |||
| 1671 | Ga0501045_0388321 | |||
| 1672 | nmdc:mga05p37_265057_c1 | |||
| 1673 | nmdc:mga05p37_53035_c1 | |||
| 1674 | nmdc:mga06r32_676437_c1 | |||
| 1675 | nmdc:mga08y16_223255_c1 | |||
| 1676 | nmdc:mga08y16_68175_c1 | |||
| 1677 | nmdc:mga0n895_72801_c1 | |||
| 1678 | nmdc:mga0rr50_14698_c1 | |||
| 1679 | nmdc:mga08x19_403084_c1 | |||
| 1680 | nmdc:mga0a205_10739_c2 | |||
| 1681 | nmdc:mga0a205_156121_c2 | |||
| 1682 | Ga0495601_0011007 | |||
| 1683 | Ga0495601_0121847 | |||
| 1684 | Ga0495595_0124648 | |||
| 1685 | Ga0495595_0173780 | |||
| 1686 | Ga0495619_0074585 | |||
| 1687 | Ga0495619_0240060 | |||
| 1688 | Ga0495619_0368104 | |||
| 1689 | Ga0501084_0005148 | |||
| 1690 | Ga0501084_0049704 | |||
| 1691 | Ga0501084_0076061 | |||
| 1692 | Ga0501084_0077657 | |||
| 1693 | Ga0501084_0216472 | |||
| 1694 | Ga0501084_0358928 | |||
| 1695 | Ga0501084_0525702 | |||
| 1696 | Ga0501084_0801650 | |||
| 1697 | Ga0501082_0003519 | |||
| 1698 | Ga0501082_0032986 | |||
| 1699 | Ga0501082_0080222 | |||
| 1700 | Ga0501082_0081108 | |||
| 1701 | Ga0501082_0151370 | |||
| 1702 | Ga0501082_0215469 | |||
| 1703 | Ga0501082_0487396 | |||
| 1704 | Ga0530510_0012617 | |||
| 1705 | Ga0530510_0013743 | |||
| 1706 | Ga0530510_0055123 | |||
| 1707 | Ga0530510_0068009 | |||
| 1708 | Ga0530510_0370288 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a29-assembly1.cif.gz_A | structure of the engineered retro-aldolase ra95.0 | 0.8797 | 4 | 186 |
| 4pek-assembly1.cif.gz_A | crystal structure of a computationally designed retro-aldolase, ra114.3 | 0.8736 | 5 | 185 |
| 4a2s-assembly1.cif.gz_A | structure of the engineered retro-aldolase ra95.5 | 0.8707 | 5 | 186 |
| 3ud6-assembly1.cif.gz_A | structural analyses of covalent enzyme-substrate analogue complexes reveal strengths and limitations of de novo enzyme design | 0.8687 | 5 | 187 |
| 3nyz-assembly2.cif.gz_B | crystal structure of kemp elimination catalyst 1a53-2 | 0.8687 | 5 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o6yX00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8628 | 4 | 182 | 3.20.20.70 |
| 2c3zA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8608 | 4 | 178 | 3.20.20.70 |
| af_Q2FYR6_1_260_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8576 | 4 | 183 | 3.20.20.70 |
| af_Q58328_1_266_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8558 | 5 | 184 | 3.20.20.70 |
| 3tsmB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.843 | 15 | 186 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9G2N6-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9381 | 1 | 185 |
GO:0000162
GO:0004425 |
| AF-A0A538K1W5-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9204 | 4 | 192 |
GO:0000162
GO:0004425 |
| AF-A0A1F2WEF0-F1-model_v4 | Indole-3-glycerol-phosphate synthase | 0.9174 | 4 | 192 |
|
| AF-A0A538CLN9-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9149 | 1 | 192 |
GO:0000162
GO:0004425 |
| AF-A0A538CLN9-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9103 | 1 | 192 |
GO:0000162
GO:0004425 |